WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'E05A06_A06_01.ab1' (676 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 7 Sequences : less than 7 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1896 419 |=========================================================== 6310 1477 265 |===================================== 3980 1212 359 |=================================================== 2510 853 250 |=================================== 1580 603 172 |======================== 1000 431 101 |============== 631 330 97 |============= 398 233 88 |============ 251 145 33 |==== 158 112 18 |== 100 94 19 |== 63.1 75 13 |= 39.8 62 27 |=== 25.1 35 0 | 15.8 35 10 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 25 <<<<<<<<<<<<<<<<< 10.0 25 2 |: 6.31 23 1 |: 3.98 22 5 |: 2.51 17 0 | 1.58 17 0 | 1.00 17 0 | 0.63 17 1 |: 0.40 16 0 | 0.25 16 4 |: 0.16 12 0 | 0.10 12 0 | 0.063 12 0 | 0.040 12 0 | 0.025 12 1 |: 0.016 11 1 |: 0.010 10 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|9279721|dbj|BAB01311.1|(AB025639) contains similar... +2 447 3.2e-41 1 gi|6539656|gb|AAF15970.1|(AF110764) RS21-C6 [Mus musc... +2 297 2.5e-25 1 gi|10437250|dbj|BAB15025.1|(AK024843) unnamed protein... +2 295 4.1e-25 1 gi|11498778ref|NP_070007.1| hypothetical protein [Arc... +2 183 3.0e-13 1 gi|11348241|pir||C83047conserved hypothetical protein... +2 153 4.6e-10 1 gi|10176622|dbj|BAB07716.1|(AP001520) BH3997~unknown ... +2 152 5.9e-10 1 gi|10644760|gb|AAG21389.1|AF302051_3(AF302051) unknow... +2 147 2.0e-09 1 gi|6959524|gb|AAF33141.1|AF196567_17(AF196567) Pdtorf... +2 134 6.1e-08 1 gi|10174296|dbj|BAB05398.1|(AP001512) BH1679~unknown ... +2 99 0.00065 1 gi|7519375|pir||C71225hypothetical protein PHS001 - P... +2 90 0.0067 1 gi|1945662|emb|CAB08069.1|(Z94043) hypothetical prote... +2 88 0.011 1 gi|7475480|pir||C70033hypothetical protein yvdC - Bac... +2 85 0.024 1 gi|1176702|sp|P42979|YPJD_BACSUHYPOTHETICAL 13.0 KD P... +2 80 0.16 1 gi|7518387|pir||B75193hypothetical protein PAB3022 - ... +2 77 0.17 1 gi|7451184|pir||G70194hypothetical protein BB0760 - L... +2 85 0.18 1 gi|9366750|emb|CAB95512.1|(AL359782) hypothetical pro... -3 94 0.20 1 gi|11498426ref|NP_069654.1| hypothetical protein [Arc... +2 74 0.33 1 gi|870706|gb|AAA99302.1|(L43064) orf4; putative [Pseu... +2 75 0.94 1 gi|7518405|pir||D75036hypothetical protein PAB3319 - ... +2 68 0.98 1 gi|12060145|gb|AAG35609.2|AF201828_1(AF201828) beta-l... +2 85 0.98 1 gi|213591|gb|AAA49470.1|(M62415) HPLC6 [Pseudopleuron... -3 65 0.98 1 gi|7451338|pir||C71127hypothetical protein PHS025 - P... +2 65 0.98 1 gi|6015885|emb|CAB57712.1|(Y18930) hypothetical prote... +2 81 0.99 1 gi|6735234|emb|CAB69042.1|(AJ132105) beta-lactamase [... +2 83 0.998 1 gi|1076601|pir||S49761structural cell wall protein - ... -3 63 0.999 1
Use the and icons to retrieve links to Entrez:
