WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'E07E01_I01_09.ab1' (605 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 7 Sequences : less than 7 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1410 392 |======================================================== 6310 1018 257 |==================================== 3980 761 192 |=========================== 2510 569 214 |============================== 1580 355 114 |================ 1000 241 94 |============= 631 147 42 |====== 398 105 25 |=== 251 80 16 |== 158 64 6 |: 100 58 4 |: 63.1 54 5 |: 39.8 49 13 |= 25.1 36 6 |: 15.8 30 10 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 20 <<<<<<<<<<<<<<<<< 10.0 20 11 |= 6.31 9 1 |: 3.98 8 1 |: 2.51 7 2 |: 1.58 5 2 |: 1.00 3 0 | 0.63 3 0 | 0.40 3 0 | 0.25 3 0 | 0.16 3 0 | 0.10 3 0 | 0.063 3 0 | 0.040 3 0 | 0.025 3 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|11357297|pir||T45642FtsH metalloproteinase-like pr... +1 452 5.4e-41 1 gi|9759220|dbj|BAB09632.1|(AB016885) cell division pr... +1 433 6.4e-39 1 gi|2492512|sp|P73437|FTH3_SYNY3CELL DIVISION PROTEIN ... +1 108 0.021 1 gi|3218522|emb|CAA19646.1|(AL023874) /prediction=(met... +1 94 0.71 1 gi|7290347|gb|AAF45806.1|(AE003425) EG:100G10.7 gene ... +1 94 0.71 1 gi|11467496ref|NP_043642.1| ORF 644 [Odontella sinens... +1 91 0.87 1 gi|128980|sp|P01433|NXS2_HEMHASHORT NEUROTOXIN 2 (TOX... +3 66 0.92 1 gi|8927680|gb|AAF82171.1|AC068143_13(AC068143) Contai... +1 66 0.92 1 gi|2492513|sp|P72991|FTH4_SYNY3CELL DIVISION PROTEIN ... +1 88 0.99 1 gi|5804782|dbj|BAA33755.2|(AB017480) chloroplast FtsH... +1 87 0.999 1 gi|128967|sp|P01435|NXS1_LATSESHORT NEUROTOXIN 1 PREC... +3 62 0.9990 1 gi|69471|pir||N1LT1Eshort neurotoxin 1 - broad-banded... +3 62 0.9990 1 gi|4558181|pdb|1QKD|AChain A, Erabutoxin >gi|4558182|... +3 62 0.9990 1 gi|2780864|pdb|3ERA|AChain A, Recombinant Erabutoxin ... +3 62 0.9990 1 gi|2780901|pdb|2ERA| Recombinant Erabutoxin A, S8g ... +3 62 0.9990 1 gi|11467752ref|NP_050804.1| hypothetical chloroplast ... +1 86 0.9994 1 gi|7438494|pir||T02967cyclin A-type (clone30) - commo... -1 84 0.9999 1 gi|128986|sp|P01420|NXS3_NAJHASHORT NEUROTOXIN 3 (TOX... +3 61 0.9999 1 gi|128989|sp|P01421|NXS4_NAJHASHORT NEUROTOXIN 4 (TOX... +3 61 0.9999 1 gi|128971|sp|P01424|NXS1_NAJMESHORT NEUROTOXIN 1 (NEU... +3 61 0.9999 1
Use the and icons to retrieve links to Entrez:
>gi|11357297|pir||T45642 FtsH metalloproteinase-like protein - Arabidopsis thaliana >gi|6522587|emb|CAB61952.1| (AL133292) FtsH metalloprotease-like protein [Arabidopsis thaliana] Length = 802 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | 802 0 150 300 450 600 750 Plus Strand HSPs: Score = 452 (159.1 bits), Expect = 5.4e-41, P = 5.4e-41 Identities = 90/117 (76%), Positives = 101/117 (86%), Frame = +1 Query: 22 AGYGLNQTIGPVSISTLSNGGIDESGGSAPWGRDQGHLVDLVQREVKALLQSALEVSLSI 201 A YGLNQ IGPVS++TLS GGID+SGGS PWGRDQG LVDLVQ+EV LLQSAL+V+LS+ Sbjct: 686 AEYGLNQKIGPVSVATLSGGGIDDSGGS-PWGRDQGKLVDLVQKEVTILLQSALDVALSV 744 Query: 