WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'E13F08_L08_12.ab1' (392 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 3 Sequences : less than 3 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 850 174 |========================================================== 6310 676 143 |=============================================== 3980 533 155 |=================================================== 2510 378 140 |============================================== 1580 238 58 |=================== 1000 180 55 |================== 631 125 40 |============= 398 85 24 |======== 251 61 18 |====== 158 43 9 |=== 100 34 2 |: 63.1 32 1 |: 39.8 31 1 |: 25.1 30 1 |: 15.8 29 1 |: >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 28 <<<<<<<<<<<<<<<<< 10.0 28 0 | 6.31 28 1 |: 3.98 27 2 |: 2.51 25 2 |: 1.58 23 4 |= 1.00 19 1 |: 0.63 18 0 | 0.40 18 1 |: 0.25 17 0 | 0.16 17 0 | 0.10 17 0 | 0.063 17 1 |: 0.040 16 0 | 0.025 16 0 | 0.016 16 2 |: 0.010 14 1 |: 0.0063 13 0 | 0.0040 13 4 |= Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|8778208|gb|AAF79217.1|AC006917_2(AC006917) F10B6.3... +2 207 1.4e-15 1 gi|6010773|gb|AAF01248.1|AF187853_1(AF187853) putativ... +2 202 2.9e-15 1 gi|7527721|gb|AAF63170.1|AC010657_6(AC010657) T5E21.1... +2 207 6.9e-15 1 gi|4406780|gb|AAD20090.1|(AC006532) putative endosoma... +2 207 8.1e-15 1 gi|9758717|dbj|BAB09103.1|(AB017069) endosomal protei... +2 201 3.6e-14 1 gi|6562330|emb|CAB62549.1|(AJ249959) multispanning me... +2 139 1.4e-08 1 gi|1931647|gb|AAB65482.1|(U95973) endomembrane protei... +2 114 8.1e-05 1 gi|12321575|gb|AAG50838.1|AC073944_5(AC073944) multis... +2 114 9.0e-05 1 gi|9294023|dbj|BAB01926.1|(AP001307) multispanning me... +2 107 0.00051 1 gi|9755055|gb|AAF98161.1|AF269152_1(AF269152) transme... +2 100 0.0027 1 gi|5453742ref|NP_006396.1| transmembrane 9 superfamil... +2 100 0.0027 1 gi|11433994ref|XP_007305.1| transmembrane 9 superfami... +2 100 0.0027 1 gi|11281523|pir||T50793hypothetical protein T30N20_11... +2 100 0.0029 1 gi|7662028ref|NP_055557.1| KIAA0255 gene product [Hom... +2 95 0.0095 1 gi|4115377|gb|AAD03378.1|(AC005967) putative multispa... +2 95 0.010 1 gi|7018399|emb|CAB75607.1|(AL049539) dJ836N17.2 (KIAA... +2 95 0.012 1 gi|7498641|pir||T32472hypothetical protein F08F1.7 - ... +2 93 0.049 1 gi|7298704|gb|AAF53917.1|(AE003667) CG9318 gene produ... +2 90 0.24 1 gi|7021042|dbj|BAA91362.1|(AK000756) unnamed protein ... +2 86 0.54 1 gi|6650722|gb|AAF21983.1|(AF116347) SM-11044 binding ... +2 86 0.65 1 gi|10047130ref|NP_064508.1| endomembrane protein emp7... +2 86 0.65 1 gi|9755053|gb|AAF98160.1|AF269151_1(AF269151) transme... +2 86 0.65 1 gi|9755051|gb|AAF98159.1|AF269150_1(AF269150) transme... +2 86 0.65 1 gi|7295446|gb|AAF50762.1|(AE003565) CG10590 gene prod... +2 84 0.87 1 gi|7493096|pir||T39285probable transmembrane protein ... +2 84 0.90 1 gi|417434|sp|P32802|EM70_YEASTENDOSOMAL P24A PROTEIN ... +2 83 0.97 1 gi|6323112ref|NP_013184.1| endosomal membrane protein... +2 83 0.97 1 gi|7511376|pir||T28058hypothetical protein ZK858.6 - ... +2 82 0.99 1
Use the and icons to retrieve links to Entrez:
>gi|8778208|gb|AAF79217.1|AC006917_2 (AC006917) F10B6.3 [Arabidopsis thaliana] Length = 336 Frame 2 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 336 0 150 300 Plus Strand HSPs: Score = 207 (72.9 bits), Expect = 1.4e-15, P = 1.4e-15 Identities = 37/39 (94%), Positives = 39/39 (100%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFFGYMACICYGFFLMLG+VGFRA+LLFVRHIYRSIKCE Sbjct: 298 FFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE 336 >gi|6010773|gb|AAF01248.1|AF187853_1 (AF187853) putative multispanning membrane protein [Populus x canescens] Length = 104 Frame 2 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | | | | 104 0 20 40 