WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= SSH7B05.SEQ(1>194) (171 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 505,245 sequences; 158,518,215 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 14 Sequences : less than 14 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 4321 55 |=== 6310 4266 353 |========================= 3980 3913 462 |================================= 2510 3451 843 |============================================================ 1580 2608 810 |========================================================= 1000 1798 535 |====================================== 631 1263 369 |========================== 398 894 260 |================== 251 634 197 |============== 158 437 142 |========== 100 295 99 |======= 63.1 196 71 |===== 39.8 125 29 |== 25.1 96 26 |= 15.8 70 20 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 50 <<<<<<<<<<<<<<<<< 10.0 50 11 |: 6.31 39 14 |= 3.98 25 6 |: 2.51 19 8 |: 1.58 11 4 |: 1.00 7 1 |: 0.63 6 2 |: 0.40 4 0 | 0.25 4 2 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|419768|pir||S29793protein ORF 214 (atpA 3' region)... +1 196 1.0e-14 1 gi|320576|pir||S26980hypothetical protein 209 - kidne... +1 184 1.9e-13 1 gi|388439|gb|AAB27469.1|paired box Pax-3 gene product... +1 71 0.17 1 gi|6002393|dbj|BAA84748.1|(AB015750) homeobox protein... +1 62 0.18 2 gi|5106930|gb|AAD39893.1|AF107295_1(AF107295) outer m... -1 55 0.35 2 gi|1633405|pdb|1FJL|AChain A, Homeodomain From The Dr... +1 67 0.38 1 gi|2143469|pir||I52812gene Pax-3 protein - mouse (fra... +1 64 0.63 1 gi|555819|gb|AAA80574.1|(U12259) paired box homeotic ... +1 71 0.64 1 gi|2136302|pir||A45452transcription factor PAX3 - hum... +1 71 0.71 1 gi|2462779|gb|AAB71983.1|(U72659) luteinizing hormone... +2 49 0.71 2 gi|4102797|gb|AAD01589.1|(AF016318) cyclophilin 1 [Di... +3 40 0.75 2 gi|3193075|gb|AAC42641.1|(AF064335) envelope glycopro... +3 40 0.84 2 gi|6679211ref|NP_032807.1| paired box gene 3 >gi|1296... +1 71 0.87 1 gi|1172022|sp|P23760|PAX3_HUMANPAIRED BOX PROTEIN PAX... +1 71 0.87 1 gi|2145076|gb|AAB58415.1|(AF000673) paired-box transc... +1 71 0.87 1 gi|2909767|gb|AAC41254.1|(AF014367) transcription fac... +1 68 0.88 1 gi|2909765|gb|AAC41253.1|(AF014366) transcription fac... +1 71 0.89 1 gi|6539648|gb|AAF15966.1|AF106915_1(AF106915) luteini... +2 46 0.90 2 gi|3193118|gb|AAC42661.1|(AF064358) envelope glycopro... +3 40 0.91 2 gi|126476|sp|P18842|LSHB_CANFALUTROPIN BETA CHAIN PRE... +2 46 0.95 2 gi|3617823|gb|AAC36048.1|(AF024520) luteinizing hormo... +2 46 0.96 2 gi|2909773|gb|AAC41257.1|(AF014370) transcription fac... +1 68 0.97 1 gi|1352721|sp|P47239|PAX7_MOUSEPAIRED BOX PROTEIN PAX... +1 66 0.97 1 gi|560583|gb|AAB30807.1|PAX7-FKHR=chimeric transcript... +1 68 0.97 1 gi|3193063|gb|AAC42635.1|(AF064329) envelope glycopro... +3 40 0.98 2 gi|431254|gb|AAC50053.1|(U02368) PAX3 protein-forkhea... +1 71 0.98 1 gi|6753740ref|NP_034253.1| eukaryotic translation ini... +1 47 0.98 2 gi|1172023|sp|P23759|PAX7_HUMANPAIRED BOX PROTEIN PAX... +1 68 0.99 1 gi|2909771|gb|AAC41256.1|(AF014369) transcription fac... +1 68 0.99 1 gi|7595813|gb|AAF64461.1|AF241311_1(AF241311) transcr... +1 66 0.990 1 gi|2909769|gb|AAC41255.1|(AF014368) transcription fac... +1 68 0.991 1 gi|7524359ref|NP_039236.1| paired box gene 7, isoform... +1 68 0.992 1 gi|4505619ref|NP_002575.1| paired box gene 7, isoform... +1 68 0.992 1 gi|2576239|dbj|BAA23005.1|(D87838) PAX7 protein [Gall... +1 68 0.992 1 gi|420441|pir||S31628MA28L protein - myxoma virus >gi... -2 44 0.995 2 gi|3789862|gb|AAC67524.1|(AF067805) PspGI restriction... +1 64 0.996 1 gi|7293597|gb|AAF48969.1|(AE003512) CG14202 gene prod... +1 57 0.996 1 gi|2240026|gb|AAB62325.1|(AF001907) retinal homeobox ... +1 62 0.997 1 gi|3193042|gb|AAC42626.1|(AF064317) envelope glycopro... +3 40 0.997 2 gi|4138292|emb|CAA07775.1|(AJ007939) Rx2 protein [Ory... +1 61 0.999 1 gi|2305107|gb|AAB65697.1|(AF009954) phytoene synthase... +1 55 0.999 2 gi|585748|sp|P37271|PSY_ARATHPHYTOENE SYNTHASE PRECUR... +1 55 0.999 2 gi|4505315ref|NP_003961.1| myomesin 2; titin-associat... +2 71 0.9994 1 gi|7243783|gb|AAF43449.1|AF239614_1(AF239614) M-Prote... +2 71 0.9994 1 gi|1743856|gb|AAB39104.1|(U57759) intrageneric coaggr... +1 63 0.9998 1 gi|6319412ref|NP_009494.1| Ybl059wp >gi|465518|sp|P34... -3 60 0.9999 1 gi|4519627|dbj|BAA75673.1|(AB017633) Djrax [Dugesia j... +1 62 0.9999 1 gi|7496121|pir||T29397hypothetical protein C16C8.11 -... +2 45 0.9999 2 gi|7297914|gb|AAF53160.1|(AE003634) prd gene product ... +1 66 0.9999 1 gi|123412|sp|P06601|HMPR_DROMESEGMENTATION PROTEIN PA... +1 66 0.99993 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|4102797 | ____________________ gi|3193075 | _______________ gi|3193118 | _______________ gi|3193063 | _______________ gi|3193042 | _______________ __________________________________________________ Query sequence: | | | | 57 0 20 40 Locus_ID Frame 2 Hits gi|6002393 | __________ gi|2462779 | ____________________________ gi|6539648 | ____________________________ gi|126476 | ____________________________ gi|3617823 | ____________________________ gi|4505315 | __________________________________________ gi|7243783 | __________________________________________ gi|7496121 | __________________ __________________________________________________ Query sequence: | | | | 57 0 20 40 Locus_ID Frame 1 Hits gi|419768 | _______________________________________________ gi|320576 | ___________________________________________ gi|388439 | _______________________________ gi|6002393 | ________________________________ gi|1633405 | ________________________________ gi|2143469 | _________________________ gi|555819 | _______________________________ gi|2136302 | _______________________________ gi|4102797 | __________________ gi|3193075 | ______________________ gi|6679211 | _______________________________ gi|1172022 | _______________________________ gi|2145076 | _______________________________ gi|2909767 | _______________________________ gi|2909765 | _______________________________ gi|3193118 | ______________________ gi|2909773 | _______________________________ gi|1352721 | _______________________________ gi|560583 | _______________________________ gi|3193063 | ______________________ gi|431254 | _______________________________ gi|6753740 | ___________________________________________ gi|1172023 | _______________________________ gi|2909771 | _______________________________ gi|7595813 | ____________________________________________ gi|2909769 | _______________________________ gi|7524359 | _______________________________ gi|4505619 | _______________________________ gi|2576239 | _______________________________ gi|3789862 | ___________________________ gi|7293597 | ______________________________ gi|2240026 | ________________________________ gi|3193042 | ______________________ gi|4138292 | ________________________________ gi|2305107 | _______________________________________ gi|585748 | _______________________________________ gi|1743856 | ____________________ gi|4519627 | ________________________________ gi|7496121 | _________________ gi|7297914 | _______________________________ gi|123412 | _______________________________ __________________________________________________ Query sequence: | | | | 57 0 20 40 Locus_ID Frame -1 Hits gi|5106930 | _______________ gi|420441 | _________________________ __________________________________________________ Query sequence: | | | | 57 0 20 40 Locus_ID Frame -2 Hits gi|420441 | _________________ __________________________________________________ Query sequence: | | | | 57 0 20 40 Locus_ID Frame -3 Hits gi|5106930 | ___________________ gi|6319412 | _________________________ __________________________________________________ Query sequence: | | | | 57 0 20 40
Use the and icons to retrieve links to Entrez:
>gi|419768|pir||S29793 protein ORF 214 (atpA 3' region) - soybean mitochondrion >gi|22740|emb|CAA78406.1| (Z14031) orf214 [Glycine max] Length = 214 Frame 1 hits (HSPs): ______________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 214 0 50 100 150 200 __________________ Annotated Domains: DOMO DM05819: 1..214 __________________ Plus Strand HSPs: Score = 196 (69.0 bits), Expect = 1.0e-14, P = 1.0e-14 Identities = 41/53 (77%), Positives = 44/53 (83%), Frame = +1 Query: 13 FGRHGQSSEEKVLNAQVKIERAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 FG ++KVLNAQVKIERAIEKALLSDGYSRDELSQR+KRDE R LFYR Sbjct: 99 FGDLSDQQKDKVLNAQVKIERAIEKALLSDGYSRDELSQRNKRDEIRGFLFYR 151 >gi|320576|pir||S26980 hypothetical protein 209 - kidney bean mitochondrion >gi|169319|gb|AAB01583.1| (M64246) ORF-209; putative [Phaseolus vulgaris] Length = 209 Frame 1 hits (HSPs): _____________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 209 0 50 100 150 200 __________________ Annotated Domains: DOMO DM05819: 1..209 __________________ Plus Strand HSPs: Score = 184 (64.8 bits), Expect = 1.9e-13, P = 1.9e-13 Identities = 39/48 (81%), Positives = 42/48 (87%), Frame = +1 Query: 28 QSSEEKVLNAQVKIERAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 + +EKVL AQV+IERAIEKALLSDGYSRDELSQRSKRDE R LFYR Sbjct: 109 EEKKEKVLLAQVQIERAIEKALLSDGYSRDELSQRSKRDEIRGFLFYR 156 >gi|388439|gb|AAB27469.1| paired box Pax-3 gene product [chickens, embryo, Peptide Partial, 61 aa, segment 2 of 2] Length = 61 Frame 1 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | | 61 0 20 40 60 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 0.18, P = 0.17 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 15 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 49 >gi|6002393|dbj|BAA84748.1| (AB015750) homeobox protein Rax1/Rx1 [Gallus gallus] Length = 228 Frame 2 hits (HSPs): ___ Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | 228 0 50 100 150 200 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 0.20, Sum P(2) = 0.18 Identities = 13/36 (36%), Positives = 23/36 (63%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 ++ERA EK+ D YSR+EL+ + E R ++++ Sbjct: 50 ELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQ 85 Score = 30 (10.6 bits), Expect = 0.20, Sum P(2) = 0.18 Identities = 5/10 (50%), Positives = 7/10 (70%), Frame = +2 Query: 11 CSGDMVKARK 40 C GD+ + RK Sbjct: 6 CEGDLGELRK 15 >gi|5106930|gb|AAD39893.1|AF107295_1 (AF107295) outer membrane protein [Rattus norvegicus] Length = 206 Frame -1 hits (HSPs): _____ Frame -3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 