WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A12A02_CONSENSUS (507 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 6 Sequences : less than 6 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1558 361 |============================================================ 6310 1197 224 |===================================== 3980 973 252 |========================================== 2510 721 205 |================================== 1580 516 160 |========================== 1000 356 82 |============= 631 274 88 |============== 398 186 61 |========== 251 125 28 |==== 158 97 23 |=== 100 74 17 |== 63.1 57 22 |=== 39.8 35 5 |: 25.1 30 1 |: 15.8 29 8 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 21 <<<<<<<<<<<<<<<<< 10.0 21 5 |: 6.31 16 3 |: 3.98 13 3 |: 2.51 10 1 |: 1.58 9 0 | 1.00 9 1 |: 0.63 8 0 | 0.40 8 0 | 0.25 8 2 |: 0.16 6 0 | 0.10 6 1 |: 0.063 5 0 | 0.040 5 0 | 0.025 5 0 | 0.016 5 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|7486304|pir||T04535hypothetical protein F28J12.50 ... +1 88 5.6e-06 2 gi|12320852|gb|AAG50562.1|AC073506_4(AC073506) hypoth... +2 91 1.6e-05 2 gi|7294399|gb|AAF49745.1|(AE003535) CG13482 gene prod... -3 104 7.1e-05 1 gi|3328126|gb|AAC26786.1|(AF072691) putative basic he... +2 83 0.00038 2 gi|11358650|pir||T50492probable helix-loop-helix DNA ... +2 77 0.011 2 gi|7488996|pir||T07030extensin - tomato (fragment) >g... -2 48 0.079 2 gi|7499707|pir||T30119hypothetical protein F22H10.2 -... -3 74 0.16 1 gi|7504000|pir||T16435hypothetical protein F53A9.2 - ... -3 73 0.21 1 gi|7503998|pir||T16436hypothetical protein F53A9.1 - ... -3 68 0.58 1 gi|1076601|pir||S49761structural cell wall protein - ... -2 51 0.91 2 gi|11359668|pir||T48707related to regulatory protein ... -3 88 0.96 1 gi|8777486|dbj|BAA97066.1|(AP000370) gene_id:K15M2.17... +2 80 0.97 2 gi|737061|prf||1921322Apolyserin [Homo sapiens] +1 73 0.97 1 gi|3746070|gb|AAC63845.1|(AC005311) unknown protein [... +2 82 0.992 1 gi|12722782ref|XP_010700.1| small protein effector 1 ... -2 61 0.997 1 gi|9758388|dbj|BAB08875.1|(AB022212) AP2 domain trans... +1 79 0.998 1 gi|3243274|gb|AAC24010.1|(AF072134) TCP3 [Arabidopsis... +2 81 0.999 1 gi|6689585|emb|CAB65515.1|(AJ243596) homeodomain tran... -3 60 0.9993 1 gi|7291971|gb|AAF47387.1|(AE003468) CG13885 gene prod... -3 60 0.9993 1 gi|7769872|gb|AAF69550.1|AC008007_25(AC008007) F12M16... +2 81 0.9994 1 gi|9632203ref|NP_048922.1| a566L [Paramecium bursaria... -2 64 0.9996 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 2 Hits gi|7486304 | ____________ gi|12320852 | ____________ gi|3328126 | ____________ gi|11358650 | ____________ gi|8777486 | ______________ gi|3746070 | ______________ gi|3243274 | ______________ gi|7769872 | ______________ __________________________________________________ Query sequence: | | | | | 169 0 50 100 150 Locus_ID Frame 1 Hits gi|7486304 | ______________ gi|12320852 | ________ gi|3328126 | _______ gi|11358650 | ________ gi|8777486 | _____ gi|737061 | ___________________ gi|9758388 | _______________________ __________________________________________________ Query sequence: | | | | | 169 0 50 100 150 Locus_ID Frame -2 Hits gi|7488996 | _________ gi|1076601 | _________ gi|12722782 | __________ gi|9632203 | ____________ __________________________________________________ Query sequence: | | | | | 169 0 50 100 150 Locus_ID Frame -3 Hits gi|7294399 | ______________ gi|7488996 | ____ gi|7499707 | _______________ gi|7504000 | _______________ gi|7503998 | _________ gi|1076601 | ____ gi|11359668 | __________________ gi|6689585 | ___ gi|7291971 | ______________ __________________________________________________ Query sequence: | | | | | 169 0 50 100 150
Use the and icons to retrieve links to Entrez:
>gi|7486304|pir||T04535 hypothetical protein F28J12.50 - Arabidopsis thaliana >gi|2832644|emb|CAA16719.1| (AL021710) teosinte branched1 - like protein [Arabidopsis thaliana] >gi|7268632|emb|CAB78841.1| (AL161548) teosinte branched1-like protein [Arabidopsis thaliana] Length = 360 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 360 0 150 300 Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 5.6e-06, Sum P(2) = 5.6e-06 Identities = 22/43 (51%), Positives = 25/43 (58%), Frame = +1 Query: 232 KGVGGGGGSDASTNHFHQSSWHY-SSKIXRVSXASGGKXRHXKV 360 K G D N+ S WH+ SS+I RVS ASGGK RH KV Sbjct: 2 KNNNNGDVVDNEVNN-RLSRWHHNSSRIIRVSRASGGKDRHSKV 44 Score = 83 (29.2 bits), Expect = 5.6e-06, Sum P(2) = 5.6e-06 Identities = 19/37 (51%), Positives = 26/37 (70%), Frame = +2 Query: 356 KLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNK 463 K++TSKG R+ V LSV+TA+ FYD + LG P+K Sbjct: 43 KVLTSKGPRDRRVRLSVSTALQFYDLQDRLGYDQPSK 79 >gi|12320852|gb|AAG50562.1|AC073506_4 (AC073506) hypothetical protein [Arabidopsis thaliana] Length = 324 Frame 2 hits (HSPs): _______ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | | | 324 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 91 (32.0 bits), Expect = 1.6e-05, Sum P(2) = 1.6e-05 Identities = 20/37 (54%), Positives = 26/37 (70%), Frame = +2 Query: 356 KLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNK 463 K++TSKGLR+ + LSV TAI FYD + LG P+K Sbjct: 56 KVLTSKGLRDRRIRLSVATAIQFYDLQDRLGFDQPSK 92 Score = 73 (25.7 bits), Expect = 1.6e-05, Sum P(2) = 1.6e-05 Identities = 16/25 (64%), Positives = 19/25 (76%), Frame = +1 Query: 289 SWHY-SSKIXRVSXASGGKXRHXKV 360 +W+ SS+I RVS ASGGK RH KV Sbjct: 33 NWNNPSSRIIRVSRASGGKDRHSKV 57 >gi|7294399|gb|AAF49745.1| (AE003535) CG13482 gene product [Drosophila melanogaster] Length = 102 Frame -3 hits (HSPs): _______________________________________ __________________________________________________ Database sequence: | | | | | | | 102 0 20 40 60 80 100 Minus Strand HSPs: Score = 104 (36.6 bits), Expect = 7.1e-05, P = 7.1e-05 Identities = 26/75 (34%), Positives = 33/75 (44%), Frame = -3 Query: 283 GGSGLC*HHFHHHHQHLXFLGHPLLPPLGIGHYSYHFQL*GTYMXESHPPPYHSHAFFPS 104 GG G HH HHHH H PP + H+ +H G M PPP+H H + P Sbjct: 20 