Q9D285 - (Q9D285) Adult male colon cDNA, RIKEN full-length enriched library, clone:9030215D04, full insert sequence || Number of peptides = 4 || ambiguous || 99.6% Confident
MPK2_MOUSE - (Q63932) Dual specificity mitogen-activated protein kinase kinase 2 (EC 2.7.1.-) (MAP kinase kinase 2) (MAPKK 2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK2) || Number of peptides = 1 || ambiguous || 99.6% Confident
NDKB_MOUSE - (Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18) || Number of peptides = 18 || unambiguous || 99.6% Confident
PNPH_MOUSE - (P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) || Number of peptides = 3 || unambiguous || 99.6% Confident
O88543 - (O88543) COP9 complex subunit 3 || Number of peptides = 5 || ambiguous || 99.6% Confident
KPY2_MOUSE - (P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) || Number of peptides = 45 || unambiguous || 99.6% Confident
Q9D1A2 - (Q9D1A2) 0610010E05Rik protein (RIKEN cDNA 0610010E05 gene) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9DCZ7 - (Q9DCZ7) WD40 protein Ciao1 || Number of peptides = 2 || ambiguous || 99.6% Confident
FETA_MOUSE - (P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) || Number of peptides = 45 || unambiguous || 99.6% Confident
SPCO_MOUSE - (Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) || Number of peptides = 8 || unambiguous || 99.6% Confident
6PGD_MOUSE - (Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) || Number of peptides = 7 || ambiguous || 99.6% Confident
2AAA_HUMAN - (P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) || Number of peptides = 4 || ambiguous || 99.6% Confident
UBCI_HUMAN - (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) || Number of peptides = 4 || ambiguous || 99.6% Confident
RAC1_HUMAN - (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) || Number of peptides = 5 || ambiguous || 99.6% Confident
ITH2_MOUSE - (Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) || Number of peptides = 13 || unambiguous || 99.6% Confident
NPM_MOUSE - (Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9D9F9 - (Q9D9F9) C330027I04Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
SM30_MOUSE - (Q64374) Senescence marker protein-30 (SMP-30) (Regucalcin) (RC) || Number of peptides = 2 || unambiguous || 99.6% Confident
MK01_MOUSE - (P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) || Number of peptides = 4 || ambiguous || 99.6% Confident
IF5A_HUMAN - (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) || Number of peptides = 26 || ambiguous || 99.6% Confident
Q9CZ44 - (Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence || Number of peptides = 6 || unambiguous || 99.6% Confident
SBP2_MOUSE - (Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56) || Number of peptides = 17 || unambiguous || 99.6% Confident
Q9CVB6 - (Q9CVB6) 2210023N03Rik protein (Fragment) || Number of peptides = 6 || ambiguous || 99.6% Confident
YB1_MOUSE - (P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) || Number of peptides = 17 || ambiguous || 99.6% Confident
HBE_MOUSE - (P02104) Hemoglobin epsilon-Y2 chain || Number of peptides = 5 || ambiguous || 99.6% Confident
ACLY_MOUSE - (Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) || Number of peptides = 15 || unambiguous || 99.6% Confident
DPY2_MOUSE - (O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) || Number of peptides = 26 || unambiguous || 99.6% Confident
HS74_MOUSE - (Q61316) Heat shock 70-related protein APG-2 || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9DBR1 - (Q9DBR1) 5'-3' exoribonuclease 2 || Number of peptides = 3 || ambiguous || 99.6% Confident
PUR8_MOUSE - (P54822) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylosuccinase) (ASL) (ASASE) || Number of peptides = 5 || unambiguous || 99.6% Confident
SODC_MOUSE - (P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) || Number of peptides = 7 || unambiguous || 99.6% Confident
PL10_MOUSE - (P16381) Putative ATP-dependent RNA helicase PL10 || Number of peptides = 7 || unambiguous || 99.6% Confident
143E_HUMAN - (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) || Number of peptides = 10 || ambiguous || 99.6% Confident
Q9D819 - (Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene) || Number of peptides = 5 || ambiguous || 99.6% Confident
O88738 - (O88738) Ubiquitin-conjugating enzyme || Number of peptides = 6 || unambiguous || 99.6% Confident
CALM_HUMAN - (P02593) Calmodulin (P02593) Calmodulin || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9D8S9 - (Q9D8S9) 1810037G04Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
NDR2_MOUSE - (Q9QYG0) NDRG2 protein (Ndr2 protein) || Number of peptides = 2 || unambiguous || 99.6% Confident
LIS1_MOUSE - (P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) || Number of peptides = 4 || ambiguous || 99.6% Confident
GCAA_MOUSE - (P01863) Ig gamma-2A chain C region, A allele || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9D910 - (Q9D910) 1810013B01Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
IDI1_MOUSE - (P58044) Isopentenyl-diphosphate delta-isomerase 1 (EC 5.3.3.2) (IPP isomerase 1) (Isopentenyl pyrophosphate isomerase 1) (IPPI1) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q920C7 - (Q920C7) CDV-3B (Pp36) (Carnitine deficiency-associated protein CDV3B) || Number of peptides = 4 || ambiguous || 99.6% Confident
MLEN_MOUSE - (Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q99LJ3 - (Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q91WK2 - (Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD) || Number of peptides = 4 || unambiguous || 99.6% Confident
SBP1_MOUSE - (P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56) || Number of peptides = 28 || unambiguous || 99.6% Confident
S142_MOUSE - (Q99J08) SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) || Number of peptides = 7 || unambiguous || 99.6% Confident
MDHC_MOUSE - (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) || Number of peptides = 11 || unambiguous || 99.6% Confident
CLP2_MOUSE - (Q08093) Calponin H2, smooth muscle || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9DAB4 - (Q9DAB4) 1700015E05Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
SAHH_MOUSE - (P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9D0A9 - (Q9D0A9) 2610030F17Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
CAZ1_MOUSE - (P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment) || Number of peptides = 5 || ambiguous || 99.6% Confident
BIN1_MOUSE - (O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) || Number of peptides = 4 || ambiguous || 99.6% Confident
LDHB_MOUSE - (P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H) || Number of peptides = 5 || ambiguous || 99.6% Confident
PSD8_MOUSE - (Q9CX56) 26S proteasome non-ATPase regulatory subunit 8 (26S proteasome regulatory subunit S14) || Number of peptides = 2 || ambiguous || 99.6% Confident
PDX1_MOUSE - (P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) || Number of peptides = 15 || unambiguous || 99.6% Confident
IDE_HUMAN - (P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 5 || unambiguous || 99.6% Confident
U2AF_MOUSE - (P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) || Number of peptides = 4 || ambiguous || 99.6% Confident
BAG3_MOUSE - (Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q99PC3 - (Q99PC3) CGI-74-like SR-rich protein || Number of peptides = 3 || ambiguous || 99.6% Confident
Q8VEH5 - (Q8VEH5) Similar to KIAA0766 gene product || Number of peptides = 6 || unambiguous || 99.6% Confident
PEPD_MOUSE - (Q11136) Xaa-Pro dipeptidase (EC 3.4.13.9) (X-Pro dipeptidase) (Proline dipeptidase) (Prolidase) (Imidodipeptidase) (Peptidase 4) || Number of peptides = 3 || unambiguous || 99.6% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 46 || unambiguous || 99.6% Confident
ST13_MOUSE - (Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) || Number of peptides = 10 || unambiguous || 99.6% Confident
Y076_HUMAN - (Q14999) Hypothetical protein KIAA0076 (HA0936) || Number of peptides = 7 || unambiguous || 99.6% Confident
RL26_HUMAN - (Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26 || Number of peptides = 18 || ambiguous || 99.6% Confident
FAS_MOUSE - (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) || Number of peptides = 20 || ambiguous || 99.6% Confident
Q9CR86 - (Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) || Number of peptides = 6 || ambiguous || 99.6% Confident
CAP1_MOUSE - (P40124) Adenylyl cyclase-associated protein 1 (CAP 1) || Number of peptides = 10 || unambiguous || 99.6% Confident
RBB9_MOUSE - (O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
PTB_MOUSE - (P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) || Number of peptides = 3 || ambiguous || 99.6% Confident
TBA1_HUMAN - (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) || Number of peptides = 69 || ambiguous || 99.6% Confident
Q9JM65 - (Q9JM65) Nonclathrin coat protein epsilon-COP (Coatomer protein complex, subunit epsilon) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9D1P4 - (Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9QWJ7 - (Q9QWJ7) Non-erythrocyte beta spectrin || Number of peptides = 2 || ambiguous || 99.6% Confident
RNT1_MOUSE - (Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) || Number of peptides = 5 || ambiguous || 99.6% Confident
TCPE_MOUSE - (P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) || Number of peptides = 8 || unambiguous || 99.6% Confident
PGK1_MOUSE - (P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) || Number of peptides = 23 || ambiguous || 99.6% Confident
PGK1_HUMAN - (P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) || Number of peptides = 2 || unambiguous || 99.6% Confident
UBA1_MOUSE - (Q02053) Ubiquitin-activating enzyme E1 1 || Number of peptides = 26 || unambiguous || 99.6% Confident
ENOB_HUMAN - (P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) || Number of peptides = 5 || unambiguous || 99.6% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 49 || unambiguous || 99.6% Confident
GR78_MOUSE - (P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) || Number of peptides = 6 || ambiguous || 99.6% Confident
GBLP_HUMAN - (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) || Number of peptides = 5 || ambiguous || 99.6% Confident
RS15_HUMAN - (P11174) 40S ribosomal protein S15 (RIG protein) (P11174) 40S ribosomal protein S15 (RIG protein) || Number of peptides = 8 || ambiguous || 99.6% Confident
UBC7_HUMAN - (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9Z2L7 - (Q9Z2L7) Cytokine receptor related protein 4 || Number of peptides = 3 || ambiguous || 99.6% Confident
Q923D8 - (Q923D8) Similar to Rho GTPase activating protein 1 || Number of peptides = 3 || unambiguous || 99.6% Confident
A1T1_MOUSE - (P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 3 || ambiguous || 99.6% Confident
KPYR_MOUSE - (P53657) Pyruvate kinase, isozymes R/L (EC 2.7.1.40) (L-PK) || Number of peptides = 2 || unambiguous || 99.6% Confident
DPP3_MOUSE - (Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) || Number of peptides = 5 || unambiguous || 99.6% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 113 || unambiguous || 99.6% Confident
DYHC_MOUSE - (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) || Number of peptides = 26 || unambiguous || 99.6% Confident
ANX2_MOUSE - (P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV) || Number of peptides = 5 || unambiguous || 99.6% Confident
PDX4_MOUSE - (O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) || Number of peptides = 5 || ambiguous || 99.6% Confident
MTPN_MOUSE - (P80144) Myotrophin (V-1 protein) (Granule cell differentiation protein) || Number of peptides = 4 || ambiguous || 99.6% Confident
PAB1_MOUSE - (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1) || Number of peptides = 4 || unambiguous || 99.6% Confident
COF1_MOUSE - (P18760) Cofilin, non-muscle isoform || Number of peptides = 10 || unambiguous || 99.6% Confident
Q99K86 - (Q99K86) Lutheran blood group (Auberger b antigen included) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9DCF2 - (Q9DCF2) 0610039H12Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q99K88 - (Q99K88) Hypothetical 38.1 kDa protein || Number of peptides = 10 || ambiguous || 99.6% Confident
Q99KY3 - (Q99KY3) Hypothetical 45.0 kDa protein (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
ACTZ_HUMAN - (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) || Number of peptides = 2 || ambiguous || 99.6% Confident
TALI_MOUSE - (P26039) Talin || Number of peptides = 31 || unambiguous || 99.6% Confident
GDIC_MOUSE - (Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) || Number of peptides = 11 || ambiguous || 99.6% Confident
NIBL_MOUSE - (Q8R1F1) Niban-like protein || Number of peptides = 6 || unambiguous || 99.6% Confident
ARP2_HUMAN - (O15142) Actin-like protein 2 (Actin-related protein 2) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 58 || unambiguous || 99.6% Confident
AAC2_MOUSE - (Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) || Number of peptides = 10 || ambiguous || 99.6% Confident
Q9QXD8 - (Q9QXD8) LIM domains containing protein 1 || Number of peptides = 3 || unambiguous || 99.6% Confident
MCM7_MOUSE - (Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) || Number of peptides = 7 || unambiguous || 99.6% Confident
TAGL_MOUSE - (P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9DAJ6 - (Q9DAJ6) 1500026J17Rik protein || Number of peptides = 6 || ambiguous || 99.6% Confident
IQG1_MOUSE - (Q9JKF1) Ras GTPase-activating-like protein IQGAP1 || Number of peptides = 15 || unambiguous || 99.6% Confident
Q9JJU6 - (Q9JJU6) B-Raf protein (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
PDL1_MOUSE - (O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) || Number of peptides = 5 || ambiguous || 99.6% Confident
PUA2_MOUSE - (P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase) || Number of peptides = 3 || unambiguous || 99.6% Confident
GTP1_MOUSE - (P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) || Number of peptides = 6 || unambiguous || 99.6% Confident
MYG1_MOUSE - (Q9JK81) MYG1 protein (Gamm1 protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 11 || unambiguous || 99.6% Confident
NTF2_HUMAN - (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) || Number of peptides = 5 || ambiguous || 99.6% Confident
DEST_MOUSE - (Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) || Number of peptides = 12 || unambiguous || 99.6% Confident
RL3_MOUSE - (P27659) 60S ribosomal protein L3 (J1 protein) || Number of peptides = 7 || unambiguous || 99.6% Confident
GDIR_MOUSE - (Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) || Number of peptides = 11 || ambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 49 || unambiguous || 99.6% Confident
NED4_MOUSE - (P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9D8J6 - (Q9D8J6) 1810073G14Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
RS7_HUMAN - (P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9EST5 - (Q9EST5) Proliferation related acidic leucine rich protein PAL31 (Similar to acidic protein rich in leucines) || Number of peptides = 2 || unambiguous || 99.6% Confident
PRS4_HUMAN - (Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q91ZP1 - (Q91ZP1) Fibrinogen B-beta-chain (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
HNT1_MOUSE - (P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) || Number of peptides = 5 || unambiguous || 99.6% Confident
TSN_MOUSE - (Q62348) Translin || Number of peptides = 10 || ambiguous || 99.6% Confident
Q99KS1 - (Q99KS1) Hypothetical 16.5 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9CTV9 - (Q9CTV9) 5830475I06Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9DCS7 - (Q9DCS7) 0610011D08Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
PAK2_HUMAN - (Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9Z1R2 - (Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) || Number of peptides = 3 || unambiguous || 99.6% Confident
P97825 - (P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) || Number of peptides = 8 || unambiguous || 99.6% Confident
LDHA_MOUSE - (P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) || Number of peptides = 18 || unambiguous || 99.6% Confident
Q9D1L0 - (Q9D1L0) Ethanol induced 6 || Number of peptides = 1 || unambiguous || 99.6% Confident
PDA4_MOUSE - (P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) || Number of peptides = 11 || unambiguous || 99.6% Confident
KINH_MOUSE - (Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) || Number of peptides = 12 || unambiguous || 99.6% Confident
VIME_MOUSE - (P20152) Vimentin || Number of peptides = 13 || unambiguous || 99.6% Confident
UBP5_MOUSE - (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9DAS8 - (Q9DAS8) 1600029N02Rik protein || Number of peptides = 6 || unambiguous || 99.6% Confident
IF2A_HUMAN - (P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 15 || ambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 35 || ambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 195 || unambiguous || 99.6% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 41 || ambiguous || 99.6% Confident
Q8R1K5 - (Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9DBY6 - (Q9DBY6) 1200009K13Rik protein || Number of peptides = 7 || ambiguous || 99.6% Confident
PCB2_MOUSE - (Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) || Number of peptides = 3 || ambiguous || 99.6% Confident
RHOA_MOUSE - (Q9QUI0) Transforming protein RhoA || Number of peptides = 4 || ambiguous || 99.6% Confident
Q8VCM7 - (Q8VCM7) Similar to fibrinogen, gamma polypeptide || Number of peptides = 11 || ambiguous || 99.6% Confident
Q91WT7 - (Q91WT7) Hypothetical 37.2 kDa protein (Expressed sequence AW557061) || Number of peptides = 5 || unambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 72 || ambiguous || 99.6% Confident