202 VRANPTVLEGLGAHLEEKEKVEGEELQKWLRLVVAPAELAIFIDGKQGSLLPLQTGS 372 VRANP VLEGLGA LEEKEKVEGEELQKWL +VVAP ELA+F++GKQ LLP Q S Sbjct: 745 VRANPDVLEGLGAQLEEKEKVEGEELQKWLSMVVAPEELAVFVEGKQELLLPAQASS 801 >gi|9759220|dbj|BAB09632.1| (AB016885) cell division protein FtsH [Arabidopsis thaliana] Length = 806 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | 806 0 150 300 450 600 750 Plus Strand HSPs: Score = 433 (152.4 bits), Expect = 6.4e-39, P = 6.4e-39 Identities = 87/117 (74%), Positives = 99/117 (84%), Frame = +1 Query: 22 AGYGLNQTIGPVSISTLSNGGIDESGGSAPWGRDQGHLVDLVQREVKALLQSALEVSLSI 201 A YGLN+ IGPVS++TLS GGID+SGGS PWGRDQGHLVDLVQREV LLQSAL+V+L++ Sbjct: 690 AEYGLNEKIGPVSVATLSAGGIDDSGGS-PWGRDQGHLVDLVQREVTNLLQSALDVALTV 748 Query: 202 VRANPTVLEGLGAHLEEKEKVEGEELQKWLRLVVAPAELAIFIDGKQGSLLPLQTGS 372 VRANP VLEGLGA LE++EKVEGEELQKWL VV ELA+FI GKQ +LLP Q S Sbjct: 749 VRANPDVLEGLGAQLEDEEKVEGEELQKWLNRVVPSEELAVFIKGKQTALLPAQASS 805 >gi|2492512|sp|P73437|FTH3_SYNY3 CELL DIVISION PROTEIN FTSH HOMOLOG 3 >gi|7446571|pir||S77374 cell division protein ftsH-4 - Synechocystis sp. (strain PCC 6803) >gi|1652556|dbj|BAA17477.1| (D90906) cell division protein FtsH [Synechocystis sp.] Length = 628 Frame 1 hits (HSPs): _________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 628 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00674A: AAA-protein family proteins. 173..193 BLOCKS BL00674B: AAA-protein family proteins. 207..228 BLOCKS BL00674C: AAA-protein family proteins. 240..282 BLOCKS BL00674D: AAA-protein family proteins. 301..347 BLOCKS BL00674E: AAA-protein family proteins. 379..398 BLOCKS BL00142: Neutral zinc metallopeptidases, 435..445 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1..20 Entrez Transmembrane region: POTENTIAL. 21..31 Entrez Domain: EXTRACELLULAR (POTENTIAL). 32..119 Entrez Transmembrane region: POTENTIAL. 120..142 Entrez Domain: CYTOPLASMIC (POTENTIAL). 143..628 Entrez np-binding site: ATP (POTENTIAL). 214..221 Entrez metal-binding site: ZINC (CATALYTIC) (BY 438 Entrez active site: BY SIMILARITY. 439 Entrez metal-binding site: ZINC (CATALYTIC) (BY 442 PFAM AAA: ATPases associated with various cel 209..398 PFAM Peptidase_M41: Peptidase family M41 404..616 PRODOM PD094595: FTH3_SYNY3 1..21 PRODOM PD035190: FTSH(6) 23..150 PRODOM PD000092: LON(19) CLPB(18) FTSH(17) 155..323 PRODOM PD186075: FTSH(11) PRS6(3) FTH2(2) 329..364 PRODOM PD000272: FTSH(15) TERA(10) PRS7(8) 367..401 PRODOM PD002293: FTSH(16) FTH1(2) FTH2(2) 404..591 PRODOM PD193292: FTH3_SYNY3 593..627 PROSITE AAA: AAA-protein family signature. 