GGGG---HHHHHHHPPPPV--HHYHPPPPVHHHHHH----GPPMHHHGPPPHHHHHYGPP 70 Query: 103 LTP-HLVFFSYPHGKY 59 P H + HG + Sbjct: 71 PPPPHYDHHHHHHGSH 86 Score = 70 (24.6 bits), Expect = 3.6, P = 0.97 Identities = 16/45 (35%), Positives = 22/45 (48%), Frame = -3 Query: 253 HHHHQHLXFLGHPLLPPLGIGHYSYHFQL*GTYMXESHPPPYHSH 119 HHHH + G P PP HY +H G++ + H P+H H Sbjct: 62 HHHHHY----GPPPPPP----HYDHHHHHHGSHF-DHHHGPHHGH 97 >gi|3328126|gb|AAC26786.1| (AF072691) putative basic helix-loop-helix DNA binding protein TCP2 [Arabidopsis thaliana] Length = 335 Frame 2 hits (HSPs): _______ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 335 0 150 300 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 0.00038, Sum P(2) = 0.00038 Identities = 19/37 (51%), Positives = 26/37 (70%), Frame = +2 Query: 356 KLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNK 463 K++TSKG R+ V LSV+TA+ FYD + LG P+K Sbjct: 20 KVLTSKGPRDRRVRLSVSTALQFYDLQDRLGYDQPSK 56 Score = 71 (25.0 bits), Expect = 0.00038, Sum P(2) = 0.00038 Identities = 15/20 (75%), Positives = 16/20 (80%), Frame = +1 Query: 301 SSKIXRVSXASGGKXRHXKV 360 SS+I RVS ASGGK RH KV Sbjct: 2 SSRIIRVSRASGGKDRHSKV 21 >gi|11358650|pir||T50492 probable helix-loop-helix DNA binding protein - Arabidopsis thaliana >gi|8346544|emb|CAB93708.1| (AL357612) putative helix-loop-helix DNA binding protein [Arabidopsis thaliana] Length = 242 Frame 2 hits (HSPs): _________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 242 0 50 100 150 200 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.011, Sum P(2) = 0.011 Identities = 18/38 (47%), Positives = 25/38 (65%), Frame = +2 Query: 356 KLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNKL 466 K+ T +GLR+ + LSV TAI YD + LGL P+K+ Sbjct: 39 KVCTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKV 76 Score = 60 (21.1 bits), Expect = 0.011, Sum P(2) = 0.011 Identities = 13/23 (56%), Positives = 16/23 (69%), Frame = +1 Query: 292 WHYSSKIXRVSXASGGKXRHXKV 360 W+ + +I RVS A GGK RH KV Sbjct: 19 WN-NPRIVRVSRAFGGKDRHSKV 40 >gi|7488996|pir||T07030 extensin - tomato (fragment) >gi|575950|emb|CAA86660.1| (Z46675) extensin [Lycopersicon esculentum] Length = 42 Frame -2 hits (HSPs): ______________________________ Frame -3 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | 42 0 20 40 Minus Strand HSPs: Score = 48 (16.9 bits), Expect = 0.083, Sum P(2) = 0.079 Identities = 11/26 (42%), Positives = 14/26 (53%), Frame = -2 Query: 251 PPPPTPFXLRSPSSSSSXYWSLLLPF 174 PPPPTP +SP + Y S P+ Sbjct: 6 PPPPTPIY-KSPPPPTPAYNSPPPPY 30 Score = 45 (15.8 bits), Expect = 0.083, Sum P(2) = 0.079 Identities = 7/11 (63%), Positives = 8/11 (72%), Frame = -3 Query: 157 YMXESHPPPYH 125 Y+ S PPPYH Sbjct: 31 YLYTSPPPPYH 41 >gi|7499707|pir||T30119 hypothetical protein F22H10.2 - Caenorhabditis elegans >gi|1572746|gb|AAB09100.1| (U70845) contains weak similarity to B-type repeats found in plant dehydrins [Caenorhabditis elegans] Length = 102 Frame -3 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | | | 102 0 20 40 60 80 100 