PYRG_MOUSE - (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CRK7 - (Q9CRK7) 9430095H01Rik protein (Fragment) || Number of peptides = 6 || ambiguous || 99.6% Confident
APA4_MOUSE - (P06728) Apolipoprotein A-IV precursor (Apo-AIV) || Number of peptides = 6 || unambiguous || 99.6% Confident
G6PI_MOUSE - (P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) || Number of peptides = 16 || unambiguous || 99.6% Confident
DVL2_MOUSE - (Q60838) Segment polarity protein dishevelled homolog DVL-2 (Dishevelled-2) (DSH homolog 2) || Number of peptides = 3 || unambiguous || 99.6% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 12 || ambiguous || 99.6% Confident
TERA_MOUSE - (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] || Number of peptides = 26 || ambiguous || 99.6% Confident
Q8VI52 - (Q8VI52) Endophilin B1b || Number of peptides = 2 || ambiguous || 99.6% Confident
CLH1_HUMAN - (Q00610) Clathrin heavy chain 1 (CLH-17) || Number of peptides = 25 || unambiguous || 99.6% Confident
CDC2_MOUSE - (P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) || Number of peptides = 2 || ambiguous || 99.6% Confident
CRP1_MOUSE - (P04006) Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP) || Number of peptides = 4 || unambiguous || 99.6% Confident
FAAA_MOUSE - (P35505) Fumarylacetoacetase (EC 3.7.1.2) (Fumarylacetoacetate hydrolase) (Beta-diketonase) (FAA) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9UEV9 - (Q9UEV9) Actin-binding protein homolog ABP-278 || Number of peptides = 10 || ambiguous || 99.6% Confident
LKHA_MOUSE - (P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 17 || unambiguous || 99.6% Confident
Q91Y37 - (Q91Y37) Cytosolic aminopeptidase P || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9Z1F9 - (Q9Z1F9) ARX || Number of peptides = 7 || unambiguous || 99.6% Confident
Q8R2X0 - (Q8R2X0) Similar to EH-domain containing 2 || Number of peptides = 4 || unambiguous || 99.6% Confident
ARF1_HUMAN - (P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 || Number of peptides = 3 || ambiguous || 99.6% Confident
RO60_MOUSE - (O08848) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP) || Number of peptides = 7 || unambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 17 || ambiguous || 99.6% Confident
Q920Q6 - (Q920Q6) RNA-binding protein Musashi2-L || Number of peptides = 4 || ambiguous || 99.6% Confident
Q8VCI5 - (Q8VCI5) Peroxisomal farnesylated protein || Number of peptides = 1 || unambiguous || 99.6% Confident
RANG_MOUSE - (P34022) Ran-specific GTPase-activating protein (Ran binding protein 1) (RANBP1) || Number of peptides = 4 || ambiguous || 99.6% Confident
PDX2_MOUSE - (Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) || Number of peptides = 5 || unambiguous || 99.6% Confident
CYPB_MOUSE - (P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) || Number of peptides = 4 || ambiguous || 99.6% Confident
O35499 - (O35499) Nuclear autoantigenic sperm protein || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CQR6 - (Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit) || Number of peptides = 1 || ambiguous || 99.6% Confident
TBCA_MOUSE - (P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A) || Number of peptides = 2 || unambiguous || 99.6% Confident
TPIS_MOUSE - (P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) || Number of peptides = 8 || unambiguous || 99.6% Confident
ENOA_MOUSE - (P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) || Number of peptides = 38 || unambiguous || 99.6% Confident
P2CG_MOUSE - (Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9JKR6 - (Q9JKR6) 170 kDa glucose regulated protein GRP170 precursor || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9D892 - (Q9D892) 2010016I08Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
RL28_MOUSE - (P41105) 60S ribosomal protein L28 || Number of peptides = 1 || ambiguous || 99.6% Confident
RS3_MOUSE - (P17073) 40S ribosomal protein S3 || Number of peptides = 7 || ambiguous || 99.6% Confident
FKB3_MOUSE - (Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) || Number of peptides = 6 || unambiguous || 99.6% Confident
CCT1_MOUSE - (Q9QWV9) Cyclin T1 (Cyclin T) (CycT1) || Number of peptides = 5 || unambiguous || 99.6% Confident
TKT_MOUSE - (P40142) Transketolase (EC 2.2.1.1) (TK) (P68) || Number of peptides = 41 || unambiguous || 99.6% Confident
Q60817 - (Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q91YJ2 - (Q91YJ2) Similar to sorting nexin 4 || Number of peptides = 2 || unambiguous || 99.6% Confident
ANX6_MOUSE - (P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II) || Number of peptides = 15 || unambiguous || 99.6% Confident
AMP2_MOUSE - (O08663) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2) (Peptidase M 2) (Initiation factor 2 associated 67 kDa glycoprotein) (p67) (p67eIF2) || Number of peptides = 2 || ambiguous || 99.6% Confident
CRTC_MOUSE - (P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) || Number of peptides = 14 || ambiguous || 99.6% Confident
P97315 - (P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) || Number of peptides = 9 || ambiguous || 99.6% Confident
ACF7_MOUSE - (Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) || Number of peptides = 26 || unambiguous || 99.6% Confident
Q99LE7 - (Q99LE7) Similar to paxillin (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 8 || unambiguous || 99.6% Confident
PRS6_MOUSE - (P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21) || Number of peptides = 8 || unambiguous || 99.6% Confident
DYNA_MOUSE - (O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) || Number of peptides = 10 || unambiguous || 99.6% Confident
THIO_MOUSE - (P10639) Thioredoxin (ATL-derived factor) (ADF) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9D3T6 - (Q9D3T6) 4933436C10Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9CWE4 - (Q9CWE4) 2410153K17Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D6E6 - (Q9D6E6) 2900073G15Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
HS9B_MOUSE - (P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) || Number of peptides = 35 || ambiguous || 99.6% Confident
ACBP_MOUSE - (P31786) Acyl-CoA-binding protein (ACBP) (Diazepam binding inhibitor) (DBI) (Endozepine) (EP) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9QZ83 - (Q9QZ83) Gamma actin-like protein || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9Z1K1 - (Q9Z1K1) HS1 binding protein 3 || Number of peptides = 3 || unambiguous || 99.6% Confident
PCB1_HUMAN - (Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) || Number of peptides = 3 || unambiguous || 99.6% Confident
MAP4_MOUSE - (P27546) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 7 || unambiguous || 99.6% Confident
PPCE_MOUSE - (Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) || Number of peptides = 18 || unambiguous || 99.6% Confident
ENPL_MOUSE - (P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) || Number of peptides = 8 || unambiguous || 99.6% Confident
GYS1_MOUSE - (Q9Z1E4) Glycogen [starch] synthase, muscle (EC 2.4.1.11) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q8R1H0 - (Q8R1H0) Hypothetical 8.3 kDa protein || Number of peptides = 7 || unambiguous || 99.6% Confident
RAN_HUMAN - (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) || Number of peptides = 12 || ambiguous || 99.6% Confident
RL30_HUMAN - (P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CV45 - (Q9CV45) 2310038O07Rik protein (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
AOP2_MOUSE - (O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) || Number of peptides = 4 || unambiguous || 99.6% Confident
O55181 - (O55181) RBP associated molecule RAM14-1 || Number of peptides = 25 || unambiguous || 99.6% Confident
SMD3_HUMAN - (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) || Number of peptides = 3 || ambiguous || 99.6% Confident
VINC_MOUSE - (Q64727) Vinculin (Metavinculin) || Number of peptides = 6 || ambiguous || 99.6% Confident
RL5_MOUSE - (P47962) 60S ribosomal protein L5 || Number of peptides = 8 || ambiguous || 99.6% Confident
Q9JII6 - (Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase) || Number of peptides = 13 || unambiguous || 99.6% Confident
IF41_HUMAN - (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) || Number of peptides = 5 || ambiguous || 99.6% Confident
A2HS_MOUSE - (P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) || Number of peptides = 19 || unambiguous || 99.6% Confident
LDHL_HUMAN - (Q9BYZ2) L-lactate dehydrogenase A-like (EC 1.1.1.27) || Number of peptides = 3 || unambiguous || 99.6% Confident
PSD7_MOUSE - (P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) || Number of peptides = 5 || ambiguous || 99.6% Confident
PSB2_MOUSE - (Q9R1P3) Proteasome subunit beta type 2 (EC 3.4.25.1) (Proteasome component C7-I) (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9DCA3 - (Q9DCA3) RAN binding protein 1 || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9CQL8 - (Q9CQL8) 1500001M02Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
COPB_MOUSE - (Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9CQM9 - (Q9CQM9) Thioredoxin-like 2 || Number of peptides = 8 || unambiguous || 99.6% Confident
PMG1_MOUSE - (Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) || Number of peptides = 36 || ambiguous || 99.6% Confident
HBB2_MOUSE - (P02089) Hemoglobin beta-2 chain (B2) (Minor) || Number of peptides = 13 || unambiguous || 99.6% Confident
KCRB_MOUSE - (Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) || Number of peptides = 8 || unambiguous || 99.6% Confident
ICAL_MOUSE - (P51125) Calpain inhibitor (Calpastatin) || Number of peptides = 13 || unambiguous || 99.6% Confident
PSA7_MOUSE - (Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9DCT8 - (Q9DCT8) 0610010I23Rik protein (Cysteine-rich protein 2) || Number of peptides = 5 || unambiguous || 99.6% Confident
SERA_MOUSE - (Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
SPCN_HUMAN - (Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) || Number of peptides = 7 || unambiguous || 99.6% Confident
O88544 - (O88544) COP9 complex subunit 4 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 4) (ARABIDOPSIS) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9JJH0 - (Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase || Number of peptides = 8 || ambiguous || 99.6% Confident
Q8R016 - (Q8R016) Similar to bleomycin hydrolase || Number of peptides = 10 || unambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 52 || ambiguous || 99.6% Confident
KC21_MOUSE - (Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37) || Number of peptides = 7 || ambiguous || 99.6% Confident
PSA6_MOUSE - (Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) || Number of peptides = 6 || ambiguous || 99.6% Confident
GSHC_MOUSE - (P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase) || Number of peptides = 6 || unambiguous || 99.6% Confident
HS9A_MOUSE - (P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) || Number of peptides = 66 || unambiguous || 99.6% Confident
EZRI_MOUSE - (P26040) Ezrin (p81) (Cytovillin) (Villin 2) || Number of peptides = 24 || ambiguous || 99.6% Confident
PSA3_MOUSE - (O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) || Number of peptides = 4 || ambiguous || 99.6% Confident
TCPY_MOUSE - (Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) || Number of peptides = 4 || unambiguous || 99.6% Confident
FKB4_MOUSE - (P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9CPS1 - (Q9CPS1) 2510002C21Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
SEP2_MOUSE - (P42208) Septin 2 (NEDD5 protein) || Number of peptides = 6 || ambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 129 || unambiguous || 99.6% Confident
WDR1_MOUSE - (O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) || Number of peptides = 9 || unambiguous || 99.6% Confident
FLNA_HUMAN - (P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) || Number of peptides = 21 || unambiguous || 99.6% Confident
Q91VM9 - (Q91VM9) Similar to pyrophosphatase (Inorganic) || Number of peptides = 1 || unambiguous || 99.6% Confident
RL12_MOUSE - (P35979) 60S ribosomal protein L12 || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9CW64 - (Q9CW64) 1200003G01Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
ADHA_MOUSE - (P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) || Number of peptides = 35 || unambiguous || 99.6% Confident
ALDR_MOUSE - (P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) || Number of peptides = 18 || ambiguous || 99.6% Confident
FKB1_MOUSE - (P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 14 || ambiguous || 99.6% Confident
ALFA_MOUSE - (P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) || Number of peptides = 20 || unambiguous || 99.6% Confident
TF1B_MOUSE - (Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) || Number of peptides = 19 || unambiguous || 99.6% Confident
PA1B_HUMAN - (Q29459) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) || Number of peptides = 2 || unambiguous || 99.6% Confident
FUMH_MOUSE - (P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9JK31 - (Q9JK31) ATFa-associated factor || Number of peptides = 3 || unambiguous || 99.6% Confident
PE15_MOUSE - (Q62048) Astrocytic phosphoprotein PEA-15 || Number of peptides = 6 || ambiguous || 99.6% Confident
Q8VDM6 - (Q8VDM6) Similar to E1B-55 kDa-associated protein 5 || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9QYB1 - (Q9QYB1) Intracellular chloride channel protein || Number of peptides = 4 || ambiguous || 99.6% Confident
HBD_HUMAN - (P02042) Hemoglobin delta chain || Number of peptides = 18 || unambiguous || 99.6% Confident
MCM3_MOUSE - (P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) || Number of peptides = 16 || unambiguous || 99.6% Confident
CAH2_MOUSE - (P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) || Number of peptides = 21 || ambiguous || 99.6% Confident
PEBP_MOUSE - (P70296) Phosphatidylethanolamine-binding protein (PEBP) || Number of peptides = 8 || unambiguous || 99.6% Confident
P137_MOUSE - (Q60865) GPI-anchored protein p137 (p137GPI) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CQ99 - (Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) || Number of peptides = 2 || unambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 38 || ambiguous || 99.6% Confident
Q9CVT3 - (Q9CVT3) 1700037H04Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9D7P7 - (Q9D7P7) 2300003G24Rik protein || Number of peptides = 5 || unambiguous || 99.6% Confident
PLSL_MOUSE - (Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65) || Number of peptides = 8 || unambiguous || 99.6% Confident
RL7_MOUSE - (P14148) 60S ribosomal protein L7 || Number of peptides = 13 || ambiguous || 99.6% Confident
Q9Z0P5 - (Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9EQR0 - (Q9EQR0) Fatty acid synthase || Number of peptides = 32 || unambiguous || 99.6% Confident
Q9CQ60 - (Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9Z1Y4 - (Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) || Number of peptides = 3 || unambiguous || 99.6% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 19 || unambiguous || 99.6% Confident
RS20_HUMAN - (P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 || Number of peptides = 1 || ambiguous || 99.6% Confident
HGD_MOUSE - (O09173) Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) || Number of peptides = 2 || unambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 83 || ambiguous || 99.6% Confident
TRM3_MOUSE - (Q9R1R2) Tripartite motif protein 3 (RING finger protein 22) (RING finger protein HAC1) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q91YZ8 - (Q91YZ8) Hypothetical 67.9 kDa protein || Number of peptides = 3 || unambiguous || 99.6% Confident
TCPZ_MOUSE - (P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) || Number of peptides = 4 || unambiguous || 99.6% Confident
BHMT_MOUSE - (O35490) Betaine--homocysteine S-methyltransferase (EC 2.1.1.5) || Number of peptides = 4 || unambiguous || 99.6% Confident
AAC1_HUMAN - (P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein) || Number of peptides = 11 || ambiguous || 99.6% Confident
RCN1_MOUSE - (Q05186) Reticulocalbin 1 precursor || Number of peptides = 1 || ambiguous || 99.6% Confident
Q8VDD5 - (Q8VDD5) Nonmuscle heavy chain myosin II-A || Number of peptides = 17 || unambiguous || 99.6% Confident
GRBA_MOUSE - (Q60760) Growth factor receptor-bound protein 10 (GRB10 adaptor protein) || Number of peptides = 3 || ambiguous || 99.6% Confident
DHSO_MOUSE - (Q64442) Sorbitol dehydrogenase (EC 1.1.1.14) (L-iditol 2-dehydrogenase) (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
NDR3_MOUSE - (Q9QYF9) NDRG3 protein (Ndr3 protein) || Number of peptides = 5 || unambiguous || 99.6% Confident
NDR1_MOUSE - (Q62433) NDRG1 protein (N-myc downstream regulated gene 1 protein) (Protein Ndr1) || Number of peptides = 3 || unambiguous || 99.6% Confident
LA_MOUSE - (P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) || Number of peptides = 4 || ambiguous || 99.6% Confident
TRFE_MOUSE - (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) || Number of peptides = 64 || unambiguous || 99.6% Confident
Q9WTQ5 - (Q9WTQ5) SSECKS (PKC binding protein SSECKS) || Number of peptides = 2 || unambiguous || 99.6% Confident
TRXB_MOUSE - (Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9DCL8 - (Q9DCL8) 0610025N14Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 93 || ambiguous || 99.6% Confident
S23A_HUMAN - (Q15436) Protein transport protein Sec23A (SEC23-related protein A) || Number of peptides = 4 || unambiguous || 99.6% Confident
HBAZ_MOUSE - (P06467) Hemoglobin zeta chain || Number of peptides = 9 || unambiguous || 99.6% Confident