206 0 50 100 150 200 Minus Strand HSPs: Score = 55 (19.4 bits), Expect = 0.43, Sum P(2) = 0.35 Identities = 10/17 (58%), Positives = 12/17 (70%), Frame = -1 Query: 114 PGIPVGEQSFLNGPFDF 64 PG P GEQS +NG D+ Sbjct: 52 PGFPPGEQSDMNGRVDY 68 Score = 33 (11.6 bits), Expect = 0.43, Sum P(2) = 0.35 Identities = 8/20 (40%), Positives = 8/20 (40%), Frame = -3 Query: 169 GRTTRSFFHLVCSFEKAHPG 110 G RS HL A PG Sbjct: 34 GEAARSLIHLHLRRAPADPG 53 >gi|1633405|pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide >gi|1633406|pdb|1FJL|B Chain B, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide >gi|1633407|pdb|1FJL|C Chain C, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 67 (23.6 bits), Expect = 0.48, P = 0.38 Identities = 13/36 (36%), Positives = 24/36 (66%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 ++ERA E+ D Y+R+EL+QR+ E R ++++ Sbjct: 32 ELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQ 67 >gi|2143469|pir||I52812 gene Pax-3 protein - mouse (fragment) >gi|239201|gb|AAB20359.1| (S66429) Pax-3 [mice, C3H/HeJ, Peptide Partial, 42 aa] [Mus sp.] Length = 42 Frame 1 hits (HSPs): __________________________________ __________________________________________________ Database sequence: | | | | 42 0 20 40 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 1.0, P = 0.63 Identities = 13/28 (46%), Positives = 20/28 (71%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDE 147 ++ERA E+ D Y+R+EL+QR+K E Sbjct: 15 ELERAFERTHYPDIYTREELAQRAKLTE 42 >gi|555819|gb|AAA80574.1| (U12259) paired box homeotic protein [Homo sapiens] Length = 283 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 283 0 50 100 150 200 250 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.0, P = 0.64 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 37 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 71 >gi|2136302|pir||A45452 transcription factor PAX3 - human (fragments) Length = 326 Frame 1 hits (HSPs): ______ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | 326 0 150 300 __________________ Annotated Domains: Entrez domain: homeobox homology #label HOX 67..123 PROSITE HOMEOBOX_1: 'Homeobox' domain signature. 99..122 __________________ Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.2, P = 0.71 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 80 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 114 >gi|2462779|gb|AAB71983.1| (U72659) luteinizing hormone beta subunit [Ceratotherium simum] Length = 135 Frame 2 hits (HSPs): ____ _________ __________________________________________________ Database sequence: | | | | 135 0 50 100 Plus Strand HSPs: Score = 49 (17.2 bits), Expect = 1.2, Sum P(2) = 0.71 Identities = 9/11 (81%), Positives = 9/11 (81%), Frame = +2 Query: 68 SKGPLRKLCSP 100 SKGPLR LC P Sbjct: 15 SKGPLRPLCRP 25 Score = 29 (10.2 bits), Expect = 1.2, Sum P(2) = 0.71 Identities = 7/21 (33%), Positives = 9/21 (42%), Frame = +2 Query: 98 PTGIPGMSFLKGANEMKEGPC 160 P G+ M A + GPC Sbjct: 87 PPGVDPMVSFPVALSCRCGPC 107 >gi|4102797|gb|AAD01589.1| (AF016318) cyclophilin 1 [Dirofilaria immitis] Length = 99 Frame 3 hits (HSPs): ___________ Frame 1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 99 0 20 40 60 80 Plus Strand HSPs: Score = 40 (14.1 bits), Expect = 1.4, Sum P(2) = 0.75 Identities = 9/21 (42%), Positives = 12/21 (57%), Frame = +3 Query: 9 IVRETWSKLGRKSAKRTSQNR 71 + RET SK RKS R + + Sbjct: 36 VTRETGSKQKRKSESRDHRGK 56 Score = 34 (12.0 bits), Expect = 1.4, Sum P(2) = 0.75 Identities = 9/23 (39%), Positives = 14/23 (60%), Frame = +1 Query: 85 KALLSDGY---SRDELSQRSKRD 144 K++ DG SRD + Q +KR+ Sbjct: 64 KSIEEDGKRSTSRDRIDQITKRE 86 >gi|3193075|gb|AAC42641.1| (AF064335) envelope glycoprotein [Human immunodeficiency virus type 2] Length = 106 Frame 3 hits (HSPs): _______ Frame 1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 40 (14.1 bits), Expect = 1.8, Sum P(2) = 0.84 Identities = 9/16 (56%), Positives = 11/16 (68%), Frame = +3 Query: 18 ETWSKLGRKSAKRTSQ 65 ETWS GR++ TSQ Sbjct: 13 ETWSSAGRETT--TSQ 26 Score = 34 (12.0 bits), Expect = 1.8, Sum P(2) = 0.84 Identities = 9/25 (36%), Positives = 11/25 (44%), Frame = +1 Query: 55 AQVKIERAIEKALLSDGYSRDELSQ 129 A + +E IE G RDE Q Sbjct: 50 AGIGLEEVIECQFNMTGLKRDESKQ 74 >gi|6679211 ref|NP_032807.1| paired box gene 3 >gi|129650|sp|P24610|PAX3_MOUSE PAIRED BOX PROTEIN PAX-3 >gi|110793|pir||S15031 paired box transcription factor Pax-3 - mouse >gi|53592|emb|CAA42008.1| (X59358) DNA binding protein [Mus musculus] Length = 479 Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 479 0 150 300 450 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 2.1, P = 0.87 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 233 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 267 >gi|1172022|sp|P23760|PAX3_HUMAN PAIRED BOX PROTEIN PAX-3 (HUP2) Length = 479 Frame 1 hits (HSPs): ____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 479 0 150 300 450 __________________ Annotated Domains: BLOCKS BL00034A: 'Paired box' domain proteins. 34..84 BLOCKS BL00034B: 'Paired box' domain proteins. 88..124 BLOCKS BL00034C: 'Paired box' domain proteins. 129..159 BLOCKS BL00027: 'Homeobox' domain proteins. 234..276 BLOCKS BL00034D: 'Paired box' domain proteins. 