315..333 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 214..221 PROSITE ZINC_PROTEASE: Neutral zinc metallopepti 435..444 __________________ Plus Strand HSPs: Score = 108 (38.0 bits), Expect = 0.021, P = 0.021 Identities = 29/107 (27%), Positives = 48/107 (44%), Frame = +1 Query: 4 ANSAITAGYGLNQTIGPVSISTLSNGGIDESGGSAPWGRDQGHLVDLVQREVKALLQSAL 183 A +T YG+++ +GP++ G P + EVK +++ Sbjct: 523 AEQMVTT-YGMSKVLGPLAYDKGQQNNFLGQGMGNPRRMVSDDTAKEIDLEVKEIVEQGH 581 Query: 184 EVSLSIVRANPTVLEGLGAHLEEKEKVEGEELQKWLRLVVAPAELAI 324 +L+I+ N +LE + + EKE +EGEEL L V AP L + Sbjct: 582 NQALAILEHNRDLLEAIAEKILEKEVIEGEELHHLLGQVQAPGTLVV 628 >gi|3218522|emb|CAA19646.1| (AL023874) /prediction=(method:""genefinder"", version:""084"", score:""143.99"")~/motif=(desc:""ATP/GTP-binding site motif A (P-loop)"", dbase:""PROSITE"", acc:""PS00017"", method:""ppsearch"")~/match=(desc:""PARAPLEGIN"", species:""Homo sapiens (Huma> Length = 819 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | | 819 0 150 300 450 600 750 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 1.2, P = 0.71 Identities = 24/84 (28%), Positives = 44/84 (52%), Frame = +1 Query: 28 YGLNQTIGPVSI---STLSNGGIDESGGSAPWGRDQGHLVDLVQREVKALLQSALEVSLS 198 +G+N T+GP+ + GG SGG P+ R ++D E + ++ SA + + Sbjct: 699 FGMNDTLGPIYVRDADETEGGGAMGSGGKKPFSRAMESMID---NEARHVVASAYQTTEG 755 Query: 199 IVRANPTVLEGLGAHLEEKEKVEGEEL 279 I+ + LE L L EKE ++ +++ Sbjct: 756 ILTTHRDKLEKLAEALLEKETLDYDQV 782 >gi|7290347|gb|AAF45806.1| (AE003425) EG:100G10.7 gene product [Drosophila melanogaster] Length = 819 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | | 819 0 150 300 450 600 750 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 1.2, P = 0.71 Identities = 24/84 (28%), Positives = 44/84 (52%), Frame = +1 Query: 28 YGLNQTIGPVSI---STLSNGGIDESGGSAPWGRDQGHLVDLVQREVKALLQSALEVSLS 198 +G+N T+GP+ + GG SGG P+ R ++D E + ++ SA + + Sbjct: 699 FGMNDTLGPIYVRDADETEGGGAMGSGGKKPFSRAMESMID---NEARHVVASAYQTTEG 755 Query: 199 IVRANPTVLEGLGAHLEEKEKVEGEEL 279 I+ + LE L L EKE ++ +++ Sbjct: 756 ILTTHRDKLEKLAEALLEKETLDYDQV 782 >gi|11467496 ref|NP_043642.1| ORF 644 [Odontella sinensis] >gi|1706925|sp|P49825|FTSH_ODOSI CELL DIVISION PROTEIN FTSH HOMOLOG >gi|7446573|pir||S78301 hypothetical protein 644 - Odontella sinensis chloroplast >gi|1185191|emb|CAA91674.1| (Z67753) ORF 644 [Odontella sinensis] Length = 644 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 644 0 150 300 450 600 Plus Strand HSPs: Score = 91 (32.0 bits), Expect = 2.0, P = 0.87 Identities = 24/96 (25%), Positives = 49/96 (51%), Frame = +1 Query: 4 ANSAITAGYGLNQTIGPVSISTLSNGGIDESGGSAPWGRDQGHLVDLVQREVKALLQSAL 183 A +T +G++ IGP+++ S G + G A ++ D + EV+ ++ Sbjct: 533 ARQMVTR-FGMSN-IGPLALEDESTGQVFLGGNMASGSEYAENIADRIDDEVRKIITYCY 590 Query: 184 EVSLSIVRANPTVLEGLGAHLEEKEKVEGEELQKWL 291 E ++ IV N V++ + L +KE ++G+E ++ L Sbjct: 591 EKAIEIVLDNRVVIDLIVEKLLDKETMDGDEFRELL 626 >gi|128980|sp|P01433|NXS2_HEMHA SHORT NEUROTOXIN 2 (TOXIN IV) >gi|69467|pir||N1RI2 short neurotoxin 2 - ringhals Length = 61 Frame 3 hits (HSPs): ____________________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 61 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00272A: Snake toxins proteins. 15..25 BLOCKS BL00272B: Snake toxins proteins. 36..48 BLOCKS BL00272C: Snake toxins proteins. 