MCA1_MOUSE - (P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9ERD3 - (Q9ERD3) Telokin || Number of peptides = 4 || unambiguous || 99.6% Confident
Q99K30 - (Q99K30) Similar to hypothetical protein FLJ21935 || Number of peptides = 5 || unambiguous || 99.6% Confident
ARF4_MOUSE - (P36403) ADP-ribosylation factor 4 || Number of peptides = 2 || unambiguous || 99.6% Confident
Q99K35 - (Q99K35) Similar to hypothetical protein LOC57333 (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
SAD1_MOUSE - (Q60710) SAM domain and HD domain-containing protein 1 (Interferon-gamma inducible protein Mg11) || Number of peptides = 5 || unambiguous || 99.6% Confident
LEG3_MOUSE - (P16110) Galectin-3 (Galactose-specific lectin 3) (MAC-2 antigen) (IgE-binding protein) (35 kDa lectin) (Carbohydrate binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-34 galactoside-binding lectin) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CVL3 - (Q9CVL3) 1810024J13Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q8VC30 - (Q8VC30) Similar to DKFZP586B1621 protein || Number of peptides = 4 || unambiguous || 99.6% Confident
SYD_MOUSE - (Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) || Number of peptides = 4 || ambiguous || 99.6% Confident
TES_MOUSE - (P47226) Testin (TES1/TES2) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CSP7 - (Q9CSP7) 2700017M01Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q91VJ3 - (Q91VJ3) Similar to Adenosin kinase || Number of peptides = 4 || unambiguous || 99.5% Confident
RL15_MOUSE - (Q9CZM2) 60S ribosomal protein L15 || Number of peptides = 13 || unambiguous || 99.5% Confident
AAC4_MOUSE - (P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) || Number of peptides = 25 || unambiguous || 99.5% Confident
Q922D8 - (Q922D8) Similar to C1-tetrahydrofolate synthase || Number of peptides = 17 || unambiguous || 99.5% Confident
CALU_MOUSE - (O35887) Calumenin precursor || Number of peptides = 6 || ambiguous || 99.5% Confident
GTA4_MOUSE - (P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4) || Number of peptides = 6 || unambiguous || 99.5% Confident
DP30_MOUSE - (Q99LT0) Dpy-30-like protein || Number of peptides = 2 || ambiguous || 99.5% Confident
Q93052 - (Q93052) LIPOMA PREFERRED partner (LPP) || Number of peptides = 3 || unambiguous || 99.5% Confident
GFA1_MOUSE - (P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) || Number of peptides = 4 || unambiguous || 99.5% Confident
PYR5_MOUSE - (P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] || Number of peptides = 2 || unambiguous || 99.5% Confident
ARR1_HUMAN - (P49407) Beta-arrestin 1 (Arrestin, beta 1) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q8R3G1 - (Q8R3G1) Similar to protein phosphatase 1, regulatory (Inhibitor) subunit 8 || Number of peptides = 3 || unambiguous || 99.4% Confident
RS23_HUMAN - (P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23 || Number of peptides = 8 || ambiguous || 99.4% Confident
ILK_MOUSE - (O55222) Integrin-linked protein kinase (EC 2.7.1.-) || Number of peptides = 6 || ambiguous || 99.4% Confident
FABE_MOUSE - (Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) || Number of peptides = 7 || unambiguous || 99.4% Confident
O35945 - (O35945) Aldehyde dehydrogenase Ahd-2-like || Number of peptides = 4 || unambiguous || 99.4% Confident
SYS_MOUSE - (P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) || Number of peptides = 5 || unambiguous || 99.4% Confident
G3PT_HUMAN - (O14556) Putative glyceraldehyde 3-phosphate dehydrogenase, testis-specific (EC 1.2.1.12) (GAPDH-2) || Number of peptides = 1 || unambiguous || 99.4% Confident
Q9CSH0 - (Q9CSH0) 2810036L13Rik protein (Fragment) || Number of peptides = 7 || ambiguous || 99.4% Confident
PRS8_HUMAN - (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) || Number of peptides = 8 || ambiguous || 99.4% Confident
Q91ZJ5 - (Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2 || Number of peptides = 4 || unambiguous || 99.4% Confident
RL2A_MOUSE - (P14115) 60S ribosomal protein L27a (L29) || Number of peptides = 10 || ambiguous || 99.4% Confident
SPS1_HUMAN - (P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1) || Number of peptides = 3 || ambiguous || 99.4% Confident
Q91Y38 - (Q91Y38) UDP-N-acetylglucosaminyltransferase || Number of peptides = 4 || ambiguous || 99.4% Confident
VAA1_MOUSE - (P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) || Number of peptides = 6 || unambiguous || 99.4% Confident
Q9CWI4 - (Q9CWI4) Esterase 10 || Number of peptides = 2 || ambiguous || 99.4% Confident
Q9CPS0 - (Q9CPS0) Sorbitol dehydrogenase 1 || Number of peptides = 2 || unambiguous || 99.4% Confident
Q9CXZ2 - (Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence || Number of peptides = 12 || ambiguous || 99.4% Confident
Q9CV31 - (Q9CV31) 2310014J01Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 99.4% Confident
SPCB_MOUSE - (P15508) Spectrin beta chain, erythrocyte (Beta-I spectrin) || Number of peptides = 6 || unambiguous || 99.4% Confident
ALFA_HUMAN - (P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1) || Number of peptides = 7 || unambiguous || 99.4% Confident
ASSY_MOUSE - (P16460) Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) || Number of peptides = 10 || unambiguous || 99.4% Confident
Q9CRY5 - (Q9CRY5) 3010001M15Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 99.4% Confident
Q9DC49 - (Q9DC49) Repeat family 3 gene || Number of peptides = 1 || ambiguous || 99.4% Confident
Q99J10 - (Q99J10) Hypothetical 43.8 kDa protein || Number of peptides = 1 || unambiguous || 99.4% Confident
ANX4_MOUSE - (P97429) Annexin A4 (Annexin IV) || Number of peptides = 5 || ambiguous || 99.4% Confident
O55201 - (O55201) Chromatin structural protein homolog Supt5hp (Similar to suppressor of Ty (S.cerevisiae) 5 homolog) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9CT10 - (Q9CT10) 2610024N24Rik protein (Fragment) || Number of peptides = 6 || unambiguous || 99.4% Confident
O35737 - (O35737) Heterogeneous nuclear ribonucleoprotein H || Number of peptides = 5 || ambiguous || 99.4% Confident
RBB4_MOUSE - (Q60972) Chromatin assembly factor 1 subunit C (CAF-1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF-I 48 kDa subunit) (CAF-Ip48) (Retinoblastoma binding protein p48) (Retinoblastoma-binding protein 4) (RBBP-4) || Number of peptides = 2 || ambiguous || 99.4% Confident
Q96A90 - (Q96A90) G6b-C protein precursor || Number of peptides = 3 || unambiguous || 99.4% Confident
MCM2_MOUSE - (P97310) DNA replication licensing factor MCM2 || Number of peptides = 6 || unambiguous || 99.4% Confident
O70140 - (O70140) Calcyclin binding protein (Fragment) || Number of peptides = 5 || unambiguous || 99.4% Confident
Q9EPX1 - (Q9EPX1) Thimet oligopeptidase (EC 3.4.24.15) || Number of peptides = 1 || unambiguous || 99.4% Confident
Q9CZB7 - (Q9CZB7) Protein kinase, interferon inducible double stranded RNA dependent activator || Number of peptides = 2 || ambiguous || 99.4% Confident
O08795 - (O08795) Alpha glucosidase II, beta subunit || Number of peptides = 2 || ambiguous || 99.4% Confident
Q924X9 - (Q924X9) Type II cAMP-dependent protein kinase anchoring protein Ht31 (Fragment) || Number of peptides = 4 || unambiguous || 99.4% Confident
SYG_MOUSE - (Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) || Number of peptides = 7 || unambiguous || 99.4% Confident
Q91YL6 - (Q91YL6) Hypothetical 34.0 kDa protein || Number of peptides = 4 || unambiguous || 99.4% Confident
SNXC_MOUSE - (O70493) Sorting nexin 12 (SDP8 protein) || Number of peptides = 4 || ambiguous || 99.4% Confident
Q99PG2 - (Q99PG2) Opioid growth factor receptor || Number of peptides = 1 || ambiguous || 99.4% Confident
TAL1_MOUSE - (Q93092) Transaldolase (EC 2.2.1.2) || Number of peptides = 7 || unambiguous || 99.3% Confident
PPI2_MOUSE - (P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) || Number of peptides = 7 || ambiguous || 99.3% Confident
RS4_HUMAN - (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) || Number of peptides = 14 || ambiguous || 99.3% Confident
RL7A_MOUSE - (P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) || Number of peptides = 13 || ambiguous || 99.3% Confident
CAN2_MOUSE - (O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80) || Number of peptides = 11 || unambiguous || 99.3% Confident
Q9CXT4 - (Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence || Number of peptides = 12 || ambiguous || 99.3% Confident
PDX5_MOUSE - (P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) || Number of peptides = 16 || ambiguous || 99.3% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 3 || unambiguous || 99.3% Confident
APA1_MOUSE - (Q00623) Apolipoprotein A-I precursor (Apo-AI) || Number of peptides = 9 || unambiguous || 99.3% Confident
DAG1_MOUSE - (Q62165) Dystroglycan precursor (Dystrophin-associated glycoprotein 1) [Contains: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)] || Number of peptides = 2 || ambiguous || 99.3% Confident
GTT1_MOUSE - (Q64471) Glutathione S-transferase theta 1 (EC 2.5.1.18) (GST class-theta) || Number of peptides = 5 || unambiguous || 99.3% Confident
PSE1_MOUSE - (P97371) Proteasome activator complex subunit 1 (Proteasome activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) || Number of peptides = 2 || ambiguous || 99.3% Confident
EF1G_MOUSE - (Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) || Number of peptides = 8 || ambiguous || 99.3% Confident
Q9DCC4 - (Q9DCC4) 1110058B13Rik protein || Number of peptides = 3 || ambiguous || 99.3% Confident
CO3_MOUSE - (P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] || Number of peptides = 11 || unambiguous || 99.2% Confident
Q8TE44 - (Q8TE44) WIRE protein || Number of peptides = 2 || unambiguous || 99.2% Confident
Q9Y6Y8 - (Q9Y6Y8) Phospholipase || Number of peptides = 3 || unambiguous || 99.1% Confident
PHS2_MOUSE - (Q9WUB3) Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) || Number of peptides = 3 || unambiguous || 99.1% Confident
S108_MOUSE - (P27005) Calgranulin A (Migration inhibitory factor-related protein 8) (MRP-8) (P8) (Leukocyte L1 complex light chain) (Chemotactic cytokine CP-10) (PRO-inflammatory S100 cytokine) || Number of peptides = 4 || unambiguous || 99.1% Confident
ARS1_MOUSE - (O54984) Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) || Number of peptides = 3 || ambiguous || 99.1% Confident
Q91V31 - (Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence) || Number of peptides = 3 || ambiguous || 99.1% Confident
TAG2_MOUSE - (Q9WVA4) Transgelin 2 || Number of peptides = 3 || ambiguous || 99.1% Confident
Q8R2Y6 - (Q8R2Y6) Hypothetical 35.4 kDa protein || Number of peptides = 5 || ambiguous || 99.1% Confident
Q921M5 - (Q921M5) Unknown (Protein for IMAGE:3597757) (Fragment) || Number of peptides = 2 || unambiguous || 99.1% Confident
TCTP_MOUSE - (P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein) || Number of peptides = 3 || unambiguous || 99.1% Confident
PHS3_HUMAN - (P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) || Number of peptides = 8 || unambiguous || 99.1% Confident
Q9Z1A1 - (Q9Z1A1) TFG protein (Trk-fused gene) || Number of peptides = 4 || unambiguous || 99.1% Confident
IMD2_MOUSE - (P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) || Number of peptides = 9 || ambiguous || 99.1% Confident
TCPD_MOUSE - (P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) || Number of peptides = 4 || unambiguous || 99.1% Confident
O00301 - (O00301) KSRP || Number of peptides = 8 || unambiguous || 99.1% Confident
Q9CR16 - (Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) || Number of peptides = 5 || unambiguous || 99.1% Confident
SNX3_MOUSE - (O70492) Sorting nexin 3 (SDP3 protein) || Number of peptides = 3 || ambiguous || 99.1% Confident
Q8VDP4 - (Q8VDP4) Hypothetical 112.5 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 99.1% Confident
RL1X_MOUSE - (P11249) 60S ribosomal protein L18a || Number of peptides = 6 || ambiguous || 99.1% Confident
GUAA_HUMAN - (P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase) || Number of peptides = 8 || unambiguous || 99.1% Confident
Q9ET11 - (Q9ET11) PIST || Number of peptides = 3 || unambiguous || 99.1% Confident
ACDL_MOUSE - (P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD) || Number of peptides = 1 || unambiguous || 99.1% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 4 || ambiguous || 99.1% Confident
PHS1_MOUSE - (Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) || Number of peptides = 12 || unambiguous || 99.1% Confident
Q8R5F2 - (Q8R5F2) Hypothetical 31.3 kDa protein || Number of peptides = 1 || ambiguous || 99.1% Confident
CAZ2_MOUSE - (P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) || Number of peptides = 3 || ambiguous || 99.1% Confident
NDKA_MOUSE - (P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) || Number of peptides = 5 || unambiguous || 99.1% Confident
K2C1_HUMAN - (P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) || Number of peptides = 7 || unambiguous || 99.1% Confident
PRSX_HUMAN - (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) || Number of peptides = 13 || ambiguous || 99.1% Confident
C61A_MOUSE - (P46737) C6.1A protein || Number of peptides = 4 || ambiguous || 99.1% Confident
Q8VCN5 - (Q8VCN5) Hypothetical 43.6 kDa protein || Number of peptides = 2 || unambiguous || 99.1% Confident
PIMT_MOUSE - (P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) || Number of peptides = 8 || unambiguous || 99.1% Confident
FCL_MOUSE - (P23591) GDP-fucose synthetase (FX protein) (Red cell NADP(H)-binding protein) (Transplantation antigen P35B) (Tum-P35B antigen) [Includes: GDP-mannose-4-keto-6-D epimerase (EC 5.1.3.-); GDP-4-keto-6-L-galactose reductase (EC 1.-.-.-)] || Number of peptides = 2 || unambiguous || 99.1% Confident
SEP7_MOUSE - (O55131) Septin 7 (CDC10 protein homolog) || Number of peptides = 3 || ambiguous || 99.0% Confident
Q91YR5 - (Q91YR5) Hypothetical 78.8 kDa protein || Number of peptides = 2 || unambiguous || 99.0% Confident
GTM2_MOUSE - (P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5) || Number of peptides = 6 || unambiguous || 99.0% Confident
PPI1_MOUSE - (P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) || Number of peptides = 5 || unambiguous || 99.0% Confident
Q9JHU9 - (Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1) || Number of peptides = 1 || unambiguous || 98.9% Confident
Q62189 - (Q62189) Small nuclear RNA (Small nuclear ribonucleoprotein polypeptide A) || Number of peptides = 2 || unambiguous || 98.9% Confident
Q921J0 - (Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) || Number of peptides = 2 || ambiguous || 98.9% Confident
UNRI_MOUSE - (Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) || Number of peptides = 4 || unambiguous || 98.9% Confident
Q9CQX8 - (Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) || Number of peptides = 1 || unambiguous || 98.9% Confident
PUR9_MOUSE - (Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] || Number of peptides = 10 || unambiguous || 98.8% Confident
SPH2_MOUSE - (Q9JIA7) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2) || Number of peptides = 2 || unambiguous || 98.8% Confident
COPP_MOUSE - (O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) || Number of peptides = 6 || ambiguous || 98.7% Confident
DHCA_MOUSE - (P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) || Number of peptides = 3 || unambiguous || 98.7% Confident
O54988 - (O54988) Serine/threonine protein kinase || Number of peptides = 7 || unambiguous || 98.6% Confident
DD15_MOUSE - (O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15) || Number of peptides = 3 || ambiguous || 98.6% Confident
Q8R3E6 - (Q8R3E6) Similar to chromosome 14 open reading frame 3 || Number of peptides = 1 || unambiguous || 98.6% Confident
Q9H845 - (Q9H845) Hypothetical protein FLJ13950 || Number of peptides = 6 || unambiguous || 98.6% Confident
PRO1_MOUSE - (P10924) Profilin I || Number of peptides = 10 || unambiguous || 98.6% Confident
ENOB_MOUSE - (P21550) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (Enolase 3) || Number of peptides = 2 || ambiguous || 98.6% Confident
Q99J36 - (Q99J36) Similar to hypothetical protein FLJ20274 || Number of peptides = 3 || unambiguous || 98.6% Confident
Q91WQ3 - (Q91WQ3) Similar to tyrosyl-tRNA synthetase (Hypothetical 59.1 kDa protein) (Expressed sequence AL024047) || Number of peptides = 4 || ambiguous || 98.6% Confident
Q921G5 - (Q921G5) Similar to methyltransferase-like 1 (S. cerevisiae) || Number of peptides = 1 || ambiguous || 98.6% Confident
O95752 - (O95752) Chromosome-associated polypeptide-C || Number of peptides = 3 || unambiguous || 98.6% Confident
RPIA_MOUSE - (P47968) Ribose 5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase) || Number of peptides = 1 || unambiguous || 98.6% Confident
Q61123 - (Q61123) MEM3 || Number of peptides = 11 || unambiguous || 98.6% Confident
RADI_MOUSE - (P26043) Radixin || Number of peptides = 7 || ambiguous || 98.6% Confident
UBL3_MOUSE - (Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3) || Number of peptides = 3 || unambiguous || 98.6% Confident
Q9R0P2 - (Q9R0P2) KIAA312p (Fragment) || Number of peptides = 3 || ambiguous || 98.6% Confident
RL19_HUMAN - (P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19 || Number of peptides = 8 || ambiguous || 98.6% Confident
Q924D2 - (Q924D2) Myosin light chain kinase (Fragment) || Number of peptides = 8 || unambiguous || 98.6% Confident
MCM4_MOUSE - (P49717) DNA replication licensing factor MCM4 (CDC21 homolog) (P1-CDC21) || Number of peptides = 8 || unambiguous || 98.6% Confident
G25B_HUMAN - (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) || Number of peptides = 4 || ambiguous || 98.6% Confident
TPM1_MOUSE - (P58771) Tropomyosin 1 alpha chain (Alpha-tropomyosin) || Number of peptides = 4 || ambiguous || 98.5% Confident