Minus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.18, P = 0.16 Identities = 19/48 (39%), Positives = 23/48 (47%), Frame = -3 Query: 262 HHFHHHHQHLXFLGHPLLPPLGIGHYSYHFQL*GTYMXESHPPPYHSH 119 HH HHHH L LGH L G GH+ +H G + H +H H Sbjct: 61 HHHHHHHGLLHGLGHALT---G-GHHHHHHHG-GHHFGHHHH--HHGH 101 >gi|7504000|pir||T16435 hypothetical protein F53A9.2 - Caenorhabditis elegans >gi|746553|gb|AAC46557.1| (U23523) histidine-rich [Caenorhabditis elegans] Length = 83 Frame -3 hits (HSPs): _________________________ __________________________________________________ Database sequence: | | | | | | 83 0 20 40 60 80 Minus Strand HSPs: Score = 73 (25.7 bits), Expect = 0.23, P = 0.21 Identities = 19/48 (39%), Positives = 23/48 (47%), Frame = -3 Query: 262 HHFHHHHQH--LXFLGHPLLPPLGIGHYSYHFQL*GTYMXESHPPPYHSH 119 HH HHHH H L LGH L GH+ +H G + H +H H Sbjct: 42 HHGHHHHHHSFLHELGHALT-----GHHHHHH---GHHFGHHHHH-HHGH 82 >gi|7503998|pir||T16436 hypothetical protein F53A9.1 - Caenorhabditis elegans >gi|746552|gb|AAC46556.1| (U23523) F53A9.1 gene product [Caenorhabditis elegans] Length = 77 Frame -3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | 77 0 20 40 60 Minus Strand HSPs: Score = 68 (23.9 bits), Expect = 0.87, P = 0.58 Identities = 14/29 (48%), Positives = 17/29 (58%), Frame = -3 Query: 262 HHFHHHHQH--LXFLGHPLLPPLGIGHYSYH 176 HH HHHH H L LGH + GH+ +H Sbjct: 43 HHGHHHHHHGFLHELGHAMT-----GHHHHH 68 >gi|1076601|pir||S49761 structural cell wall protein - tomato (fragment) >gi|575952|emb|CAA86659.1| (Z46674) extensin [Lycopersicon esculentum] Length = 80 Frame -2 hits (HSPs): __________________ Frame -3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Minus Strand HSPs: Score = 51 (18.0 bits), Expect = 2.4, Sum P(2) = 0.91 Identities = 13/28 (46%), Positives = 15/28 (53%), Frame = -2 Query: 251 PPPPTPFXLRSPSSSSSXYWSLLLPF-PT 168 PPPPTP +SP S Y P+ PT Sbjct: 21 PPPPTPVY-KSPPSPVKPYHPSPTPYHPT 48 Score = 46 (16.2 bits), Expect = 2.4, Sum P(2) = 0.91 Identities = 7/11 (63%), Positives = 8/11 (72%), Frame = -3 Query: 157 YMXESHPPPYH 125 Y+ S PPPYH Sbjct: 69 YVSSSPPPPYH 79 >gi|11359668|pir||T48707 related to regulatory protein wetA [imported] - Neurospora crassa >gi|11544665|emb|CAB88506.2| (AL353817) related to regulatory protein wetA [Neurospora crassa] Length = 963 Frame -3 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | | | 963 0 150 300 450 600 750 900 Minus Strand HSPs: Score = 88 (31.0 bits), Expect = 3.2, P = 0.96 Identities = 20/55 (36%), Positives = 25/55 (45%), Frame = -3 Query: 256 FHHHHQHLXFLGHPLLPPLGIGHYSYHFQL*GTYMXESHPPPYHSHAFFPSLTPH 92 FHH H H +G+P +PPL H H G PPP+H H S + H Sbjct: 756 FHHPH-HRGVMGYPPMPPLPAHHLQAHHGP-GASSLSPPPPPHHHHHPSKSFSLH 808 >gi|8777486|dbj|BAA97066.1| (AP000370) gene_id:K15M2.17~unknown protein [Arabidopsis thaliana] Length = 406 Frame 2 hits (HSPs): _______ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 406 0 150 300 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 3.4, Sum P(2) = 0.97 Identities = 22/50 (44%), Positives = 28/50 (56%), Frame = +2 Query: 329 HLVAXTGT----XKLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNK 463 H+V TG K+ T+KG R+ V LS TAI FYD + LG P+K Sbjct: 24 HIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRLGFDRPSK 73 Score = 38 (13.4 bits), Expect = 3.4, Sum P(2) = 0.97 Identities = 6/15 (40%), Positives = 12/15 (80%), Frame = +1 Query: 460 QTVEWLIQLLKTTLN 504 + V+WLI+ KT+++ Sbjct: 73 KAVDWLIKKAKTSID 87 >gi|737061|prf||1921322A polyserin [Homo sapiens] Length = 115 Frame 1 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | 115 0 50 100 Plus Strand HSPs: Score = 73 (25.7 bits), Expect = 3.7, P = 0.97 Identities = 22/65 (33%), Positives = 29/65 (44%), Frame = +1 Query: 178 GRSSDQYXEEEEEGDLRXKGVGGG---GGSDASTNHFHQSSWHYSSKIXRVSXASGGKXR 348 G S++ E E G + G GGG G S +S++ SS SS S +SGGK Sbjct: 26 GSVSNRNMEREASGSGKGSGSGGGSSSGSSSSSSSSSSSSSSSSSSSSSSPSSSSGGKGS 85 Query: 349 HXKVD 363 D Sbjct: 86 ETSSD 90 >gi|3746070|gb|AAC63845.1| (AC005311) unknown protein [Arabidopsis thaliana] Length = 361 Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 361 0 150 300 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 4.9, P = 0.99 Identities = 22/50 (44%), Positives = 28/50 (56%), Frame = +2 Query: 329 HLVAXTGT----XKLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNK 463 H++ TG K+ TSKG R+ V LS TAI FYD + LG P+K Sbjct: 22 HIIRATGRKDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSK 71 >gi|12722782 ref|XP_010700.1| small protein effector 1 of Cdc42 [Homo sapiens] Length = 69 Frame -2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 Minus Strand HSPs: Score = 61 (21.5 bits), Expect = 5.7, P = 1.0 Identities = 14/32 (43%), Positives = 16/32 (50%), Frame = -2 Query: 263 ASLPPPPPTPFXLRS-PSSSSSXYWSLLLPFP 171 +SLPP P P SS +W LLPFP Sbjct: 35 SSLPPCPSPPSCWNELKQMSSRGWWGCLLPFP 66 >gi|9758388|dbj|BAB08875.1| (AB022212) AP2 domain transcription factor-like [Arabidopsis thaliana] Length = 248 Frame 1 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | | 248 0 50 100 150 200 Plus Strand HSPs: Score = 79 (27.8 bits), Expect = 6.2, P = 1.0 Identities = 20/75 (26%), Positives = 32/75 (42%), Frame = +1 Query: 190 DQYXEEEEEGDLRXKGVGGGGGSDASTNHFHQSSWHYSSKIXRVSXASGGKXRHXKVDDL 369 +QY + GD+ +GGG GS + H +S ++ S +SGG R + D Sbjct: 175 NQYYHDASSGDMLSFNLGGGYGSGTGYSMSHDNS---TTTAATTSSSSGGSSRQQEEQDY 231 Query: 370 XRVKKXXGXALCDHS 414 R + + HS Sbjct: 232 ARFWRFGDSSSSPHS 246 >gi|3243274|gb|AAC24010.1| (AF072134) TCP3 [Arabidopsis thaliana] Length = 373 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 373 0 150 300 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 6.9, P = 1.0 Identities = 22/50 (44%), Positives = 28/50 (56%), Frame = +2 Query: 329 HLVAXTGT----XKLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNK 463 H+V TG K+ T+KG R+ V LS TAI FYD + LG P+K Sbjct: 24 HIVRSTGRKDRHSKVCTAKGPRDRRVRLSAPTAIQFYDVQDRLGFDRPSK 73 >gi|6689585|emb|CAB65515.1| (AJ243596) homeodomain transcription factor [Xenopus laevis] Length = 69 Frame -3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 Minus Strand HSPs: Score = 60 (21.1 bits), Expect = 7.2, P = 1.0 Identities = 8/9 (88%), Positives = 8/9 (88%), Frame = -3 Query: 262 HHFHHHHQH 236 HH HHHHQH Sbjct: 25 HHHHHHHQH 33 >gi|7291971|gb|AAF47387.1| (AE003468) CG13885 gene product [Drosophila melanogaster] Length = 71 Frame -3 hits (HSPs): ________________________________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 Minus Strand HSPs: Score = 60 (21.1 bits), Expect = 7.2, P = 1.0 Identities = 16/46 (34%), Positives = 19/46 (41%), Frame = -3 Query: 262 HHFHHHHQHLXFLGHPLLPPLGIGHYSYHFQL*GTYMXESHPP---PYH 125 H HHHH H HP P H+ H G + H P PY+ Sbjct: 26 HSHHHHHSH----SHPHPHPHSHPHHHPHLGTAGGMPMDLHVPQGFPYY 70 >gi|7769872|gb|AAF69550.1|AC008007_25 (AC008007) F12M16.13 [Arabidopsis thaliana] Length = 391 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 391 0 150 300 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 7.3, P = 1.0 Identities = 22/50 (44%), Positives = 28/50 (56%), Frame = +2 Query: 329 HLVAXTGT----XKLMTSKGLRNXXVXLSVTTAIXFYDFKI-LGLXXPNK 463 H+V TG K+ T+KG R+ V LS TAI FYD + LG P+K Sbjct: 42 HIVRSTGRKDRHSKVCTAKGPRDRRVRLSAPTAIQFYDVQDRLGFDRPSK 91 >gi|9632203 ref|NP_048922.1| a566L [Paramecium bursaria Chlorella virus 1] >gi|7461701|pir||T18068 hypothetical protein a566L - Chlorella virus PBCV-1 >gi|2447145|gb|AAC97003.1| (U42580) a566L [Paramecium bursaria Chlorella virus 1] Length = 90 Frame -2 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 90 0 20 40 60 80 Minus Strand HSPs: Score = 64 (22.5 bits), Expect = 7.7, P = 1.0 Identities = 14/39 (35%), Positives = 21/39 (53%), Frame = -2 Query: 278 KWFVLASLPPPPPTP--FXLRSPSSSSSXYWSLLLPFPT 168 ++F++ + PPPPP P F PS + S PFP+ Sbjct: 32 RFFLILTPPPPPPPPPDFTHFFPSQFHPFFMSHTQPFPS 70 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.94 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.374 0.170 0.793 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.338 0.145 0.450 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.325 0.138 0.432 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.341 0.146 0.464 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.333 0.141 0.475 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.356 0.162 0.619 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 168 155 10. 74 3 12 22 0.096 34 30 0.12 36 +2 0 168 155 10. 74 3 12 22 0.096 34 30 0.12 36 +1 0 169 155 10. 74 3 12 22 0.096 34 30 0.12 36 -1 0 169 154 10. 74 3 12 22 0.095 34 30 0.12 36 -2 0 168 157 10. 74 3 12 22 0.098 34 30 0.12 36 -3 0 168 156 10. 74 3 12 22 0.097 34 30 0.12 36 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 21 No. of states in DFA: 596 (59 KB) Total size of DFA: 191 KB (192 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 159.01u 1.21s 160.22t Elapsed: 00:00:27 Total cpu time: 159.03u 1.25s 160.28t Elapsed: 00:00:27 Start: Mon Oct 1 23:38:01 2001 End: Mon Oct 1 23:38:28 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000