49..60 DOMO DM00082: SNAKETOXINS 1..60 PFAM toxin: Snake toxin 1..61 PRODOM PD000206: NXS1(24) NXL1(17) CX1(10) 1..60 __________________ Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 2.5, P = 0.92 Identities = 14/44 (31%), Positives = 20/44 (45%), Frame = +3 Query: 201 CAGKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 C G++ C+ W R R RG V +K+ CT+ CN Sbjct: 17 CPGETNCYKKQWSDHRGSRTERGCGCPTVKPGIKLKCCTTDRCN 60 >gi|8927680|gb|AAF82171.1|AC068143_13 (AC068143) Contains similarity to a chloroplast protease from Capsicum annuum gb|AJ012165. EST gb|AI995330 comes from this gene. [Arabidopsis thaliana] Length = 88 Frame 1 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 2.5, P = 0.92 Identities = 16/50 (32%), Positives = 27/50 (54%), Frame = +1 Query: 133 LVDLVQREVKALLQSALEVSLSIVRANPTVLEGLGAHLEEKEKVEGEELQ 282 L + + VK L A E++LS +R N ++ + L EKE + G+E + Sbjct: 10 LANDIDTAVKTLSDKAYEIALSQIRNNREAMDKIVEILLEKETMSGDEFR 59 >gi|2492513|sp|P72991|FTH4_SYNY3 CELL DIVISION PROTEIN FTSH HOMOLOG 4 >gi|7446576|pir||S74970 cell division protein ftsH-2 - Synechocystis sp. (strain PCC 6803) >gi|1652085|dbj|BAA17010.1| (D90902) cell division protein FtsH [Synechocystis sp.] Length = 616 Frame 1 hits (HSPs): _________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 616 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00674A: AAA-protein family proteins. 160..180 BLOCKS BL00674B: AAA-protein family proteins. 194..215 BLOCKS BL00674C: AAA-protein family proteins. 227..269 BLOCKS BL00674D: AAA-protein family proteins. 286..332 BLOCKS BL00674E: AAA-protein family proteins. 364..383 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1..9 Entrez Transmembrane region: POTENTIAL. 10..30 Entrez Domain: EXTRACELLULAR (POTENTIAL). 31..108 Entrez Transmembrane region: POTENTIAL. 109..129 Entrez Domain: CYTOPLASMIC (POTENTIAL). 130..616 Entrez np-binding site: ATP (POTENTIAL). 201..208 Entrez metal-binding site: ZINC (CATALYTIC) (BY 423 Entrez active site: BY SIMILARITY. 424 Entrez metal-binding site: ZINC (CATALYTIC) (BY 427 PFAM AAA: ATPases associated with various cel 196..383 PFAM Peptidase_M41: Peptidase family M41 389..604 PRODOM PD035190: FTSH(6) 15..134 PRODOM PD000092: LON(19) CLPB(18) FTSH(17) 137..308 PRODOM PD186075: FTSH(11) PRS6(3) FTH2(2) 315..348 PRODOM PD000272: FTSH(15) TERA(10) PRS7(8) 352..384 PRODOM PD002293: FTSH(16) FTH1(2) FTH2(2) 389..579 PRODOM PD193293: FTH4_SYNY3 581..615 PROSITE AAA: AAA-protein family signature. 300..318 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 201..208 __________________ Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 4.3, P = 0.99 Identities = 28/96 (29%), Positives = 45/96 (46%), Frame = +1 Query: 4 ANSAITAGYGLNQTIGPVSISTLSNGGIDESGGSAPWGRD-QGHLVDLVQREVKALLQSA 180 A +T +G++ +GPV++ GG+ G RD + EV L+ A Sbjct: 512 ARQMVTR-FGMSDRLGPVALGR-QGGGVF-LGRDIASDRDFSDETAAAIDEEVSQLVDQA 568 Query: 181 LEVSLSIVRANPTVLEGLGAHLEEKEKVEGEELQKWL 291 + + ++ N +L+ L L EKE V+ EELQ L Sbjct: 569 YQRAKQVLVENRGILDQLAEILVEKETVDSEELQTLL 605 >gi|5804782|dbj|BAA33755.2| (AB017480) chloroplast FtsH protease [Nicotiana tabacum] Length = 714 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 