GTM1_MOUSE - (P10649) Glutathione S-transferase Mu 1 (EC 2.5.1.18) (GST class-mu 1) (Glutathione S-transferase GT8.7) (pmGT10) (GST 1-1) || Number of peptides = 9 || unambiguous || 98.4% Confident
ASNS_MOUSE - (Q61024) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Glutamine-dependent asparagine synthetase) || Number of peptides = 10 || unambiguous || 98.4% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 6 || ambiguous || 98.4% Confident
CATA_MOUSE - (P24270) Catalase (EC 1.11.1.6) || Number of peptides = 5 || unambiguous || 98.3% Confident
Q9JHJ3 - (Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) || Number of peptides = 14 || unambiguous || 98.2% Confident
Q91XC8 - (Q91XC8) Similar to death-associated protein (Hypothetical 11.2 kDa protein) || Number of peptides = 5 || ambiguous || 98.2% Confident
MKK2_MOUSE - (P49138) MAP kinase-activated protein kinase 2 (EC 2.7.1.-) (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAPK-2) (Fragment) || Number of peptides = 2 || ambiguous || 98.2% Confident
NEMO_MOUSE - (O88522) NF-kappaB essential modulator (NEMO) (NF-kappaB essential modifier) (Inhibitor of nuclear factor kappa-B kinase gamma subunit) (IkB kinase gamma subunit) (I-kappa-B kinase gamma) (IKK-gamma) (IKKG) (IkB kinase-associated protein 1) (IKKAP1) (mFIP-3) || Number of peptides = 1 || unambiguous || 98.2% Confident
Q9BY13 - (Q9BY13) Golgi-associated microtubule-binding protein HOOK3 || Number of peptides = 1 || unambiguous || 98.2% Confident
U186_MOUSE - (Q923D4) Hypothetical protein MGC11596 || Number of peptides = 1 || ambiguous || 98.2% Confident
R13A_MOUSE - (P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen) || Number of peptides = 10 || unambiguous || 98.2% Confident
RGSA_MOUSE - (Q9CQE5) Regulator of G-protein signaling 10 (RGS10) || Number of peptides = 1 || unambiguous || 98.1% Confident
COTR_MOUSE - (P07759) Contrapsin precursor || Number of peptides = 4 || ambiguous || 98.1% Confident
P2AA_MOUSE - (P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) || Number of peptides = 3 || ambiguous || 98.1% Confident
Q9HC82 - (Q9HC82) Rb-associated protein || Number of peptides = 3 || ambiguous || 98.1% Confident
Q8VHA6 - (Q8VHA6) SOCS box protein ASB-18 || Number of peptides = 7 || unambiguous || 98.1% Confident
LGUL_MOUSE - (Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) || Number of peptides = 4 || ambiguous || 98.1% Confident
Q923D2 - (Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein) || Number of peptides = 1 || ambiguous || 98.0% Confident
KNG_MOUSE - (O08677) Kininogen precursor [Contains: Bradykinin] || Number of peptides = 5 || unambiguous || 98.0% Confident
PPS1_MOUSE - (Q60967) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1 (PAPS synthethase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (Sulfate adenylate transferase) (SAT) (ATP-sulfurylase); Adenylylsulfate kinase (EC 2.7.1.25) (Adenylylsulfate 3'-phosphotransferase) (APS kinase) (Adenosine-5'-phosphosulfate 3'-phosphotransferase) (3'-phosphoadenosine-5'-phosphosulfate synthetase)] || Number of peptides = 6 || ambiguous || 98.0% Confident
MOES_MOUSE - (P26041) Moesin (Membrane-organizing extension spike protein) || Number of peptides = 6 || ambiguous || 98.0% Confident
HBA_HUMAN - (P01922) Hemoglobin alpha chain || Number of peptides = 6 || unambiguous || 97.9% Confident
RAGE_MOUSE - (Q62151) Advanced glycosylation end product-specific receptor precursor (Receptor for advanced glycosylation end products) || Number of peptides = 10 || unambiguous || 97.9% Confident
Q9DBL4 - (Q9DBL4) 1300003M23Rik protein || Number of peptides = 5 || unambiguous || 97.9% Confident
AMPL_MOUSE - (Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) || Number of peptides = 5 || ambiguous || 97.9% Confident
GLYG_MOUSE - (Q9R062) Glycogenin-1 (EC 2.4.1.186) || Number of peptides = 10 || unambiguous || 97.9% Confident
GYG2_HUMAN - (O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) || Number of peptides = 7 || unambiguous || 97.9% Confident
ERF_MOUSE - (P70459) ETS-domain transcription factor ERF || Number of peptides = 3 || unambiguous || 97.9% Confident
IDE_MOUSE - (Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 8 || unambiguous || 97.9% Confident
Q8R3Q6 - (Q8R3Q6) Similar to CG15881 gene product (H. sapiens) || Number of peptides = 1 || unambiguous || 97.8% Confident
Q96MZ8 - (Q96MZ8) Hypothetical protein FLJ31638 || Number of peptides = 13 || ambiguous || 97.8% Confident
CLI1_MOUSE - (Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) || Number of peptides = 7 || ambiguous || 97.8% Confident
Q8R0Y6 - (Q8R0Y6) Similar to 10-formyltetrahydrofolate dehydrogenase || Number of peptides = 4 || unambiguous || 97.8% Confident
CATB_MOUSE - (P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) || Number of peptides = 1 || unambiguous || 97.8% Confident
Q9WTL7 - (Q9WTL7) Lysophospholipase II (Lysophospholipase 2) || Number of peptides = 3 || ambiguous || 97.8% Confident
Q61482 - (Q61482) CDE1-binding protein CDEBP || Number of peptides = 2 || unambiguous || 97.8% Confident
RS8_HUMAN - (P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8 || Number of peptides = 6 || ambiguous || 97.7% Confident
Q62418 - (Q62418) Drebrin-like SH3 domain-containing protein SH3P7 || Number of peptides = 3 || unambiguous || 97.6% Confident
K6PL_MOUSE - (P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) || Number of peptides = 10 || unambiguous || 97.5% Confident
NPL1_MOUSE - (P28656) Nucleosome assembly protein 1-like 1 (NAP-1 related protein) (Brain protein DN38) || Number of peptides = 10 || ambiguous || 97.5% Confident
SRC8_MOUSE - (Q60598) Src substrate cortactin || Number of peptides = 3 || unambiguous || 97.5% Confident
K6A1_MOUSE - (P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) || Number of peptides = 5 || unambiguous || 97.5% Confident
SERC_MOUSE - (Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) || Number of peptides = 7 || unambiguous || 97.4% Confident
MGN_HUMAN - (P50606) Mago nashi protein homolog (P50606) Mago nashi protein homolog || Number of peptides = 2 || ambiguous || 97.3% Confident
SNX1_HUMAN - (Q13596) Sorting nexin 1 || Number of peptides = 2 || unambiguous || 97.3% Confident
143G_HUMAN - (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 2 || ambiguous || 97.3% Confident
ILK1_HUMAN - (Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) || Number of peptides = 2 || ambiguous || 97.2% Confident
Q9CWR9 - (Q9CWR9) 2410006O11Rik protein || Number of peptides = 1 || ambiguous || 97.2% Confident
PTPA_MOUSE - (P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) || Number of peptides = 5 || unambiguous || 97.2% Confident
SZ15_MOUSE - (Q9WVL7) Small inducible cytokine B15 precursor (CXCL15) (Lungkine) || Number of peptides = 1 || unambiguous || 97.2% Confident
Q9JM14 - (Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C) || Number of peptides = 1 || ambiguous || 97.2% Confident
O08794 - (O08794) Alpha glucosidase II, alpha subunit || Number of peptides = 6 || unambiguous || 97.2% Confident
PSA_MOUSE - (Q11011) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA) || Number of peptides = 5 || unambiguous || 97.2% Confident
CDK4_MOUSE - (P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) || Number of peptides = 5 || unambiguous || 97.1% Confident
Q9EPF1 - (Q9EPF1) L-gicerin/MUC18 || Number of peptides = 3 || unambiguous || 97.1% Confident
Q91V41 - (Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) || Number of peptides = 3 || ambiguous || 97.1% Confident
PRSA_MOUSE - (O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1) || Number of peptides = 6 || unambiguous || 97.0% Confident
Q9DC14 - (Q9DC14) 1200007H22Rik protein || Number of peptides = 2 || ambiguous || 97.0% Confident
CRKL_MOUSE - (P47941) Crk-like protein || Number of peptides = 1 || ambiguous || 97.0% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 5 || ambiguous || 97.0% Confident
Q8R001 - (Q8R001) Similar to microtubule-associated protein, RP/EB family, member 2 (Hypothetical 36.9 kDa protein) || Number of peptides = 3 || ambiguous || 96.9% Confident
GDIB_MOUSE - (P50397) Rab GDP dissociation inhibitor beta (Rab GDI beta) (GDI-2) || Number of peptides = 2 || unambiguous || 96.9% Confident
O09132 - (O09132) A6 gene product || Number of peptides = 5 || ambiguous || 96.9% Confident
IRE1_MOUSE - (P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) || Number of peptides = 5 || unambiguous || 96.8% Confident
Q99JK2 - (Q99JK2) Hypothetical 49.8 kDa protein || Number of peptides = 2 || unambiguous || 96.8% Confident
R37A_HUMAN - (P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a || Number of peptides = 9 || ambiguous || 96.7% Confident
Q63918 - (Q63918) Serum deprivation response (Sdpr protein) || Number of peptides = 1 || ambiguous || 96.5% Confident
DYI2_MOUSE - (O88487) Dynein intermediate chain 2, cytosolic (DH IC-2) (Cytoplasmic dynein intermediate chain 2) || Number of peptides = 4 || unambiguous || 96.5% Confident
DNPE_MOUSE - (Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21) || Number of peptides = 7 || unambiguous || 96.5% Confident
PSA2_MOUSE - (P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) || Number of peptides = 6 || ambiguous || 96.4% Confident
Q9Z2X1 - (Q9Z2X1) Ribonucleoprotein F || Number of peptides = 3 || ambiguous || 96.4% Confident
MY9B_HUMAN - (Q13459) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 6 || unambiguous || 96.4% Confident
Q9D1G1 - (Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) || Number of peptides = 1 || ambiguous || 96.4% Confident
FSC1_HUMAN - (Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) || Number of peptides = 4 || ambiguous || 96.4% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 4 || ambiguous || 96.4% Confident
PSD9_MOUSE - (Q9CR00) 26S proteasome non-ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27) || Number of peptides = 3 || ambiguous || 96.4% Confident
AGM1_MOUSE - (Q9CYR6) Phosphoacetylglucosamine mutase (EC 5.4.2.3) (PAGM) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase) || Number of peptides = 4 || unambiguous || 96.4% Confident
KAC_MOUSE - (P01837) Ig kappa chain C region || Number of peptides = 4 || ambiguous || 96.3% Confident
DNPE_HUMAN - (Q9ULA0) Aspartyl aminopeptidase (EC 3.4.11.21) || Number of peptides = 5 || ambiguous || 96.3% Confident
ROA2_MOUSE - (O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) || Number of peptides = 7 || ambiguous || 96.3% Confident
PRS7_MOUSE - (P46471) 26S protease regulatory subunit 7 (MSS1 protein) || Number of peptides = 11 || ambiguous || 96.3% Confident
HBB_HUMAN - (P02023) Hemoglobin beta chain || Number of peptides = 1 || ambiguous || 96.3% Confident
Q9CSN8 - (Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) || Number of peptides = 1 || ambiguous || 96.3% Confident
RLA0_MOUSE - (P14869) 60S acidic ribosomal protein P0 (L10E) || Number of peptides = 1 || unambiguous || 96.3% Confident
Q9CTB9 - (Q9CTB9) 1110030K07Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 96.2% Confident
Q9D1J1 - (Q9D1J1) 1110005F07Rik protein || Number of peptides = 1 || unambiguous || 96.1% Confident
IF3A_MOUSE - (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin) || Number of peptides = 13 || unambiguous || 96.1% Confident
Q96LJ2 - (Q96LJ2) Hypothetical protein FLJ25439 || Number of peptides = 3 || unambiguous || 96.0% Confident
MIF_MOUSE - (P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) || Number of peptides = 7 || unambiguous || 96.0% Confident
RL18_MOUSE - (P35980) 60S ribosomal protein L18 || Number of peptides = 1 || ambiguous || 95.9% Confident
P2CA_MOUSE - (P49443) Protein phosphatase 2C alpha isoform (EC 3.1.3.16) (PP2C-alpha) (IA) (Protein phosphatase 1A) || Number of peptides = 4 || ambiguous || 95.9% Confident
FLIH_HUMAN - (Q13045) Flightless-I protein homolog || Number of peptides = 4 || unambiguous || 95.8% Confident
Q8VCQ8 - (Q8VCQ8) Similar to caldesmon 1 || Number of peptides = 1 || unambiguous || 95.8% Confident
Q9D0K4 - (Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase) || Number of peptides = 1 || ambiguous || 95.8% Confident
FINC_HUMAN - (P02751) Fibronectin precursor (FN) (Cold-insoluble globulin) (CIG) || Number of peptides = 6 || unambiguous || 95.7% Confident
TLE4_MOUSE - (Q62441) Transducin-like enhancer protein 4 (Groucho-related protein 4) || Number of peptides = 2 || unambiguous || 95.7% Confident
Q9D3R6 - (Q9D3R6) 4933439B08Rik protein || Number of peptides = 2 || ambiguous || 95.7% Confident
Q9D083 - (Q9D083) 2410030K01Rik protein || Number of peptides = 2 || unambiguous || 95.6% Confident
ZO1_MOUSE - (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) || Number of peptides = 8 || unambiguous || 95.6% Confident
IF6_MOUSE - (O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP)) || Number of peptides = 2 || ambiguous || 95.6% Confident
Q9H853 - (Q9H853) Hypothetical protein FLJ13940 || Number of peptides = 9 || unambiguous || 95.5% Confident
FSC1_MOUSE - (Q61553) Fascin (Singed-like protein) || Number of peptides = 5 || unambiguous || 95.3% Confident
Q99J99 - (Q99J99) Similar to thiosulfate sulfurtransferase (Rhodanese) || Number of peptides = 2 || unambiguous || 95.2% Confident
Q91X94 - (Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) || Number of peptides = 3 || ambiguous || 95.2% Confident
Q9CZP1 - (Q9CZP1) 2700038L12Rik protein || Number of peptides = 5 || ambiguous || 95.2% Confident
Q9D6F9 - (Q9D6F9) Tubulin, beta 4 || Number of peptides = 3 || ambiguous || 95.1% Confident
Q9P2F6 - (Q9P2F6) Hypothetical protein KIAA1391 (Fragment) || Number of peptides = 3 || unambiguous || 95.0% Confident
P2CB_MOUSE - (P36993) Protein phosphatase 2C beta isoform (EC 3.1.3.16) (PP2C-beta) (IA) (Protein phosphatase 1B) || Number of peptides = 4 || ambiguous || 95.0% Confident
Q9Y5B0 - (Q9Y5B0) RNA polymerase II CTD phosphatase || Number of peptides = 2 || ambiguous || 95.0% Confident
Q9DAH0 - (Q9DAH0) Four and a half LIM domains 4 || Number of peptides = 3 || unambiguous || 94.9% Confident
TCP1_MOUSE - (P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) || Number of peptides = 6 || unambiguous || 94.9% Confident
AP19_MOUSE - (P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) || Number of peptides = 2 || ambiguous || 94.9% Confident
PFTB_HUMAN - (P49356) Protein farnesyltransferase beta subunit (EC 2.5.1.-) (CAAX farnesyltransferase beta subunit) (RAS proteins prenyltransferase beta) (FTase-beta) || Number of peptides = 1 || unambiguous || 94.9% Confident
HDGF_MOUSE - (P51859) Hepatoma-derived growth factor (HDGF) || Number of peptides = 10 || unambiguous || 94.8% Confident
VDP_MOUSE - (Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment) || Number of peptides = 7 || unambiguous || 94.8% Confident
Q9CR49 - (Q9CR49) Hemoglobin Y, beta-like embryonic chain || Number of peptides = 2 || unambiguous || 94.8% Confident
GRB2_MOUSE - (Q60631) Growth factor receptor-bound protein 2 (GRB2 adapter protein) (SH2/SH3 adapter GRB2) || Number of peptides = 1 || ambiguous || 94.7% Confident
RL4_MOUSE - (Q9D8E6) 60S ribosomal protein L4 (L1) || Number of peptides = 10 || ambiguous || 94.7% Confident
PSA1_MOUSE - (Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) || Number of peptides = 16 || unambiguous || 94.6% Confident
Q61167 - (Q61167) APC-binding protein EB2 (Fragment) || Number of peptides = 1 || ambiguous || 94.6% Confident
HXB3_MOUSE - (P09026) Homeobox protein Hox-B3 (Hox-2.7) (MH-23) || Number of peptides = 4 || unambiguous || 94.6% Confident
TDBP_MOUSE - (Q921F2) TAR DNA-binding protein-43 (TDP-43) || Number of peptides = 1 || ambiguous || 94.4% Confident
Q9D8F9 - (Q9D8F9) 2010003J03Rik protein || Number of peptides = 2 || unambiguous || 94.4% Confident
MYHB_MOUSE - (O08638) Myosin heavy chain, smooth muscle isoform (SMMHC) || Number of peptides = 8 || ambiguous || 94.4% Confident
BUB3_MOUSE - (Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5) || Number of peptides = 2 || ambiguous || 94.4% Confident
O88306 - (O88306) DJ-1 || Number of peptides = 6 || ambiguous || 94.4% Confident
Q9CR15 - (Q9CR15) 1110014J22Rik protein || Number of peptides = 4 || unambiguous || 94.3% Confident
Q9D0N4 - (Q9D0N4) 1110001I24Rik protein || Number of peptides = 3 || ambiguous || 94.3% Confident
Q9CVI6 - (Q9CVI6) 1200015E15Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 94.3% Confident
RS24_HUMAN - (P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19) || Number of peptides = 7 || ambiguous || 94.3% Confident
RSP4_MOUSE - (P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor) || Number of peptides = 2 || ambiguous || 94.2% Confident
Q9CZT3 - (Q9CZT3) 2610529C04Rik protein || Number of peptides = 2 || unambiguous || 94.1% Confident
Q923E6 - (Q923E6) Unknown (Protein for IMAGE:3587102) (Fragment) || Number of peptides = 2 || unambiguous || 94.1% Confident
Q9BTR0 - (Q9BTR0) Hypothetical protein || Number of peptides = 51 || unambiguous || 94.1% Confident
ICE7_MOUSE - (P97864) Caspase-7 precursor (EC 3.4.22.-) (LICE2 cysteine protease) (Apoptotic protease Mch-3) || Number of peptides = 2 || unambiguous || 94.1% Confident
Q91W48 - (Q91W48) Archain 1 || Number of peptides = 7 || unambiguous || 93.9% Confident
Q91VR4 - (Q91VR4) Unknown (Protein for IMAGE:3155544) (Fragment) || Number of peptides = 3 || unambiguous || 93.9% Confident
Q9D1Q6 - (Q9D1Q6) 1110001E24Rik protein (RIKEN cDNA 1110001E24 gene) || Number of peptides = 5 || unambiguous || 93.9% Confident
Q96FJ5 - (Q96FJ5) Similar to RIKEN cDNA 2810403L02 gene (Fragment) || Number of peptides = 1 || unambiguous || 93.7% Confident
Q9JJN5 - (Q9JJN5) Carboxypeptidase N (Carboxypeptidase N small subunit) || Number of peptides = 3 || ambiguous || 93.6% Confident
Q9D2R0 - (Q9D2R0) 2210408B16Rik protein (Acetoacetyl-coenzyme a synthetase) (RIKEN cDNA 2210408B16 gene) || Number of peptides = 5 || unambiguous || 93.6% Confident
