WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= SSH4F02.SEQ(1>541) (510 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 505,245 sequences; 158,518,215 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 4 Sequences : less than 4 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 830 210 |==================================================== 6310 620 182 |============================================= 3980 438 127 |=============================== 2510 311 90 |====================== 1580 221 75 |================== 1000 146 47 |=========== 631 99 39 |========= 398 60 13 |=== 251 47 8 |== 158 39 8 |== 100 31 4 |= 63.1 27 7 |= 39.8 20 1 |: 25.1 19 0 | 15.8 19 2 |: >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 17 <<<<<<<<<<<<<<<<< 10.0 17 0 | 6.31 17 1 |: 3.98 16 1 |: 2.51 15 0 | 1.58 15 0 | 1.00 15 0 | 0.63 15 0 | 0.40 15 0 | 0.25 15 0 | 0.16 15 0 | 0.10 15 0 | 0.063 15 0 | 0.040 15 0 | 0.025 15 0 | 0.016 15 0 | 0.010 15 1 |: 0.0063 14 0 | 0.0040 14 0 | 0.0025 14 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|7573430|emb|CAB87746.1|(AL163816) putative protein... +2 225 1.4e-17 1 gi|6729022|gb|AAF27018.1|AC009177_8(AC009177) unknown... +2 215 1.6e-16 1 gi|5487873|gb|AAD04946.2|(AF110333) PrMC3 [Pinus radi... +2 210 3.4e-16 1 gi|4190952|dbj|BAA74434.1|(AB022689) similar to hsr20... +2 202 4.4e-15 1 gi|6092014|dbj|BAA85654.1|(AB026296) hsr203J homolog ... +2 195 2.9e-14 1 gi|542058|pir||S42807HSR203J protein - common tobacco... +2 182 8.3e-13 1 gi|7417008|gb|AAF62404.1|AF212184_1(AF212184) cell de... +2 182 8.3e-13 1 gi|5734715|gb|AAD49980.1|AC008075_13(AC008075) Simila... +2 172 1.1e-11 1 gi|7485628|pir||T00874hypothetical protein F17K2.14 -... +2 167 3.5e-11 1 gi|6523100|emb|CAB62358.1|(AL133315) putative protein... +2 150 2.8e-09 1 gi|7485627|pir||T00873hypothetical protein F17K2.13 -... +2 134 1.7e-07 1 gi|5668813|gb|AAD46039.1|AC007519_24(AC007519) Simila... +2 129 5.4e-07 1 gi|7573456|emb|CAB87770.1|(AL163817) putative protein... +2 124 3.6e-06 1 gi|4335745|gb|AAD17422.1|(AC006284) putative esterase... +2 108 0.0023 1 gi|6523101|emb|CAB62359.1|(AL133315) putative protein... +2 104 0.0088 1 gi|1352393|sp|P18773|EST_ACICAESTERASE >gi|303953|gb|... +2 82 0.98 1 gi|1209223|gb|AAB17013.1|(L38252) esterase [Acinetoba... +2 81 0.995 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 2 Hits gi|7573430 |_____________________________________________ gi|6729022 |______________________________________ gi|5487873 |________________________________ gi|4190952 |_______________________________ gi|6092014 |_____________________________________ gi|542058 |_______________________________ gi|7417008 |_______________________________ gi|5734715 |__________________________ gi|7485628 |______________________________________ gi|6523100 |___________________________________________ gi|7485627 |______________________________________ gi|5668813 |_____________________________________________ gi|7573456 | _____________________________________________ gi|4335745 |______________________________________ gi|6523101 |___________________________________________ gi|1352393 |___________________ gi|1209223 |___________________ Prosite Hits: _______ __________________________________________________ Query sequence: | | | | | 170 0 50 100 150 __________________ Prosite hits: LEUCINE_ZIPPER Leucine zipper pattern. 64..85 __________________
