WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= B10F06.seq(1>489) (459 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 6 Sequences : less than 6 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1914 326 |====================================================== 6310 1588 237 |======================================= 3980 1351 305 |================================================== 2510 1046 287 |=============================================== 1580 759 115 |=================== 1000 644 118 |=================== 631 526 135 |====================== 398 391 97 |================ 251 294 39 |====== 158 255 69 |=========== 100 186 35 |===== 63.1 151 97 |================ 39.8 54 31 |===== 25.1 23 6 |= 15.8 17 9 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 8 <<<<<<<<<<<<<<<<< 10.0 8 1 |: 6.31 7 1 |: 3.98 6 0 | 2.51 6 2 |: 1.58 4 0 | 1.00 4 1 |: 0.63 3 0 | 0.40 3 0 | 0.25 3 2 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|12322207|gb|AAG51143.1|AC069273_14(AC069273) unkno... +3 341 5.5e-30 1 gi|282138|pir||B42645ribosomal protein L29 - Chlamydi... -3 74 0.15 1 gi|6920076|sp|P28538|RL29_CHLTR50S RIBOSOMAL PROTEIN ... -3 74 0.15 1 gi|11362655|pir||G81664ribosomal protein L29 TC0807 [... -3 68 0.56 1 gi|2245471|gb|AAB62522.1|(AF000523) Tat protein [Huma... +2 64 0.91 1 gi|7297461|gb|AAF52718.1|(AE003623) CG15868 gene prod... +3 64 0.91 1 gi|1749861|gb|AAB39117.1|(U80467) tat protein [Human ... +2 61 0.995 1 gi|102568|pir||S08572chymotrypsin/elastase inhibitor ... -1 59 0.9999 1
Use the and icons to retrieve links to Entrez:
>gi|12322207|gb|AAG51143.1|AC069273_14 (AC069273) unknown protein [Arabidopsis thaliana] Length = 97 Frame 3 hits (HSPs): _________________________________________________ __________________________________________________ Database sequence: | | | | | | 97 0 20 40 60 80 Plus Strand HSPs: Score = 341 (120.0 bits), Expect = 5.5e-30, P = 5.5e-30 Identities = 64/96 (66%), Positives = 81/96 (84%), Frame = +3 Query: 57 MAFNNALRSAAKLVASSESSFSNSVSRGFHSTGMKRM-GGGHGHDEPYYLHAKHMYNLDK 233 MA + ++RS +K++ASSE+S S SV+R FHSTG+K+M GGGHG + YYLHAKHMYNLD+ Sbjct: 1 MALSTSIRSVSKIIASSEASVSRSVTRSFHSTGVKKMSGGGHGGYDEYYLHAKHMYNLDR 60 Query: 234 MKHQGLKMSLAVFIAFSIGVAVPVYAVIFQQKKTAS 341 MK+Q LKMSL VF AFSIGV VP++AV+FQQ+KT S Sbjct: 61 MKYQALKMSLGVFTAFSIGVGVPIFAVVFQQRKTQS 96 >gi|282138|pir||B42645 ribosomal protein L29 - Chlamydia trachomatis >gi|144619|gb|AAA23170.1| (M80325) ribosomal protein CtrL29e [Chlamydia trachomatis] Length = 72 Frame -3 hits (HSPs): _________________________________ Annotated Domains: ___________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 __________________ Annotated Domains: PROSITE RIBOSOMAL_L29: Ribosomal protein L29 sig 45..59 __________________ Minus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.17, P = 0.15 Identities = 19/47 (40%), Positives = 27/47 (57%), Frame = -3 Query: 142 KPLLTELEKEDSEEATSFAADLSALLKAIGFESDALENEMVSLHAYS 2 K LL EL ++ SEE F D L A+ E+ AL+N++V H +S Sbjct: 5 KNLLAELREKSSEELDEFIRDNKKALFALRAEA-ALQNKVVKTHQFS 50 >gi|6920076|sp|P28538|RL29_CHLTR 50S RIBOSOMAL PROTEIN L29 >gi|3328957|gb|AAC68121.1| (AE001323) L29 Ribosomal Protein [Chlamydia trachomatis] Length = 72 Frame -3 hits (HSPs): _________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00579A: Ribosomal protein L29 proteins 10..19 BLOCKS BL00579B: Ribosomal protein L29 proteins 37..66 DOMO DM01647: RIBOSOMALPROTEINL29 1..68 PFAM Ribosomal_L29: Ribosomal L29 protein 8..71 PRODOM PD187745: O84525(1) RL29(1) Q9Z7R5(1) 1..71 PROSITE RIBOSOMAL_L29: Ribosomal protein L29 sig 45..59 __________________ Minus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.17, P = 0.15 Identities = 19/47 (40%), Positives = 27/47 (57%), Frame = -3 Query: 142 KPLLTELEKEDSEEATSFAADLSALLKAIGFESDALENEMVSLHAYS 2 K LL EL ++ SEE F D L A+ E+ AL+N++V H +S Sbjct: 5 KNLLAELREKSSEELDEFIRDNKKALFALRAEA-ALQNKVVKTHQFS 50 >gi|11362655|pir||G81664 ribosomal protein L29 TC0807 [imported] - Chlamydia muridarum (strain Nigg) >gi|7190835|gb|AAF39610.1| (AE002347) ribosomal protein L29 [Chlamydia muridarum] Length = 72 Frame -3 hits (HSPs): _________________________________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 Minus Strand HSPs: Score = 68 (23.9 bits), Expect = 0.83, P = 0.56 Identities = 18/47 (38%), Positives = 25/47 (53%), Frame = -3 Query: 142 KPLLTELEKEDSEEATSFAADLSALLKAIGFESDALENEMVSLHAYS 2 K LL EL ++ SEE F D L + E+ AL+N+ V H +S Sbjct: 5 KNLLAELREKSSEELDEFIRDNKKALFTLRAEA-ALQNKAVKTHQFS 50 >gi|2245471|gb|AAB62522.1| (AF000523) Tat protein [Human immunodeficiency virus type 1] Length = 71 Frame 2 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 2.4, P = 0.91 Identities = 10/27 (37%), Positives = 12/27 (44%), Frame = +2 Query: 242 PGVENVPCCVHCFQHWCCSSCVCCHFP 322 PG + P C C+ CC C C P Sbjct: 14 PGSQPKPACTTCYCKKCCLHCQVCFIP 40 >gi|7297461|gb|AAF52718.1| (AE003623) CG15868 gene product [Drosophila melanogaster] Length = 67 Frame 3 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | 67 0 20 40 60 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 2.4, P = 0.91 Identities = 12/35 (34%), Positives = 19/35 (54%), Frame = +3 Query: 144 HSTGMKRMGGGHGHDE--PYYLHAKHMYNLDKMKH 242 HS+ K G GHGH E P+++H+ + +H Sbjct: 23 HSSSGKHQGSGHGHREQQPHHVHSLATSTMASSRH 57 >gi|1749861|gb|AAB39117.1| (U80467) tat protein [Human immunodeficiency virus type 1] Length = 72 Frame 2 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 5.3, P = 0.99 Identities = 9/24 (37%), Positives = 11/24 (45%), Frame = +2 Query: 242 PGVENVPCCVHCFQHWCCSSCVCC 313 PG + C C+ CC C CC Sbjct: 14 PGSQPKTACTSCYCKRCCFHCQCC 37 >gi|102568|pir||S08572 chymotrypsin/elastase inhibitor - common roundworm Length = 63 Frame -1 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | 63 0 20 40 60 Minus Strand HSPs: Score = 59 (20.8 bits), Expect = 9.1, P = 1.0 Identities = 14/35 (40%), Positives = 17/35 (48%), Frame = -1 Query: 252 STPGASSC--PSCTCALHEDSRAHHDHVHLPSSSC 154 +TP A C PSC C+ R HD +P S C Sbjct: 25 NTPCALMCRPPSCECSPGRGMRRTHDGKCVPVSEC 59 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.99 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.340 0.143 0.459 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.342 0.150 0.555 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.353 0.154 0.575 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.348 0.147 0.509 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.349 0.151 0.514 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.350 0.150 0.506 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 152 152 10. 74 3 12 22 0.094 34 30 0.12 36 +2 0 152 151 10. 74 3 12 22 0.093 34 30 0.12 36 +1 0 153 152 10. 74 3 12 22 0.094 34 30 0.12 36 -1 0 153 152 10. 74 3 12 22 0.094 34 30 0.12 36 -2 0 152 152 10. 74 3 12 22 0.094 34 30 0.12 36 -3 0 152 152 10. 74 3 12 22 0.094 34 30 0.12 36 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 8 No. of states in DFA: 593 (58 KB) Total size of DFA: 192 KB (192 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 154.30u 1.11s 155.41t Elapsed: 00:00:36 Total cpu time: 154.33u 1.13s 155.46t Elapsed: 00:00:36 Start: Wed Feb 6 11:47:13 2002 End: Wed Feb 6 11:47:49 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000