714 0 150 300 450 600 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 6.7, P = 1.0 Identities = 31/98 (31%), Positives = 45/98 (45%), Frame = +1 Query: 31 GLNQTIGPVSISTLSNGGIDESGGSAPWGRDQGHLV-DLVQREVKALLQSALEVSLSIVR 207 G ++ IG V+I GG G +D D+V EV+ L++ A E + I+ Sbjct: 612 GFSKKIGQVAIG--GGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATEIIT 669 Query: 208 ANPTVLEGLGAHLEEKEKVEGEELQKWLRLVVAPAELAI 324 + +L L L EKE V+GEE + AEL I Sbjct: 670 THIDILHKLAQLLIEKETVDGEEFMSLF--IDGKAELYI 706 >gi|128967|sp|P01435|NXS1_LATSE SHORT NEUROTOXIN 1 PRECURSOR (ERABUTOXIN A, B, AND C) >gi|69470|pir||N1LT2E short neurotoxin 1a precursor [validated] - broad-banded blue sea krait >gi|64054|emb|CAA26373.1| (X02533) erabutoxin a [Laticauda semifasciata] >gi|4519816|dbj|BAA75752.1| (AB017932) short chain neurotoxin [Laticauda semifasciata] Length = 83 Frame 3 hits (HSPs): ___________________________ Annotated Domains: ______________________________________ __________________________________________________ Database sequence: | | | | | | 83 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00272A: Snake toxins proteins. 37..47 BLOCKS BL00272B: Snake toxins proteins. 58..70 BLOCKS BL00272C: Snake toxins proteins. 71..82 DOMO DM00082: SNAKETOXINS 22..82 PFAM toxin: Snake toxin 22..83 PRODOM PD000206: NXS1(24) NXL1(17) CX1(10) 23..81 __________________ Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 6.9, P = 1.0 Identities = 15/45 (33%), Positives = 20/45 (44%), Frame = +3 Query: 201 CA-GKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 C+ G+S C+ W FR RG V +K+ C S CN Sbjct: 38 CSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCN 82 >gi|69471|pir||N1LT1E short neurotoxin 1 - broad-banded blue sea krait Length = 62 Frame 3 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | 62 0 20 40 60 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 6.9, P = 1.0 Identities = 14/43 (32%), Positives = 19/43 (44%), Frame = +3 Query: 204 AGKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 +G+S C+ W FR RG V +K+ C S CN Sbjct: 19 SGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCN 61 >gi|4558181|pdb|1QKD|A Chain A, Erabutoxin >gi|4558182|pdb|1QKD|B Chain B, Erabutoxin >gi|4558183|pdb|1QKE| Erabutoxin >gi|231131|pdb|5EBX| Erabutoxin a Length = 62 Frame 3 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | | 62 0 20 40 60 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 6.9, P = 1.0 Identities = 15/45 (33%), Positives = 20/45 (44%), Frame = +3 Query: 201 CA-GKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 C+ G+S C+ W FR RG V +K+ C S CN Sbjct: 17 CSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCN 61 >gi|2780864|pdb|3ERA|A Chain A, Recombinant Erabutoxin A (S8t Mutant) >gi|2780865|pdb|3ERA|B Chain B, Recombinant Erabutoxin A (S8t Mutant) Length = 62 Frame 3 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | | 62 0 20 40 60 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 6.9, P = 1.0 Identities = 15/45 (33%), Positives = 20/45 (44%), Frame = +3 Query: 201 CA-GKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 C+ G+S C+ W FR RG V +K+ C S CN Sbjct: 17 CSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCN 61 >gi|2780901|pdb|2ERA| Recombinant Erabutoxin A, S8g Mutant Length = 62 Frame 3 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | | 62 0 20 40 60 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 6.9, P = 1.0 Identities = 15/45 (33%), Positives = 20/45 (44%), Frame = +3 Query: 201 CA-GKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 C+ G+S C+ W FR RG V +K+ C S CN Sbjct: 17 CSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCN 61 >gi|11467752 ref|NP_050804.1| hypothetical chloroplast RF25 [Guillardia theta] >gi|6016057|sp|O78516|FTSH_GUITH CELL DIVISION PROTEIN FTSH HOMOLOG >gi|3603077|gb|AAC35738.1| (AF041468) hypothetical chloroplast RF25 [Guillardia theta] Length = 631 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 631 0 150 300 450 600 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 7.5, P = 1.0 Identities = 26/94 (27%), Positives = 54/94 (57%), Frame = +1 Query: 4 ANSAITAGYGLNQTIGPVSI-STLSNGGIDES-GGSAPWGRDQGHLVDLVQREVKALLQS 177 A +T +G++ IGP+S+ S S+ + + G S+ + D +D+ +V+A++Q Sbjct: 520 ARQMVTR-FGMSN-IGPLSLESQNSDPFLGRTMGSSSQYSEDIASRIDM---QVRAIIQH 574 Query: 178 ALEVSLSIVRANPTVLEGLGAHLEEKEKVEGEELQK 285 ++ I++ N V++ L L EKE ++G+E ++ Sbjct: 575 CHTETVQIIKDNRVVIDKLVDLLIEKETIDGDEFRQ 610 >gi|7438494|pir||T02967 cyclin A-type (clone30) - common tobacco >gi|1064929|emb|CAA63543.1| (X92967) cyclin A-like protein [Nicotiana tabacum] Length = 482 Frame -1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | 482 0 150 300 450 Minus Strand HSPs: Score = 84 (29.6 bits), Expect = 8.9, P = 1.0 Identities = 30/92 (32%), Positives = 45/92 (48%), Frame = -1 Query: 320 ASSAGATTNL-NHFCSSSPSTFSFSSK*APRPSKTVGFARTIESDTSSA-DCSNAFTSL* 147 A A TN+ NH +S+ ++ S SSK AP SK V + + SS S++F Sbjct: 34 AKKRPALTNISNHTTASARNSLSHSSKLAPCTSKVVSIKKNNSNAASSVLPTSSSFVKPI 93 Query: 146 TRSTRCP*SLPQGADPPDSSIPPLERV-EIDTGP 48 +++ P S A P ++IPPL +D P Sbjct: 94 SKTVSLPRS--DAAVPKITAIPPLPSTCSMDISP 125 >gi|128986|sp|P01420|NXS3_NAJHA SHORT NEUROTOXIN 3 (TOXIN CM-10) (TOXIN V-NH-I1) >gi|69452|pir||N1NJ3E short neurotoxin 3 - cobra (Naja haje annulifera) >gi|229523|prf||751415A toxin CM10 [Naja haje annulifera] Length = 61 Frame 3 hits (HSPs): ________________________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 61 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00272A: Snake toxins proteins. 15..25 BLOCKS BL00272B: Snake toxins proteins. 36..48 BLOCKS BL00272C: Snake toxins proteins. 