Use the and icons to retrieve links to Entrez:
>gi|7573430|emb|CAB87746.1| (AL163816) putative protein [Arabidopsis thaliana] Length = 358 Frame 2 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | 358 0 150 300 Plus Strand HSPs: Score = 225 (79.2 bits), Expect = 1.4e-17, P = 1.4e-17 Identities = 61/150 (40%), Positives = 85/150 (56%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNL 184 ++GDS+GGNIAH++A R + V+V G +LL P FGG RT+SE F+ + Sbjct: 187 LAGDSSGGNIAHNVAVRA-----TNEGVKVLGNILLHPMFGGQERTQSEKTLDGKYFVTI 241 Query: 185 ELIDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPILVVAGGS*LA*R*GQKDYAK 364 + D +WR +P GE DHP NPFGP QSL+ ++F LVV G L + Q Y Sbjct: 242 QDRDWYWRAYLPEGEDRDHPACNPFGPRGQSLKGVNFPKSLVVVAGLDLV-QDWQLAYVD 300 Query: 365 RLKELGLIKI*NYVINLKGQQHGFLPLFIP 454 LK+ GL ++ N ++ LK GF F+P Sbjct: 301 GLKKTGL-EV-N-LLYLKQATIGFY--FLP 325 >gi|6729022|gb|AAF27018.1|AC009177_8 (AC009177) unknown protein [Arabidopsis thaliana] Length = 345 Frame 2 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | 345 0 150 300 Plus Strand HSPs: Score = 215 (75.7 bits), Expect = 1.6e-16, P = 1.6e-16 Identities = 52/126 (41%), Positives = 70/126 (55%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNL 184 ++GDS+GGNIAH++A R G + V G +LL P FGG RT+SE F+ + Sbjct: 187 LAGDSSGGNIAHNVALRAGESG-----IDVLGNILLNPMFGGNERTESEKSLDGKYFVTV 241 Query: 185 ELIDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPILVVAGGS*LA*R*GQKDYAK 364 D +W+ +P GE +HP NPF P +SLE + F LVV G L R Q YA+ Sbjct: 242 RDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLI-RDWQLAYAE 300 Query: 365 RLKELG 382 LK+ G Sbjct: 301 GLKKAG 306 >gi|5487873|gb|AAD04946.2| (AF110333) PrMC3 [Pinus radiata] Length = 319 Frame 2 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | | | | 319 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 210 (73.9 bits), Expect = 3.4e-16, P = 3.4e-16 Identities = 42/106 (39%), Positives = 61/106 (57%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNL 184 ++G+SAGGNIAH + +R +L P+++RG +++ P+FG R + E D L Sbjct: 156 LAGESAGGNIAHVVGSRTA--DQDLGPLKIRGLIVIHPYFGSEERIECEKVAAGDDAAAL 213 Query: 185 ELIDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPILVVAGG 322 EL D FWRL++P G D+P NP GP S L + P+LV G Sbjct: 214 ELNDLFWRLALPPGSDRDYPTCNPRGPRSADLRKVPLPPVLVTVAG 259 >gi|4190952|dbj|BAA74434.1| (AB022689) similar to hsr203J [Lycopersicon esculentum] Length = 335 Frame 2 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | 335 0 150 300 Plus Strand HSPs: Score = 202 (71.1 bits), Expect = 4.4e-15, P = 4.4e-15 Identities = 39/99 (39%), Positives = 62/99 (62%), Frame = +2 Query: 11 GDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNLEL 190 GDS+GGN+ H +AAR G +L P+++ G + + P F + R+KSE E + FL L++ Sbjct: 169 GDSSGGNVVHQVAARAG--EEDLSPMKLAGAIPIHPGFMRSQRSKSELEQEQTPFLTLDM 226 Query: 191 IDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPIL 307 +D+F L++PIG T DHP+ P G + ++E + P L Sbjct: 227 VDKFMELALPIGSTKDHPITCPMGDAAPAVEELKLPPYL 265 >gi|6092014|dbj|BAA85654.1| (AB026296) hsr203J homolog [Pisum sativum] Length = 339 Frame 2 hits (HSPs): __________________ __________________________________________________ Database sequence: | | | | 339 0 150 300 Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 2.9e-14, P = 2.9e-14 Identities = 44/122 (36%), Positives = 69/122 (56%), Frame = +2 Query: 11 GDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNLEL 190 GDS+GGN+ H ++AR S +L PVR+ G + + P + + R++SE E P+ FL L++ Sbjct: 173 GDSSGGNLVHEVSARAS--STDLRPVRLAGAIPIHPGYVRSERSRSENEMPQSPFLTLDM 230 Query: 191 IDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPILVVAGGS*LA*R*GQKDYAKRL 370 +D+F LS+PIG DHP+ P G + L P L+ L R Q +Y + + Sbjct: 231 LDKFLSLSLPIGSNKDHPITCPMGEAAPPLAGFKLPPFLLCVAEKDLL-RDPQMEYYEAM 289 Query: 371 KE 376 K+ Sbjct: 290 KK 291 >gi|542058|pir||S42807 HSR203J protein - common tobacco >gi|444002|emb|CAA54393.1| (X77136) HSR203J [Nicotiana tabacum] Length = 335 Frame 2 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | 335 0 150 300 Plus Strand HSPs: Score = 182 (64.1 bits), Expect = 8.3e-13, P = 8.3e-13 Identities = 36/99 (36%), Positives = 58/99 (58%), Frame = +2 Query: 11 GDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNLEL 190 GDS+GGNI H +A + G L P+R+ G + + P F + R+KSE E + FL L++ Sbjct: 169 GDSSGGNIVHQVAVKAG--EENLSPMRLAGAIPIHPGFVRSYRSKSELEQEQTPFLTLDM 226 Query: 191 IDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPIL 307 +D+F L++P+G DH + P G + ++E + P L Sbjct: 227 VDKFLGLALPVGSNKDHQITCPMGEAAPAVEELKLPPYL 265 >gi|7417008|gb|AAF62404.1|AF212184_1 (AF212184) cell death associated protein [Nicotiana tabacum] Length = 335 Frame 2 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | 335 0 150 300 Plus Strand HSPs: Score = 182 (64.1 bits), Expect = 8.3e-13, P = 8.3e-13 Identities = 36/99 (36%), Positives = 58/99 (58%), Frame = +2 Query: 11 GDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNLEL 190 GDS+GGNI H +A + G L P+R+ G + + P F + R+KSE E + FL L++ Sbjct: 169 GDSSGGNIVHQVAVKAG--EENLSPMRLAGAIPIHPGFVRSYRSKSELEQEQTPFLTLDM 226 Query: 191 IDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPIL 307 +D+F L++P+G DH + P G + ++E + P L Sbjct: 227 VDKFLGLALPVGSNKDHQITCPMGEAAPAVEELKLPPYL 265 >gi|5734715|gb|AAD49980.1|AC008075_13 (AC008075) Similar to gb|AF110333 PrMC3 protein from Pinus radiata and is a member of PF|00135 Carboxylesterases family. EST gb|N37841 comes from this gene. [Arabidopsis thaliana] Length = 336 Frame 2 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | 336 0 150 300 Plus Strand HSPs: Score = 172 (60.5 bits), Expect = 1.1e-11, P = 1.1e-11 Identities = 37/84 (44%), Positives = 51/84 (60%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAE--GPKDVFL 178 ++GDSAGGNIA +AARL SPE +++ G +L+ PF+ G RT+SE K L Sbjct: 172 LAGDSAGGNIAQQVAARLA--SPEDLALKIEGTILIQPFYSGEERTESERRVGNDKTAVL 229 Query: 179 NLELIDRFWRLSIPIGETTDHPLVNP 256 L D +WR+S+P G +HP P Sbjct: 230 TLASSDAWWRMSLPRGANREHPYCKP 255 >gi|7485628|pir||T00874 hypothetical protein F17K2.14 - Arabidopsis thaliana >gi|2979556|gb|AAC06165.1| (AC003680) unknown protein [Arabidopsis thaliana] Length = 324 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | | | | 324 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 167 (58.8 bits), Expect = 3.5e-11, P = 3.5e-11 Identities = 46/127 (36%), Positives = 61/127 (48%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNL 184 I G S G NIA LA R +L P+++ G V P FGG RTKSE + D + + Sbjct: 167 ICGSSNGANIAFQLALRSL--DHDLTPLQIDGCVFYQPLFGGKTRTKSELKNFADPVMPV 224 Query: 185 ELIDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPILVVA-GGS*LA*R*GQKDYA 361 +D W LS+P+G DH NP G Q +V LV+ GG R Q+D+ Sbjct: 225 PAVDAMWELSLPVGVDRDHRYCNPLGYLPQKEKVGRLGRCLVIGYGGDTSLDR--QQDFV 282 Query: 362 KRLKELGL 385 L G+ Sbjct: 283 NLLVAAGV 290 >gi|6523100|emb|CAB62358.1| (AL133315) putative protein [Arabidopsis thaliana] Length = 324 Frame 2 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | | | 324 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 150 (52.8 bits), Expect = 2.8e-09, P = 2.8e-09 Identities = 48/144 (33%), Positives = 73/144 (50%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFG--SPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFL 178 +SGDSAG NI HH+A R SP L+ + G +LL P+F +T + + KD L Sbjct: 158 LSGDSAGANIVHHMAMRAAKEKLSPGLNDTGISGIILLHPYFWS--KTPIDEKDTKDETL 215 Query: 179 NLELIDRFWRLSIPIGET-TDHPLVNPFGPYSQSLEVIDFDPILVVAGGS*LA*R*GQKD 355 ++ I+ FW ++ P + TD PL+N S L + +LV+ R G Sbjct: 216 RMK-IEAFWMMASPNSKDGTDDPLLNVVQSESVDLSGLGCGKVLVMVAEKDALVRQGW-G 273 Query: 356 YAKRLKELGLIKI*NYVINLKGQQHGF 436 YA +L++ G K V+ +G+ H F Sbjct: 274 YAAKLEKSGW-KGEVEVVESEGEDHVF 299 >gi|7485627|pir||T00873 hypothetical protein F17K2.13 - Arabidopsis thaliana >gi|2979555|gb|AAC06164.1| (AC003680) unknown protein [Arabidopsis thaliana] Length = 329 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | 329 0 150 300 Plus Strand HSPs: Score = 134 (47.2 bits), Expect = 1.7e-07, P = 1.7e-07 Identities = 41/127 (32%), Positives = 63/127 (49%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNL 184 + G S+GGNI +++A R+ +L PV+++G ++ FFGG + SE+ D L Sbjct: 157 VMGSSSGGNIVYNVALRVV--DTDLSPVKIQGLIMNQAFFGGVEPSDSESRLKDDKICPL 214 Query: 185 ELIDRFWRLSIPIGETTDHPLVNPF---GPYSQSLEVIDFDPILVVA-GGS*LA*R*GQK 352 W L +P G DH NP GP + ++ F L+ GG L R Q+ Sbjct: 215 PATHLLWSLCLPDGVDRDHVYSNPIKSSGPQEKD-KMGRFPSTLINGYGGDPLVDR--QR 271 Query: 353 DYAKRLKELGL 385 A+ LK G+ Sbjct: 272 HVAEMLKGRGV 282 >gi|5668813|gb|AAD46039.1|AC007519_24 (AC007519) Similar to gb|X77136 HSR203J protein from Nicotiana tabacum and is a member of the PF|00135 Carboxylesterase family. ESTs gb|Z25688 and gb|F14025 come from this gene. [Arabidopsis thaliana] Length = 314 Frame 2 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | | | | 314 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 129 (45.4 bits), Expect = 5.4e-07, P = 5.4e-07 Identities = 40/148 (27%), Positives = 69/148 (46%), Frame = +2 Query: 11 GDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNLEL 190 GDSAG NI+HHLA R L +++G ++ P+F GT +E KD ++ Sbjct: 156 GDSAGANISHHLAFRAKQSDQTL---KIKGIGMIHPYFWGTQPIGAEI---KDE-ARKQM 208 Query: 191 IDRFWRLSIPIGETTDHPLVNPFGPYSQSLEVIDFDPILVVAGGS*LA*R*GQKDYAKRL 370 +D +W P + +D P +NPF S L + + +++ + G+ Y + + Sbjct: 209 VDGWWEFVCPSEKGSDDPWINPFADGSPDLGGLGCERVMITVAEKDILNERGKMYYERLV 268 Query: 371 KELGLIKI*NYVINLKGQQHGFLPLFIP 454 K K+ ++ K + H F +F P Sbjct: 269 KSEWKGKV--EIMETKEKDHVF-HIFEP 293 >gi|7573456|emb|CAB87770.1| (AL163817) putative protein [Arabidopsis thaliana] Length = 439 Frame 2 hits (HSPs): __________________ __________________________________________________ Database sequence: | | | | 439 0 150 300 Plus Strand HSPs: Score = 124 (43.7 bits), Expect = 3.6e-06, P = 3.6e-06 Identities = 45/149 (30%), Positives = 74/149 (49%), Frame = +2 Query: 17 SAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNLELID 196 S GGNIA ++A + L+PV+V VL+ PFF G T+SE + F + + Sbjct: 267 SCGGNIADYVARKAVEAGKLLEPVKVVAQVLMYPFFIGNNPTQSEIKLANSYFYDKPVSV 326 Query: 197 RFWRLSIPIGETT-DHPLVNPFGPYSQSLEVIDFDP--ILVVAGGS*LA*R*GQKDYAKR 367 W+L +P E DHP NP +++S + P + VVA + R Y++ Sbjct: 327 LAWKLFLPEKEFDFDHPAANPLA-HNRSGPPLKLMPPTLTVVAEHDWMRDR--AIAYSEE 383 Query: 368 LKELGLIKI*NYVINLKGQQHGF--LPLFIPTPE 463 L++ + + + V+ K H F L + + TP+ Sbjct: 384 LRK---VNVDSPVLEYKDAVHEFATLDMLLKTPQ 414 >gi|4335745|gb|AAD17422.1| (AC006284) putative esterase [Arabidopsis thaliana] Length = 312 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | | | | 312 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 108 (38.0 bits), Expect = 0.0023, P = 0.0023 Identities = 39/126 (30%), Positives = 62/126 (49%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVFLNL 184 ++GDSAGGNI+HHL R +L + G +L+ P+F +T + +DV Sbjct: 155 LAGDSAGGNISHHLTMRAK--KEKLCDSLISGIILIHPYFWS--KTPIDEFEVRDVG-KT 209 Query: 185 ELIDRFWRLSIPIGET-TDHPLVNPFGPYSQSLEVIDFDPILVVAGGS*LA*R*GQKDYA 361 + ++ WR++ P + D P +N G L +LV+ G L R G YA Sbjct: 210 KGVEGSWRVASPNSKQGVDDPWLNVVGSDPSGLGC---GRVLVMVAGDDLFVRQGWC-YA 265 Query: 362 KRLKELG 382 ++LK+ G Sbjct: 266 EKLKKSG 272 >gi|6523101|emb|CAB62359.1| (AL133315) putative protein [Arabidopsis thaliana] Length = 329 Frame 2 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | 329 0 150 300 Plus Strand HSPs: Score = 104 (36.6 bits), Expect = 0.0088, P = 0.0088 Identities = 40/144 (27%), Positives = 67/144 (46%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFG--SPE-LDPVRVRGYVLLAPFFGGTIRTKSEAEGPKDVF 175 ++GDSAG NI HH+ + SPE L+ + G +L+ P+F +T + + DV Sbjct: 161 LAGDSAGANITHHMTMKAAKDKLSPESLNESGISGIILVHPYFWS--KTPVDDKETTDVA 218 Query: 176 LNLELIDRFWRLSIPIGET-TDHPLVNPFGPYSQSLEVIDFDPILVVAGGS*LA*R*GQK 352 + I+ W L+ P + +D P +N S L + +LV+ R G Sbjct: 219 IRT-WIESVWTLASPNSKDGSDDPFINVVQSESVDLSGLGCGKVLVMVAEKDALVRQGWG 277 Query: 353 DYAKRLKELGLIKI*NYVINLKGQQHGF 436 + K K ++ + V+ KG+ H F Sbjct: 278 YWEKLGKSRWNGEVLD-VVETKGEGHVF 304 >gi|1352393|sp|P18773|EST_ACICA ESTERASE >gi|303953|gb|AAA02895.1| (M24890) esterase [Acinetobacter calcoaceticus] Length = 303 Frame 2 hits (HSPs): ___________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | || 303 0 50 100 150 200 250 300 __________________ Annotated Domains: Entrez active site: POTENTIAL. 