347..357 DOMO DM00579: PAIREDBOX 31..126 DOMO DM08778: 'PAIREDBOX'DOMAIN 128..215 DOMO DM00009: HOMEOBOX 217..278 Entrez Domain: PAIRED BOX. 34..159 Entrez dna-binding site: HOMEOBOX. 219..278 Entrez Splicing variant: ASAPQSDEGSDIDSEPDLPL - 196..215 Entrez Splicing variant: MISSING (IN PAX3A). 216..479 Entrez Splicing variant: ASAPQSDEGSD -> GKALVSG 196..206 Entrez Splicing variant: MISSING (IN PAX3B). 207..479 PFAM PAX: 'Paired box' domain 34..159 PFAM homeobox: Homeobox domain 220..276 PRINTS PAIREDBOX1: Paired box motif I - 2 38..53 PRINTS PAIREDBOX2: Paired box motif II - 2 56..74 PRINTS PAIREDBOX3: Paired box motif III - 2 76..93 PRINTS PAIREDBOX4: Paired box motif IV - 2 94..111 PRODOM PD007232: PAX3(2) 1..32 PRODOM PD005124: PAX6(7) PAX2(3) PAX3(2) 34..68 PRODOM PD000643: PAX6(7) PAX2(3) PX8A(2) 70..109 PRODOM PD000685: PAX6(7) PAX2(3) PAX3(2) 112..162 PRODOM PD006608: PAX3(2) 181..217 PRODOM PD000010: HMP1(10) PAX6(7) DLX3(6) 219..276 PRODOM PD007328: PAX3(2) 278..393 PRODOM PD009296: PAX3(2) 395..472 PROSITE HOMEOBOX_1: 'Homeobox' domain signature. 252..275 PROSITE PAIRED_BOX: 'Paired box' domain signatur 68..84 __________________ Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 2.1, P = 0.87 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 233 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 267 >gi|2145076|gb|AAB58415.1| (AF000673) paired-box transcription factor protein [Coturnix coturnix] Length = 479 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 479 0 150 300 450 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 2.1, P = 0.87 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 228 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 262 >gi|2909767|gb|AAC41254.1| (AF014367) transcription factor PAX7A [Danio rerio] Length = 280 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 280 0 50 100 150 200 250 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 2.1, P = 0.88 Identities = 14/35 (40%), Positives = 23/35 (65%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R + Y Sbjct: 234 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVRY 268 >gi|2909765|gb|AAC41253.1| (AF014366) transcription factor PAX3 [Danio rerio] Length = 509 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 509 0 150 300 450 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 2.2, P = 0.89 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 234 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 268 >gi|6539648|gb|AAF15966.1|AF106915_1 (AF106915) luteinizing hormone beta subunit [Phodopus sungorus] Length = 128 Frame 2 hits (HSPs): _____ _________ __________________________________________________ Database sequence: | | | | 128 0 50 100 Plus Strand HSPs: Score = 46 (16.2 bits), Expect = 2.3, Sum P(2) = 0.90 Identities = 8/11 (72%), Positives = 9/11 (81%), Frame = +2 Query: 68 SKGPLRKLCSP 100 S+GPLR LC P Sbjct: 21 SRGPLRPLCRP 31 Score = 29 (10.2 bits), Expect = 2.3, Sum P(2) = 0.90 Identities = 7/21 (33%), Positives = 9/21 (42%), Frame = +2 Query: 98 PTGIPGMSFLKGANEMKEGPC 160 P G+ M A + GPC Sbjct: 93 PPGVDPMVSFPVALSCRCGPC 113 >gi|3193118|gb|AAC42661.1| (AF064358) envelope glycoprotein [Human immunodeficiency virus type 2] Length = 107 Frame 3 hits (HSPs): _______ Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 Plus Strand HSPs: Score = 40 (14.1 bits), Expect = 2.4, Sum P(2) = 0.91 Identities = 9/16 (56%), Positives = 11/16 (68%), Frame = +3 Query: 18 ETWSKLGRKSAKRTSQ 65 ETWS GR++ TSQ Sbjct: 13 ETWSSAGRETT--TSQ 26 Score = 33 (11.6 bits), Expect = 2.4, Sum P(2) = 0.91 Identities = 9/25 (36%), Positives = 11/25 (44%), Frame = +1 Query: 55 AQVKIERAIEKALLSDGYSRDELSQ 129 A + +E IE G RDE Q Sbjct: 50 AGIGLEEMIECQFNMTGLKRDESKQ 74 >gi|126476|sp|P18842|LSHB_CANFA LUTROPIN BETA CHAIN PRECURSOR (LUTEINIZING HORMONE) (LSH-B) (LH-B) >gi|89051|pir||S00512 lutropin beta chain precursor - dog (fragment) >gi|860906|emb|CAA68572.1| (Y00518) LH precursor [Canis familiaris] Length = 138 Frame 2 hits (HSPs): ____ ________ Annotated Domains: _____________________________________ __________________________________________________ Database sequence: | | | | 138 0 50 100 __________________ Annotated Domains: Entrez glycosylation site: PROBABLE. 30 PFAM Cys_knot: Cystine-knot domain 26..110 PROSITE GLYCO_HORMONE_BETA_1: Glycoprotein hormo 51..57 PROSITE GLYCO_HORMONE_BETA_2: Glycoprotein hormo 100..127 __________________ Plus Strand HSPs: Score = 46 (16.2 bits), Expect = 3.0, Sum P(2) = 0.95 Identities = 8/11 (72%), Positives = 9/11 (81%), Frame = +2 Query: 68 SKGPLRKLCSP 100 S+GPLR LC P Sbjct: 18 SRGPLRPLCRP 28 Score = 29 (10.2 bits), Expect = 3.0, Sum P(2) = 0.95 Identities = 7/21 (33%), Positives = 9/21 (42%), Frame = +2 Query: 98 PTGIPGMSFLKGANEMKEGPC 160 P G+ M A + GPC Sbjct: 90 PPGVDPMVSFPVALSCRCGPC 110 >gi|3617823|gb|AAC36048.1| (AF024520) luteinizing hormone beta subunit precursor [Ceratotherium simum] >gi|3617825|gb|AAC36049.1| (AF024521) luteinizing hormone beta subunit precursor [Ceratotherium simum] Length = 141 Frame 2 hits (HSPs): ____ ________ __________________________________________________ Database sequence: | | | | 141 0 50 100 Plus Strand HSPs: Score = 46 (16.2 bits), Expect = 3.2, Sum P(2) = 0.96 Identities = 8/11 (72%), Positives = 9/11 (81%), Frame = +2 Query: 68 SKGPLRKLCSP 100 S+GPLR LC P Sbjct: 21 SRGPLRPLCRP 31 Score = 29 (10.2 bits), Expect = 3.2, Sum P(2) = 0.96 Identities = 7/21 (33%), Positives = 9/21 (42%), Frame = +2 Query: 98 PTGIPGMSFLKGANEMKEGPC 160 P G+ M A + GPC Sbjct: 93 PPGVDPMVSFPVALSCRCGPC 113 >gi|2909773|gb|AAC41257.1| (AF014370) transcription factor PAX7E [Danio rerio] Length = 395 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | 395 0 150 300 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 3.4, P = 0.97 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 234 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 268 >gi|1352721|sp|P47239|PAX7_MOUSE PAIRED BOX PROTEIN PAX-7 >gi|2137624|pir||I49265 Pax7 - mouse (fragment) >gi|736381|gb|AAA64491.1| (U20792) Pax7 [Mus musculus] Length = 290 Frame 1 hits (HSPs): _______ Annotated Domains: ______________________ ___________ __________________________________________________ Database sequence: | | | | | | | 290 0 50 100 150 200 250 __________________ Annotated Domains: Entrez Domain: PAIRED BOX. 1..125 Entrez dna-binding site: HOMEOBOX. 181..240 PFAM PAX: 'Paired box' domain 1..125 PFAM homeobox: Homeobox domain 182..238 PROSITE PAIRED_BOX: 'Paired box' domain signatur 34..50 __________________ Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 3.7, P = 0.97 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 195 ELEKAFERTHYPDIYTREELAQRTKLTEARFQVWF 229 >gi|560583|gb|AAB30807.1| PAX7-FKHR=chimeric transcription factor(FKHR, PAX7) {translocation} [human, alveolar rhabdomyosarcoma patient, Peptide, 420 aa] Length = 420 Frame 1 hits (HSPs): _____ Annotated Domains: ___ ____ __________________________________________________ Database sequence: | | | | 420 0 150 300 __________________ Annotated Domains: PROSITE HOMEOBOX_1: 'Homeobox' domain signature. 223..246 PROSITE PAIRED_BOX: 'Paired box' domain signatur 39..55 __________________ Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 3.7, P = 0.97 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 204 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 238 >gi|3193063|gb|AAC42635.1| (AF064329) envelope glycoprotein [Human immunodeficiency virus type 2] Length = 107 Frame 3 hits (HSPs): _______ Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 Plus Strand HSPs: Score = 40 (14.1 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 9/16 (56%), Positives = 11/16 (68%), Frame = +3 Query: 18 ETWSKLGRKSAKRTSQ 65 ETWS GR++ TSQ Sbjct: 13 ETWSSAGRETT--TSQ 26 Score = 31 (10.9 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 8/25 (32%), Positives = 11/25 (44%), Frame = +1 Query: 55 AQVKIERAIEKALLSDGYSRDELSQ 129 A + +E I+ G RDE Q Sbjct: 50 AGIGLEEMIDCQFNMSGLKRDESKQ 74 >gi|431254|gb|AAC50053.1| (U02368) PAX3 protein-forkhead transcription factor fusion [Homo sapiens] >gi|6636097|gb|AAF20054.1|AF178854_1 (AF178854) Pax3-forkhead fusion protein [synthetic construct] Length = 836 Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | | 836 0 150 300 450 600 750 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 4.0, P = 0.98 Identities = 14/35 (40%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+K E R +++ Sbjct: 233 ELERAFERTHYPDIYTREELAQRAKLTEARVQVWF 267 >gi|6753740 ref|NP_034253.1| eukaryotic translation initiation factor 3 >gi|1083257|pir||S52391 centrosomin B - mouse >gi|671560|emb|CAA59144.1| (X84651) centrosomin B [Mus musculus] Length = 447 Frame 1 hits (HSPs): ___ ____ __________________________________________________ Database sequence: | | | | 447 0 150 300 Plus Strand HSPs: Score = 47 (16.5 bits), Expect = 4.1, Sum P(2) = 0.98 Identities = 10/33 (30%), Positives = 21/33 (63%), Frame = +1 Query: 73 RAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 + E+ L + +SR E +R +++ER+ + +YR Sbjct: 263 KQFEERLAEERHSRLEDRKRQRKEERK-ITYYR 294 Score = 40 (14.1 bits), Expect = 4.1, Sum P(2) = 0.98 Identities = 7/19 (36%), Positives = 13/19 (68%), Frame = +1 Query: 28 QSSEEKVLNAQVKIERAIE 84 Q EE++ Q++ E+A+E Sbjct: 213 QQEEERITTMQLEREKALE 231 >gi|1172023|sp|P23759|PAX7_HUMAN PAIRED BOX PROTEIN PAX-7 (HUP1) >gi|1085403|pir||S50115 transcription factor pax-7 - human (fragment) >gi|602343|emb|CAA84513.1| (Z35141) PAX7 paired box containing transcription factor [Homo sapiens] Length = 467 Frame 1 hits (HSPs): _____ Annotated Domains: __________________ _______________________________ __________________________________________________ Database sequence: | | | | | 467 0 150 300 450 __________________ Annotated Domains: BLOCKS BL00034A: 'Paired box' domain proteins. 34..84 BLOCKS BL00034B: 'Paired box' domain proteins. 88..124 BLOCKS BL00034C: 'Paired box' domain proteins. 129..159 BLOCKS BL00027: 'Homeobox' domain proteins. 232..274 BLOCKS BL00034D: 'Paired box' domain proteins. 383..393 DOMO DM00579: PAIREDBOX 31..145 DOMO DM00009: HOMEOBOX 213..276 Entrez Domain: PAIRED BOX. 34..161 Entrez dna-binding site: HOMEOBOX. 