WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= SSH5C04.SEQ(1>240) (215 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 505,245 sequences; 158,518,215 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 10 Sequences : less than 10 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 2851 578 |========================================================= 6310 2273 485 |================================================ 3980 1788 397 |======================================= 2510 1391 350 |=================================== 1580 1041 254 |========================= 1000 787 185 |================== 631 602 161 |================ 398 441 122 |============ 251 319 78 |======= 158 241 69 |====== 100 172 53 |===== 63.1 119 35 |=== 39.8 84 20 |== 25.1 64 8 |: 15.8 56 11 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 45 <<<<<<<<<<<<<<<<< 10.0 45 10 |= 6.31 35 3 |: 3.98 32 5 |: 2.51 27 6 |: 1.58 21 7 |: 1.00 14 4 |: 0.63 10 0 | 0.40 10 3 |: 0.25 7 0 | 0.16 7 1 |: 0.10 6 2 |: 0.063 4 0 | 0.040 4 0 | 0.025 4 0 | 0.016 4 0 | 0.010 4 3 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|3776080|emb|CAA77093.1|(Y18249) MtN9 [Medicago tru... -3 112 9.6e-06 1 gi|131157|sp|P11601|PSAC_MAIZEPHOTOSYSTEM I IRON-SULF... +3 54 0.0078 2 gi|131164|sp|P10794|PSAC_WHEATPHOTOSYSTEM I IRON-SULF... +3 54 0.0098 2 gi|100633|pir||A32364photosystem I iron-sulfur protei... +3 54 0.0098 2 gi|4210390|emb|CAA10625.1|(AJ132264) PSI Fe-S polypep... +3 48 0.093 2 gi|7259570|gb|AAF43871.1|AF166114_83(AF166114) subuni... +3 48 0.093 2 gi|165142|gb|AAA31299.1|(M21266) Ig heavy region V-D-... -3 49 0.12 2 gi|165122|gb|AAA64250.1|(K01356) Ig gamma chain (VDJ-... -3 48 0.23 2 gi|1346822|sp|P31556|PSAC_EUGGRPHOTOSYSTEM I IRON-SUL... +3 47 0.29 2 gi|4261933|gb|AAD14233.1|S76746_1(S76746) Unknown [Or... -3 48 0.31 2 gi|7524769ref|NP_045771.1| photosystem I iron-sulfer ... +3 46 0.47 2 gi|5880795|gb|AAD54888.1|AF137379_111(AF137379) subun... +3 46 0.47 2 gi|4249376|gb|AAD14473.1|(AC005966) Strong similarity... -3 74 0.49 1 gi|4895247|gb|AAD32832.1|AC007659_14(AC007659) putati... -3 73 0.56 1 gi|79662|pir||JT0557photosystem I iron-sulfur protein... +3 45 0.76 2 gi|97733|pir||S16200photosystem I iron-sulfur protein... +3 45 0.76 2 gi|7299007|gb|AAF54209.1|(AE003678) ato gene product ... -1 70 0.78 1 gi|131155|sp|P23392|PSAC_ANASPPHOTOSYSTEM I IRON-SULF... +3 45 0.79 2 gi|131161|sp|P18083|PSAC_SYNENPHOTOSYSTEM I IRON-SULF... +3 45 0.79 2 gi|400861|sp|P23810|PSAC_FREDIPHOTOSYSTEM I IRON-SULF... +3 45 0.79 2 gi|3914443|sp|O07112|PSAC_MASLAPHOTOSYSTEM I IRON-SUL... +3 45 0.79 2 gi|2707667|gb|AAB94702.1|(AF029937) IgM heavy chain V... -3 48 0.82 2 gi|2496512|sp|Q50648|YP73_MYCTUHYPOTHETICAL 26.2 KDA ... +1 52 0.85 2 gi|361355|prf||1408204Aphotosystem I protein [Spinaci... +3 45 0.86 2 gi|2914473|pdb|1AYN|3Chain 3, Human Rhinovirus 16 Coa... +1 52 0.88 2 gi|7516401|pir||E72603hypothetical protein APE1292 - ... +1 62 0.90 1 gi|2707669|gb|AAB94703.1|(AF029938) IgM heavy chain V... -3 48 0.92 2 gi|400859|sp|P31173|PSAC_CYAPAPHOTOSYSTEM I IRON-SULF... +3 44 0.93 2 gi|2496541|sp|Q50609|YI24_MYCTUHYPOTHETICAL 12.8 KDA ... +1 60 0.96 1 gi|5880610|gb|AAD54767.1|AF120156_1(AF120156) endo-1,... -1 52 0.96 2 gi|131158|sp|P06251|PSAC_MARPOPHOTOSYSTEM I IRON-SULF... +3 44 0.96 2 gi|7520996|pir||A71058probable cytosine permease - Py... +2 54 0.97 2 gi|7482000|pir||T18357mhp1 protein - Mycoplasma hyopn... -3 55 0.98 2 gi|7478574|pir||D70610probable PE protein - Mycobacte... -3 58 0.99 1 gi|165174|gb|AAA31315.1|(M29421) Ig mu-chain V-D-J pr... -3 49 0.990 2 gi|7462968|pir||A72278transcription regulator, XylR-r... +1 65 0.999 1 gi|7482002|pir||T18353protein P97 - Mycoplasma hyopne... -3 53 0.999 2 gi|1352005|sp|P48987|ATO_DROMEATONAL PROTEIN >gi|4768... -1 64 0.999 1 gi|2194124|gb|AAB61099.1|(AC002062) Similar to Glycin... -3 65 0.999 1 gi|3128477|gb|AAC31167.1|(AF062640) metalloproteinase... -3 64 0.9995 1 gi|2707691|gb|AAB94714.1|(AF029949) IgM heavy chain V... -3 48 0.9998 2 gi|280480|pir||S22449FPR1 protein - Podospora anserin... -3 64 0.9998 1 gi|102173|pir||A3059233K cytoskeletal protein - Giard... -3 50 0.9999 2 gi|3914827|sp|O33431|RPOC_PORCNDNA-DIRECTED RNA POLYM... -3 52 0.99991 2 gi|2506519|sp|P35693|FPR1_PODANMAT+ SEXUAL CELL FERTI... -3 64 0.99992 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|131157 | ______________________ gi|131164 | ______________________ gi|100633 | ______________________ gi|4210390 | ______________________ gi|7259570 | ______________________ gi|1346822 | ______________________ gi|7524769 | ______________________ gi|5880795 | ______________________ gi|79662 | ______________________ gi|97733 | ______________________ gi|131155 | ______________________ gi|131161 | ______________________ gi|400861 | ______________________ gi|3914443 | ______________________ gi|361355 | ______________________ gi|400859 | ___________________ gi|131158 | ______________________ __________________________________________________ Query sequence: | | | | | 72 0 20 40 60 Locus_ID Frame 2 Hits gi|131157 | ______________ gi|131164 | ______________ gi|100633 | ______________ gi|4210390 | ______________ gi|7259570 | ______________ gi|1346822 | ______________ gi|7524769 | ______________ gi|5880795 | ______________ gi|79662 | ______________ gi|97733 | ______________ gi|131155 | ______________ gi|131161 | ______________ gi|400861 | ______________ gi|3914443 | ______________ gi|2496512 | _____________ gi|361355 | ______________ gi|2914473 | ____ gi|400859 | ______________ gi|131158 | ______________ gi|7520996 | ______________ ___________________________ __________________________________________________ Query sequence: | | | | | 72 0 20 40 60 Locus_ID Frame 1 Hits gi|2496512 | _________________________________ gi|2914473 | ________________ gi|7516401 | ____________________ gi|2496541 | _____________ gi|7462968 | ___________________________ __________________________________________________ Query sequence: | | | | | 72 0 20 40 60 Locus_ID Frame -1 Hits gi|165142 |__________ gi|165122 | ______ gi|4261933 |__________ gi|7299007 | ______________________ gi|2707667 | ______ gi|2707669 |__________ gi|5880610 | _____________ gi|165174 | ______ gi|1352005 | ______________________ gi|2707691 | _______ gi|102173 | __________________ __________________________________________________ Query sequence: | | | | | 72 0 20 40 60 Locus_ID Frame -2 Hits gi|3914827 | ___________ __________________________________________________ Query sequence: | | | | | 72 0 20 40 60 Locus_ID Frame -3 Hits gi|3776080 | _____________________________________ gi|165142 | ______________ gi|165122 | _____________ gi|4261933 | _____________ gi|4249376 | gi|4895247 | _____________________________________ gi|2707667 | _____________ gi|2707669 | _____________ gi|5880610 | _________ gi|7482000 |__________________________ ____________________ gi|7478574 | ________________________ gi|165174 | _____________ gi|7482002 |__________________________ ____________________ gi|2194124 | ________________________________________ gi|3128477 | _________________________________ gi|2707691 | _____________ gi|280480 |______________________________ gi|102173 | ___________________ gi|3914827 | ____________________ gi|2506519 |______________________________ __________________________________________________ Query sequence: | | | | | 72 0 20 40 60
Use the and icons to retrieve links to Entrez:
>gi|3776080|emb|CAA77093.1| (Y18249) MtN9 [Medicago truncatula] Length = 191 Frame -3 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | 191 0 50 100 150 Minus Strand HSPs: Score = 112 (39.4 bits), Expect = 9.6e-06, P = 9.6e-06 Identities = 22/54 (40%), Positives = 36/54 (66%), Frame = -3 Query: 213 PEXQIPDNMSRVFRDSFARWAQASGTLSLT-ATTYDNADIQVGLYHFTNSRIEV 55 PE +I + VFR++F RW+Q + L + AT+YD+ADI++G Y+ + + EV Sbjct: 16 PESKISIDKVNVFRNAFTRWSQTTRVLKFSEATSYDDADIKIGFYNISYNSKEV 69 >gi|131157|sp|P11601|PSAC_MAIZE PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KDA POLYPEPTIDE) (PSI-C) >gi|65729|pir||FEZM1C photosystem I iron-sulfur protein psaC - maize chloroplast >gi|12423|emb|CAA31557.1| (X13159) 8.7 kDa FeS protein [Zea mays] >gi|7019728|emb|CAB75860.1| (X86563) psaC; PSI 9kDa protein [Zea mays] >gi|226549|prf||1601520B psaC gene [Zea mays] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00198: 4Fe-4S ferredoxins, iron-sulfur 10..21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 54 (19.0 bits), Expect = 0.0078, Sum P(2) = 0.0078 Identities = 13/32 (40%), Positives = 17/32 (53%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LGP + R++ Y Sbjct: 50 GCKRCESACPTDFLSVRVYLGPETTRSMALSY 81 Score = 40 (14.1 bits), Expect = 0.0078, Sum P(2) = 0.0078 Identities = 8/19 (42%), Positives = 13/19 (68%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC + +R P T +LE++ W Sbjct: 13 GCTHCVRACP-TDVLEMIPW 31 >gi|131164|sp|P10794|PSAC_WHEAT PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|65727|pir||FERZA photosystem I iron-sulfur protein psaC - rice chloroplast >gi|65728|pir||FEWT1 photosystem I iron-sulfur protein psaC - wheat chloroplast >gi|12051|emb|CAA33954.1| (X15901) PSI 9kDa protein [Oryza sativa] >gi|12350|emb|CAA31555.1| (X13158) photosystem I 8 kDa subunit [Triticum aestivum] >gi|167038|gb|AAA32953.1| (L06607) photosystem I subunit C [Hordeum vulgare] >gi|4150873|emb|CAA09816.1| (AJ011848) PSI 9 kDa protein [Hordeum vulgare] >gi|226558|prf||1601522B photosystem I 8kD protein [Triticum aestivum] >gi|226671|prf||1603356CY photosystem I 9kD protein [Oryza sativa] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00198: 4Fe-4S ferredoxins, iron-sulfur 10..21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRINTS 4FE4SFRDOXIN1: 4Fe4S ferredoxin motif I 3..14 PRINTS 4FE4SFRDOXIN2: 4Fe4S ferredoxin motif II 15..26 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 54 (19.0 bits), Expect = 0.0099, Sum P(2) = 0.0098 Identities = 13/32 (40%), Positives = 17/32 (53%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LGP + R++ Y Sbjct: 50 GCKRCESACPTDFLSVRVYLGPETTRSMALSY 81 Score = 39 (13.7 bits), Expect = 0.0099, Sum P(2) = 0.0098 Identities = 8/19 (42%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE++ W Sbjct: 13 GCTQCVRACP-TDVLEMIPW 31 >gi|100633|pir||A32364 photosystem I iron-sulfur protein - barley chloroplast Length = 80 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): _____________ Annotated Domains: ________________________________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 __________________ Annotated Domains: Entrez domain: ferredoxin 2[4Fe-4S] homology #l 3..65 Entrez binding site: 4Fe-4S cluster (Cys) (cova 10 Entrez binding site: 4Fe-4S cluster (Cys) (cova 13 Entrez binding site: 4Fe-4S cluster (Cys) (cova 16 Entrez binding site: 4Fe-4S cluster (Cys) (cova 57 Entrez binding site: 4Fe-4S cluster (Cys) (cova 20 Entrez binding site: 4Fe-4S cluster (Cys) (cova 47 Entrez binding site: 4Fe-4S cluster (Cys) (cova 50 Entrez binding site: 4Fe-4S cluster (Cys) (cova 53 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 10..21 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 47..58 __________________ Plus Strand HSPs: Score = 54 (19.0 bits), Expect = 0.0099, Sum P(2) = 0.0098 Identities = 13/32 (40%), Positives = 17/32 (53%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LGP + R++ Y Sbjct: 49 GCKRCESACPTDFLSVRVYLGPETTRSMALSY 80 Score = 39 (13.7 bits), Expect = 0.0099, Sum P(2) = 0.0098 Identities = 8/19 (42%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE++ W Sbjct: 12 GCTQCVRACP-TDVLEMIPW 30 >gi|4210390|emb|CAA10625.1| (AJ132264) PSI Fe-S polypeptide SU VII [Skeletonema costatum] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 48 (16.9 bits), Expect = 0.097, Sum P(2) = 0.093 Identities = 13/32 (40%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R+L Y Sbjct: 50 GCKRCETACPTDFLSVRVYLGAETTRSLGLAY 81 Score = 40 (14.1 bits), Expect = 0.097, Sum P(2) = 0.093 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|7259570|gb|AAF43871.1|AF166114_83 (AF166114) subunit VII of photosystem I (Fe-Spolypeptide) [Mesostigma viride] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 48 (16.9 bits), Expect = 0.097, Sum P(2) = 0.093 Identities = 13/32 (40%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG S R++ Y Sbjct: 50 GCKRCESACPTDFLSVRVYLGNESTRSMGLAY 81 Score = 40 (14.1 bits), Expect = 0.097, Sum P(2) = 0.093 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|165142|gb|AAA31299.1| (M21266) Ig heavy region V-D-region [Oryctolagus cuniculus] Length = 72 Frame -1 hits (HSPs): _________ Frame -3 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 Minus Strand HSPs: Score = 49 (17.2 bits), Expect = 0.13, Sum P(2) = 0.12 Identities = 9/20 (45%), Positives = 14/20 (70%), Frame = -3 Query: 168 SFARWAQASGTLSLTATTYD 109 ++A WA+ T+S T+TT D Sbjct: 24 AYASWAKGRFTISKTSTTVD 43 Score = 33 (11.6 bits), Expect = 0.13, Sum P(2) = 0.12 Identities = 7/13 (53%), Positives = 7/13 (53%), Frame = -1 Query: 44 ALYFCNRILVRKG 6 A YFC RI G Sbjct: 55 ATYFCARIETGSG 67 >gi|165122|gb|AAA64250.1| (K01356) Ig gamma chain (VDJ-region) [Oryctolagus cuniculus] Length = 59 Frame -1 hits (HSPs): _______ Frame -3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | 59 0 20 40 Minus Strand HSPs: Score = 48 (16.9 bits), Expect = 0.26, Sum P(2) = 0.23 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -3 Query: 165 FARWAQASGTLSLTATTYD 109 +A WA+ T+S T+TT D Sbjct: 2 YASWAKGRFTISKTSTTVD 20 Score = 31 (10.9 bits), Expect = 0.26, Sum P(2) = 0.23 Identities = 5/8 (62%), Positives = 6/8 (75%), Frame = -1 Query: 44 ALYFCNRI 21 A YFC R+ Sbjct: 32 ATYFCARV 39 >gi|1346822|sp|P31556|PSAC_EUGGR PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|415777|emb|CAA50121.1| (X70810) PSI Fe-S polypeptide [Euglena gracilis] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00198: 4Fe-4S ferredoxins, iron-sulfur 10..21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRINTS 4FE4SFRDOXIN1: 4Fe4S ferredoxin motif I 3..14 PRINTS 4FE4SFRDOXIN2: 4Fe4S ferredoxin motif II 15..26 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 47 (16.5 bits), Expect = 0.34, Sum P(2) = 0.29 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCESACPTDFLSVRVYLGSETSRSMGLAY 81 Score = 40 (14.1 bits), Expect = 0.34, Sum P(2) = 0.29 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|4261933|gb|AAD14233.1|S76746_1 (S76746) Unknown [Oryctolagus cuniculus] Length = 115 Frame -1 hits (HSPs): _______ Frame -3 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 115 0 50 100 Minus Strand HSPs: Score = 48 (16.9 bits), Expect = 0.37, Sum P(2) = 0.31 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -3 Query: 165 FARWAQASGTLSLTATTYD 109 +A WA+ T+S T+TT D Sbjct: 58 YASWAKGRFTISKTSTTVD 76 Score = 44 (15.5 bits), Expect = 0.37, Sum P(2) = 0.31 Identities = 8/14 (57%), Positives = 9/14 (64%), Frame = -1 Query: 44 ALYFCNRILVRKGW 3 A YFC R+LV W Sbjct: 88 ATYFCARVLVVVDW 101 >gi|7524769 ref|NP_045771.1| photosystem I iron-sulfer center >gi|3024451|sp|P56301|PSAC_CHLVU PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|7430801|pir||T07199 photosystem I iron-sulfur protein psaC - Chlorella vulgaris chloroplast >gi|2224362|dbj|BAA57846.1| (AB001684) photosystem I iron-sulfer center [Chlorella vulgaris] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 46 (16.2 bits), Expect = 0.63, Sum P(2) = 0.47 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCESACPTDFLSVRVYLGSETTRSMGLAY 81 Score = 40 (14.1 bits), Expect = 0.63, Sum P(2) = 0.47 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|5880795|gb|AAD54888.1|AF137379_111 (AF137379) subunit VII of photosystem I (Fe-Spolypeptide) [Nephroselmis olivacea] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 46 (16.2 bits), Expect = 0.63, Sum P(2) = 0.47 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCESACPTDFLSVRVYLGAETTRSMGLAY 81 Score = 40 (14.1 bits), Expect = 0.63, Sum P(2) = 0.47 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|4249376|gb|AAD14473.1| (AC005966) Strong similarity to gi|2829864 F3I6.6 zinc metalloproteinase homolog from Arabidopsis thaliana BAC gb|AC002396. EST gb|Z26412 comes from this gene Length = 360 Frame -3 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 360 0 150 300 Minus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.68, P = 0.49 Identities = 20/66 (30%), Positives = 35/66 (53%), Frame = -3 Query: 213 PEXQIPDNMSRVFRDSFARWAQASGTLSLTAT-TYDNADIQVGLYHFTNSRIEVYGGSLI 37 P+ + D + RVF +F RWA+ + L+ T + + ADI +G + + E + G++ Sbjct: 165 PQNNLTDEVKRVFSRAFTRWAEVT-PLNFTRSESILRADIVIGFFSGEHGDGEPFDGAMG 223 Query: 36 FLQPDSS 16 L SS Sbjct: 224 TLAHASS 230 >gi|4895247|gb|AAD32832.1|AC007659_14 (AC007659) putative metalloproteinase [Arabidopsis thaliana] Length = 342 Frame -3 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 342 0 150 300 Minus Strand HSPs: Score = 73 (25.7 bits), Expect = 0.81, P = 0.56 Identities = 16/53 (30%), Positives = 27/53 (50%), Frame = -3 Query: 198 PDNMSRVFRDSFARWAQASGTLSLTATTYDNADIQVGLYHFTNSRIEVYGGSL 40 P ++ RVFR +F +WA + Y ADI++G ++ + E + G L Sbjct: 157 PTDIRRVFRRAFGKWASVIPVSFIETEDYVIADIKIGFFNGDHGDGEPFDGVL 209 >gi|79662|pir||JT0557 photosystem I iron-sulfur protein - Synechococcus sp Length = 80 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): _____________ Annotated Domains: ________________________________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 __________________ Annotated Domains: Entrez domain: ferredoxin 2[4Fe-4S] homology #l 3..65 Entrez binding site: 4Fe-4S cluster (Cys) (cova 10 Entrez binding site: 4Fe-4S cluster (Cys) (cova 13 Entrez binding site: 4Fe-4S cluster (Cys) (cova 16 Entrez binding site: 4Fe-4S cluster (Cys) (cova 57 Entrez binding site: 4Fe-4S cluster (Cys) (cova 20 Entrez binding site: 4Fe-4S cluster (Cys) (cova 47 Entrez binding site: 4Fe-4S cluster (Cys) (cova 50 Entrez binding site: 4Fe-4S cluster (Cys) (cova 53 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 10..21 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 47..58 __________________ Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.4, Sum P(2) = 0.76 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 49 GCKRCETACPTDFLSIRVYLGAETTRSMGLAY 80 Score = 40 (14.1 bits), Expect = 1.4, Sum P(2) = 0.76 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 12 GCTQCVRACP-TDVLEMVPW 30 >gi|97733|pir||S16200 photosystem I iron-sulfur protein psaC - Calothrix sp. (PCC 7601) >gi|238432|gb|AAB20251.1| photosystem I (PS I) protein C=psaC protein [Fremyella diplosiphon, Calothrix sp PCC 7601, Peptide, 80 aa] Length = 80 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): _____________ Annotated Domains: ________ ________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 __________________ Annotated Domains: PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 10..21 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 47..58 __________________ Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.4, Sum P(2) = 0.76 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 49 GCKRCETACPTDFLSIRVYLGAETTRSMGLAY 80 Score = 40 (14.1 bits), Expect = 1.4, Sum P(2) = 0.76 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 12 GCTQCVRACP-TDVLEMVPW 30 >gi|7299007|gb|AAF54209.1| (AE003678) ato gene product [Drosophila melanogaster] Length = 312 Frame -1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | | | 312 0 50 100 150 200 250 300 Minus Strand HSPs: Score = 70 (24.6 bits), Expect = 1.5, P = 0.78 Identities = 15/31 (48%), Positives = 18/31 (58%), Frame = -1 Query: 185 VG-CSEIPLRGGPKPRGL*VSRRQPTTTPTS 96 VG C IP GPKP+ + QP+TT TS Sbjct: 138 VGTCKTIPASAGPKPKRSYTKKNQPSTTATS 168 >gi|131155|sp|P23392|PSAC_ANASP PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|65731|pir||FEAI1C photosystem I iron-sulfur protein psaC - Anabaena sp. (strain PCC 7120) >gi|65732|pir||FEAICV photosystem I iron-sulfur protein psaC - Anabaena variabilis >gi|39045|emb|CAA40443.1| (X57153) PSI-C protein [Anabaena sp.] >gi|39047|emb|CAA43645.1| (X61369) FA/FB apoprotein of Photosystem I [Anabaena PCC7120] >gi|444328|prf||1906377A photosystem I FA/FB protein [Anabaena variabilis] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00198: 4Fe-4S ferredoxins, iron-sulfur 10..21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRINTS 4FE4SFRDOXIN1: 4Fe4S ferredoxin motif I 3..14 PRINTS 4FE4SFRDOXIN2: 4Fe4S ferredoxin motif II 15..26 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCETACPTDFLSIRVYLGAETTRSMGLAY 81 Score = 40 (14.1 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|131161|sp|P18083|PSAC_SYNEN PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|79664|pir||JU0282 photosystem I iron-sulfur protein psaC - Synechococcus sp >gi|47574|emb|CAA45303.1| (X63767) photosystem I subunit VII [Synechococcus sp.] >gi|217132|dbj|BAA00468.1| (D00590) PsaC [Synechococcus vulcanus] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00198: 4Fe-4S ferredoxins, iron-sulfur 10..21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRINTS 4FE4SFRDOXIN1: 4Fe4S ferredoxin motif I 3..14 PRINTS 4FE4SFRDOXIN2: 4Fe4S ferredoxin motif II 15..26 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCETACPTDFLSIRVYLGAETTRSMGLAY 81 Score = 40 (14.1 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|400861|sp|P23810|PSAC_FREDI PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|3169798|gb|AAC17972.1| (AF028734) photosystem I subunit VII; PsaC [Nostoc PCC9229] >gi|5020113|gb|AAD38029.1|AF148517_2 (AF148517) photosystem I subunit PsaC [Nostoc PCC8009] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCETACPTDFLSIRVYLGAETTRSMGLAY 81 Score = 40 (14.1 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|3914443|sp|O07112|PSAC_MASLA PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|2160758|gb|AAC64638.1| (U97517) photosystem I protein PsaC [Mastigocladus laminosus] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRINTS 4FE4SFRDOXIN1: 4Fe4S ferredoxin motif I 3..14 PRINTS 4FE4SFRDOXIN2: 4Fe4S ferredoxin motif II 15..26 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCETACPTDFLSIRVYLGAETTRSMGLAY 81 Score = 40 (14.1 bits), Expect = 1.6, Sum P(2) = 0.79 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|2707667|gb|AAB94702.1| (AF029937) IgM heavy chain VDJ region [Oryctolagus cuniculus] Length = 99 Frame -1 hits (HSPs): _____ Frame -3 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | | 99 0 20 40 60 80 Minus Strand HSPs: Score = 48 (16.9 bits), Expect = 1.7, Sum P(2) = 0.82 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -3 Query: 165 FARWAQASGTLSLTATTYD 109 +A WA+ T+S T+TT D Sbjct: 62 YATWAKGRFTISKTSTTVD 80 Score = 34 (12.0 bits), Expect = 1.7, Sum P(2) = 0.82 Identities = 6/8 (75%), Positives = 6/8 (75%), Frame = -1 Query: 44 ALYFCNRI 21 A YFC RI Sbjct: 92 ATYFCTRI 99 >gi|2496512|sp|Q50648|YP73_MYCTU HYPOTHETICAL 26.2 KDA PROTEIN RV2573 >gi|7477262|pir||D70724 hypothetical protein Rv2573 - Mycobacterium tuberculosis (strain H37RV) >gi|1478239|emb|CAB01270.1| (Z77724) hypothetical protein Rv2573 [Mycobacterium tuberculosis] Length = 246 Frame 2 hits (HSPs): ____ Frame 1 hits (HSPs): ___________ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 246 0 50 100 150 200 __________________ Annotated Domains: PRODOM PD007657: APBA(6) 14..243 __________________ Plus Strand HSPs: Score = 52 (18.3 bits), Expect = 1.9, Sum P(2) = 0.85 Identities = 17/50 (34%), Positives = 25/50 (50%), Frame = +1 Query: 7 PFLTRIRLQKYKAATIHFNPRVSEVVQPYLD----VGVVVGCRRETQSPRG 147 P+LTR+ ++ A + E VQP+ V +V C ETQ P+G Sbjct: 34 PWLTRLCDERTVVAVLQNGVEQVEQVQPHCPSSAVVPAIVWCSAETQ-PQG 83 Score = 32 (11.3 bits), Expect = 1.9, Sum P(2) = 0.85 Identities = 7/18 (38%), Positives = 10/18 (55%), Frame = +2 Query: 146 AWAHLAKESLNTLLMLSG 199 AW L +L ++LSG Sbjct: 125 AWRKLLVNALAGFMVLSG 142 >gi|361355|prf||1408204A photosystem I protein [Spinacia oleracea] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 2.0, Sum P(2) = 0.86 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCESRCPTDFLSVRVYLGNETSRSMGLSY 81 Score = 39 (13.7 bits), Expect = 2.0, Sum P(2) = 0.86 Identities = 8/19 (42%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE++ W Sbjct: 13 GCTQCVRACP-TDVLEMIPW 31 >gi|2914473|pdb|1AYN|3 Chain 3, Human Rhinovirus 16 Coat Protein >gi|2914540|pdb|1AYM|3 Chain 3, Human Rhinovirus 16 Coat Protein At High Resolution >gi|5822294|pdb|1QJU|3 Chain 3, Human Rhinovirus 16 Coat Protein In Complex With Antiviral Compound Vp61209 >gi|5822298|pdb|1QJX|3 Chain 3, Human Rhinovirus 16 Coat Protein In Complex With Antiviral Compound Win68934 >gi|5822302|pdb|1QJY|3 Chain 3, Human Rhinovirus 16 Coat Protein In Complex With Antiviral Compound Vp65099 >gi|6980417|pdb|1D3E|3 Chain 3, Cryo-Em Structure Of Human Rhinovirus 16 (Hrv16) Complexed With A Two-Domain Fragment Of Its Cellular Receptor, Intercellular Adhesion Molecule-1 (D1d2-Icam-1). Implications For Virus-Receptor Interactions. Alpha Carbons Only Length = 238 Frame 2 hits (HSPs): __ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 238 0 50 100 150 200 Plus Strand HSPs: Score = 52 (18.3 bits), Expect = 2.2, Sum P(2) = 0.88 Identities = 11/24 (45%), Positives = 16/24 (66%), Frame = +1 Query: 136 SPRGLGPPR-KGISEHPTHVVWDL 204 +P G+G PR + + THVVWD+ Sbjct: 134 TPPGIGKPRSRKEAMLGTHVVWDV 157 Score = 31 (10.9 bits), Expect = 2.2, Sum P(2) = 0.88 Identities = 4/5 (80%), Positives = 5/5 (100%), Frame = +2 Query: 80 WYNPT 94 WY+PT Sbjct: 27 WYHPT 31 >gi|7516401|pir||E72603 hypothetical protein APE1292 - Aeropyrum pernix (strain K1) >gi|5104969|dbj|BAA80283.1| (AP000061) 132aa long hypothetical protein [Aeropyrum pernix] Length = 132 Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 132 0 50 100 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 2.3, P = 0.90 Identities = 12/28 (42%), Positives = 16/28 (57%), Frame = +1 Query: 112 VGCRRETQSPRGLGPPRKGISEHPTHVV 195 V C +E Q P G GPP + E P H++ Sbjct: 32 VYCHQEVQLPLGGGPPYNLLDEAPVHLL 59 >gi|2707669|gb|AAB94703.1| (AF029938) IgM heavy chain VDJ region [Oryctolagus cuniculus] Length = 117 Frame -1 hits (HSPs): _______ Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 117 0 50 100 Minus Strand HSPs: Score = 48 (16.9 bits), Expect = 2.5, Sum P(2) = 0.92 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -3 