79 Entrez active site: POTENTIAL. 149 PRODOM PD033245: EST(1) Q44087(1) 1..58 PRODOM PD000169: ACES(11) EST1(8) LIP2(3) 60..191 PRODOM PD002749: LIPS(3) 199..295 PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 168..189 PROSITE LIPASE_GDXG_HIS: Lipolytic enzymes "G-D- 75..91 PROSITE LIPASE_GDXG_SER: Lipolytic enzymes "G-D- 143..155 __________________ Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 4.0, P = 0.98 Identities = 24/63 (38%), Positives = 36/63 (57%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPK-DVFLN 181 ISGDS G N+A L+ RL PEL P G +L++P+ T+ ++S K D L+ Sbjct: 145 ISGDSCGANLALALSLRLK-QQPELMP---SGLILMSPYLDLTLTSESLRFNQKHDALLS 200 Query: 182 LELI 193 +E + Sbjct: 201 IEAL 204 >gi|1209223|gb|AAB17013.1| (L38252) esterase [Acinetobacter lwoffii] Length = 303 Frame 2 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | || 303 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 5.3, P = 1.0 Identities = 24/63 (38%), Positives = 35/63 (55%), Frame = +2 Query: 5 ISGDSAGGNIAHHLAARLGFGSPELDPVRVRGYVLLAPFFGGTIRTKSEAEGPK-DVFLN 181 ISGDS G N+A L RL PEL P G +L++P+ T+ ++S K D L+ Sbjct: 145 ISGDSCGANLALALCLRLK-QQPELMP---SGLILMSPYLDLTLTSESLRFNQKHDALLS 200 Query: 182 LELI 193 +E + Sbjct: 201 IEAL 204 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.99 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.362 0.167 0.598 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.341 0.158 0.507 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.346 0.153 0.612 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.345 0.152 0.530 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.348 0.157 0.549 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.345 0.153 0.554 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 169 169 10. 74 3 12 22 0.11 34 31 0.11 37 +2 0 169 168 10. 74 3 12 22 0.11 34 31 0.11 37 +1 0 170 169 10. 74 3 12 22 0.11 34 31 0.11 37 -1 0 170 169 10. 74 3 12 22 0.11 34 31 0.11 37 -2 0 169 169 10. 74 3 12 22 0.11 34 31 0.11 37 -3 0 169 169 10. 74 3 12 22 0.11 34 31 0.11 37 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 8:50 PM CDT May 27, 2000 Format: BLAST # of letters in database: 158,518,215 # of sequences in database: 505,245 # of database sequences satisfying E: 17 No. of states in DFA: 596 (59 KB) Total size of DFA: 206 KB (256 KB) Time to generate neighborhood: 0.02u 0.00s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 4 Search cpu time: 236.13u 1.06s 237.19t Elapsed: 00:01:56 Total cpu time: 236.19u 1.10s 237.29t Elapsed: 00:01:56 Start: Wed Feb 14 18:58:46 2001 End: Wed Feb 14 19:00:42 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000