>gi|9279721|dbj|BAB01311.1| (AB025639) contains similarity to unknown protein~gb|AAF15970.1~gene_id:MTE24.1 [Arabidopsis thaliana] Length = 141 Frame 2 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | 141 0 50 100 Plus Strand HSPs: Score = 447 (157.4 bits), Expect = 3.2e-41, P = 3.2e-41 Identities = 84/102 (82%), Positives = 93/102 (91%), Frame = +2 Query: 320 VSLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEE 499 VSL L + MD+FAK RDWE++HSPRNLLLA+VGEVGELSEIFQWKGEV +G DWKEEE Sbjct: 14 VSLQTLSKKMDDFAKARDWEKYHSPRNLLLAMVGEVGELSEIFQWKGEVARGCPDWKEEE 73 Query: 500 KVHLGEELSDVLLYLVRLSDMCGVDLGKAALRKVQLNAVKYP 625 KVHLGEELSDVLLYLVRLSD CGVDLGKAALRK++LNA+KYP Sbjct: 74 KVHLGEELSDVLLYLVRLSDACGVDLGKAALRKIELNAIKYP 115 >gi|6539656|gb|AAF15970.1| (AF110764) RS21-C6 [Mus musculus] Length = 170 Frame 2 hits (HSPs): ______________________________ __________________________________________________ Database sequence: | | | | | 170 0 50 100 150 Plus Strand HSPs: Score = 297 (104.5 bits), Expect = 2.5e-25, P = 2.5e-25 Identities = 56/101 (55%), Positives = 73/101 (72%), Frame = +2 Query: 323 SLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEK 502 +L+ ++++ EFA ERDWEQFH PRNLLLALVGEVGEL+E+FQWK + G W +E+ Sbjct: 30 TLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKER 89 Query: 503 VHLGEELSDVLLYLVRLSDMCGVDLGKAALRKVQLNAVKYP 625 L EELSDVL+YLV L+ C VDL +A + K+ N +YP Sbjct: 90 AALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYP 130 >gi|10437250|dbj|BAB15025.1| (AK024843) unnamed protein product [Homo sapiens] >gi|12654993|gb|AAH01344.1|AAH01344 (BC001344) Unknown (protein for MGC:5627) [Homo sapiens] Length = 170 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | 170 0 50 100 150 Plus Strand HSPs: Score = 295 (103.8 bits), Expect = 4.1e-25, P = 4.1e-25 Identities = 59/116 (50%), Positives = 75/116 (64%), Frame = +2 Query: 323 SLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEK 502 +L+ ++++ EFA ERDWEQFH PRNLLLALVGEVGEL+E+FQWK + G W E+ Sbjct: 30 TLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRER 89 Query: 503 VHLGEELSDVLLYLVRLSDMCGVDLGKAALRKVQLNAVKYPKKVYEDPSSSTVSPP 670 L EELSDVL+YLV L+ C VDL A L K+ +N +YP + S P Sbjct: 90 AALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELP 145 >gi|11498778 ref|NP_070007.1| hypothetical protein [Archaeoglobus fulgidus] >gi|7483568|pir||A69397 hypothetical protein AF1178 - Archaeoglobus fulgidus >gi|2649424|gb|AAB90082.1| (AE001023) A. fulgidus predicted coding region AF1178 [Archaeoglobus fulgidus] Length = 106 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 183 (64.4 bits), Expect = 3.0e-13, P = 3.0e-13 Identities = 40/105 (38%), Positives = 66/105 (62%), Frame = +2 Query: 326 LDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEKV 505 +++L I+ EF R W ++H+P+NL +++ EV EL EIFQW + + E K Sbjct: 1 MEELLDILREFRDSRGWLKYHTPKNLAVSISIEVAELLEIFQWTRSSDEEF-EVLERRKG 59 Query: 506 HLGEELSDVLLYLVRLSDMCGVDLGKAALRKVQLNAVKYPK-KVYE 640 + EE++DVL+YL+ L D+ ++ +A RK++ N KYPK +V+E Sbjct: 60 EVEEEIADVLIYLLFLCDVAEINPIEAVKRKMEKNERKYPKNRVHE 105 >gi|11348241|pir||C83047 conserved hypothetical protein PA4789 [imported] - Pseudomonas aeruginosa (strain PAO1) >gi|9951055|gb|AAG08175.1|AE004892_6 (AE004892) conserved hypothetical protein [Pseudomonas aeruginosa] Length = 101 Frame 2 hits (HSPs): ______________________________________________ __________________________________________________ Database sequence: | | | | | || 101 0 20 40 60 80 100 Plus