217..276 Entrez Domain: POLY-ALA. 340..346 PFAM PAX: 'Paired box' domain 34..161 PFAM homeobox: Homeobox domain 218..274 PRINTS PAIREDBOX1: Paired box motif I - 2 38..53 PRINTS PAIREDBOX2: Paired box motif II - 2 56..74 PRINTS PAIREDBOX3: Paired box motif III - 2 76..93 PRINTS PAIREDBOX4: Paired box motif IV - 2 94..111 PRODOM PD007232: PAX3(2) 1..32 PRODOM PD005124: PAX6(7) PAX2(3) PAX3(2) 34..68 PRODOM PD000643: PAX6(7) PAX2(3) PX8A(2) 70..107 PRODOM PD000685: PAX6(7) PAX2(3) PAX3(2) 112..164 PRODOM PD006608: PAX3(2) 180..215 PRODOM PD000010: HMP1(10) PAX6(7) DLX3(6) 217..274 PRODOM PD007328: PAX3(2) 276..385 PRODOM PD009296: PAX3(2) 389..466 PROSITE HOMEOBOX_1: 'Homeobox' domain signature. 250..273 PROSITE PAIRED_BOX: 'Paired box' domain signatur 68..84 __________________ Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 4.2, P = 0.99 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 231 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 265 >gi|2909771|gb|AAC41256.1| (AF014369) transcription factor PAX7D [Danio rerio] Length = 487 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 487 0 150 300 450 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 4.4, P = 0.99 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 234 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 268 >gi|7595813|gb|AAF64461.1|AF241311_1 (AF241311) transcription factor PaxD [Acropora millepora] Length = 342 Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 342 0 150 300 Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 4.6, P = 0.99 Identities = 16/51 (31%), Positives = 28/51 (54%), Frame = +1 Query: 19 RHGQSSEEKVLNAQVK-IERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 R + S K +AQ+ +E+A +K D Y+R+EL+ R E R +++ Sbjct: 233 RKQRRSRTKFTHAQLNALEKAFQKTQYPDVYTREELAHRLSLTEARVQVWF 283 >gi|2909769|gb|AAC41255.1| (AF014368) transcription factor PAX7C [Danio rerio] Length = 507 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 507 0 150 300 450 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 4.7, P = 0.99 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 234 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 268 >gi|7524359 ref|NP_039236.1| paired box gene 7, isoform 2; paired domain gene 7 >gi|2570014|emb|CAA65521.1| (X96744) PAX7 [Homo sapiens] Length = 518 Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 518 0 150 300 450 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 4.8, P = 0.99 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 229 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 263 >gi|4505619 ref|NP_002575.1| paired box gene 7, isoform 1; paired domain gene 7 >gi|7446238|pir||S78502 paired box transcription factor PAX7, long splice form - human >gi|2570015|emb|CAA65522.1| (X96744) alternative [Homo sapiens] >gi|2570021|emb|CAA65520.1| (X96743) paired box containing transcription factor [Homo sapiens] >gi|3115988|emb|CAA16432.1| (AL021528) dJ394P21.1 (PAX-7) [Homo sapiens] Length = 520 Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 520 0 150 300 450 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 4.8, P = 0.99 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 231 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 265 >gi|2576239|dbj|BAA23005.1| (D87838) PAX7 protein [Gallus gallus] Length = 524 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 524 0 150 300 450 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 4.9, P = 0.99 Identities = 13/35 (37%), Positives = 24/35 (68%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++E+A E+ D Y+R+EL+QR+K E R +++ Sbjct: 229 ELEKAFERTHYPDIYTREELAQRTKLTEARVQVWF 263 >gi|420441|pir||S31628 MA28L protein - myxoma virus >gi|60612|emb|CAA79662.1| (Z19600) unknown [Myxoma virus] >gi|6523971|gb|AAF15004.1|AF170726_120 (AF170726) m116L [Myxoma virus] Length = 140 Frame -1 hits (HSPs): ___________ Frame -2 hits (HSPs): _______ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 140 0 50 100 __________________ Annotated Domains: DOMO DM03160: SHEEPPOXVIRUSHM3PROTEIN 1..140 __________________ Minus Strand HSPs: Score = 44 (15.5 bits), Expect = 5.4, Sum P(2) = 1.0 Identities = 10/18 (55%), Positives = 12/18 (66%), Frame = -2 Query: 62 TCAFSTFSSEL*PCLPNN 9 T + ST SS L PC+P N Sbjct: 109 TFSTSTHSSILNPCIPPN 126 Score = 29 (10.2 bits), Expect = 5.4, Sum P(2) = 1.0 Identities = 7/29 (24%), Positives = 13/29 (44%), Frame = -1 Query: 150 SFISFAPLRKLIPGIPVGEQSFLNGPFDF 64 S++S + G+ + LNG D+ Sbjct: 80 SYVSLSMFGYKADGVGIRRFRTLNGCIDY 108 >gi|3789862|gb|AAC67524.1| (AF067805) PspGI restriction endonuclease [Pyrococcus sp. GI-H] Length = 272 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 272 0 50 100 150 200 250 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 5.5, P = 1.0 Identities = 13/31 (41%), Positives = 19/31 (61%), Frame = +1 Query: 37 EEKVLNAQVKIERAIEKALLSDGYSRDELSQ 129 EEK + E+ + +A LS GYSR++L Q Sbjct: 60 EEKAFEIYKEYEKQVREAYLSAGYSREKLEQ 90 >gi|7293597|gb|AAF48969.1| (AE003512) CG14202 gene product [Drosophila melanogaster] Length = 112 Frame 1 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | 112 0 50 100 Plus Strand HSPs: Score = 57 (20.1 bits), Expect = 5.6, P = 1.0 Identities = 13/34 (38%), Positives = 21/34 (61%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLF 165 ++E A K+ D Y R+EL++ +K +E R LF Sbjct: 74 ELEAAFAKSHYPDIYCREELARTTKLNEARIQLF 107 >gi|2240026|gb|AAB62325.1| (AF001907) retinal