49..60 PFAM toxin: Snake toxin 1..61 PRODOM PD000206: NXS1(24) NXL1(17) CX1(10) 1..60 __________________ Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 9.0, P = 1.0 Identities = 15/48 (31%), Positives = 20/48 (41%), Frame = +3 Query: 189 ITFYCAGKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 IT C G+ C+ W R RG V ++I CT+ CN Sbjct: 13 ITTVCPGEKNCYKKQWSGHRGTIIERGCGCPSVKKGIEINCCTTDKCN 60 >gi|128989|sp|P01421|NXS4_NAJHA SHORT NEUROTOXIN 4 (TOXIN CM-12) (TOXIN V-NH-I2) >gi|69453|pir||N1NJ4E short neurotoxin 4 - cobra (Naja haje annulifera) >gi|229524|prf||751415B toxin CM12 [Naja haje annulifera] Length = 61 Frame 3 hits (HSPs): ________________________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 61 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00272A: Snake toxins proteins. 15..25 BLOCKS BL00272B: Snake toxins proteins. 36..48 BLOCKS BL00272C: Snake toxins proteins. 49..60 DOMO DM00082: SNAKETOXINS 1..60 PFAM toxin: Snake toxin 1..61 PRODOM PD000206: NXS1(24) NXL1(17) CX1(10) 1..60 __________________ Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 9.0, P = 1.0 Identities = 15/48 (31%), Positives = 20/48 (41%), Frame = +3 Query: 189 ITFYCAGKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 IT C G+ C+ W R RG V ++I CT+ CN Sbjct: 13 ITTVCPGEKNCYKKQWSGHRGTIIERGCGCPSVKKGIEINCCTTDKCN 60 >gi|128971|sp|P01424|NXS1_NAJME SHORT NEUROTOXIN 1 (NEUROTOXIN D) >gi|69456|pir||N1NJ1W short neurotoxin 1 - forest cobra Length = 61 Frame 3 hits (HSPs): ____________________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 61 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00272A: Snake toxins proteins. 15..25 BLOCKS BL00272B: Snake toxins proteins. 36..48 BLOCKS BL00272C: Snake toxins proteins. 49..60 DOMO DM00082: SNAKETOXINS 1..60 PFAM toxin: Snake toxin 1..61 PRODOM PD000206: NXS1(24) NXL1(17) CX1(10) 1..59 __________________ Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 9.0, P = 1.0 Identities = 15/44 (34%), Positives = 19/44 (43%), Frame = +3 Query: 201 CAGKSYCFGGSWCSFRRKRESRG*RATEV---VKIGSCTSRACN 323 C G++ C+ W R RG V VKI CT+ CN Sbjct: 17 CPGETNCYKKQWSDHRGTIIERGCGCPSVKKGVKINCCTTDRCN 60 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.98 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.343 0.150 0.541 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.361 0.160 0.601 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.337 0.149 0.474 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.345 0.151 0.517 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.350 0.158 0.542 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.360 0.159 0.606 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 201 200 10. 77 3 12 22 0.094 35 31 0.10 38 +2 0 201 200 10. 77 3 12 22 0.094 35 31 0.10 38 +1 0 201 201 10. 77 3 12 22 0.094 35 31 0.10 38 -1 0 201 200 10. 77 3 12 22 0.094 35 31 0.10 38 -2 0 201 200 10. 77 3 12 22 0.094 35 31 0.10 38 -3 0 201 200 10. 77 3 12 22 0.094 35 31 0.10 38 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 20 No. of states in DFA: 594 (59 KB) Total size of DFA: 221 KB (256 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 201.04u 0.90s 201.94t Elapsed: 00:01:03 Total cpu time: 201.09u 0.90s 201.99t Elapsed: 00:01:04 Start: Fri Jan 18 17:34:57 2002 End: Fri Jan 18 17:36:01 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000