Q9CY91 - (Q9CY91) G1 to phase transition 2 || Number of peptides = 4 || unambiguous || 93.6% Confident
Q9UG94 - (Q9UG94) Hypothetical protein || Number of peptides = 2 || unambiguous || 93.6% Confident
Q8VED9 - (Q8VED9) Hypothetical 19.0 kDa protein || Number of peptides = 2 || unambiguous || 93.5% Confident
NUCL_MOUSE - (P09405) Nucleolin (Protein C23) || Number of peptides = 9 || unambiguous || 93.5% Confident
Q923Q2 - (Q923Q2) DM544J17.1 (Novel protein similar to rat RhoGap) (Fragment) || Number of peptides = 1 || unambiguous || 93.3% Confident
Q9D973 - (Q9D973) Steroid receptor RNA activator 1 || Number of peptides = 3 || ambiguous || 93.3% Confident
143B_MOUSE - (Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 9 || ambiguous || 93.2% Confident
CYTB_MOUSE - (Q62426) Cystatin B (Stefin B) || Number of peptides = 5 || unambiguous || 93.1% Confident
Q99K37 - (Q99K37) Similar to HNOEL-iso protein || Number of peptides = 2 || unambiguous || 93.0% Confident
CTPT_MOUSE - (P49586) Cholinephosphate cytidylyltransferase A (EC 2.7.7.15) (Phosphorylcholine transferase A) (CTP:phosphocholine cytidylyltransferase A) (CT A) (CCT A) (CCT-alpha) || Number of peptides = 3 || ambiguous || 93.0% Confident
G25P_HUMAN - (P25763) G25K GTP-binding protein, placental isoform (GP) (CDC42 homolog) (P25763) G25K GTP-binding protein, placental isoform (GP) (CDC42 homolog) || Number of peptides = 1 || ambiguous || 92.8% Confident
Q9CWW1 - (Q9CWW1) 2410003B16Rik protein || Number of peptides = 3 || ambiguous || 92.7% Confident
Q9Y372 - (Q9Y372) CGI-62 protein || Number of peptides = 4 || ambiguous || 92.7% Confident
Q9D9Q9 - (Q9D9Q9) 2310045H08Rik protein || Number of peptides = 3 || unambiguous || 92.7% Confident
PA1G_MOUSE - (Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) || Number of peptides = 7 || ambiguous || 92.6% Confident
Q04692 - (Q04692) Enhancer TRAP locus 1 (Enhancer-TRAP-locus 1 protein) (Fragment) || Number of peptides = 3 || unambiguous || 92.6% Confident
CNBP_MOUSE - (P53996) Cellular nucleic acid binding protein (CNBP) || Number of peptides = 5 || ambiguous || 92.3% Confident
O88179 - (O88179) Guanine nucleotide regulatory protein (Fragment) || Number of peptides = 2 || ambiguous || 92.2% Confident
Q9D7Y0 - (Q9D7Y0) Bisphosphate 3'-nucleotidase 1 || Number of peptides = 3 || unambiguous || 92.2% Confident
DHAX_HUMAN - (P49419) Antiquitin (EC 1.2.1.-) || Number of peptides = 2 || unambiguous || 92.0% Confident
Q8TDG4 - (Q8TDG4) DNA helicase HEL308 || Number of peptides = 7 || unambiguous || 92.0% Confident
MAP4_HUMAN - (P27816) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 1 || unambiguous || 91.7% Confident
AR20_HUMAN - (O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4) (O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4) || Number of peptides = 3 || ambiguous || 91.7% Confident
Q9CWE0 - (Q9CWE0) 2410166I05Rik protein (RIKEN cDNA 2410166I05 gene) || Number of peptides = 2 || ambiguous || 91.7% Confident
PMM2_MOUSE - (Q9Z2M7) Phosphomannomutase 2 (EC 5.4.2.8) (PMM 2) || Number of peptides = 2 || unambiguous || 91.4% Confident
Q9UH87 - (Q9UH87) Transposase-like protein || Number of peptides = 4 || ambiguous || 91.3% Confident
CTE1_MOUSE - (O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) || Number of peptides = 3 || ambiguous || 91.3% Confident
RL29_MOUSE - (P47915) 60S ribosomal protein L29 || Number of peptides = 6 || unambiguous || 91.1% Confident
MTAP_MOUSE - (Q9CQ65) 5'-methylthioadenosine phosphorylase (EC 2.4.2.28) (MTA phosphorylase) (MTAPase) || Number of peptides = 1 || unambiguous || 91.1% Confident
Q91V12 - (Q91V12) Acyl-CoA hydrolase (Hypothetical 37.6 kDa protein) || Number of peptides = 5 || ambiguous || 91.0% Confident
Q922F4 - (Q922F4) Unknown (Protein for MGC:6469) || Number of peptides = 2 || ambiguous || 90.9% Confident
CABA_MOUSE - (Q99020) CARG-binding factor-A (CBF-A) || Number of peptides = 2 || ambiguous || 90.7% Confident
GELS_MOUSE - (P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) || Number of peptides = 8 || unambiguous || 90.4% Confident
RL35_HUMAN - (P42766) 60S ribosomal protein L35 || Number of peptides = 3 || unambiguous || 90.2% Confident
R10A_MOUSE - (P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) || Number of peptides = 1 || ambiguous || 90.1% Confident
Q8VCC9 - (Q8VCC9) Similar to spondin 1a || Number of peptides = 7 || unambiguous || 89.9% Confident
Q14997 - (Q14997) Hypothetical protein KIAA0077 (Fragment) || Number of peptides = 9 || unambiguous || 89.8% Confident
Q99KR6 - (Q99KR6) Hypothetical 42.0 kDa protein (Phafin 1) || Number of peptides = 3 || unambiguous || 89.8% Confident
Q91WN7 - (Q91WN7) Similar to glycine N-methyltransferase || Number of peptides = 2 || ambiguous || 89.7% Confident
Q9D398 - (Q9D398) 6330415E02Rik protein || Number of peptides = 6 || unambiguous || 89.5% Confident
Q9D8P9 - (Q9D8P9) 1810047K05Rik protein || Number of peptides = 4 || ambiguous || 89.5% Confident
DJA1_MOUSE - (P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) || Number of peptides = 4 || ambiguous || 89.5% Confident
Q9WTS5 - (Q9WTS5) Ten-m2 || Number of peptides = 8 || unambiguous || 89.2% Confident
ST5A_MOUSE - (P42230) Signal transducer and activator of transcription 5A (Mammary gland factor) || Number of peptides = 2 || ambiguous || 89.2% Confident
H2AG_HUMAN - (P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) || Number of peptides = 4 || ambiguous || 88.9% Confident
ARI1_MOUSE - (Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment) || Number of peptides = 2 || ambiguous || 88.9% Confident
BAC1_MOUSE - (P97302) Transcription regulator protein BACH1 (BTB and CNC homolog 1) || Number of peptides = 6 || unambiguous || 88.8% Confident
ENOA_HUMAN - (P06733) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase) || Number of peptides = 4 || unambiguous || 88.8% Confident
Q99LL9 - (Q99LL9) Hypothetical 69.6 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 88.7% Confident
Q61166 - (Q61166) APC-binding protein EB1 homolog || Number of peptides = 2 || unambiguous || 88.7% Confident
MBNL_MOUSE - (Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein) || Number of peptides = 4 || ambiguous || 88.7% Confident
G3BP_MOUSE - (P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) || Number of peptides = 3 || unambiguous || 88.5% Confident
Q9DAE4 - (Q9DAE4) 1700012F10Rik protein || Number of peptides = 1 || ambiguous || 88.4% Confident
RL13_MOUSE - (P47963) 60S ribosomal protein L13 (A52) || Number of peptides = 14 || unambiguous || 88.3% Confident
PNAD_MOUSE - (Q64311) Protein N-terminal asparagine amidohydrolase (EC 3.5.1.-) (Protein NH2-terminal asparagine deamidase) (NTN-amidase) (PNAD) (Protein NH2-terminal asparagine amidohydrolase) (PNAA) || Number of peptides = 1 || unambiguous || 88.2% Confident
Q8VC93 - (Q8VC93) Prion protein interacting protein || Number of peptides = 1 || ambiguous || 88.1% Confident
CDNC_MOUSE - (P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2) || Number of peptides = 4 || unambiguous || 88.1% Confident
Q9D8X5 - (Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) || Number of peptides = 11 || ambiguous || 88.0% Confident
K6A3_HUMAN - (P51812) Ribosomal protein S6 kinase alpha 3 (EC 2.7.1.-) (S6K-alpha 3) (90 kDa ribosomal protein S6 kinase 3) (p90-RSK 3) (Ribosomal S6 kinase 2) (RSK-2) (pp90RSK2) (Insulin-stimulated protein kinase 1) (ISPK-1) || Number of peptides = 2 || unambiguous || 88.0% Confident
RBB7_MOUSE - (Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7) || Number of peptides = 3 || ambiguous || 87.8% Confident
Q9Z0H4 - (Q9Z0H4) Apoptosis-related RNA binding protein (CUG triplet repeat,RNA binding protein 2) || Number of peptides = 2 || ambiguous || 87.8% Confident
Q14558 - (Q14558) Phosphoribosypyrophosphate synthetase-associated protein 39 || Number of peptides = 1 || unambiguous || 87.7% Confident
FUS_MOUSE - (P56959) RNA-binding protein FUS (Pigpen protein) || Number of peptides = 4 || ambiguous || 87.6% Confident
Q9CT05 - (Q9CT05) 2610027H02Rik protein (Fragment) || Number of peptides = 5 || ambiguous || 87.4% Confident
WDR5_HUMAN - (Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) (Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) || Number of peptides = 1 || ambiguous || 87.4% Confident
ZFP2_MOUSE - (P08043) Zinc finger protein 2 (Zfp-2) (mKR2 protein) || Number of peptides = 3 || unambiguous || 87.2% Confident
ZN43_HUMAN - (P17038) Zinc finger protein 43 (Zinc protein HTF6) (Zinc finger protein KOX27) || Number of peptides = 4 || unambiguous || 87.2% Confident
ZF38_MOUSE - (Q07231) Zinc finger protein 38 (Zfp-38) (CtFIN51) (Transcription factor RU49) || Number of peptides = 2 || ambiguous || 87.2% Confident
CPZ4_MOUSE - (P56656) Cytochrome P450 2C39 (EC 1.14.14.1) (CYPIIC39) || Number of peptides = 1 || unambiguous || 87.1% Confident
Q9CWR1 - (Q9CWR1) 2410008B13Rik protein || Number of peptides = 2 || unambiguous || 87.1% Confident
Q9EQM6 - (Q9EQM6) GY1 protein || Number of peptides = 3 || unambiguous || 86.8% Confident
HS71_MOUSE - (P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) || Number of peptides = 5 || ambiguous || 86.8% Confident
Q60902 - (Q60902) Eps15R protein || Number of peptides = 4 || unambiguous || 86.5% Confident
Q9D8M4 - (Q9D8M4) 1500016H10Rik protein || Number of peptides = 1 || unambiguous || 86.3% Confident
O75663 - (O75663) DJ69E11.3 (Yeast YPR037W and WORM C02C2.6 PREDICTED proteins like) || Number of peptides = 2 || unambiguous || 86.2% Confident
MK14_MOUSE - (P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1) || Number of peptides = 4 || ambiguous || 86.2% Confident
Q9CZ85 - (Q9CZ85) 2810038F24Rik protein || Number of peptides = 5 || unambiguous || 86.0% Confident
GIPC_MOUSE - (Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) || Number of peptides = 4 || unambiguous || 85.9% Confident
Q62219 - (Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5) || Number of peptides = 1 || unambiguous || 85.7% Confident
PHS_HUMAN - (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) || Number of peptides = 3 || ambiguous || 85.4% Confident
Q96L71 - (Q96L71) ARAP1 || Number of peptides = 3 || unambiguous || 85.3% Confident
COMT_MOUSE - (O88587) Catechol O-methyltransferase, membrane-bound form (EC 2.1.1.6) (MB-COMT) [Contains: Catechol O-methyltransferase, soluble form (S-COMT)] || Number of peptides = 1 || ambiguous || 85.1% Confident
SNX2_MOUSE - (Q9CWK8) Sorting nexin 2 || Number of peptides = 6 || unambiguous || 85.0% Confident
Q99KN9 - (Q99KN9) Similar to KIAA0171 gene product (Fragment) || Number of peptides = 1 || ambiguous || 84.9% Confident
O08817 - (O08817) CW17 protein || Number of peptides = 3 || ambiguous || 84.8% Confident
DPY3_MOUSE - (Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein) || Number of peptides = 3 || unambiguous || 84.7% Confident
Q924M4 - (Q924M4) RANBP9 isoform 1 || Number of peptides = 5 || ambiguous || 84.3% Confident
ACSA_MOUSE - (Q9QXG4) Acetyl-coenzyme A synthetase, cytoplasmic (EC 6.2.1.1) (Acetate--CoA ligase) (Acyl-activating enzyme) (Acetyl-CoA synthetase) (ACS) (AceCS) || Number of peptides = 3 || unambiguous || 84.1% Confident
DJB4_MOUSE - (Q9D832) DnaJ homolog subfamily B member 4 || Number of peptides = 2 || unambiguous || 84.1% Confident
Q9CXI5 - (Q9CXI5) 3230402M22Rik protein || Number of peptides = 1 || ambiguous || 83.3% Confident
Q15327 - (Q15327) Nuclear protein || Number of peptides = 1 || unambiguous || 83.2% Confident
2ACA_HUMAN - (Q06190) Serine/threonine protein phosphatase 2A, 72/130 kDa regulatory subunit B (PP2A, subunit B, B''-PR72/PR130) (PP2A, subunit B, B72/B130 isoforms) (PP2A, subunit B, PR72/PR130 isoforms) (PP2A, subunit B, R3 isoform) || Number of peptides = 3 || unambiguous || 82.5% Confident
Y379_HUMAN - (O15084) Hypothetical protein KIAA0379 (Fragment) || Number of peptides = 5 || unambiguous || 82.3% Confident
O60705 - (O60705) LIM protein || Number of peptides = 1 || unambiguous || 82.0% Confident
Q9Z1R0 - (Q9Z1R0) B144 || Number of peptides = 2 || unambiguous || 81.6% Confident
POSC_MOUSE - (Q9Z2Y8) Proline synthetase co-transcribed bacterial homolog protein || Number of peptides = 3 || unambiguous || 81.6% Confident
EHD4_MOUSE - (Q9EQP2) EH-domain containing protein 4 (mPAST2) || Number of peptides = 5 || unambiguous || 81.5% Confident
Q9Y4G0 - (Q9Y4G0) Hypothetical protein KIAA0381 (Fragment) || Number of peptides = 1 || unambiguous || 81.3% Confident
Q9CWU3 - (Q9CWU3) 2410004D02Rik protein || Number of peptides = 1 || ambiguous || 81.3% Confident
Q9QYS9 - (Q9QYS9) QKI-5 protein || Number of peptides = 2 || ambiguous || 81.2% Confident
SI7A_HUMAN - (Q9NSC7) Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (EC 2.4.99.3) (GalNAc alpha-2,6-sialyltransferase I) (ST6GalNAc I) (Sialyltransferase 7A) || Number of peptides = 1 || unambiguous || 81.2% Confident
Q9EQ18 - (Q9EQ18) SIR2L2 || Number of peptides = 3 || unambiguous || 81.2% Confident
RCQ5_HUMAN - (O94762) ATP-dependent DNA helicase Q5 (RecQ protein-like 5) || Number of peptides = 1 || ambiguous || 81.1% Confident
O95316 - (O95316) Ribosome S6 protein kinase || Number of peptides = 5 || ambiguous || 80.9% Confident
Q9NVH9 - (Q9NVH9) Hypothetical protein FLJ10724 || Number of peptides = 3 || unambiguous || 80.8% Confident
H2AZ_HUMAN - (P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z) || Number of peptides = 3 || ambiguous || 80.6% Confident
RL31_HUMAN - (P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31 || Number of peptides = 6 || ambiguous || 80.5% Confident
O43304 - (O43304) Hypothetical protein KIAA0420 (Fragment) || Number of peptides = 10 || unambiguous || 80.4% Confident
Q9DBQ4 - (Q9DBQ4) 1200016L19Rik protein || Number of peptides = 4 || unambiguous || 80.3% Confident
Q96BG7 - (Q96BG7) Similar to hypothetical protein FLJ22582 || Number of peptides = 4 || unambiguous || 80.3% Confident
Q8R3P1 - (Q8R3P1) Similar to hypothetical protein MGC16714 || Number of peptides = 1 || unambiguous || 80.2% Confident
HS27_MOUSE - (P14602) Heat shock 27 kDa protein (HSP 27) (Growth-related 25 kDa protein) (P25) (HSP25) || Number of peptides = 2 || unambiguous || 80.0% Confident
ZN30_HUMAN - (P17039) Zinc finger protein 30 (Zinc finger protein KOX28) (Fragment) || Number of peptides = 2 || ambiguous || 79.8% Confident
ANXA_MOUSE - (Q9QZ10) Annexin A10 || Number of peptides = 4 || ambiguous || 79.8% Confident
Q9D6M0 - (Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene) || Number of peptides = 6 || unambiguous || 79.7% Confident
Q9H009 - (Q9H009) Alpha-NAC protein || Number of peptides = 3 || unambiguous || 79.6% Confident
Q99K51 - (Q99K51) Hypothetical 70.7 kDa protein || Number of peptides = 4 || ambiguous || 79.5% Confident
RL6_MOUSE - (P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) || Number of peptides = 7 || unambiguous || 79.5% Confident
NADC_MOUSE - (Q91X91) Nicotinate-nucleotide pyrophosphorylase [carboxylating] (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) (QAPRTase) (QPRTase) || Number of peptides = 1 || unambiguous || 79.5% Confident
SVS6_MOUSE - (Q64356) Seminal vesicle secretory protein VI precursor (Seminal vesicle protein 6) (SVSP99) (SVS VI) || Number of peptides = 2 || unambiguous || 79.5% Confident
Q9EPZ2 - (Q9EPZ2) ELAC2 || Number of peptides = 4 || unambiguous || 79.5% Confident
RSU1_MOUSE - (Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1) || Number of peptides = 5 || ambiguous || 79.4% Confident
EF1D_MOUSE - (P57776) Elongation factor 1-delta (EF-1-delta) || Number of peptides = 6 || unambiguous || 79.4% Confident
FRZB_MOUSE - (P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3) || Number of peptides = 2 || ambiguous || 79.3% Confident
ALD1_MOUSE - (P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7) || Number of peptides = 8 || ambiguous || 79.2% Confident
RS10_MOUSE - (P09900) 40S ribosomal protein S10 || Number of peptides = 2 || ambiguous || 79.1% Confident
FXP1_MOUSE - (P58462) Forkhead box protein P1 (Forkhead-related transcription factor 1) || Number of peptides = 3 || unambiguous || 79.0% Confident
Q9DC15 - (Q9DC15) 1200007E24Rik protein || Number of peptides = 2 || unambiguous || 78.8% Confident
O54865 - (O54865) Soluble guanylate cyclase beta-1 subunit || Number of peptides = 4 || unambiguous || 78.7% Confident
Q8VHQ0 - (Q8VHQ0) SPI3L2 || Number of peptides = 3 || unambiguous || 78.6% Confident
PSD4_MOUSE - (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) || Number of peptides = 10 || ambiguous || 78.6% Confident
RL8_HUMAN - (P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8 || Number of peptides = 6 || ambiguous || 78.1% Confident
Q9CS64 - (Q9CS64) 5730508B09Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 78.0% Confident
IDHC_MOUSE - (O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) || Number of peptides = 8 || unambiguous || 78.0% Confident
RS29_HUMAN - (P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 || Number of peptides = 2 || ambiguous || 77.9% Confident
DJB1_MOUSE - (Q9QYJ3) DnaJ homolog subfamily B member 1 (Heat shock 40 kDa protein 1) (Heat shock protein 40) (HSP40) || Number of peptides = 3 || ambiguous || 77.9% Confident
ZYX_MOUSE - (Q62523) Zyxin || Number of peptides = 7 || unambiguous || 77.7% Confident
Q91XF0 - (Q91XF0) Similar to pyridoxine 5'-phosphate oxidase (Expressed sequence AI415282) || Number of peptides = 4 || unambiguous || 77.7% Confident
143S_MOUSE - (O70456) 14-3-3 protein sigma (Stratifin) || Number of peptides = 1 || ambiguous || 77.6% Confident
Y232_HUMAN - (Q92628) Hypothetical protein KIAA0232 (Fragment) || Number of peptides = 2 || unambiguous || 77.4% Confident
ILF3_MOUSE - (Q9Z1X4) Interleukin enhancer-binding factor 3 || Number of peptides = 4 || ambiguous || 77.1% Confident