Strand HSPs: Score = 153 (53.9 bits), Expect = 4.6e-10, P = 4.6e-10 Identities = 34/94 (36%), Positives = 50/94 (53%), Frame = +2 Query: 320 VSLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEE 499 + L +L + DW QFHSP+NL +A E+ EL EIFQW E L ++ E Sbjct: 1 MDLHELTARLHAIRDRNDWRQFHSPKNLAMAASVEMAELVEIFQWLTEDQSRTLSAEQLE 60 Query: 500 KVHLGEELSDVLLYLVRLSDMCGVDLGKAALRKV 601 H G+E+ D++LYL+ G+DL + K+ Sbjct: 61 --HAGQEVGDIVLYLLLFCGETGLDLEQVVRAKL 92 >gi|10176622|dbj|BAB07716.1| (AP001520) BH3997~unknown conserved protein in others [Bacillus halodurans] Length = 101 Frame 2 hits (HSPs): _____________________________________________ __________________________________________________ Database sequence: | | | | | || 101 0 20 40 60 80 100 Plus Strand HSPs: Score = 152 (53.5 bits), Expect = 5.9e-10, P = 5.9e-10 Identities = 33/93 (35%), Positives = 55/93 (59%), Frame = +2 Query: 347 MDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEKVHLGEELS 526 ++EF ER+W Q+H+P++L +++ E EL E FQW + L +E K ++ EE++ Sbjct: 11 INEFRDERNWRQYHNPKDLAISISIEAAELLEDFQWISS-EEAL----KENKENIREEIA 65 Query: 527 DVLLYLVRLSDMCGVDLGKAALRKVQLNAVKYP 625 DVL+Y + L G+D+ + K+ N KYP Sbjct: 66 DVLIYSLMLCSDLGLDVKEIVEEKMVKNGKKYP 98 >gi|10644760|gb|AAG21389.1|AF302051_3 (AF302051) unknown [Bacillus licheniformis] Length = 103 Frame 2 hits (HSPs): _______________________________________________ __________________________________________________ Database sequence: | | | | | | | 103 0 20 40 60 80 100 Plus Strand HSPs: Score = 147 (51.7 bits), Expect = 2.0e-09, P = 2.0e-09 Identities = 32/100 (32%), Positives = 56/100 (56%), Frame = +2 Query: 326 LDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEKV 505 + L ++EF ER+W Q+H+P++L +++ E EL E FQW + L + K Sbjct: 4 IQSLINAINEFRDERNWRQYHNPKDLAISISIEAAELLEDFQWISS-EEAL----KANKE 58 Query: 506 HLGEELSDVLLYLVRLSDMCGVDLGKAALRKVQLNAVKYP 625 ++ EE++D+L+Y L + G+D+ + K+ N KYP Sbjct: 59 NIREEIADILIYSFMLCNDLGLDVKEIVEEKIVKNGRKYP 98 >gi|6959524|gb|AAF33141.1|AF196567_17 (AF196567) PdtorfQ [Pseudomonas stutzeri] Length = 53 Frame 2 hits (HSPs): _____________________________________________ __________________________________________________ Database sequence: | | | | 53 0 20 40 Plus Strand HSPs: Score = 134 (47.2 bits), Expect = 6.1e-08, P = 6.1e-08 Identities = 24/47 (51%), Positives = 34/47 (72%), Frame = +2 Query: 305 PPEAHVSLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEI 445 PP + V + L + +++FA+ R+W QFHSP+NL +AL GE GEL EI Sbjct: 7 PPSSLVDVAPLAEALEQFAEARNWAQFHSPKNLAMALAGETGELLEI 53 >gi|10174296|dbj|BAB05398.1| (AP001512) BH1679~unknown conserved protein [Bacillus halodurans] Length = 114 Frame 2 hits (HSPs): ______________________________________ __________________________________________________ Database sequence: | | | | 114 0 50 100 Plus Strand HSPs: Score = 99 (34.8 bits), Expect = 0.00065, P = 0.00065 Identities = 30/88 (34%), Positives = 51/88 (57%), Frame = +2 Query: 323 SLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELS-EIFQWKGEVPKGLLDWKEEE 499 ++ Q++Q +D + + E + SP +L L EVGELS E+ + GE PK D EEE Sbjct: 5 TMRQMQQEVDAYISQFK-EGYFSPLAMLARLSEEVGELSREVNHFYGEKPKK--D-SEEE 60 Query: 500 