Query: 165 FARWAQASGTLSLTATTYD 109 +A WA+ T+S T+TT D Sbjct: 62 YASWAKGRFTISKTSTTVD 80 Score = 36 (12.7 bits), Expect = 2.5, Sum P(2) = 0.92 Identities = 7/14 (50%), Positives = 8/14 (57%), Frame = -1 Query: 44 ALYFCNRILVRKGW 3 A YFC R+ GW Sbjct: 92 ATYFCARVS-SSGW 104 >gi|400859|sp|P31173|PSAC_CYAPA PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|81139|pir||JS0697 photosystem I iron-sulfur protein psaC precursor - Cyanophora paradoxa cyanelle >gi|336635|gb|AAA65469.1| (M86239) FA/FB protein [Cyanophora paradoxa] >gi|1016214|gb|AAA81301.1| (U30821) PsaC subunit of the photosystem I reaction center complex [Cyanophora paradoxa] Length = 81 Frame 3 hits (HSPs): _________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00198: 4Fe-4S ferredoxins, iron-sulfur 10..21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRINTS 4FE4SFRDOXIN1: 4Fe4S ferredoxin motif I 3..14 PRINTS 4FE4SFRDOXIN2: 4Fe4S ferredoxin motif II 15..26 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 44 (15.5 bits), Expect = 2.6, Sum P(2) = 0.93 Identities = 11/28 (39%), Positives = 15/28 (53%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL 173 GC+RC P D S R LG + R++ Sbjct: 50 GCKRCESACPTDFLSIRVYLGAETTRSM 77 Score = 40 (14.1 bits), Expect = 2.6, Sum P(2) = 0.93 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE+V W Sbjct: 13 GCTQCVRACP-TDVLEMVPW 31 >gi|2496541|sp|Q50609|YI24_MYCTU HYPOTHETICAL 12.8 KDA PROTEIN RV1824 >gi|7476920|pir||A70721 hypothetical protein Rv1824 - Mycobacterium tuberculosis (strain H37RV) >gi|1483547|emb|CAB01477.1| (Z78020) hypothetical protein Rv1824 [Mycobacterium tuberculosis] Length = 121 Frame 1 hits (HSPs): ________ Annotated Domains: ____________________________________________ __________________________________________________ Database sequence: | | | | 121 0 50 100 __________________ Annotated Domains: Entrez Transmembrane region: POTENTIAL. 12..32 Entrez Transmembrane region: POTENTIAL. 35..55 Entrez Transmembrane region: POTENTIAL. 67..87 PRODOM PD031502: SBP(1) YI24(1) 15..117 __________________ Plus Strand HSPs: Score = 60 (21.1 bits), Expect = 3.1, P = 0.96 Identities = 11/18 (61%), Positives = 14/18 (77%), Frame = +1 Query: 58 FNPRVSEVVQPYLDVGVV 111 F+P V EV+QPYL + VV Sbjct: 28 FHPGVPEVIQPYLPIAVV 45 >gi|5880610|gb|AAD54767.1|AF120156_1 (AF120156) endo-1,4-beta-xylanase [Cellulomonas pachnodae] Length = 335 Frame -1 hits (HSPs): ____ Frame -3 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 335 0 150 300 Minus Strand HSPs: Score = 52 (18.3 bits), Expect = 3.2, Sum P(2) = 0.96 Identities = 9/17 (52%), Positives = 12/17 (70%), Frame = -1 Query: 113 TTTPTSR*GCTTSLTRG 63 TTTP + GCT +T+G Sbjct: 242 TTTPPTNNGCTVQVTKG 258 Score = 33 (11.6 bits), Expect = 3.2, Sum P(2) = 0.96 Identities = 5/13 (38%), Positives = 9/13 (69%), Frame = -3 Query: 165 FARWAQASGTLSL 127 ++ W A GT+S+ Sbjct: 58 YSFWTDAPGTVSM 70 >gi|131158|sp|P06251|PSAC_MARPO PHOTOSYSTEM I IRON-SULFUR CENTER (PHOTOSYSTEM I SUBUNIT VII) (9 KD POLYPEPTIDE) (PSI-C) >gi|65726|pir||FELVA photosystem I iron-sulfur protein psaC - liverwort (Marchantia polymorpha) chloroplast >gi|11724|emb|CAA28135.1| (X04465) frxA [Marchantia polymorpha] Length = 81 Frame 3 hits (HSPs): ____________________ Frame 2 hits (HSPs): ____________ Annotated Domains: _______________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00198: 4Fe-4S ferredoxins, iron-sulfur 10..21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 11 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 14 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 17 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 21 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 48 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 51 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 54 Entrez metal-binding site: IRON-SULFUR (4FE-4S) 58 PFAM fer4: 4Fe-4S ferredoxins and related iro 3..65 PRINTS 4FE4SFRDOXIN1: 4Fe4S ferredoxin motif I 3..14 PRINTS 4FE4SFRDOXIN2: 4Fe4S ferredoxin motif II 15..26 PRODOM PD000058: FER(33) PSAC(22) NUIM(9) 4..59 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 11..22 PROSITE 4FE4S_FERREDOXIN: 4Fe-4S ferredoxins, ir 48..59 __________________ Plus Strand HSPs: Score = 44 (15.5 bits), Expect = 3.3, Sum P(2) = 0.96 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = +3 Query: 96 GCRRCRRLSP*DSKSPR--LGPTSQRNL*TPY 185 GC+RC P D S R LG + R++ Y Sbjct: 50 GCKRCESRCPTDFLSVRVYLGNETTRSMGLSY 81 Score = 39 (13.7 bits), Expect = 3.3, Sum P(2) = 0.96 Identities = 8/19 (42%), Positives = 12/19 (63%), Frame = +2 Query: 26 GCKN-IRLPPYTSILELVKW 82 GC +R P T +LE++ W Sbjct: 13 GCTQCVRACP-TDVLEMIPW 31 >gi|7520996|pir||A71058 probable cytosine permease - Pyrococcus horikoshii >gi|3257576|dbj|BAA30259.1| (AP000005) 422aa long hypothetical cytosine permease [Pyrococcus horikoshii] Length = 422 Frame 2 hits (HSPs): ___ _____ __________________________________________________ Database sequence: | | | | 422 0 150 300 Plus Strand HSPs: Score = 54 (19.0 bits), Expect = 3.4, Sum P(2) = 0.97 Identities = 16/37 (43%), Positives = 20/37 (54%), Frame = +2 Query: 95 WMSALS*VVAVRLKV-PEAWAHLAKESLNTLLMLSGIW 205 W+ L +V V V PE W L K S+ L +LSG W Sbjct: 125 WVIVLGVLVTVWTLVGPERWGWLEKLSVILLAILSG-W 