Q99KP6 - (Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV) || Number of peptides = 5 || unambiguous || 76.8% Confident
PMG2_HUMAN - (P15259) Phosphoglycerate mutase 2 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme M) (PGAM-M) (BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase) || Number of peptides = 7 || unambiguous || 76.8% Confident
STN1_MOUSE - (P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) || Number of peptides = 5 || ambiguous || 76.5% Confident
TCPH_MOUSE - (P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) || Number of peptides = 9 || unambiguous || 76.5% Confident
UBIM_HUMAN - (P35544) Ubiquitin-like protein FUBI || Number of peptides = 1 || ambiguous || 76.3% Confident
Q99MZ9 - (Q99MZ9) Structural protein FBF1 || Number of peptides = 4 || unambiguous || 76.0% Confident
MYO6_HUMAN - (Q9UM54) Myosin VI || Number of peptides = 4 || ambiguous || 75.9% Confident
O75155 - (O75155) Hypothetical protein KIAA0667 (Fragment) || Number of peptides = 4 || unambiguous || 75.8% Confident
O88903 - (O88903) SH3 domain-containing adapter protein || Number of peptides = 5 || unambiguous || 75.6% Confident
Q8VEL9 - (Q8VEL9) Similar to GTP-binding protein REM2 || Number of peptides = 1 || unambiguous || 75.6% Confident
Q9D7S7 - (Q9D7S7) 3110001N18Rik protein || Number of peptides = 2 || unambiguous || 75.4% Confident
Q9CSM4 - (Q9CSM4) 60S ribosomal protein L27 (Fragment) || Number of peptides = 2 || ambiguous || 74.9% Confident
PGMU_MOUSE - (Q9D0F9) Phosphoglucomutase (EC 5.4.2.2) (Glucose phosphomutase) (PGM) || Number of peptides = 3 || unambiguous || 74.8% Confident
Q99JW9 - (Q99JW9) Similar to alpha-coatomer protein (Fragment) || Number of peptides = 2 || ambiguous || 74.6% Confident
Q8WUC7 - (Q8WUC7) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 74.6% Confident
Q14568 - (Q14568) Heat shock protein 86 (Fragment) || Number of peptides = 2 || unambiguous || 74.4% Confident
Q9D9A2 - (Q9D9A2) 1700121J11Rik protein || Number of peptides = 1 || ambiguous || 74.0% Confident
DPO2_MOUSE - (P33611) DNA polymerase alpha 70 kDa subunit (DNA polymerase subunit B) || Number of peptides = 2 || unambiguous || 74.0% Confident
AK10_MOUSE - (O88845) A kinase anchor protein 10, mitochondrial (Protein kinase A anchoring protein 10) (PRKA10) (Dual specificity A-Kinase anchoring protein 2) (D-AKAP-2) (Fragment) || Number of peptides = 2 || unambiguous || 74.0% Confident
Q9CYN5 - (Q9CYN5) 5730405I09Rik protein || Number of peptides = 1 || unambiguous || 73.7% Confident
TPM3_MOUSE - (P21107) Tropomyosin alpha 3 chain (Tropomyosin 3) (Tropomyosin gamma) || Number of peptides = 1 || ambiguous || 73.7% Confident
VP26_MOUSE - No description || Number of peptides = 2 || ambiguous || 73.7% Confident
Q9CXS4 - (Q9CXS4) 3110013H01Rik protein || Number of peptides = 3 || unambiguous || 73.6% Confident
GNDS_MOUSE - (Q03385) Ral guanine nucleotide dissociation stimulator (RalGEF) (RalGDS) || Number of peptides = 4 || unambiguous || 73.3% Confident
RL44_HUMAN - (P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a) || Number of peptides = 3 || ambiguous || 73.2% Confident
Q9D418 - (Q9D418) 4930560E09Rik protein || Number of peptides = 2 || ambiguous || 73.1% Confident
Q9BYZ6 - (Q9BYZ6) DBC2 || Number of peptides = 1 || ambiguous || 73.1% Confident
Q91W50 - (Q91W50) Hypothetical 88.8 kDa protein || Number of peptides = 5 || unambiguous || 73.1% Confident
O55033 - (O55033) SH2/SH3 adaptor protein (Similar to non-catalytic region of tyrosine kinase adaptor protein 2) || Number of peptides = 4 || unambiguous || 72.5% Confident
DHQU_MOUSE - (Q64669) NAD(P)H dehydrogenase [quinone] 1 (EC 1.6.99.2) (Quinone reductase 1) (QR1) (DT-diaphorase) (DTD) (Azoreductase) (Phylloquinone reductase) (Menadione reductase) || Number of peptides = 2 || ambiguous || 72.5% Confident
MTX1_MOUSE - (P47802) Metaxin 1 || Number of peptides = 4 || unambiguous || 72.2% Confident
VAB2_MOUSE - (P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) || Number of peptides = 5 || ambiguous || 72.1% Confident
TTHY_MOUSE - (P07309) Transthyretin precursor (Prealbumin) || Number of peptides = 1 || unambiguous || 72.1% Confident
RL23_HUMAN - (P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) || Number of peptides = 9 || ambiguous || 72.0% Confident
Q8VDW8 - (Q8VDW8) Hypothetical 25.4 kDa protein || Number of peptides = 1 || unambiguous || 71.9% Confident
CIA1_HUMAN - (O76071) WD-repeat containing protein Ciao 1 || Number of peptides = 3 || unambiguous || 71.6% Confident
Q9WU78 - (Q9WU78) ALG-2 interacting protein AIP1 || Number of peptides = 3 || unambiguous || 71.5% Confident
O95686 - (O95686) Serine-threonine specific protein phosphatase (EC 3.1.3.16) (Similar to protein phosphatase 1, regulatory (Inhibitor) subunit 3C) || Number of peptides = 1 || ambiguous || 71.4% Confident
FAK2_HUMAN - (Q14289) Protein tyrosine kinase 2 beta (EC 2.7.1.112) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Cell adhesion kinase beta) (CAK beta) (Calcium-dependent tyrosine kinase) (CADTK) (Related adhesion focal tyrosine kinase) || Number of peptides = 1 || unambiguous || 71.3% Confident
TGR2_MOUSE - (Q62312) TGF-beta receptor type II precursor (EC 2.7.1.37) (TGFR-2) (TGF-beta type II receptor) || Number of peptides = 4 || unambiguous || 71.3% Confident
RCQ1_MOUSE - (Q9Z129) ATP-dependent DNA helicase Q1 || Number of peptides = 3 || unambiguous || 71.2% Confident
PA1B_MOUSE - (Q61206) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) || Number of peptides = 3 || ambiguous || 71.1% Confident
Q64706 - (Q64706) Tenascin C precursor || Number of peptides = 9 || unambiguous || 71.0% Confident
Q8VC87 - (Q8VC87) RIKEN cDNA 2810411K16 gene || Number of peptides = 1 || unambiguous || 70.9% Confident
Q9BTA9 - (Q9BTA9) Hypothetical protein || Number of peptides = 3 || ambiguous || 70.8% Confident
O43154 - (O43154) Hypothetical protein KIAA0404 (Fragment) || Number of peptides = 7 || unambiguous || 70.7% Confident
Q9NYF0 - (Q9NYF0) Heptacellular carcinoma novel gene-3 protein || Number of peptides = 1 || unambiguous || 70.2% Confident
VATE_MOUSE - (P50518) Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) (V-ATPase 31 kDa subunit) (P31) || Number of peptides = 2 || ambiguous || 69.8% Confident
O88545 - (O88545) COP9 complex subunit 6 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6) (ARABIDOPSIS) (Similar TO COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6) || Number of peptides = 2 || ambiguous || 69.7% Confident
K1CW_MOUSE - (Q99PS0) Keratin, type I cytoskeletal 23 (Cytokeratin 23) (K23) (CK 23) || Number of peptides = 3 || unambiguous || 69.6% Confident
PIR_MOUSE - (Q9D711) Pirin || Number of peptides = 1 || unambiguous || 69.6% Confident
O14638 - (O14638) Phosphodiesterase I/nucleotide pyrophosphatase beta (EC 3.1.4.1) (Phosphodiesterase I beta) || Number of peptides = 2 || ambiguous || 69.5% Confident
Q8VI56 - (Q8VI56) LDLR dan || Number of peptides = 7 || unambiguous || 69.4% Confident
SEP4_MOUSE - (P28661) Septin 4 (Peanut-like protein 2) (Brain protein H5) || Number of peptides = 2 || ambiguous || 69.4% Confident
PFD5_MOUSE - (Q9WU28) Prefoldin subunit 5 (C-myc binding protein Mm-1) (Myc modulator 1) (EIG-1) || Number of peptides = 1 || ambiguous || 69.3% Confident
TRA1_MOUSE - (P39428) TNF receptor associated factor 1 (TRAF1) || Number of peptides = 2 || unambiguous || 68.7% Confident
Q9UG47 - (Q9UG47) Hypothetical protein || Number of peptides = 2 || unambiguous || 68.7% Confident
HUNK_MOUSE - (O88866) Hormonally upregulated neu tumor-associated kinase (EC 2.7.1.-) (Serine/threonine protein kinase MAK-V) || Number of peptides = 5 || unambiguous || 68.6% Confident
Q9NS82 - (Q9NS82) Asc-type amino acid transporter 1 (ASC1 protein) || Number of peptides = 1 || ambiguous || 68.5% Confident
ABCR_HUMAN - (P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein) || Number of peptides = 14 || unambiguous || 68.5% Confident
Q9JLB8 - (Q9JLB8) Cell adhesion molecule nectin-3 beta || Number of peptides = 2 || ambiguous || 68.3% Confident
Q9D0N0 - (Q9D0N0) 2610001M19Rik protein || Number of peptides = 2 || unambiguous || 68.1% Confident
PSB5_MOUSE - (O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6) || Number of peptides = 2 || ambiguous || 68.0% Confident
FBL1_MOUSE - (Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) || Number of peptides = 3 || unambiguous || 68.0% Confident
Q91Z83 - (Q91Z83) Beta myosin heavy chain || Number of peptides = 7 || unambiguous || 67.9% Confident
Q9QYY0 - (Q9QYY0) GRB2-associated binding protein 1 || Number of peptides = 3 || unambiguous || 67.8% Confident
Q9UH48 - (Q9UH48) Gastric cancer-related protein GCYS-20 || Number of peptides = 2 || unambiguous || 67.8% Confident
Q921Q5 - (Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1 || Number of peptides = 2 || unambiguous || 67.7% Confident
BIRF_MOUSE - (Q9JIB6) Baculoviral IAP repeat-containing protein 1f (Neuronal apoptosis inhibitory protein 6) || Number of peptides = 2 || unambiguous || 67.6% Confident
Q8VCL2 - (Q8VCL2) RIKEN cDNA 2900072D10 gene || Number of peptides = 1 || unambiguous || 67.6% Confident
Q8VGF4 - (Q8VGF4) Olfactory receptor MOR230-3 || Number of peptides = 5 || unambiguous || 67.6% Confident
Q9Y353 - (Q9Y353) Soluble liver antigen/liver pancreas antigen || Number of peptides = 5 || ambiguous || 67.4% Confident
EP15_MOUSE - (P42567) Epidermal growth factor receptor substrate 15 (Protein Eps15) (AF-1P protein) || Number of peptides = 6 || unambiguous || 67.1% Confident
RN5A_MOUSE - (Q05921) 2-5A-dependent ribonuclease (EC 3.1.26.-) (2-5A-dependent RNase) (Ribonuclease L) (RNase L) (Ribonuclease 4) || Number of peptides = 3 || unambiguous || 67.1% Confident
EGF_MOUSE - (P01132) Pro-epidermal growth factor precursor (EGF) [Contains: Epidermal growth factor] || Number of peptides = 4 || unambiguous || 66.7% Confident
RYR3_HUMAN - (Q15413) Ryanodine receptor 3 (Brain-type ryanodine receptor) (RyR3) (RYR-3) (Brain ryanodine receptor-calcium release channel) || Number of peptides = 10 || unambiguous || 66.5% Confident
RPB2_HUMAN - (P30876) DNA-directed RNA polymerase II 140 kDa polypeptide (EC 2.7.7.6) (RNA polymerase II subunit 2) (RPB2) || Number of peptides = 6 || unambiguous || 66.4% Confident
Q9BTJ1 - (Q9BTJ1) Ribosomal protein S27 || Number of peptides = 8 || unambiguous || 66.3% Confident
TRFE_HUMAN - (P02787) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) (PRO1400) || Number of peptides = 2 || unambiguous || 66.3% Confident
TYB4_MOUSE - (P20065) Thymosin beta-4 (T beta 4) || Number of peptides = 14 || unambiguous || 66.1% Confident
Q8R2Q7 - (Q8R2Q7) Similar to hypothetical protein FLJ20318 || Number of peptides = 3 || unambiguous || 66.0% Confident
Q9EQ00 - (Q9EQ00) cAMP-dependent protein kinase regulatory subunit || Number of peptides = 2 || unambiguous || 66.0% Confident
Q9EQN8 - (Q9EQN8) Mitosin (Fragment) || Number of peptides = 2 || unambiguous || 65.9% Confident
Q9DAN1 - (Q9DAN1) 1700007B13Rik protein || Number of peptides = 5 || unambiguous || 65.3% Confident
CU80_MOUSE - (Q8VHI3) Protein C21orf80 homolog || Number of peptides = 2 || unambiguous || 64.7% Confident
TDR1_HUMAN - (Q9BXT4) Tudor domain containing protein 1 || Number of peptides = 8 || unambiguous || 64.4% Confident
Q9DCY2 - (Q9DCY2) 2310045J23Rik protein || Number of peptides = 2 || ambiguous || 64.3% Confident
IF4E_MOUSE - (P20415) Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa subunit) || Number of peptides = 3 || ambiguous || 64.2% Confident
O95514 - (O95514) DJ1042K10.2 (Putative partial isoform 2) (Fragment) || Number of peptides = 4 || unambiguous || 64.2% Confident
AMYP_MOUSE - (P00688) Alpha-amylase, pancreatic precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) || Number of peptides = 2 || unambiguous || 64.1% Confident
Q9JL61 - (Q9JL61) Regulator factor X 5 || Number of peptides = 2 || unambiguous || 64.1% Confident
Q8R0G9 - (Q8R0G9) Similar to nucleoporin 133kD || Number of peptides = 4 || unambiguous || 64.1% Confident
Q8WUS3 - (Q8WUS3) Similar to hypothetical protein FLJ21463 || Number of peptides = 1 || unambiguous || 64.0% Confident
Q9HCC8 - (Q9HCC8) Osteoblast differentiation promoting factor || Number of peptides = 1 || unambiguous || 63.9% Confident
Q9NXC7 - (Q9NXC7) Hypothetical protein FLJ20320 || Number of peptides = 1 || unambiguous || 63.9% Confident
NEK1_HUMAN - (Q96PY6) Serine/threonine-protein kinase NEK1 (EC 2.7.1.37) (NimA-related protein kinase 1) (NY-REN-55 antigen) || Number of peptides = 12 || unambiguous || 63.6% Confident
Q8R0N9 - (Q8R0N9) Hypothetical 53.1 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 63.4% Confident
ROA1_MOUSE - (P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) || Number of peptides = 12 || ambiguous || 63.3% Confident
Q99ML9 - (Q99ML9) Arkadia || Number of peptides = 2 || ambiguous || 63.2% Confident
Q9D0Q8 - (Q9D0Q8) 2600005K24Rik protein || Number of peptides = 2 || ambiguous || 63.2% Confident
Q9UDR1 - (Q9UDR1) T-cell receptor gamma chain, TRGV9 || Number of peptides = 1 || ambiguous || 63.0% Confident
Q9CYP9 - (Q9CYP9) 3930402F23Rik protein || Number of peptides = 3 || unambiguous || 62.9% Confident
SYEP_HUMAN - (P07814) Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)] || Number of peptides = 9 || unambiguous || 62.8% Confident
NR52_MOUSE - (P45448) Orphan nuclear receptor NR5A2 (Liver receptor homolog) (LRH-1) || Number of peptides = 2 || unambiguous || 62.8% Confident
Q9UPY3 - (Q9UPY3) Helicase-MOI || Number of peptides = 10 || unambiguous || 62.7% Confident
SSRP_HUMAN - (Q08945) Structure-specific recognition protein 1 (SSRP1) (Recombination signal sequence recognition protein) (T160) (Chromatin-specific transcription elongation factor 80 KDA subunit) (FACT 80 KDA subunit) || Number of peptides = 3 || unambiguous || 62.7% Confident
DYLL_HUMAN - (Q9Y3P0) Putative dynein light chain protein DJ8B22.1 || Number of peptides = 1 || unambiguous || 62.6% Confident
DYL1_HUMAN - (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) || Number of peptides = 1 || ambiguous || 62.6% Confident
Q96JQ2 - (Q96JQ2) Calmin || Number of peptides = 2 || ambiguous || 62.5% Confident
Q9CXP5 - (Q9CXP5) 3110043A19Rik protein || Number of peptides = 6 || ambiguous || 62.4% Confident
Q9JLT4 - (Q9JLT4) Thioredoxin reductase 2, mitochondrial precursor (EC 1.6.4.5) || Number of peptides = 9 || unambiguous || 62.4% Confident
CYA8_MOUSE - (P97490) Adenylate cyclase, type VIII (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Ca(2+)/calmodulin activated adenylyl cyclase) || Number of peptides = 12 || unambiguous || 62.4% Confident
LDVR_MOUSE - (P98156) Very low-density lipoprotein receptor precursor (VLDL receptor) || Number of peptides = 1 || ambiguous || 62.4% Confident
SYN_HUMAN - (O43776) Asparaginyl-tRNA synthetase, cytoplasmic (EC 6.1.1.22) (Asparagine--tRNA ligase) (AsnRS) || Number of peptides = 5 || unambiguous || 62.4% Confident
UBP8_HUMAN - (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15) (Ubiquitin thiolesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) || Number of peptides = 3 || unambiguous || 62.4% Confident
Q9CWS0 - (Q9CWS0) 2410006N07Rik protein || Number of peptides = 2 || unambiguous || 62.2% Confident
Q9D4I6 - (Q9D4I6) 4931432M23Rik protein || Number of peptides = 2 || unambiguous || 62.1% Confident
SKD1_MOUSE - (P46467) SKD1 protein (Vacuolar sorting protein 4b) || Number of peptides = 4 || unambiguous || 61.9% Confident
Q9DBN6 - (Q9DBN6) 1300001I01Rik protein || Number of peptides = 2 || ambiguous || 61.9% Confident
AF4_HUMAN - (P51825) AF-4 protein (Proto-oncogene AF4) (FEL protein) || Number of peptides = 2 || unambiguous || 61.9% Confident
EDD_HUMAN - (O95071) Ubiquitin--protein ligase EDD (EC 6.3.2.-) (Hyperplastic discs protein homolog) (hHYD) (Progestin induced protein) || Number of peptides = 6 || unambiguous || 61.9% Confident
Q922U3 - (Q922U3) Unknown (Protein for IMAGE:3589116) (Fragment) || Number of peptides = 4 || unambiguous || 61.9% Confident
Q9NXE8 - (Q9NXE8) Hypothetical protein FLJ20291 || Number of peptides = 1 || unambiguous || 61.8% Confident
A2A2_MOUSE - (P17427) Adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) || Number of peptides = 1 || unambiguous || 61.6% Confident
Q9JLI8 - (Q9JLI8) Tumor-rejection antigen SART3 || Number of peptides = 3 || unambiguous || 61.6% Confident
Q9DD21 - (Q9DD21) 0610006A11Rik protein || Number of peptides = 2 || ambiguous || 61.6% Confident
3BP1_HUMAN - (Q9Y3L3) SH3-domain binding protein 1 (3BP-1) || Number of peptides = 1 || unambiguous || 61.5% Confident
Q922J3 - (Q922J3) Similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) || Number of peptides = 6 || unambiguous || 61.4% Confident
Q9D790 - (Q9D790) 2310021M12Rik protein (RIKEN cDNA 2310021M12 gene) || Number of peptides = 2 || unambiguous || 61.4% Confident
RIR1_MOUSE - (P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain) || Number of peptides = 2 || ambiguous || 61.4% Confident
JAK3_MOUSE - (Q62137) Tyrosine-protein kinase JAK3 (EC 2.7.1.112) (Janus kinase 3) (JAK-3) || Number of peptides = 3 || unambiguous || 61.3% Confident
NOA1_HUMAN - (P51513) Onconeural ventral antigen-1 (NOVA-1) (Paraneoplastic Ri antigen) (Ventral neuron-specific protein 1) || Number of peptides = 1 || unambiguous || 61.1% Confident
Y918_HUMAN - (O94991) Hypothetical protein KIAA0918 (Fragment) || Number of peptides = 4 || unambiguous || 61.1% Confident
PWP2_HUMAN - (Q15269) Periodic tryptophan protein 2 homolog || Number of peptides = 2 || ambiguous || 61.1% Confident
JIP1_HUMAN - (Q9UQF2) C-jun-amino-terminal kinase interacting protein 1 (JNK-interacting protein 1) (JIP-1) (JNK MAP kinase scaffold protein 1) (Islet-brain-1) (IB-1) (Mitogen-activated protein kinase 8-interacting protein 1) || Number of peptides = 2 || unambiguous || 61.1% Confident
Q921M3 - (Q921M3) Similar to splicing factor 3b, subunit 3, 130kD || Number of peptides = 4 || ambiguous || 61.0% Confident