KVHLGEELSDVLLYLVRLSDMCGVDLGKA 586 + + +E+ D+L L+ ++ +DL +A Sbjct: 61 RT-MEQEMGDILFVLICFANSLEIDLEEA 88 >gi|7519375|pir||C71225 hypothetical protein PHS001 - Pyrococcus horikoshii >gi|3256447|dbj|BAA29130.1| (AP000001) 78aa long hypothetical protein [Pyrococcus horikoshii] Length = 78 Frame 2 hits (HSPs): ____________________________________________ __________________________________________________ Database sequence: | | | | | 78 0 20 40 60 Plus Strand HSPs: Score = 90 (31.7 bits), Expect = 0.0067, P = 0.0067 Identities = 27/74 (36%), Positives = 45/74 (60%), Frame = +2 Query: 383 FHSPRNLLLALVGEVGELSE-IFQWKGEVPKGLLDWKEEEKVHLGEELSDVLLYLVRLSD 559 + +P +L ALV EVGEL++ I ++G KG+ K+ +K L EEL DVL L+ +++ Sbjct: 4 YWTPSQMLTALVEEVGELADVILSFEGV--KGV---KDHDK--LKEELGDVLFALICIAN 56 Query: 560 MCGVDLGKAALRKVQ 604 VD+ A + ++ Sbjct: 57 YFEVDMEDALMETIK 71 >gi|1945662|emb|CAB08069.1| (Z94043) hypothetical protein [Bacillus subtilis] Length = 117 Frame 2 hits (HSPs): _________________________________________ __________________________________________________ Database sequence: | | | | 117 0 50 100 Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 0.011, P = 0.011 Identities = 33/96 (34%), Positives = 51/96 (53%), Frame = +2 Query: 290 KMAGVPPEAHVSLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVP 469 K AGV + L ++ M EF ++R W ++ P + L+ E GEL+ + E+ Sbjct: 5 KNAGV---MRLQLADAEKWMKEFYEKRGWTEY-GPFIRVGFLMEEAGELARAVR-AYEIG 59 Query: 470 KGLLDWKE----EEKVHLGEELSDVLLYLVRLSDMCGVDL 577 + D KE E+K L EE+ DV+ + L+DM GV L Sbjct: 60 RDRPDEKESSRAEQKQELIEEMGDVIGNIAILADMYGVSL 99 >gi|7475480|pir||C70033 hypothetical protein yvdC - Bacillus subtilis >gi|2635978|emb|CAB15470.1| (Z99121) yvdC [Bacillus subtilis] Length = 106 Frame 2 hits (HSPs): __________________________________________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 0.024, P = 0.024 Identities = 29/88 (32%), Positives = 47/88 (53%), Frame = +2 Query: 320 VSLDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKE-- 493 + L ++ M EF ++R W ++ P + L+ E GEL+ + E+ + D KE Sbjct: 1 MQLADAEKWMKEFYEKRGWTEY-GPFIRVGFLMEEAGELARAVR-AYEIGRDRPDEKESS 58 Query: 494 --EEKVHLGEELSDVLLYLVRLSDMCGVDL 577 E+K L EE+ DV+ + L+DM GV L Sbjct: 59 RAEQKQELIEEMGDVIGNIAILADMYGVSL 88 >gi|1176702|sp|P42979|YPJD_BACSU HYPOTHETICAL 13.0 KD PROTEIN IN QCRC-DAPB INTERGENIC REGION >gi|7475268|pir||D69937 hypothetical protein ypjD - Bacillus subtilis >gi|755602|gb|AAA92873.1| (L38424) unknown [Bacillus subtilis] >gi|1146233|gb|AAB38441.1| (L47709) putative [Bacillus subtilis] >gi|2634668|emb|CAB14166.1| (Z99115) alternate gene name: jojD [Bacillus subtilis] Length = 111 Frame 2 hits (HSPs): _______________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 111 0 50 100 __________________ Annotated Domains: PRODOM PD169836: YPJD_BACSU 1..34 PRODOM PD029233: 36..87 PRODOM PD072674: YPJD_BACSU 89..110 __________________ Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.17, P = 0.16 Identities = 25/70 (35%), Positives = 39/70 (55%), Frame = +2 Query: 377 EQFHSPRNLLLALVGEVGELS-EIFQWKGEVPKGLLDWKEEEKVHLGEELSDVLLYLVRL 553 E + SP ++ L E+GEL+ E+ GE PK E++K + EE+ DVL LV L Sbjct: 22 EGYFSPLAMMARLTEELGELAREVNHRYGEKPKKAT---EDDK-SMEEEIGDVLFVLVCL 77 Query: 554 SDMCGVDLGKA 586 ++ + L +A Sbjct: 78 ANSLDISLEEA 88 >gi|7518387|pir||B75193 hypothetical protein PAB3022 - Pyrococcus abyssi (strain Orsay) >gi|5457502|emb|CAB48993.