161 Score = 33 (11.6 bits), Expect = 3.4, Sum P(2) = 0.97 Identities = 7/19 (36%), Positives = 10/19 (52%), Frame = +2 Query: 26 GCKNIRLPPYTSILELVKW 82 G K LP + L+L+ W Sbjct: 84 GGKGSILPSLLNYLQLIGW 102 >gi|7482000|pir||T18357 mhp1 protein - Mycoplasma hyopneumoniae >gi|1403589|gb|AAB03497.1| (U27294) Mhp1 [Mycoplasma hyopneumoniae] Length = 1099 Frame -3 hits (HSPs): __ __ __________________________________________________ Database sequence: | | | | | | | | | 1099 0 150 300 450 600 750 900 1050 Minus Strand HSPs: Score = 55 (19.4 bits), Expect = 4.2, Sum P(2) = 0.98 Identities = 9/29 (31%), Positives = 20/29 (68%), Frame = -3 Query: 213 PEXQIPDNMSRVFRDSFARWAQASGTLSL 127 PE ++P+N+ +F+ SFA+ + + +S+ Sbjct: 248 PENKLPNNLGNIFKFSFAKDSSTNQYVSI 276 Score = 40 (14.1 bits), Expect = 4.2, Sum P(2) = 0.98 Identities = 11/37 (29%), Positives = 19/37 (51%), Frame = -3 Query: 111 DNADIQVGLYHFTNSRIEVYGGSLIFLQPDSSKKGVV 1 + ADIQ H +I G + + QP ++K+ V+ Sbjct: 554 EKADIQRFTRHLEQVKI---GSNSVLNQPQTTKEQVI 587 >gi|7478574|pir||D70610 probable PE protein - Mycobacterium tuberculosis (strain H37RV) >gi|1929088|emb|CAB07816.1| (Z93777) PE [Mycobacterium tuberculosis] Length = 110 Frame -3 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | | | 110 0 20 40 60 80 100 Minus Strand HSPs: Score = 58 (20.4 bits), Expect = 4.3, P = 0.99 Identities = 15/34 (44%), Positives = 18/34 (52%), Frame = -3 Query: 195 DNMSRVFRDSFARWAQASGTLSLTATTYDNADIQ 94 D +S V FAR AQA LSL AT + +Q Sbjct: 36 DEVSAVVASLFARHAQAYQALSLQATAFHQQFVQ 69 >gi|165174|gb|AAA31315.1| (M29421) Ig mu-chain V-D-J precursor [Oryctolagus cuniculus] Length = 125 Frame -1 hits (HSPs): ___ Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 125 0 50 100 Minus Strand HSPs: Score = 49 (17.2 bits), Expect = 4.6, Sum P(2) = 0.99 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -3 Query: 165 FARWAQASGTLSLTATTYD 109 +A WA+ T+S T+TT D Sbjct: 65 YANWAKGRFTISRTSTTVD 83 Score = 31 (10.9 bits), Expect = 4.6, Sum P(2) = 0.99 Identities = 5/8 (62%), Positives = 6/8 (75%), Frame = -1 Query: 44 ALYFCNRI 21 A YFC R+ Sbjct: 96 ATYFCARV 103 >gi|7462968|pir||A72278 transcription regulator, XylR-related - Thermotoga maritima (strain MSB8) >gi|4981778|gb|AAD36299.1|AE001779_1 (AE001779) transcriptional regulator, XylR-related [Thermotoga maritima] Length = 368 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | 368 0 150 300 Plus Strand HSPs: Score = 65 (22.9 bits), Expect = 6.6, P = 1.0 Identities = 14/38 (36%), Positives = 22/38 (57%), Frame = +1 Query: 70 VSEVVQPYLDVGVVVGCRRETQSPRGLGPPRKGISEHP 183 V E+ + +L+ G+VV E SP+G+G P K + P Sbjct: 38 VGEIAKIFLEKGIVV---EEKDSPKGVGRPTKSLKISP 72 >gi|7482002|pir||T18353 protein P97 - Mycoplasma hyopneumoniae >gi|1399525|gb|AAB47806.1| (U50901) P97 [Mycoplasma hyopneumoniae] Length = 1108 Frame -3 hits (HSPs): __ ___ __________________________________________________ Database sequence: | | | | | | | | | 1108 0 150 300 450 600 750 900 1050 Minus Strand HSPs: Score = 53 (18.7 bits), Expect = 6.7, Sum P(2) = 1.0 Identities = 9/29 (31%), Positives = 19/29 (65%), Frame = -3 Query: 213 PEXQIPDNMSRVFRDSFARWAQASGTLSL 127 PE ++P+N+ +F SFA+ + + +S+ Sbjct: 248 PENKLPNNLGNIFEFSFAKDSSTNQYVSI 276 Score = 40 (14.1 bits), Expect = 6.7, Sum P(2) = 1.0 Identities = 11/37 (29%), Positives = 19/37 (51%), Frame = -3 Query: 111 DNADIQVGLYHFTNSRIEVYGGSLIFLQPDSSKKGVV 1 + ADIQ H +I G + + QP ++K+ V+ Sbjct: 554 EKADIQRFTRHLEQVKI---GSNSVLNQPQTTKEQVI 587 >gi|1352005|sp|P48987|ATO_DROME ATONAL PROTEIN >gi|476802|pir||A40708 basic-helix-loop-helix protein ato - fruit fly (Drosophila melanogaster) >gi|551566|gb|AAA21879.1| (L36646) atonal protein [Drosophila melanogaster] Length = 312 Frame -1 hits (HSPs): ______ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | | | 312 0 50 100 150 200 250 300 __________________ Annotated Domains: Entrez dna-binding site: BASIC DOMAIN. 255..267 Entrez Domain: HELIX-LOOP-HELIX MOTIF (BY SIMIL 268..308 PFAM HLH: Helix-loop-helix DNA-binding domain 256..308 PRODOM PD123677: ATO_DROME 1..254 PRODOM PD000239: MYC(20) MYOD(12) MYCN(7) 256..306 __________________ Minus Strand HSPs: Score = 64 (22.5 bits), Expect = 6.7, P = 1.0 Identities = 14/31 (45%), Positives = 17/31 (54%), Frame = -1 Query: 185 VG-CSEIPLRGGPKPRGL*VSRRQPTTTPTS 96 VG C IP PKP+ + QP+TT TS Sbjct: 138 VGTCKTIPASAAPKPKRSYTKKNQPSTTATS 168 >gi|2194124|gb|AAB61099.1| (AC002062) Similar to Glycine metalloendoproteinase (gb|U63725). [Arabidopsis thaliana] Length = 378 Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 378 0 150 300 Minus Strand HSPs: Score = 65 (22.9 bits), Expect = 6.8, P = 1.0 Identities = 13/58 (22%), Positives = 27/58 (46%), Frame = -3 Query: 213 PEXQIPDNMSRVFRDSFARWAQASGTLSLTATTYDNADIQVGLYHFTNSRIEVYGGSL 40 P+ + + + VF +F RW+ + + ++ +DI +G Y + E + G L Sbjct: 177 PKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGDHGDGEPFDGVL 234 >gi|3128477|gb|AAC31167.1| (AF062640) metalloproteinase [Arabidopsis thaliana] Length = 341 Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 341 0 150 300 Minus Strand HSPs: Score = 64 (22.5 bits), Expect = 7.6, P = 1.0 Identities = 15/48 (31%), Positives = 23/48 (47%), Frame = -3 Query: 183 RVFRDSFARWAQASGTLSLTATTYDNADIQVGLYHFTNSRIEVYGGSL 40 RVFR +F WA + Y ADI++G ++ + E + G L