REST_HUMAN - (P30622) Restin (Cytoplasmic linker protein-170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament associated protein) || Number of peptides = 6 || unambiguous || 60.8% Confident
CYRB_HUMAN - (P32927) Cytokine receptor common beta chain precursor (CDw131 antigen) || Number of peptides = 8 || unambiguous || 60.8% Confident
PTNB_MOUSE - (P35235) Protein-tyrosine phosphatase, non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase SYP) || Number of peptides = 2 || unambiguous || 60.8% Confident
PK3G_MOUSE - (O70167) Phosphatidylinositol 3-kinase C2 domain-containing gamma polypeptide (EC 2.7.1.137) (Phosphoinositide 3-Kinase-C2-gamma) (PtdIns-3-kinase C2 gamma) (PI3K-C2gamma) || Number of peptides = 5 || unambiguous || 60.8% Confident
A1T2_MOUSE - (P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 3 || ambiguous || 60.4% Confident
KERA_MOUSE - (O35367) Keratocan precursor (KTN) (Keratan sulfate proteoglycan keratocan) || Number of peptides = 2 || ambiguous || 60.4% Confident
CD86_HUMAN - (P42081) T lymphocyte activation antigen CD86 precursor (Activation B7-2 antigen) (CTLA-4 counter-receptor B7.2) (B70) (FUN-1) (BU63) || Number of peptides = 2 || unambiguous || 60.2% Confident
Q9D3V8 - (Q9D3V8) 4933432B09Rik protein || Number of peptides = 3 || unambiguous || 60.2% Confident
APB1_HUMAN - (Q02410) Amyloid beta A4 precursor protein-binding family A member 1 (Neuron-specific X11 protein) (Neuronal Munc18-1-interacting protein 1) (Mint-1) (Adapter protein X11alpha) || Number of peptides = 1 || unambiguous || 60.1% Confident
SDC2_MOUSE - (P43407) Syndecan-2 precursor (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (SYND2) || Number of peptides = 1 || ambiguous || 59.9% Confident
Q9HC56 - (Q9HC56) Protocadherin-9 || Number of peptides = 6 || unambiguous || 59.9% Confident
Q9CXT2 - (Q9CXT2) 3110007P09Rik protein || Number of peptides = 3 || unambiguous || 59.8% Confident
PSDB_HUMAN - (O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) || Number of peptides = 3 || unambiguous || 59.8% Confident
Q9NR48 - (Q9NR48) ASH1 || Number of peptides = 3 || unambiguous || 59.5% Confident
Q9R0B7 - (Q9R0B7) Double-stranded RNA-binding zinc finger protein JAZ || Number of peptides = 2 || unambiguous || 59.5% Confident
Q9ULU5 - (Q9ULU5) Hypothetical protein KIAA1124 (Fragment) || Number of peptides = 4 || unambiguous || 59.4% Confident
JMJ_MOUSE - (Q62315) Jumonji protein || Number of peptides = 6 || unambiguous || 59.4% Confident
IRR_HUMAN - (P14616) Insulin receptor-related protein precursor (EC 2.7.1.112) (IRR) (IR-related receptor) || Number of peptides = 3 || unambiguous || 59.2% Confident
CAO2_HUMAN - (Q99424) Acyl-coenzyme A oxidase 2, peroxisomal (EC 1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox) (Trihydroxycoprostanoyl-CoA oxidase) (THCCox) (THCA-CoA oxidase) || Number of peptides = 2 || unambiguous || 59.2% Confident
MTR3_HUMAN - (Q13615) Myotubularin-related protein 3 (Fragment) || Number of peptides = 1 || ambiguous || 58.8% Confident
Q8TD57 - (Q8TD57) Axonemal heavy chain dynein type 3 || Number of peptides = 9 || unambiguous || 58.6% Confident
O08828 - (O08828) Axonemal dynein heavy chain (Fragment) || Number of peptides = 5 || unambiguous || 58.6% Confident
A10A_MOUSE - (O54827) Potential phospholipid-transporting ATPase VA (EC 3.6.3.1) || Number of peptides = 6 || unambiguous || 58.6% Confident
Q92549 - (Q92549) Hypothetical protein KIAA0261 (Fragment) || Number of peptides = 8 || unambiguous || 58.6% Confident
Q9GZM9 - (Q9GZM9) Hypothetical protein FLJ13421 (Nucleolar protein ANKT) (Clone HQ0310 PRO0310p1) || Number of peptides = 2 || unambiguous || 58.6% Confident
CAD2_HUMAN - (P19022) Neural-cadherin precursor (N-cadherin) (Cadherin-2) || Number of peptides = 3 || unambiguous || 58.5% Confident
ENTK_HUMAN - (P98073) Enteropeptidase precursor (EC 3.4.21.9) (Enterokinase) || Number of peptides = 2 || unambiguous || 58.1% Confident
PIA1_MOUSE - (O88907) Protein inhibitor of activated STAT protein 1 (DEAD/H box binding protein 1) || Number of peptides = 3 || unambiguous || 58.1% Confident
22A3_MOUSE - (P70122) Protein 22A3 || Number of peptides = 3 || unambiguous || 58.0% Confident
GBB1_HUMAN - (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) || Number of peptides = 1 || ambiguous || 57.5% Confident
NEO1_MOUSE - (P97798) Neogenin precursor || Number of peptides = 2 || unambiguous || 57.3% Confident
Q96QC2 - (Q96QC2) Hypothetical protein KIAA0170 || Number of peptides = 6 || ambiguous || 57.3% Confident
Q91Z16 - (Q91Z16) Hypothetical 86.8 kDa protein (Fragment) || Number of peptides = 3 || ambiguous || 57.2% Confident
Q61627 - (Q61627) Glutamate receptor delta-1 subunit precursor || Number of peptides = 5 || unambiguous || 57.0% Confident
Q9BSP1 - (Q9BSP1) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 57.0% Confident
MCM6_MOUSE - (P97311) DNA replication licensing factor MCM6 (Mis5 homolog) || Number of peptides = 5 || unambiguous || 57.0% Confident
Q8TB68 - (Q8TB68) Similar to hypothetical protein MGC10772 || Number of peptides = 3 || unambiguous || 56.8% Confident
Q9Y382 - (Q9Y382) CGI-73 protein || Number of peptides = 3 || unambiguous || 56.7% Confident
ATM_MOUSE - (Q62388) Serine-protein kinase ATM (EC 2.7.1.37) (Ataxia telangiectasia mutated homolog) (A-T, mutated homolog) || Number of peptides = 17 || unambiguous || 56.6% Confident
Q61726 - (Q61726) Keratin, type II cytoskeletal (Fragment) || Number of peptides = 1 || unambiguous || 56.4% Confident
CM35_HUMAN - (Q08708) CMRF35 antigen precursor (CMRF-35) || Number of peptides = 1 || unambiguous || 56.1% Confident
O15050 - (O15050) Hypothetical protein KIAA0342 (Fragment) || Number of peptides = 4 || unambiguous || 56.1% Confident
Q9WVQ0 - (Q9WVQ0) Sperm tail associated protein || Number of peptides = 6 || unambiguous || 56.0% Confident
LMA4_MOUSE - (P97927) Laminin alpha-4 chain precursor || Number of peptides = 4 || unambiguous || 55.9% Confident
Q96J67 - (Q96J67) Branching-enzyme interacting dual-specificity protein phosphatase BEDP || Number of peptides = 1 || unambiguous || 55.7% Confident
Q9CUU3 - (Q9CUU3) 3830402K23Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 55.5% Confident
NER3_HUMAN - (Q9UQ49) Sialidase 3 (EC 3.2.1.18) (Membrane sialidase) (Ganglioside sialidase) (N-acetyl-alpha-neuraminidase 3) || Number of peptides = 8 || unambiguous || 55.4% Confident
Q9JJF3 - (Q9JJF3) Brain cDNA, clone MNCb-7109, similar to AF000198, weak similarity to HSP90 (Caenorhabditis elegans) || Number of peptides = 3 || unambiguous || 55.4% Confident
Q9NVM6 - (Q9NVM6) Hypothetical protein FLJ10634 || Number of peptides = 3 || unambiguous || 55.3% Confident
ZN29_HUMAN - (P17037) Zinc finger protein 29 (Zinc finger protein KOX26) (Fragment) || Number of peptides = 3 || unambiguous || 55.0% Confident
O75257 - (O75257) R31180_1 || Number of peptides = 3 || ambiguous || 55.0% Confident
EHD1_MOUSE - (Q9WVK4) EH-domain containing protein 1 (mPAST1) || Number of peptides = 4 || unambiguous || 55.0% Confident
ALK_HUMAN - (Q9UM73) ALK tyrosine kinase receptor precursor (EC 2.7.1.112) (Anaplastic lymphoma kinase) (CD246 antigen) || Number of peptides = 3 || unambiguous || 55.0% Confident
O00508 - (O00508) Latent TGF-beta binding protein-4 || Number of peptides = 5 || unambiguous || 55.0% Confident
DCT2_MOUSE - (Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) || Number of peptides = 4 || ambiguous || 54.9% Confident
CXB4_MOUSE - (Q02738) Gap junction beta-4 protein (Connexin 30.3) (Cx30.3) || Number of peptides = 1 || unambiguous || 54.8% Confident
Q9BSA9 - (Q9BSA9) Similar to RIKEN cDNA 3010001K23 gene || Number of peptides = 4 || unambiguous || 54.8% Confident
Q62412 - (Q62412) Nebulin (Fragment) || Number of peptides = 3 || unambiguous || 54.7% Confident
RS17_MOUSE - (P06584) 40S ribosomal protein S17 || Number of peptides = 2 || ambiguous || 54.6% Confident
RS26_HUMAN - (P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26 || Number of peptides = 4 || ambiguous || 54.5% Confident
Q9H2T2 - (Q9H2T2) Nuclear receptor coactivator CIA (Fragment) || Number of peptides = 2 || unambiguous || 54.2% Confident
IF4G_HUMAN - (Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) || Number of peptides = 3 || unambiguous || 54.2% Confident
Q96PE0 - (Q96PE0) Tumor endothelial marker 6 || Number of peptides = 2 || unambiguous || 54.1% Confident
Q99PS4 - (Q99PS4) Msx-2 interacting nuclear target protein || Number of peptides = 7 || ambiguous || 54.0% Confident
Q8VI24 - (Q8VI24) KIAA1034-like DNA binding protein || Number of peptides = 3 || ambiguous || 54.0% Confident
MM02_MOUSE - (P33434) 72 kDa type IV collagenase precursor (EC 3.4.24.24) (72 kDa gelatinase) (Matrix metalloproteinase-2) (MMP-2) (Gelatinase A) || Number of peptides = 2 || ambiguous || 53.9% Confident
Q9CUE5 - (Q9CUE5) 4931427F14Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 53.9% Confident
Q9Y2H6 - (Q9Y2H6) Hypothetical protein KIAA0970 (Fragment) || Number of peptides = 3 || ambiguous || 53.7% Confident
Q9BVA2 - (Q9BVA2) Similar to four and a half LIM domains 3 || Number of peptides = 2 || unambiguous || 53.7% Confident
Q8R1X8 - (Q8R1X8) Hypothetical 79.0 kDa protein || Number of peptides = 7 || unambiguous || 53.5% Confident
Q9BRR8 - (Q9BRR8) Similar to RIKEN cDNA 1300003A17 gene || Number of peptides = 2 || ambiguous || 53.5% Confident
Q8R5M0 - (Q8R5M0) PDZ-domain protein Gipc3 || Number of peptides = 3 || unambiguous || 53.3% Confident
9KD_HUMAN - (P13994) 9 kDa protein || Number of peptides = 1 || unambiguous || 53.3% Confident
ROG_MOUSE - (O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G) || Number of peptides = 3 || ambiguous || 53.3% Confident
SM6A_MOUSE - (O35464) Semaphorin 6A precursor (Semaphorin VIA) (Sema VIA) (Semaphorin Q) (Sema Q) || Number of peptides = 4 || unambiguous || 53.3% Confident
NAL1_HUMAN - (Q9C000) NACHT-, LRR- and PYD-containing protein 2 (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) (Caspase recruitment domain protein 7) || Number of peptides = 7 || unambiguous || 53.3% Confident
Q9CQR8 - (Q9CQR8) 1600016E11Rik protein || Number of peptides = 1 || unambiguous || 53.3% Confident
Q64487 - (Q64487) Protein-tyrosine phosphatase, receptor-type, D precursor (EC 3.1.3.48) (Protein-tyrosine phosphatase delta) (R-PTP-delta) || Number of peptides = 2 || unambiguous || 53.3% Confident
Q9UIE6 - (Q9UIE6) Hypothetical protein || Number of peptides = 3 || unambiguous || 53.3% Confident
NECD_HUMAN - (Q99608) Necdin || Number of peptides = 9 || unambiguous || 53.2% Confident
Q9CTV2 - (Q9CTV2) 4933434L15Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 53.2% Confident
GPDA_MOUSE - (P13707) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic (EC 1.1.1.8) (GPD-C) (GPDH-C) || Number of peptides = 2 || unambiguous || 53.1% Confident
O94837 - (O94837) Hypothetical protein KIAA0732 (Fragment) || Number of peptides = 4 || unambiguous || 53.1% Confident
NFC1_MOUSE - (O88942) Nuclear factor of activated T-cells, cytoplasmic 1 (NFAT transcription complex cytosolic component) (NF-ATc1) (NF-ATc) || Number of peptides = 5 || ambiguous || 53.0% Confident
Q9HCF4 - (Q9HCF4) Hypothetical protein KIAA1618 (Fragment) || Number of peptides = 4 || unambiguous || 53.0% Confident
Q9D486 - (Q9D486) 4933407C03Rik protein || Number of peptides = 3 || unambiguous || 53.0% Confident
HP28_HUMAN - (Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) || Number of peptides = 2 || unambiguous || 52.9% Confident
Q9CQT1 - (Q9CQT1) 2410018C20Rik protein (RIKEN cDNA 2410018C20 gene) || Number of peptides = 3 || unambiguous || 52.8% Confident
Q91Y16 - (Q91Y16) Protocadherin alpha 3 || Number of peptides = 2 || unambiguous || 52.8% Confident
STA6_MOUSE - (P52633) Signal transducer and transcription activator 6 || Number of peptides = 4 || unambiguous || 52.8% Confident
Q9Z243 - (Q9Z243) NNX3 || Number of peptides = 6 || unambiguous || 52.7% Confident
KCRM_MOUSE - (P07310) Creatine kinase, M chain (EC 2.7.3.2) (M-CK) || Number of peptides = 3 || unambiguous || 52.7% Confident
Q60920 - (Q60920) Zfp78p (Fragment) || Number of peptides = 8 || ambiguous || 52.6% Confident
O15463 - (O15463) PTPL1-associated RhoGAP || Number of peptides = 3 || unambiguous || 52.6% Confident
HAO1_HUMAN - (Q9UJM8) Hydroxyacid oxidase 1 (EC 1.1.3.15) (HAOX1) (Glycolate oxidase) (GOX) || Number of peptides = 2 || unambiguous || 52.4% Confident
Q9ESC8 - (Q9ESC8) Putative transcription factor ALF-4 || Number of peptides = 4 || unambiguous || 52.4% Confident
Q9D462 - (Q9D462) 4933411K20Rik protein || Number of peptides = 1 || unambiguous || 52.4% Confident
Q8R320 - (Q8R320) Similar to N-arginine dibasic convertase 1 || Number of peptides = 2 || unambiguous || 52.3% Confident
RM09_MOUSE - (Q99N94) 60S ribosomal protein L9, mitochondrial precursor (L9mt) (Fragment) || Number of peptides = 1 || ambiguous || 52.3% Confident
Q61285 - (Q61285) ALDR protein (ATP-binding cassette, sub-family D (ALD), member 2) || Number of peptides = 4 || unambiguous || 52.3% Confident
CCAD_HUMAN - (Q01668) Voltage-dependent L-type calcium channel alpha-1D subunit (Calcium channel, L type, alpha-1 polypeptide, isoform 2) || Number of peptides = 4 || unambiguous || 52.2% Confident
Q925F2 - (Q925F2) Endothelial cell-selective adhesion molecule || Number of peptides = 1 || unambiguous || 52.2% Confident
FCG2_MOUSE - (P08101) Low affinity immunoglobulin gamma FC region receptor II precursor (FC-gamma RII) (FCRII) (IGG FC receptor II beta) (FC gamma receptor IIB) (FCgammaRIIB) || Number of peptides = 2 || unambiguous || 52.0% Confident
Q8QZX5 - (Q8QZX5) Similar to U7 snRNP-specific Sm-like protein LSM10 (Hypothetical 13.9 kDa protein) || Number of peptides = 1 || unambiguous || 52.0% Confident
Q9CY26 - (Q9CY26) 2700085E05Rik protein || Number of peptides = 2 || ambiguous || 52.0% Confident
FGD1_MOUSE - (P52734) Putative Rho/Rac guanine nucleotide exchange factor (Rho/Rac GEF) (Faciogenital dysplasia protein homolog) || Number of peptides = 2 || ambiguous || 51.7% Confident
Q9NY74 - (Q9NY74) ETAA16 protein || Number of peptides = 4 || unambiguous || 51.6% Confident
NSGX_HUMAN - (Q9UH64) Susceptibility protein NSG-x || Number of peptides = 1 || unambiguous || 51.6% Confident
NU62_MOUSE - (Q63850) Nuclear pore glycoprotein p62 (62 kDa nucleoporin) || Number of peptides = 2 || unambiguous || 51.5% Confident
O88412 - (O88412) Zinc finger protein 105 || Number of peptides = 5 || unambiguous || 51.4% Confident
Q9BTP1 - (Q9BTP1) Hypothetical protein (Fragment) || Number of peptides = 5 || unambiguous || 51.2% Confident
Q91ZU8 - (Q91ZU8) Bullous pemphigoid antigen 1-e || Number of peptides = 4 || unambiguous || 51.0% Confident
A1A1_HUMAN - (P05023) Sodium/potassium-transporting ATPase alpha-1 chain precursor (EC 3.6.3.9) (Sodium pump 1) (Na+/K+ ATPase 1) || Number of peptides = 2 || unambiguous || 51.0% Confident
DD20_MOUSE - (Q9JJY4) Probable ATP-dependent RNA helicase DDX20 (DEAD-box protein 20) (DEAD-box protein DP 103) (Component of gems 3) (Gemin3) (Regulator of steroidogenic factor-1) (ROSF-1) || Number of peptides = 4 || unambiguous || 51.0% Confident
VMT2_HUMAN - (Q05940) Synaptic vesicle amine transporter (Monoamine transporter) (Vesicular amine transporter 2) (VAT2) || Number of peptides = 1 || unambiguous || 51.0% Confident
Q91ZG9 - (Q91ZG9) DM61H21.1 (Novel protein) (Fragment) || Number of peptides = 2 || ambiguous || 50.9% Confident
Q9D9J3 - (Q9D9J3) 1700061J02Rik protein || Number of peptides = 1 || unambiguous || 50.9% Confident
Q9JI18 - (Q9JI18) Low density lipoprotein receptor related protein LRP1B/LRP-DIT || Number of peptides = 13 || unambiguous || 50.8% Confident
ACDV_HUMAN - (P49748) Acyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor (EC 1.3.99.-) (VLCAD) || Number of peptides = 3 || unambiguous || 50.7% Confident
A2MG_MOUSE - (Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) || Number of peptides = 11 || unambiguous || 50.7% Confident
GRG_MOUSE - (Q06195) GRG protein (ESP1 protein) (Amino enhancer of split) (AES-1/AES-2) || Number of peptides = 2 || ambiguous || 50.7% Confident
PTPX_HUMAN - (Q92932) Protein-tyrosine phosphatase X precursor (EC 3.1.3.48) (R-PTP-X) (Islet cell autoantigen related protein) (ICAAR) (IAR) (Phogrin) || Number of peptides = 1 || ambiguous || 50.7% Confident
Q91ZD0 - (Q91ZD0) 3-beta-hydroxysterol delta-24 reductase || Number of peptides = 3 || unambiguous || 50.4% Confident
MYHA_HUMAN - (P35580) Myosin heavy chain, nonmuscle type B (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) || Number of peptides = 6 || unambiguous || 50.3% Confident
Q9BW11 - (Q9BW11) Similar to Max dimerization protein 3 || Number of peptides = 3 || ambiguous || 50.3% Confident
IF2B_HUMAN - (P20042) Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 beta subunit) (eIF-2-beta) || Number of peptides = 1 || unambiguous || 50.3% Confident
O60331 - (O60331) Hypothetical protein KIAA0589 (Fragment) || Number of peptides = 2 || unambiguous || 50.2% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/data/search/2002-TK-LungDevo/lung_E18_cyto_2
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
UQ9D28599.6%4618.7%134149088.5(Q9D285) Adult male colon cDNA, RIKEN full-length enriched library, clone:9030215D04, full insert sequence 
	TK261102_lung_cytoE18_2_step12.1780.1780.1	1.8891	0.3592	1597.87	1	5830.0%	2	R.VHIYHHTGNNTFR.V
	TK261102_lung_cytoE18_2_step05.3905.3905.1	0.9298	0.1667	1221.45	64	2270.0%	1	K.WVPAGGSTGFSR.V
UMPK2_MOUSE99.6%118.7%401444367.0(Q63932) Dual specificity mitogen-activated protein kinase kinase 2 (EC 2.7.1.-) (MAP kinase kinase 2) (MAPKK 2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK2) 
	TK261102_lung_cytoE18_2_step12.3691.3691.3	5.5404	0.5434	3615.84	1	2940.0%	1	R.RKPVLPALTINPTIAEGPSPTSEGASEANLVDLQK.K