homeobox protein [Danio rerio] Length = 202 Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | || 202 0 50 100 150 200 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 5.7, P = 1.0 Identities = 13/36 (36%), Positives = 23/36 (63%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 ++ERA EK+ D YSR+EL+ + E R ++++ Sbjct: 23 ELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQ 58 >gi|3193042|gb|AAC42626.1| (AF064317) envelope glycoprotein [Human immunodeficiency virus type 2] Length = 107 Frame 3 hits (HSPs): _______ Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 Plus Strand HSPs: Score = 40 (14.1 bits), Expect = 6.0, Sum P(2) = 1.0 Identities = 9/16 (56%), Positives = 11/16 (68%), Frame = +3 Query: 18 ETWSKLGRKSAKRTSQ 65 ETWS GR++ TSQ Sbjct: 13 ETWSSAGRETT--TSQ 26 Score = 29 (10.2 bits), Expect = 6.0, Sum P(2) = 1.0 Identities = 8/25 (32%), Positives = 11/25 (44%), Frame = +1 Query: 55 AQVKIERAIEKALLSDGYSRDELSQ 129 A + +E I+ G RDE Q Sbjct: 50 AGIGLEGMIDCQFNMSGLKRDESKQ 74 >gi|4138292|emb|CAA07775.1| (AJ007939) Rx2 protein [Oryzias latipes] Length = 188 Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | 188 0 50 100 150 Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 6.5, P = 1.0 Identities = 13/36 (36%), Positives = 23/36 (63%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 ++ERA EK+ D YSR+EL+ + E R ++++ Sbjct: 24 ELERAFEKSHYPDVYSREELATKVNLPEVRVQVWFQ 59 >gi|2305107|gb|AAB65697.1| (AF009954) phytoene synthase [Arabidopsis thaliana] Length = 422 Frame 1 hits (HSPs): _____ ___ __________________________________________________ Database sequence: | | | | 422 0 150 300 Plus Strand HSPs: Score = 55 (19.4 bits), Expect = 6.8, Sum P(2) = 1.0 Identities = 14/34 (41%), Positives = 16/34 (47%), Frame = +1 Query: 16 GRHGQSSEEKVLNAQVKIERAIEKALLSDGYSRD 117 G SSEEKV N +K + K L S Y D Sbjct: 79 GEIALSSEEKVYNVVLKQAALVNKQLRSSSYDLD 112 Score = 29 (10.2 bits), Expect = 6.8, Sum P(2) = 1.0 Identities = 6/12 (50%), Positives = 8/12 (66%), Frame = +1 Query: 112 RDELSQRSKRDE 147 +DEL+Q DE Sbjct: 312 QDELAQAGLSDE 323 >gi|585748|sp|P37271|PSY_ARATH PHYTOENE SYNTHASE PRECURSOR >gi|413732|gb|AAA32836.1| (L25812) phytoene synthase [Arabidopsis thaliana] Length = 423 Frame 1 hits (HSPs): _____ ___ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 423 0 150 300 __________________ Annotated Domains: DOMO DM02244: SQUALENEANDPHYTOENESYNTHASES 1..124 DOMO DM00684: SQUALENEANDPHYTOENESYNTHASES 126..414 PFAM SQS_PSY: Squalene and phytoene synthases 140..414 PRODOM PD007377: PSY(5) 4..114 PRODOM PD001082: CRTB(10) FDFT(9) PSY(6) 128..379 PRODOM PD009861: PSY(5) O22375(1) PSY1(1) 381..416 PROSITE SQUALEN_PHYTOEN_SYN_1: Squalene and phyt 251..266 PROSITE SQUALEN_PHYTOEN_SYN_2: Squalene and phyt 287..312 __________________ Plus Strand HSPs: Score = 55 (19.4 bits), Expect = 6.8, Sum P(2) = 1.0 Identities = 14/34 (41%), Positives = 16/34 (47%), Frame = +1 Query: 16 GRHGQSSEEKVLNAQVKIERAIEKALLSDGYSRD 117 G SSEEKV N +K + K L S Y D Sbjct: 79 GEIALSSEEKVYNVVLKQAALVNKQLRSSSYDLD 112 Score = 29 (10.2 bits), Expect = 6.8, Sum P(2) = 1.0 Identities = 6/12 (50%), Positives = 8/12 (66%), Frame = +1 Query: 112 RDELSQRSKRDE 147 +DEL+Q DE Sbjct: 313 QDELAQAGLSDE 324 >gi|4505315 ref|NP_003961.1| myomesin 2; titin-associated protein, 165 kD; M-band protein >gi|1709093|sp|P54296|MYM2_HUMAN MYOMESIN 2 (M-PROTEIN) (165 KD TITIN-ASSOCIATED PROTEIN) (165 KD CONNECTIN-ASSOCIATED PROTEIN) >gi|631048|pir||S43529 165K protein, skeletal muscle - human >gi|407097|emb|CAA48832.1| (X69089) 165kD protein [Homo sapiens] Length = 1465 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 1465 0 500 1000 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 7.4, P = 1.0 Identities = 19/47 (40%), Positives = 25/47 (53%), Frame = +2 Query: 20 DMVKARKKKC*THKSKSKGPLRKLCSPTGIPGMSFLKG-ANEMKEGPC 160 DM+ A + C KS PL+ LC+P GI F+K +EMK C Sbjct: 1222 DMILAMSRVC----GKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWC 1265 >gi|7243783|gb|AAF43449.1|AF239614_1 (AF239614) M-Protein [Homo sapiens] Length = 1465 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 1465 0 500 1000 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 7.4, P = 1.0 Identities = 19/47 (40%), Positives = 25/47 (53%), Frame = +2 Query: 20 DMVKARKKKC*THKSKSKGPLRKLCSPTGIPGMSFLKG-ANEMKEGPC 160 DM+ A + C KS PL+ LC+P GI F+K +EMK C Sbjct: 1222 DMILAMSRVC----GKSASPLKVLCTPEGIRLQCFMKYFTDEMKVNWC 1265 >gi|1743856|gb|AAB39104.1| (U57759) intrageneric coaggregation-relevant adhesin [Streptococcus gordonii] Length = 311 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | | | 311 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 8.6, P = 1.0 Identities = 13/23 (56%), Positives = 17/23 (73%), Frame = +1 Query: 43 KVLNAQVKIERAIEKALLSDGYS 111 +VL Q +IE AIEKA+ +GYS Sbjct: 228 EVLERQAEIEAAIEKAIADNGYS 250 >gi|6319412 ref|NP_009494.1| Ybl059wp >gi|465518|sp|P34224|YBF9_YEAST HYPOTHETICAL 22.3 KD PROTEIN IN SKT5-SHP1 INTERGENIC REGION >gi|542312|pir||S39829 probable membrane protein YBL059w - yeast (Saccharomyces cerevisiae) >gi|313739|emb|CAA80788.1| (Z23261) YBLO516 [Saccharomyces cerevisiae] >gi|602084|emb|CAA84879.1| (Z35820) ORF YBL059w [Saccharomyces