60 80 100 Plus Strand HSPs: Score = 202 (71.1 bits), Expect = 2.9e-15, P = 2.9e-15 Identities = 35/39 (89%), Positives = 37/39 (94%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFFGYMAC+CYGFFLMLGS+GFRASL FVRHIY SIKCE Sbjct: 66 FFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE 104 >gi|7527721|gb|AAF63170.1|AC010657_6 (AC010657) T5E21.15 [Arabidopsis thaliana] Length = 546 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 546 0 150 300 450 Plus Strand HSPs: Score = 207 (72.9 bits), Expect = 6.9e-15, P = 6.9e-15 Identities = 37/39 (94%), Positives = 39/39 (100%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFFGYMACICYGFFLMLG+VGFRA+LLFVRHIYRSIKCE Sbjct: 508 FFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE 546 >gi|4406780|gb|AAD20090.1| (AC006532) putative endosomal protein [Arabidopsis thaliana] Length = 592 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 592 0 150 300 450 Plus Strand HSPs: Score = 207 (72.9 bits), Expect = 8.1e-15, P = 8.1e-15 Identities = 37/39 (94%), Positives = 39/39 (100%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFFGYMACICYGFFLMLG+VGFRA+LLFVRHIYRSIKCE Sbjct: 554 FFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE 592 >gi|9758717|dbj|BAB09103.1| (AB017069) endosomal protein-like [Arabidopsis thaliana] Length = 593 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 593 0 150 300 450 Plus Strand HSPs: Score = 201 (70.8 bits), Expect = 3.6e-14, P = 3.6e-14 Identities = 36/39 (92%), Positives = 38/39 (97%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFFGYMACICYGFFLMLG++GF ASLLFVRHIYRSIKCE Sbjct: 555 FFFGYMACICYGFFLMLGTIGFCASLLFVRHIYRSIKCE 593 >gi|6562330|emb|CAB62549.1| (AJ249959) multispanning membrane protein 70 [Arabidopsis thaliana] Length = 66 Frame 2 hits (HSPs): ______________________________ __________________________________________________ Database sequence: | | | | | 66 0 20 40 60 Plus Strand HSPs: Score = 139 (48.9 bits), Expect = 1.4e-08, P = 1.4e-08 Identities = 23/39 (58%), Positives = 31/39 (79%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+ GY A +CY FL+LG++ F ASL+F+RHIYRS+K E Sbjct: 28 FYLGYTALLCYALFLVLGTISFLASLMFIRHIYRSVKLE 66 >gi|1931647|gb|AAB65482.1| (U95973) endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis thaliana] Length = 589 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 589 0 150 300 450 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 8.1e-05, P = 8.1e-05 Identities = 20/39 (51%), Positives = 27/39 (69%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+FGY C G ++ G+VG+ S LFVR IYR+IKC+ Sbjct: 551 FYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD 589 >gi|12321575|gb|AAG50838.1|AC073944_5 (AC073944) multispanning membrane protein, putative [Arabidopsis thaliana] Length = 637 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 637 0 150 300 450 600 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 9.0e-05, P = 9.0e-05 Identities = 21/38 (55%), Positives = 27/38 (71%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGYM I Y FF++ GS+GF A L FVR IY S+K + Sbjct: 600 YFGYMIIISYSFFVLTGSIGFYACLWFVRKIYSSVKID 637 >gi|9294023|dbj|BAB01926.1| (AP001307) multispanning membrane protein-like [Arabidopsis thaliana] Length = 641 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 641 0 150 300 450 600 Plus Strand HSPs: Score = 107 (37.7 bits), Expect = 0.00051, P = 0.00051 Identities = 19/38 (50%), Positives = 26/38 (68%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGYM I Y FF++ G++GF A FVR IY S+K + Sbjct: 604 YFGYMIIISYAFFVLTGTIGFYACFWFVRKIYSSVKID 641 >gi|9755055|gb|AAF98161.1|AF269152_1 (AF269152) transmembrane protein TM9SF1 [Mus musculus] Length = 605 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | || 605 0 150 300 450 600 