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 78 Frame 2 hits (HSPs): ________________________________________________ __________________________________________________ Database sequence: | | | | | 78 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.19, P = 0.17 Identities = 27/83 (32%), Positives = 48/83 (57%), Frame = +2 Query: 383 FHSPRNLLLALVGEVGELSE-IFQWKGEVPKGLLDWKEEEKVHLGEELSDVLLYLVRLSD 559 + +P +L ALV EVGEL++ I ++G KG D+ + L EE+ DVL L+ +++ Sbjct: 4 YWTPAQMLTALVEEVGELADVILSFEGV--KGEKDYNK-----LKEEVGDVLFALICIAN 56 Query: 560 MCGVDLGKAALRKVQLNAVKYPKK 631 +++ + ALR+ KY ++ Sbjct: 57 YFQINI-EDALRET---IAKYSRR 76 >gi|7451184|pir||G70194 hypothetical protein BB0760 - Lyme disease spirochete >gi|2688691|gb|AAC67101.1| (AE001175) B. burgdorferi predicted coding region BB0760 [Borrelia burgdorferi] Length = 124 Frame 2 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | 124 0 50 100 Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 0.19, P = 0.18 Identities = 25/67 (37%), Positives = 37/67 (55%), Frame = +2 Query: 407 LALVGEVGELSEIFQWKGEVPKGLLDWKEEEKVHLGEELSDVLLYLVRLSDMCGVDLGKA 586 L L GE GE+ E + G ++D +E + + +EL DVL YL LS+ G+ L Sbjct: 43 LGLAGETGEVVEKIKKLGRDKNYIID--DEYLISIKKELGDVLWYLSSLSNNLGITLEDV 100 Query: 587 AL---RKVQ 604 AL +K+Q Sbjct: 101 ALTNLKKIQ 109 >gi|9366750|emb|CAB95512.1| (AL359782) hypothetical protein, CHR1.247 [Trypanosoma brucei] Length = 224 Frame -3 hits (HSPs): __________________________________ __________________________________________________ Database sequence: | | | | | | 224 0 50 100 150 200 Minus Strand HSPs: Score = 94 (33.1 bits), Expect = 0.23, P = 0.20 Identities = 42/149 (28%), Positives = 64/149 (42%), Frame = -3 Query: 560 CRRASQDKA---THLKALHQDEPFPPLSNLEDPLEPPLSTEISQTI---LPLHPPKPKGG 399 C R + K H + H PP E+P +TE T+ L PK KGG Sbjct: 61 CERTFKSKTWQTRHRETAHSGVA-PPRGTTENPEGSEQTTESENTLQCALCSFVPKSKGG 119 Query: 398 SLGYETA--PNPSPLQTHPLSA*ADQVKHVLL-EEPQPSFKEQKTNIVKRERERDNKNEE 228 + PN +P Q +P+SA + H+ E K+++T + + RE D+ + Sbjct: 120 LTNHRRVRHPNVTPRQLYPMSA----IVHLKKGREASGVRKDRRTQLPPKNRECDHTTKS 175 Query: 227 K*G*LAPHYIRTRRQENEAFF*FLGKVHSTLYLYGKR 117 + G H+ + R + A LGK L G R Sbjct: 176 R-GESTTHHKQEHRTRDIAVA--LGKRQGPLATEGAR 209 >gi|11498426 ref|NP_069654.1| hypothetical protein [Archaeoglobus fulgidus] >gi|7451337|pir||D69352 hypothetical protein AF0820 - Archaeoglobus fulgidus >gi|2649790|gb|AAB90424.1| (AE001047) A. fulgidus predicted coding region AF0820 [Archaeoglobus fulgidus] Length = 94 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | | 94 0 20 40 60 80 Plus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.40, P = 0.33 Identities = 26/79 (32%), Positives = 43/79 (54%), Frame = +2 Query: 404 LLALVGEVGELSEIFQWKGEVPKGLLDWKEEEKVHLGEELSDVLLYLVRLSDMCGVDLGK 583 +L +V EVGEL+E V KG ++GEE++DV+ +LV L+++ VD+ + Sbjct: 27 MLWVVEEVGELAEA------VRKG---------TNVGEEIADVMAWLVSLANLLDVDVEE 71 Query: 584 AALRKVQLNAVKYPKKVYE 