Sbjct: 161 RVFRRAFGEWASVIPVSFIETEDYVIADIKIGFFNGDHGDGEPFDGVL 208 >gi|2707691|gb|AAB94714.1| (AF029949) IgM heavy chain VDJ region [Oryctolagus cuniculus] Length = 133 Frame -1 hits (HSPs): ____ Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 133 0 50 100 Minus Strand HSPs: Score = 48 (16.9 bits), Expect = 8.3, Sum P(2) = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -3 Query: 165 FARWAQASGTLSLTATTYD 109 +A WA+ T+S T+TT D Sbjct: 62 YASWAKGRFTISKTSTTVD 80 Score = 33 (11.6 bits), Expect = 8.3, Sum P(2) = 1.0 Identities = 6/9 (66%), Positives = 7/9 (77%), Frame = -1 Query: 44 ALYFCNRIL 18 A YFC R+L Sbjct: 92 ATYFCARML 100 >gi|280480|pir||S22449 FPR1 protein - Podospora anserina >gi|228928|prf||1814445B transcription factor [Podospora anserina] Length = 365 Frame -3 hits (HSPs): ______ Annotated Domains: ___________ __________________________________________________ Database sequence: | | | | 365 0 150 300 __________________ Annotated Domains: Entrez domain: HMG box homology #label HMG1 130..204 __________________ Minus Strand HSPs: Score = 64 (22.5 bits), Expect = 8.3, P = 1.0 Identities = 14/43 (32%), Positives = 25/43 (58%), Frame = -3 Query: 129 LTATTYDNADIQVGLYHFTNSRIEVYGGSLIFLQPDSSKKGVV 1 LTA +++ IQ+G H+ ++ V + + PD +KKGV+ Sbjct: 69 LTAKYWNHFSIQLG--HWNTLKVIVLDAQMFSIMPDHTKKGVL 109 >gi|102173|pir||A30592 33K cytoskeletal protein - Giardia lamblia (fragment) Length = 271 Frame -1 hits (HSPs): _____ Frame -3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | | 271 0 50 100 150 200 250 Minus Strand HSPs: Score = 50 (17.6 bits), Expect = 9.1, Sum P(2) = 1.0 Identities = 12/27 (44%), Positives = 14/27 (51%), Frame = -3 Query: 195 DNMSRVFRDSFARWAQASGTLSLTATT 115 D M+ FR S RWA S TL + T Sbjct: 109 DTMAANFRKSLERWATHSTTLRQISRT 135 Score = 34 (12.0 bits), Expect = 9.1, Sum P(2) = 1.0 Identities = 10/25 (40%), Positives = 12/25 (48%), Frame = -1 Query: 116 PTTTPTSR*GCTTSLTRGLKCMVAA 42 P T R CTTS TR + A+ Sbjct: 162 PRRTQKGR-RCTTSSTRRSQTFAAS 185 >gi|3914827|sp|O33431|RPOC_PORCN DNA-DIRECTED RNA POLYMERASE BETA' CHAIN (TRANSCRIPTASE BETA' CHAIN) (RNA POLYMERASE BETA' SUBUNIT) >gi|2463347|emb|CAA65247.1| (X96383) DNA-dependent RNA polymerase [Porphyromonas cangingivalis] Length = 1159 Frame -2 hits (HSPs): __ Frame -3 hits (HSPs): ___ Annotated Domains: __________________________ __________________________________________________ Database sequence: | | | | | | | | | 1159 0 150 300 450 600 750 900 1050 __________________ Annotated Domains: PFAM RNA_pol_A: RNA polymerase alpha subunit 173..757 __________________ Minus Strand HSPs: Score = 52 (18.3 bits), Expect = 9.3, Sum P(2) = 1.0 Identities = 10/28 (35%), Positives = 16/28 (57%), Frame = -3 Query: 117 TYDNADIQVGLYHFTNSRIEVYGGSLIF 34 T + D+ +GLY+ T R + G L+F Sbjct: 438 TVPSQDMVLGLYYITKLRKDAKGAGLVF 465 Score = 40 (14.1 bits), Expect = 9.3, Sum P(2) = 1.0 Identities = 5/14 (35%), Positives = 11/14 (78%), Frame = -2 Query: 205 PDPRQHE*GVQRFL 164 P+P+ HE G+ +++ Sbjct: 297 PEPKMHECGLPKYM 310 >gi|2506519|sp|P35693|FPR1_PODAN MAT+ SEXUAL CELL FERTILISATION PROMOTING FACTOR >gi|1666178|emb|CAA45520.1| (X64195) FPR1 [Podospora anserina] Length = 402 Frame -3 hits (HSPs): ______ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 402 0 150 300 __________________ Annotated Domains: DOMO DM00056: HMGBOX 121..194 Entrez dna-binding site: HMG BOX. 169..237 PFAM HMG_box: HMG (high mobility group) box 169..237 PRODOM PD075849: FPR1_PODAN 1..68 PRODOM PD020782: FPR1(1) MATB(1) O42834(1) 70..169 PRODOM PD000156: HMG1(10) HMG2(10) UBF1(7) 171..236 PRODOM PD096350: FPR1_PODAN 238..401 __________________ Minus Strand HSPs: Score = 64 (22.5 bits), Expect = 9.4, P = 1.0 Identities = 14/43 (32%), Positives = 25/43 (58%), Frame = -3 Query: 129 LTATTYDNADIQVGLYHFTNSRIEVYGGSLIFLQPDSSKKGVV 1 LTA +++ IQ+G H+ ++ V + + PD +KKGV+ Sbjct: 69 LTAKYWNHFSIQLG--HWNTLKVIVLDAQMFSIMPDHTKKGVL 109 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.99 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.359 0.161 0.628 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.327 0.138 0.463 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.324 0.143 0.460 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.345 0.152 0.544 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.355 0.166 0.651 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.133 0.387 same same same Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 71 70 10. 57 3 12 22 0.089 31 27 0.11 31 +2 0 71 70 10. 57 3 12 22 0.089 31 27 0.11 31 +1 0 71 70 10. 57 3 12 22 0.089 31 27 0.11 31 -1 0 71 70 10. 57 3 12 22 0.089 31 27 0.11 31 -2 0 71 70 10. 57 3 12 22 0.089 31 27 0.11 31 -3 0 71 70 10. 57 3 12 22 0.12 30 27 0.11 31 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 8:50 PM CDT May 27, 2000 Format: BLAST # of letters in database: 158,518,215 # of sequences in database: 505,245 # of database sequences satisfying E: 45 No. of states in DFA: 577 (57 KB) Total size of DFA: 124 KB (128 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 4 Search cpu time: 110.42u 0.96s 111.38t Elapsed: 00:00:41 Total cpu time: 110.45u 1.05s 111.50t Elapsed: 00:00:42 Start: Wed Feb 14 20:40:49 2001 End: Wed Feb 14 20:41:31 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000