cerevisiae] Length = 193 Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | 193 0 50 100 150 Minus Strand HSPs: Score = 60 (21.1 bits), Expect = 8.8, P = 1.0 Identities = 13/28 (46%), Positives = 18/28 (64%), Frame = -3 Query: 157 RSF-FHLVCSFEKAHPGNTRRRAELSQWP 74 RSF +++C E H NTRR+ E+ WP Sbjct: 11 RSFSINVIC--ELKHNVNTRRKFEIKDWP 37 >gi|4519627|dbj|BAA75673.1| (AB017633) Djrax [Dugesia japonica] Length = 268 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | 268 0 50 100 150 200 250 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 8.9, P = 1.0 Identities = 13/36 (36%), Positives = 23/36 (63%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFYR 171 ++ERA EK+ D YSR+EL+ + E R ++++ Sbjct: 101 ELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQ 136 >gi|7496121|pir||T29397 hypothetical protein C16C8.11 - Caenorhabditis elegans >gi|1707098|gb|AAB37853.1| (U80452) weak similarity to ubiquitin [Caenorhabditis elegans] Length = 214 Frame 2 hits (HSPs): _____ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 214 0 50 100 150 200 Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 9.1, Sum P(2) = 1.0 Identities = 9/20 (45%), Positives = 12/20 (60%), Frame = +2 Query: 89 LCSPTGIPGMSFLKGANEMK 148 LC +PG F GAN+M+ Sbjct: 144 LCIAVSMPGRLFSIGANKME 163 Score = 31 (10.9 bits), Expect = 9.1, Sum P(2) = 1.0 Identities = 8/19 (42%), Positives = 11/19 (57%), Frame = +1 Query: 37 EEKVLNAQVKIERAIEKAL 93 E+KV + K R+ E AL Sbjct: 114 EQKVGESSKKSPRSAESAL 132 >gi|7297914|gb|AAF53160.1| (AE003634) prd gene product [Drosophila melanogaster] Length = 590 Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 590 0 150 300 450 Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 9.2, P = 1.0 Identities = 13/35 (37%), Positives = 23/35 (65%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+ E R +++ Sbjct: 204 ELERAFERTQYPDIYTREELAQRTNLTEARIQVWF 238 >gi|123412|sp|P06601|HMPR_DROME SEGMENTATION PROTEIN PAIRED >gi|85138|pir||A26062 paired box segmentation protein prd - fruit fly (Drosophila melanogaster) >gi|158160|gb|AAB59221.1| (M14548) segmentation protein [Drosophila melanogaster] Length = 613 Frame 1 hits (HSPs): ____ Annotated Domains: _______________________ __________________________ __________________________________________________ Database sequence: | | | | | | 613 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00034A: 'Paired box' domain proteins. 27..77 BLOCKS BL00034B: 'Paired box' domain proteins. 81..117 BLOCKS BL00034C: 'Paired box' domain proteins. 121..151 BLOCKS BL00027: 'Homeobox' domain proteins. 228..270 BLOCKS BL00034D: 'Paired box' domain proteins. 594..604 DOMO DM00579: PAIREDBOX 24..139 DOMO DM00009: HOMEOBOX 211..272 Entrez Domain: PAIRED BOX. 27..151 Entrez dna-binding site: HOMEOBOX. 213..272 Entrez Domain: HIS/PRO-RICH REGION. 541..576 PFAM PAX: 'Paired box' domain 27..151 PFAM homeobox: Homeobox domain 214..270 PRINTS PAIREDBOX1: Paired box motif I - 2 31..46 PRINTS PAIREDBOX2: Paired box motif II - 2 49..67 PRINTS PAIREDBOX3: Paired box motif III - 2 69..86 PRINTS PAIREDBOX4: Paired box motif IV - 2 87..104 PRODOM PD062261: HMPR_DROME 1..22 PRODOM PD005124: PAX6(7) PAX2(3) PAX3(2) 24..61 PRODOM PD000643: PAX6(7) PAX2(3) PX8A(2) 63..102 PRODOM PD000685: PAX6(7) PAX2(3) PAX3(2) 104..154 PRODOM PD062278: HMPR_DROME 156..211 PRODOM PD000010: HMP1(10) PAX6(7) DLX3(6) 213..271 PRODOM PD117393: HMPR_DROME 306..541 PRODOM PD050377: HMPR_DROME 565..612 PROSITE HOMEOBOX_1: 'Homeobox' domain signature. 246..269 PROSITE PAIRED_BOX: 'Paired box' domain signatur 61..77 __________________ Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 9.6, P = 1.0 Identities = 13/35 (37%), Positives = 23/35 (65%), Frame = +1 Query: 64 KIERAIEKALLSDGYSRDELSQRSKRDERRTLLFY 168 ++ERA E+ D Y+R+EL+QR+ E R +++ Sbjct: 227 ELERAFERTQYPDIYTREELAQRTNLTEARIQVWF 261 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.98 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.345 0.148 0.466 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.334 0.144 0.494 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.316 0.134 0.348 same same same Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.338 0.153 0.500 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.350 0.148 0.461 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.342 0.147 0.493 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 56 56 10. 57 3 12 22 0.12 29 26 0.11 29 +2 0 56 55 10. 57 3 12 22 0.12 29 26 0.10 29 +1 0 57 56 10. 57 3 12 22 0.11 29 26 0.11 29 -1 0 57 56 10. 57 3 12 22 0.12 29 26 0.11 29 -2 0 56 56 10. 57 3 12 22 0.12 29 26 0.11 29 -3 0 56 56 10. 57 3 12 22 0.12 29 26 0.11 29 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 8:50 PM CDT May 27, 2000 Format: BLAST # of letters in database: 158,518,215 # of sequences in database: 505,245 # of database sequences satisfying E: 50 No. of states in DFA: 560 (55 KB) Total size of DFA: 94 KB (128 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 4 Search cpu time: 78.70u 1.10s 79.80t Elapsed: 00:00:27 Total cpu time: 78.73u 1.19s 79.92t Elapsed: 00:00:27 Start: Wed Feb 14 23:59:53 2001 End: Thu Feb 15 00:00:20 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000