640 L+K ++ KK E Sbjct: 72 EILKKYPGYCIRCGKKPCE 90 >gi|870706|gb|AAA99302.1| (L43064) orf4; putative [Pseudomonas aeruginosa] Length = 111 Frame 2 hits (HSPs): _________________________________________________ __________________________________________________ Database sequence: | | | | 111 0 50 100 Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 2.8, P = 0.94 Identities = 31/113 (27%), Positives = 50/113 (44%), Frame = +2 Query: 302 VPPEAHVSLDQLKQIMDEFAKERDWEQFHSPRNLLLALVG--EVGELSEIFQWKGEVPKG 475 +PPE H DQ + +E S + LA +GEL + + + V + Sbjct: 3 LPPERHPQRDQAMSAAVQILEETG-----SALRVALASQNWEAIGELDQ--RCRQAVDEA 55 Query: 476 LLDWKEEEKVHLGEELSDVLLYLVRLSDMCGVDLGKAALRKVQLNAVKYPKKVYE 640 +LD ++E L + ++L L D+C + K A +QLN K KVY+ Sbjct: 56 MLDVQDEAT--LRARMEELLALYRELIDVCQGEQRKLATDLIQLNQSKQGAKVYQ 108 >gi|7518405|pir||D75036 hypothetical protein PAB3319 - Pyrococcus abyssi (strain Orsay) >gi|5458698|emb|CAB50185.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 95 Frame 2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | | 95 0 20 40 60 80 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 3.7, P = 0.98 Identities = 16/47 (34%), Positives = 30/47 (63%), Frame = +2 Query: 458 GEVPKGLLDWKEEEKVHLGEELSDVLLYLVRLSDMCGVDLGKAALRK 598 GE+ + L ++ ++ L EE +DVL +L L+++ +DL +AA +K Sbjct: 35 GELAEAL---RKNDREALEEEFADVLAWLASLANLLDIDLEEAAKKK 78 >gi|12060145|gb|AAG35609.2|AF201828_1 (AF201828) beta-lactamase OXA-27 [Acinetobacter baumannii] Length = 273 Frame 2 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | 273 0 50 100 150 200 250 Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 3.8, P = 0.98 Identities = 23/68 (33%), Positives = 41/68 (60%), Frame = +2 Query: 398 NLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEKVHLGE--ELSDVLLYLVRLSDMCGV 571 N L+ L + +++EIF+WKGE + W E+ + LGE +LS V +Y L+ G+ Sbjct: 85 NALIGLENQKADINEIFKWKGE-KRSFTAW--EKDMTLGEAMKLSAVPVYQ-ELARRIGL 140 Query: 572 DLGKAALRKV 601 DL + ++++ Sbjct: 141 DLMQKEVKRI 150 >gi|213591|gb|AAA49470.1| (M62415) HPLC6 [Pseudopleuronectes americanus] Length = 83 Frame -3 hits (HSPs): _______________________________ __________________________________________________ Database sequence: | | | | | | 83 0 20 40 60 80 Minus Strand HSPs: Score = 65 (22.9 bits), Expect = 3.9, P = 0.98 Identities = 18/53 (33%), Positives = 24/53 (45%), Frame = -3 Query: 506 EPFPPLSNLEDPLEPPLSTEISQTILP-LHPPKPKGGSLGYETAPNPSPLQTHP 348 +P PP L +PP + ++ + P L PP PK L P P P Q P Sbjct: 26 QPKPPQQQLPPLPQPPQTPPLTPPLQPPLPPPTPK--PLPNSLPPTPPPPQQPP 77 >gi|7451338|pir||C71127 hypothetical protein PHS025 - Pyrococcus horikoshii >gi|3257194|dbj|BAA29877.1| (AP000003) 74aa long hypothetical protein [Pyrococcus horikoshii] Length = 74 Frame 2 hits (HSPs): ______________________________ __________________________________________________ Database sequence: | | | | | 74 0 20 40 60 Plus Strand HSPs: Score = 65 (22.9 bits), Expect = 4.0, P = 0.98 Identities = 15/47 (31%), Positives = 30/47 (63%), Frame = +2 Query: 458 GEVPKGLLDWKEEEKVHLGEELSDVLLYLVRLSDMCGVDLGKAALRK 598 GE+ + L ++ ++ + EE +DVL +L L+++ +DL +AA +K Sbjct: 13 GELAEAL---RKGDRESMEEEFADVLAWLASLANLVDIDLEEAAKKK 56 >gi|6015885|emb|CAB57712.1| (Y18930) hypothetical protein [Sulfolobus solfataricus] >gi|12312141|emb|CAC23004.1| (AL512964) on [Sulfolobus solfataricus] Length = 174 Frame 2 hits (HSPs): ______________________________ __________________________________________________ Database sequence: | | | | | 174 0 50 100 150 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 4.3, P = 0.99 Identities = 26/103 (25%), Positives = 50/103 (48%), Frame = +2 Query: 326 LDQLKQIMDEFAKERDWEQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEKV 505 +D+L + + +WE S + + +GE EI Q KG + + + W E V Sbjct: 31 IDELNSFIGLALTKIEWEDMQSDLMRVQTELFILGE--EIIQDKGRINEETIKWLESRTV 88 Query: 506 HLGEELSDVLLYLVRL-SDMCG-VDLGKAALRKVQLNAVKYPKKV 634 +E V L+++ S+ + + ++ R+V+ NAV Y K++ Sbjct: 89 EYRKESGPVKLFVIPGGSEQASYLHVVRSIARRVERNAVAYSKEL 133 >gi|6735234|emb|CAB69042.1| (AJ132105) beta-lactamase [Acinetobacter baumannii] Length = 273 Frame 2 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | 273 0 50 100 150 200 250 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 6.5, P = 1.0 Identities = 23/68 (33%), Positives = 41/68 (60%), Frame = +2 Query: 398 NLLLALVGEVGELSEIFQWKGEVPKGLLDWKEEEKVHLGE--ELSDVLLYLVRLSDMCGV 571 N L+ L + +++EIF+WKGE + W E+ + LGE +LS V +Y L+ G+ Sbjct: 85 NALIGLENQKTDINEIFKWKGE-KRSFTAW--EKDMTLGEAMKLSAVPVYQ-ELARRIGL 140 Query: 572 DLGKAALRKV 601 DL + ++++ Sbjct: 141 DLMQKEVKRI 150 >gi|1076601|pir||S49761 structural cell wall protein - tomato (fragment) >gi|575952|emb|CAA86659.1| (Z46674) extensin [Lycopersicon esculentum] Length = 80 Frame -3 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Minus Strand HSPs: Score = 63 (22.2 bits), Expect = 6.5, P = 1.0 Identities = 15/55 (27%), Positives = 25/55 (45%), Frame = -3 Query: 506 EPFPPLSNLEDPLEP-PLSTEISQTILPLHP-PKPKGGSLGYETAPNPSPLQTHP 348 +P+ P + P P P+ + P HP P P + Y++ P P+P+ P Sbjct: 10 KPYHPTPVYKSPPPPTPVYKSPPSPVKPYHPSPTPYHPTPAYKSPPPPTPVYKSP 64 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.99 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.358 0.158 0.573 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.326 0.141 0.424 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.354 0.158 0.588 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.349 0.154 0.554 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.346 0.148 0.479 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.334 0.148 0.482 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 224 224 10. 77 3 12 22 0.11 35 32 0.12 38 +2 0 225 225 10. 77 3 12 22 0.11 35 32 0.12 38 +1 0 225 225 10. 77 3 12 22 0.11 35 32 0.12 38 -1 0 225 225 10. 77 3 12 22 0.11 35 32 0.12 38 -2 0 225 225 10. 77 3 12 22 0.11 35 32 0.12 38 -3 0 224 224 10. 77 3 12 22 0.11 35 32 0.12 38 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 25 No. of states in DFA: 594 (59 KB) Total size of DFA: 244 KB (256 KB) Time to generate neighborhood: 0.02u 0.00s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 238.87u 1.01s 239.88t Elapsed: 00:01:09 Total cpu time: 238.93u 1.03s 239.96t Elapsed: 00:01:09 Start: Fri Jan 18 13:06:34 2002 End: Fri Jan 18 13:07:43 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000