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.0027, P = 0.0027 Identities = 19/38 (50%), Positives = 27/38 (71%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFGY Y FFLMLG++ F +SL F+R+IY ++K + Sbjct: 568 FFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 605 >gi|5453742 ref|NP_006396.1| transmembrane 9 superfamily member 1; multispanning membrane protein (70kD); transmembrane protein 9 superfamily member 1 [Homo sapiens] >gi|2276460|gb|AAC51782.1| (U94831) multispanning membrane protein [Homo sapiens] Length = 606 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | || 606 0 150 300 450 600 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.0027, P = 0.0027 Identities = 19/38 (50%), Positives = 27/38 (71%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFGY Y FFLMLG++ F +SL F+R+IY ++K + Sbjct: 569 FFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606 >gi|11433994 ref|XP_007305.1| transmembrane 9 superfamily member 1 [Homo sapiens] Length = 606 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | || 606 0 150 300 450 600 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.0027, P = 0.0027 Identities = 19/38 (50%), Positives = 27/38 (71%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 FFGY Y FFLMLG++ F +SL F+R+IY ++K + Sbjct: 569 FFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606 >gi|11281523|pir||T50793 hypothetical protein T30N20_110 - Arabidopsis thaliana >gi|8979718|emb|CAB96839.1| (AL365234) putative protein [Arabidopsis thaliana] Length = 639 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 639 0 150 300 450 600 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.0029, P = 0.0029 Identities = 18/38 (47%), Positives = 25/38 (65%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGYM Y FF++ G++GF A L F R IY S+K + Sbjct: 602 YFGYMLIASYAFFVLTGTIGFYACLWFTRLIYSSVKID 639 >gi|7662028 ref|NP_055557.1| KIAA0255 gene product [Homo sapiens] >gi|11420945 ref|XP_009540.1| KIAA0255 gene product [Homo sapiens] >gi|1665777|dbj|BAA13385.1| (D87444) Similar to S.cerevisiae EMP70 protein precursor (S25110) [Homo sapiens] Length = 625 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 625 0 150 300 450 600 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.0096, P = 0.0095 Identities = 16/38 (42%), Positives = 27/38 (71%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGY A + F+L+ G++GF A+ +FVR IY ++K + Sbjct: 588 YFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 625 >gi|4115377|gb|AAD03378.1| (AC005967) putative multispanning membrane protein [Arabidopsis thaliana] Length = 659 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 659 0 150 300 450 600 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.010, P = 0.010 Identities = 17/38 (44%), Positives = 24/38 (63%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGYM + Y FF+ G++GF A F R IY S+K + Sbjct: 622 YFGYMLIVSYVFFVFTGAIGFYACFWFTRLIYSSVKID 659 >gi|7018399|emb|CAB75607.1| (AL049539) dJ836N17.2 (KIAA0255 protein) [Homo sapiens] Length = 780 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | | 780 0 150 300 450 600 750 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.013, P = 0.012 Identities = 16/38 (42%), Positives = 27/38 (71%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGY A + F+L+ G++GF A+ +FVR IY ++K + Sbjct: 743 YFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 780 >gi|7498641|pir||T32472 hypothetical protein F08F1.7 - Caenorhabditis elegans >gi|2435604|gb|AAB71307.1| (AF026213) strong similarity to Saccharomyces cerevisiae endosomal P24A protein (SP:P32802) [Caenorhabditis elegans] Length = 655 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 655 0 150 300 450 600 Plus Strand HSPs: Score = 93 (32.7 bits), Expect = 0.050, P = 0.049 Identities = 17/38 (44%), Positives = 25/38 (65%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +F Y + + FFLM G++GF A+ FVR IY S+K + Sbjct: 618 YFSYTSIFVFMFFLMTGTIGFLATYYFVRKIYGSVKVD 655 >gi|7298704|gb|AAF53917.1| (AE003667) CG9318 gene product [Drosophila melanogaster] Length = 659 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 659 0 150 300 450 600 Plus Strand HSPs: Score = 90 (31.7 bits), Expect = 0.28, P = 0.24 Identities = 16/38 (42%), Positives = 25/38 (65%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGY A + + FFL+ G++GF A F+R IY +K + Sbjct: 622 YFGYTAIMVFLFFLLTGTIGFFACFWFIRKIYSVVKVD 659 >gi|7021042|dbj|BAA91362.1| (AK000756) unnamed protein product [Homo sapiens] Length = 458 Frame 2 hits (HSPs): _____ __________________________________________________ Database sequence: | | | || 458 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 0.77, P = 0.54 Identities = 15/39 (38%), Positives = 24/39 (61%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+FGYMA +M G++G+ + FVR IY ++K + Sbjct: 420 FYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 458 >gi|6650722|gb|AAF21983.1| (AF116347) SM-11044 binding protein [Homo sapiens] Length = 578 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 578 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 1.0, P = 0.65 Identities = 15/39 (38%), Positives = 24/39 (61%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+FGYMA +M G++G+ + FVR IY ++K + Sbjct: 540 FYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 578 >gi|10047130 ref|NP_064508.1| endomembrane protein emp70 precursor isolog [Homo sapiens] >gi|7677068|gb|AAF67014.1|AF160213_1 (AF160213) endomembrane protein emp70 precursor isolog [Homo sapiens] Length = 586 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 586 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 1.1, P = 0.65 Identities = 15/39 (38%), Positives = 24/39 (61%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+FGYMA +M G++G+ + FVR IY ++K + Sbjct: 548 FYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 586 >gi|9755053|gb|AAF98160.1|AF269151_1 (AF269151) transmembrane protein TM9SF3 [Mus musculus] Length = 587 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 587 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 1.1, P = 0.65 Identities = 15/39 (38%), Positives = 24/39 (61%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+FGYMA +M G++G+ + FVR IY ++K + Sbjct: 549 FYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 587 >gi|9755051|gb|AAF98159.1|AF269150_1 (AF269150) transmembrane protein TM9SF3 [Homo sapiens] Length = 589 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 589 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 1.1, P = 0.65 Identities = 15/39 (38%), Positives = 24/39 (61%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+FGYMA +M G++G+ + FVR IY ++K + Sbjct: 551 FYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 589 >gi|7295446|gb|AAF50762.1| (AE003565) CG10590 gene product [Drosophila melanogaster] Length = 567 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 567 0 150 300 450 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 2.0, P = 0.87 Identities = 16/39 (41%), Positives = 25/39 (64%), Frame = +2 Query: 14 FFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 F+FGYMA ++ G+VG+ + LFVR IY ++K + Sbjct: 529 FYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID 567 >gi|7493096|pir||T39285 probable transmembrane protein - fission yeast (Schizosaccharomyces pombe) >gi|5531470|emb|CAB50971.1| (AL096851) putative transmembrane protein [Schizosaccharomyces pombe] Length = 629 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 629 0 150 300 450 600 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 2.3, P = 0.90 Identities = 18/38 (47%), Positives = 22/38 (57%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +FGY I F + GSVGF + LFV IY SIK + Sbjct: 592 YFGYSLLISVLVFFLCGSVGFFGAFLFVNKIYASIKID 629 >gi|417434|sp|P32802|EM70_YEAST ENDOSOMAL P24A PROTEIN PRECURSOR (70 KD ENDOMEMBRANE PROTEIN) (PHEROMONE ALPHA-FACTOR TRANSPORTER) (ACIDIC 24 KD LATE ENDOCYTIC INTERMEDIATE COMPONENT) >gi|3673|emb|CAA47730.1| (X67316) p24a 70 kDa precursor [Saccharomyces cerevisiae] Length = 667 Frame 2 hits (HSPs): ___ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 667 0 150 300 450 600 __________________ Annotated Domains: DOMO DM04755: 1..666 PRODOM PD191871: EM70(1) Q12101(1) 1..31 PRODOM PD005508: EM70(2) Q12101(2) Q04562(2) 33..123 PRODOM PD191872: EM70(1) Q12101(1) 125..152 PRODOM PD025463: EM70(1) Q12101(1) Q04562(1) 154..252 PRODOM PD005508: EM70(2) Q12101(2) Q04562(2) 254..666 __________________ Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 3.4, P = 0.97 Identities = 18/38 (47%), Positives = 25/38 (65%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 + GY + I L+ GS+GF +S+LFVR IY SIK + Sbjct: 630 YVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667 >gi|6323112 ref|NP_013184.1| endosomal membrane protein; Emp70p [Saccharomyces cerevisiae] >gi|2131246|pir||S64915 EMP70 protein precursor - yeast (Saccharomyces cerevisiae) >gi|1256885|gb|AAB67587.1| (U53880) Emp70p: P24A protein [Saccharomyces cerevisiae] >gi|1360449|emb|CAA97643.1| (Z73255) ORF YLR083c [Saccharomyces cerevisiae] Length = 667 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 667 0 150 300 450 600 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 3.4, P = 0.97 Identities = 18/38 (47%), Positives = 25/38 (65%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 + GY + I L+ GS+GF +S+LFVR IY SIK + Sbjct: 630 YVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667 >gi|7511376|pir||T28058 hypothetical protein ZK858.6 - Caenorhabditis elegans >gi|3881856|emb|CAB02141.1| (Z79759) Similarity to Yeast endosomal P24A protein (SW:EM70_YEAST)~cDNA EST CEMSB40F comes from this gene~cDNA EST yk178b7.5 comes from this gene~cDNA EST yk385b5.5 comes from this gene~cDNA EST yk385b5.3 comes from this gene~cDNA EST yk586d5.5 comes > Length = 656 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 656 0 150 300 450 600 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 4.5, P = 0.99 Identities = 15/38 (39%), Positives = 23/38 (60%), Frame = +2 Query: 17 FFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE 130 +F Y + I FF M G++GF AS F+ IY ++K + Sbjct: 619 YFSYSSLIALTFFFMTGTIGFYASHFFLTKIYAAVKID 656 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=6.00 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.352 0.152 0.551 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.351 0.160 0.556 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.367 0.167 0.661 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.355 0.155 0.556 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.335 0.142 0.463 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.358 0.158 0.531 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 130 130 10. 72 3 12 22 0.11 33 29 0.12 35 +2 0 130 130 10. 72 3 12 22 0.11 33 29 0.12 35 +1 0 130 130 10. 72 3 12 22 0.11 33 29 0.12 35 -1 0 130 130 10. 72 3 12 22 0.11 33 29 0.12 35 -2 0 130 130 10. 72 3 12 22 0.11 33 29 0.12 35 -3 0 130 130 10. 72 3 12 22 0.11 33 29 0.12 35 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 28 No. of states in DFA: 593 (58 KB) Total size of DFA: 167 KB (192 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 128.12u 1.01s 129.13t Elapsed: 00:00:22 Total cpu time: 128.15u 1.05s 129.20t Elapsed: 00:00:22 Start: Wed Jan 23 18:27:40 2002 End: Wed Jan 23 18:28:02 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000