UNDKB_MOUSE99.6%1818016.4%152173637.5(Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18) 
*	TK261102_lung_cytoE18_2_step07.5092.5092.2	3.783	0.6585	1963.97	1	5710.0%	12	K.EIHLWFKPEELIDYK.S
	TK261102_lung_cytoE18_2_step05.0911.0911.1	1.7217	0.3414	1177.83	1	5000.0%	6	K.DRPFFPGLVK.Y
UPNPH_MOUSE99.6%3510.4%289322776.2(P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) 
*	TK261102_lung_cytoE18_2_step04.0652.0652.1	0.8778	0.014	981.93	4	5000.0%	1	R.QKAFTAWK.Q
	TK261102_lung_cytoE18_2_step06.4556.4556.2	3.3827	0.4523	2441.47	1	5240.0%	2	R.KLQEGTYVMLAGPNFETVAESR.L
UO8854399.6%5713.9%423478326.7(O88543) COP9 complex subunit 3 
	TK261102_lung_cytoE18_2_step04.0992.0992.3	1.0935	0.1544	2659.65	2	1520.0%	1	R.QLSAQGQMTQLCELINKSGELLAK.N
	TK261102_lung_cytoE18_2_step12.1652.1652.1	0.9439	0.0745	1096.86	57	2780.0%	1	K.QPLRGIGILK.Q
	TK261102_lung_cytoE18_2_step11.4166.4166.2	3.8655	0.5834	2894.91	1	3540.0%	2	R.FIKPLSNAYHELAQVYSTNNPSELR.N
UKPY2_MOUSE99.6%4524733.2%530577567.5(P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) 
	TK261102_lung_cytoE18_2_step11.2364.2364.2	1.2956	0.1064	1887.21	27	3000.0%	11	R.LNFSHGTHEYHAETIK.N
	TK261102_lung_cytoE18_2_step01.1920.1920.1	1.3416	0.2768	840.74	2	5710.0%	1	R.APIIAVTR.N
*	TK261102_lung_cytoE18_2_step06.2120.2120.1	1.3707	0.0905	1026.65	2	5620.0%	3	R.KAADVHEVR.K
*	TK261102_lung_cytoE18_2_step06.2112.2112.1	1.387	0.0574	896.62	1	5710.0%	2	K.AADVHEVR.K
	TK261102_lung_cytoE18_2_step01.2699.2699.2	1.767	0.4266	1767.61	1	3530.0%	2	K.KGVNLPGAAVDLPAVSEK.D
	TK261102_lung_cytoE18_2_step07.5029.5029.2	2.0989	0.5123	1933.89	1	5000.0%	5	R.EAEAAIYHLQLFEELR.R
	TK261102_lung_cytoE18_2_step06.0859.0859.2	1.2164	0.0054	1825.43	3	3670.0%	6	R.RFDEILEASDGIMVAR.G
	TK261102_lung_cytoE18_2_step01.3494.3494.1	1.0756	0.0565	1464.15	3	4580.0%	1	K.IYVDDGLISLQVK.E
	TK261102_lung_cytoE18_2_step06.1375.1375.1	1.0648	0.2029	768.93	2	5830.0%	5	R.SAHQVAR.Y
*	TK261102_lung_cytoE18_2_step01.3876.3876.2	1.6254	0.2733	2494.51	1	3180.0%	1	R.EATESFASDPILYRPVAVALDTK.G
*	TK261102_lung_cytoE18_2_step01.2019.2019.1	1.0125	0.103	1171.72	1	5000.0%	1	R.LDIDSAPITAR.N
	TK261102_lung_cytoE18_2_step06.2278.2278.1	1.3843	0.1502	673.44	2	6000.0%	1	R.KVLGEK.G
	TK261102_lung_cytoE18_2_step07.2780.2780.1	1.1137	0.053	868.8	3	5830.0%	4	R.MQHLIAR.E
	TK261102_lung_cytoE18_2_step01.4402.4402.3	1.2043	0.1657	2757.68	1	1700.0%	1	K.GDVVIVLTGWRPGSGFTNTMRVVPVP.-
UQ9D1A299.6%114.8%475527675.7(Q9D1A2) 0610010E05Rik protein (RIKEN cDNA 0610010E05 gene) 
	TK261102_lung_cytoE18_2_step12.2829.2829.2	3.2718	0.5405	2642.27	1	3860.0%	1	K.VYMGHGGKPWVSDFNHPHYQAGR.R
UQ9DCZ799.6%246.2%339376354.8(Q9DCZ7) WD40 protein Ciao1 
	TK261102_lung_cytoE18_2_step09.3693.3693.2	3.5269	0.5544	2383.95	1	5000.0%	2	K.HVVWHPSQELLASASYDDTVK.L
UFETA_MOUSE99.6%4526531.4%605673375.9(P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) 
*	TK261102_lung_cytoE18_2_step03.0032.0032.2	0.8784	0.0833	2014.3	209	1760.0%	1	R.NPFMYAPAILSLAAQYDK.V
*	TK261102_lung_cytoE18_2_step05.0842.0842.2	3.598	0.5998	1688.34	1	7000.0%	10	R.KAPQLTSAELIDLTGK.M
*	TK261102_lung_cytoE18_2_step01.2028.2028.1	1.5197	0.1876	914.9	1	6670.0%	1	R.FIYEVSR.R
*	TK261102_lung_cytoE18_2_step07.2704.2704.1	1.6528	0.2336	898.72	7	5830.0%	4	R.HQCLLAR.K
*	TK261102_lung_cytoE18_2_step10.3449.3449.3	1.2425	0.09	4503.82	4	1030.0%	2	K.WSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNR.R
*	TK261102_lung_cytoE18_2_step10.5047.5047.2	1.2603	0.2622	2682.76	1	2390.0%	3	K.NVLSIATITFTQFVPEATEEEVNK.M
*	TK261102_lung_cytoE18_2_step01.4998.4998.2	1.3151	0.225	3083.02	1	1920.0%	1	K.NSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK261102_lung_cytoE18_2_step11.0076.0076.2	1.0613	0.1301	1348.26	9	3180.0%	7	R.THPNLPVSVILR.I
*	TK261102_lung_cytoE18_2_step01.1430.1430.1	1.1076	0.0862	691.41	4	7000.0%	1	K.ALQTMK.Q
*	TK261102_lung_cytoE18_2_step04.2373.2373.2	2.3527	0.4906	2520.08	1	3640.0%	3	K.QKPELTEEQLAAVTADFSGLLEK.C
*	TK261102_lung_cytoE18_2_step01.0011.0011.1	1.5756	0.26	1143.54	1	5000.0%	3	K.HIEESQALSK.Q
USPCO_MOUSE99.6%8105.7%23632744216.0(Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) 
	TK261102_lung_cytoE18_2_step08.4257.4257.2	3.9903	0.5969	1985.03	1	6250.0%	2	R.MHTTFEHDIQALGTQVR.Q
	TK261102_lung_cytoE18_2_step06.3445.3445.2	3.3112	0.5742	1775.77	1	6790.0%	1	K.KHEAIETDIAAYEER.V
	TK261102_lung_cytoE18_2_step07.3764.3764.1	1.2303	0.1204	1179.71	96	5000.0%	1	R.KHEWEAHNK.K
	TK261102_lung_cytoE18_2_step10.1659.1659.1	1.5175	0.1253	683.48	1	8000.0%	1	R.LPKPTK.G
	TK261102_lung_cytoE18_2_step08.5532.5532.2	0.9811	0.101	3001.85	6	1800.0%	1	R.LEEASLLHQFQADADDIDAWMLDILK.I
*	TK261102_lung_cytoE18_2_step11.3258.3258.3	4.3434	0.6334	4014.35	1	2500.0%	1	K.HKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVK.G
	TK261102_lung_cytoE18_2_step01.2738.2738.2	1.4507	0.0357	3139.34	2	2200.0%	1	K.MIEKYESLASDLLEWIEQTIIILNNR.K
U6PGD_MOUSE99.6%71117.0%482531167.2(Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 
	TK261102_lung_cytoE18_2_step10.1172.1172.1	0.8414	0.0039	542.89	1	6250.0%	2	K.LKGPK.V
	TK261102_lung_cytoE18_2_step11.3146.3146.3	1.3329	0.0182	3023.94	8	2080.0%	1	R.NPELQNLLLDDFFKSAVDNCQDSWR.R
	TK261102_lung_cytoE18_2_step11.4636.4636.3	3.9492	0.5323	3932.66	1	1860.0%	1	R.DYFGAHTYELLTKPGEFIHTNWTGHGGSVSSSSYNA.-
	TK261102_lung_cytoE18_2_step11.0596.0596.1	0.8894	0.0017	400.46	2	10000.0%	1	K.KPR.R
	TK261102_lung_cytoE18_2_step05.0251.0251.1	1.8733	0.2007	1522.12	1	5000.0%	2	R.HEMLPANLIQAQR.D
U2AAA_HUMAN99.6%468.0%588650925.1(P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) 
	TK261102_lung_cytoE18_2_step10.3247.3247.1	1.077	0.2004	966.71	1	6430.0%	1	K.HMLPTVLR.M
	TK261102_lung_cytoE18_2_step11.3356.3356.2	3.9541	0.6994	2216.88	1	4210.0%	2	R.AISHEHSPSDLEAHFVPLVK.R
	TK261102_lung_cytoE18_2_step05.4198.4198.2	1.0652	0.288	2237.67	5	1670.0%	1	K.TDLVPAFQNLMKDCEAEVR.A
UUBCI_HUMAN99.6%4615.2%158180078.7(P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) 
	TK261102_lung_cytoE18_2_step11.3013.3013.1	2.4401	0.4532	1445.76	1	4170.0%	2	R.KDHPFGFVAVPTK.N
	TK261102_lung_cytoE18_2_step07.4117.4117.1	1.1195	0.1798	1220.04	1	3500.0%	1	K.KGTPWEGGLFK.L
URAC1_HUMAN99.6%5137.3%192214508.5(P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) 
	TK261102_lung_cytoE18_2_step12.2733.2733.1	2.8014	0.5394	1589.04	1	4230.0%	3	R.HHCPNTPIILVGTK.L
UITH2_MOUSE99.6%133312.2%9461059287.3(Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) 
*	TK261102_lung_cytoE18_2_step11.5486.5486.3	1.0906	0.1429	4332.95	56	710.0%	1	K.LVNNSPLPQSVVFDVQIPKGAFISNFTMTVNGMTFTSSIK.E
	TK261102_lung_cytoE18_2_step12.2136.2136.1	1.0012	0.0147	1466.14	43	3640.0%	1	K.KFYNQVSTPLLR.N
*	TK261102_lung_cytoE18_2_step11.4017.4017.2	3.0838	0.5497	2255.69	1	4470.0%	1	R.FLHVPDTFEGHFQGVPVISK.G
*	TK261102_lung_cytoE18_2_step10.1905.1905.1	1.1123	0.1166	961.62	7	4290.0%	1	R.KLGSYEHK.I
	TK261102_lung_cytoE18_2_step11.2053.2053.2	3.1647	0.588	1469.53	1	7080.0%	1	K.AHVSFKPTVAQQR.K
	TK261102_lung_cytoE18_2_step01.2126.2126.1	1.0879	0.0415	1583.11	3	3570.0%	1	K.IQPSGGTNINEALLR.A
*	TK261102_lung_cytoE18_2_step08.2491.2491.1	1.21	0.0906	794.75	48	5000.0%	5	K.IHLQPGK.L
*	TK261102_lung_cytoE18_2_step06.2718.2718.3	1.3784	0.0855	2094.82	36	2220.0%	1	K.LVNNSPLPQSVVFDVQIPK.G
UNPM_MOUSE99.6%2211.3%292325604.8(Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38) 
	TK261102_lung_cytoE18_2_step05.0969.0969.2	3.698	0.366	2931.32	1	3330.0%	1	R.TVSLGAGAKDELHIVEAEAMNYEGSPIK.V
	TK261102_lung_cytoE18_2_step09.2239.2239.1	0.7759	0.0161	707.62	14	6250.0%	1	K.DYHFK.V
UQ9D9F999.6%2220.6%218252267.9(Q9D9F9) C330027I04Rik protein 
	TK261102_lung_cytoE18_2_step12.2305.2305.3	1.7202	0.0037	2770.41	5	2020.0%	1	K.TNIILLGDSIGDLTMADGVPGVQNILK.I
	TK261102_lung_cytoE18_2_step09.4249.4249.2	3.8235	0.5983	2309.77	1	4710.0%	1	K.ELTELFHHYYPIEIDPHR.T
USM30_MOUSE99.6%245.0%299334075.3(Q64374) Senescence marker protein-30 (SMP-30) (Regucalcin) (RC) 
*	TK261102_lung_cytoE18_2_step10.3697.3697.2	1.407	0.1331	1716.88	1	3930.0%	2	R.HQGSLYSLFPDHSVK.K
UMK01_MOUSE99.6%4416.5%358412767.0(P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) 
	TK261102_lung_cytoE18_2_step01.2754.2754.2	1.1757	0.06	2147.13	5	2500.0%	1	R.VADPDHDHTGFLTEYVATR.W
	TK261102_lung_cytoE18_2_step05.0966.0966.3	3.6739	0.5753	3519.65	1	2590.0%	1	K.RIEVEQALAHPYLEQYYDPSDEPIAEAPFK.F
	TK261102_lung_cytoE18_2_step11.2106.2106.2	2.1056	0.4517	1210.23	1	8890.0%	1	K.YIHSANVLHR.D
UIF5A_HUMAN99.6%2622440.5%153167015.2(P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) 
	TK261102_lung_cytoE18_2_step01.2038.2038.1	1.258	0.1942	905.71	2	5710.0%	1	R.KNGFVVLK.G
	TK261102_lung_cytoE18_2_step11.0039.0039.1	2.9914	0.5148	1301.89	1	5000.0%	13	K.VHLVGIDIFTGK.K
	TK261102_lung_cytoE18_2_step10.0074.0074.2	0.9277	0.0301	2740.22	8	1960.0%	5	K.RNDFQLIGIQDGYLSLLQDSGEVR.E
	TK261102_lung_cytoE18_2_step01.2003.2003.2	2.8979	0.3969	2165.2	1	4710.0%	2	K.KYEDICPSTHNMDVPNIK.R
UQ9CZ4499.6%6109.5%370407105.1(Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence 
	TK261102_lung_cytoE18_2_step07.2926.2926.2	2.5199	0.5733	1692.47	1	6070.0%	2	R.LAHGGQVNLDMEDHR.D
	TK261102_lung_cytoE18_2_step09.3022.3022.2	2.149	0.3524	2651.17	4	2500.0%	1	R.LAHGGQVNLDMEDHRDEDFVKPK.G
	TK261102_lung_cytoE18_2_step09.4526.4526.2	1.5333	0.0482	1849.96	16	3000.0%	1	R.RLAHGGQVNLDMEDHR.D
*	TK261102_lung_cytoE18_2_step08.2975.2975.1	1.3195	0.0915	1218.72	3	4500.0%	2	R.HSGQDVHVVLK.L
USBP2_MOUSE99.6%178314.0%472526286.2(Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56) 
*	TK261102_lung_cytoE18_2_step09.5566.5566.2	1.3835	0.2197	2388.52	1	3250.0%	7	K.GWMLPEMPGLITDILLSLDDR.F
*	TK261102_lung_cytoE18_2_step03.0580.0580.2	3.3362	0.6682	2408.45	1	4520.0%	4	R.FLHDPSATQGFVGCALSSNIQR.F
	TK261102_lung_cytoE18_2_step11.4694.4694.2	2.9709	0.5331	2549.12	1	3640.0%	1	K.LNPNFLVDFGKEPLGPALAHELR.Y
	TK261102_lung_cytoE18_2_step06.3746.3746.1	1.3344	0.3021	1305.74	1	3180.0%	4	K.EPLGPALAHELR.Y
UQ9CVB699.6%61216.5%170199138.4(Q9CVB6) 2210023N03Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step12.3163.3163.2	1.2581	0.0894	2258.57	1	2630.0%	1	R.ASHTAPQVLFSHREPPLELK.D
	TK261102_lung_cytoE18_2_step11.2592.2592.2	2.5397	0.5438	1451.81	1	7080.0%	1	R.ASHTAPQVLFSHR.E
	TK261102_lung_cytoE18_2_step09.2795.2795.1	2.3471	0.3231	1090.64	1	6430.0%	3	R.DYLHYHIK.C
UYB1_MOUSE99.6%178115.5%322357309.9(P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) 
	TK261102_lung_cytoE18_2_step09.1530.1530.2	2.2149	0.3934	1267.55	4	5500.0%	2	R.RPENPKPQDGK.E
	TK261102_lung_cytoE18_2_step10.1307.1307.1	0.7542	0.0174	592.68	7	5000.0%	8	R.RYPR.R
	TK261102_lung_cytoE18_2_step09.2475.2475.3	3.9841	0.4787	3225.24	1	2410.0%	2	R.RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.Q
	TK261102_lung_cytoE18_2_step08.1547.1547.1	0.6534	0.3346	428.47	8	5000.0%	1	R.GPPR.N
	TK261102_lung_cytoE18_2_step11.1094.1094.1	1.2179	0.3747	1424.89	1	2730.0%	2	R.RRPENPKPQDGK.E
UHBE_MOUSE99.6%5731.5%146160058.2(P02104) Hemoglobin epsilon-Y2 chain 
	TK261102_lung_cytoE18_2_step07.3500.3500.2	2.8369	0.2847	2082.51	1	4690.0%	2	K.LSELHCDKLHVDPENFK.L
	TK261102_lung_cytoE18_2_step01.3866.3866.2	3.4652	0.5526	2019.7	1	5560.0%	1	R.FFDSFGNLSSASAIMGNPR.V
	TK261102_lung_cytoE18_2_step01.2547.2547.1	1.3379	0.0618	1065.74	1	6670.0%	1	K.VLTAFGESIK.N
	TK261102_lung_cytoE18_2_step01.2240.2240.1	1.4917	0.1682	1002.0	1	6430.0%	1	K.LSELHCDK.L
UACLY_MOUSE99.6%15318.3%10911197287.4(Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) 
	TK261102_lung_cytoE18_2_step10.1664.1664.1	0.7028	0.0376	874.32	59	4290.0%	1	K.LLVGVDEK.L
	TK261102_lung_cytoE18_2_step08.4320.4320.2	1.5121	0.0661	1872.83	2	2500.0%	3	K.GVTIIGPATVGGIKPGCFK.I
	TK261102_lung_cytoE18_2_step07.2321.2321.1	1.3773	0.1965	1248.8	1	4500.0%	3	R.RGGPNYQEGLR.V
	TK261102_lung_cytoE18_2_step08.3499.3499.1	1.2871	0.0659	786.51	3	7000.0%	1	K.SWLKPR.L
*	TK261102_lung_cytoE18_2_step10.2616.2616.1	1.9544	0.2891	1160.73	1	6110.0%	2	R.HLLVHAPEDK.K
	TK261102_lung_cytoE18_2_step10.1899.1899.3	1.5906	0.1142	2120.0	14	2220.0%	1	R.DEPSVAAMVYPFTGDHKQK.F
*	TK261102_lung_cytoE18_2_step11.2100.2100.2	2.7763	0.5023	1287.95	1	7500.0%	1	R.HLLVHAPEDKK.E
	TK261102_lung_cytoE18_2_step06.5270.5270.2	1.4675	0.3489	1971.79	1	3440.0%	2	K.QHFPATPLLDYALEVEK.I
UDPY2_MOUSE99.6%2611230.8%572621716.4(O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) 
	TK261102_lung_cytoE18_2_step07.3801.3801.2	1.3798	0.2688	2170.43	4	3420.0%	2	R.NLHQSGFSLSGAQIDDNIPR.R
	TK261102_lung_cytoE18_2_step07.5348.5348.2	3.972	0.4408	3140.77	1	3280.0%	6	K.AALAGGTTMIIDHVVPEPGTSLLAAFDQWR.E
	TK261102_lung_cytoE18_2_step01.2458.2458.1	1.6725	0.344	1296.0	1	5000.0%	3	R.MVIPGGIDVHTR.F
	TK261102_lung_cytoE18_2_step06.4152.4152.2	4.0802	0.6614	2555.26	1	5220.0%	1	K.KGTVVYGEPITASLGTDGSHYWSK.N
	TK261102_lung_cytoE18_2_step01.2119.2119.1	1.6347	0.1451	1085.08	1	6500.0%	1	R.GSPLVVISQGK.I
*	TK261102_lung_cytoE18_2_step06.4713.4713.2	4.8507	0.5685	2074.89	1	6880.0%	3	K.THNSALEYNIFEGMECR.G
	TK261102_lung_cytoE18_2_step09.4069.4069.3	1.3352	0.0702	2751.42	45	1540.0%	1	R.GSPLVVISQGKIVLEDGTLHVTEGSGR.Y
	TK261102_lung_cytoE18_2_step03.0587.0587.2	1.9061	0.2589	2901.54	3	2120.0%	1	R.ILDLGITGPEGHVLSRPEEVEAEAVNR.S
*	TK261102_lung_cytoE18_2_step01.1803.1803.1	0.9635	0.0427	1015.68	2	5560.0%	1	K.SAAEVIAQAR.K
	TK261102_lung_cytoE18_2_step06.3878.3878.1	2.2047	0.27	1142.96	1	7500.0%	7	R.KPFPDFVYK.R
UHS74_MOUSE99.6%6108.8%841941335.2(Q61316) Heat shock 70-related protein APG-2 
*	TK261102_lung_cytoE18_2_step12.2275.2275.3	1.3436	0.063	3027.01	141	1250.0%	1	K.ETAESVLKKPVVDCVVSVPSFYTDAER.R
	TK261102_lung_cytoE18_2_step07.4477.4477.2	1.5339	0.1485	1999.23	1	4000.0%	2	R.KFDEVLVNHFCEEFGK.K
	TK261102_lung_cytoE18_2_step07.2248.2248.1	1.951	0.3605	871.58	1	7140.0%	2	K.NHAAPFSK.V
	TK261102_lung_cytoE18_2_step05.5030.5030.3	1.336	0.0078	2816.59	21	1820.0%	1	K.LEDTENWLYEDGEDQPKQVYVDK.L
UQ9DBR199.6%335.0%9511086877.6(Q9DBR1) 5'-3' exoribonuclease 2 
	TK261102_lung_cytoE18_2_step11.2329.2329.2	1.8715	0.2605	1469.92	1	5830.0%	1	R.KPATVLKPGDWEK.S
	TK261102_lung_cytoE18_2_step08.4984.4984.3	1.6957	0.0177	3789.14	11	1400.0%	1	R.TLGHVTPRGSGTSVYTNTALPPANYQGNNYRPLLR.G
UPUR8_MOUSE99.6%578.9%484548087.3(P54822) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylosuccinase) (ASL) (ASASE) 
	TK261102_lung_cytoE18_2_step11.0638.0638.1	0.8423	0.0342	444.51	3	10000.0%	1	R.RIR.Q
*	TK261102_lung_cytoE18_2_step05.0921.0921.2	1.6622	0.3442	2363.55	1	3420.0%	2	R.FLEEEVRPLLKPYGNEMAVK.A
	TK261102_lung_cytoE18_2_step12.2248.2248.2	1.0466	0.0558	1934.9	15	2670.0%	1	R.HDVMAHVHTFGHCCPK.A
	TK261102_lung_cytoE18_2_step09.1033.1033.1	1.1205	0.1941	422.47	3	8330.0%	1	K.AGFK.R
USODC_MOUSE99.6%71531.4%153158116.5(P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) 
*	TK261102_lung_cytoE18_2_step06.3673.3673.1	2.2665	0.2965	1368.83	1	5420.0%	2	R.VISLSGEHSIIGR.T
*	TK261102_lung_cytoE18_2_step12.3556.3556.2	1.0254	0.0305	2119.88	2	2500.0%	1	K.HGGPADEERHVGDLGNVTAGK.D
*	TK261102_lung_cytoE18_2_step01.1896.1896.1	1.8164	0.3311	1512.9	2	3850.0%	1	K.GDGPVQGTIHFEQK.A
*	TK261102_lung_cytoE18_2_step01.1799.1799.1	2.7917	0.5323	1169.69	1	6360.0%	3	R.HVGDLGNVTAGK.D
UPL10_MOUSE99.6%7916.8%660731417.2(P16381) Putative ATP-dependent RNA helicase PL10 
*	TK261102_lung_cytoE18_2_step11.5898.5898.3	1.6152	0.0613	3986.93	2	1410.0%	2	R.SGGGSHGSSRGFGGGSYGGFYNSDGYGGNYSSQGVDWWGN.-
	TK261102_lung_cytoE18_2_step01.2596.2596.1	0.896	0.055	1524.85	64	2690.0%	1	R.VGNLGLATSFFNER.N
*	TK261102_lung_cytoE18_2_step05.3850.3850.1	0.9901	0.148	1230.23	31	3330.0%	1	K.VVWVEEADKR.S
	TK261102_lung_cytoE18_2_step06.5040.5040.2	3.0765	0.5902	2085.98	1	5000.0%	1	K.HVINFDLPSDIEEYVHR.I
	TK261102_lung_cytoE18_2_step12.5455.5455.3	1.3445	0.034	2661.89	119	1700.0%	1	K.QYPISLVLAPTRELAVQIYEEAR.K
	TK261102_lung_cytoE18_2_step10.2768.2768.1	1.11	0.2162	791.43	10	5000.0%	1	K.HAIPIIK.E
U143E_HUMAN99.6%103219.2%255291744.7(P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) 
	TK261102_lung_cytoE18_2_step01.2500.2500.2	2.1698	0.3279	1822.62	1	4380.0%	2	K.AASDIAMTELPPTHPIR.L
	TK261102_lung_cytoE18_2_step11.3661.3661.2	0.8035	0.0603	2439.02	7	2110.0%	1	R.QMVETELKLICCDILDVLDK.H
	TK261102_lung_cytoE18_2_step05.3473.3473.1	1.9429	0.4288	1239.6	1	5910.0%	5	K.HLIPAANTGESK.V
UQ9D81999.6%51311.4%289326675.6(Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene) 
	TK261102_lung_cytoE18_2_step06.0432.0432.2	2.6399	0.4534	2232.33	1	3890.0%	3	R.YKVPDGKPENEFAFNAEFK.N
	TK261102_lung_cytoE18_2_step10.4515.4515.2	2.7738	0.556	1696.72	1	6150.0%	2	R.LKPGYLEATVDWFR.R
UO8873899.6%661.9%48455284296.1(O88738) Ubiquitin-conjugating enzyme 
*	TK261102_lung_cytoE18_2_step05.3389.3389.1	0.7509	0.0428	736.34	25	5000.0%	1	K.KTSICK.E
*	TK261102_lung_cytoE18_2_step06.1200.1200.2	0.7788	0.0386	2716.89	142	1190.0%	1	R.IELMAQCEEWIADIQQYSSDKR.V
	TK261102_lung_cytoE18_2_step07.2893.2893.2	1.7483	0.0616	1913.81	3	3240.0%	1	K.KINQNVAALPVASSVMDR.L
	TK261102_lung_cytoE18_2_step08.1876.1876.1	1.0226	0.0056	686.5	11	6250.0%	1	K.ERVQR.C
*	TK261102_lung_cytoE18_2_step07.4525.4525.2	0.953	0.1009	2344.93	39	2000.0%	1	K.IDVSSTEGYDLFITQLKDGLK.N
*	TK261102_lung_cytoE18_2_step12.2579.2579.2	3.2077	0.5443	1946.92	1	5000.0%	1	R.INATSHVIQHPMFGAGHK.F
UCALM_HUMAN99.6%2236.5%148167064.2(P02593) Calmodulin (P02593) Calmodulin 
	TK261102_lung_cytoE18_2_step01.2939.2939.2	3.4372	0.5386	1845.63	1	5310.0%	1	K.EAFSLFDKDGDGTITTK.E
	TK261102_lung_cytoE18_2_step01.5043.5043.3	1.3925	0.1934	4074.86	4	1320.0%	1	R.SLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR.K
UQ9D8S999.6%4632.8%137143798.8(Q9D8S9) 1810037G04Rik protein 
*	TK261102_lung_cytoE18_2_step11.3237.3237.2	1.2657	0.2944	2299.8	2	2620.0%	2	R.LVHEALSEELAGPVHALAIQAK.T
*	TK261102_lung_cytoE18_2_step04.4681.4681.2	0.8445	0.0216	3039.89	19	1480.0%	1	R.LVHEALSEELAGPVHALAIQAKTPAQWR.E
*	TK261102_lung_cytoE18_2_step07.2326.2326.2	1.7995	0.029	1753.97	5	4060.0%	1	R.NESGGHAVPAGSETHFR.V
UNDR2_MOUSE99.6%2210.0%371407895.4(Q9QYG0) NDRG2 protein (Ndr2 protein) 
*	TK261102_lung_cytoE18_2_step11.3274.3274.2	2.0344	0.3692	1794.58	1	5710.0%	1	K.RPAIFTYHDVGLNYK.S
*	TK261102_lung_cytoE18_2_step09.4518.4518.2	3.4076	0.579	2659.2	1	4520.0%	1	R.GIIQHAPNLENIELYWNSYNNR.R
ULIS1_MOUSE99.6%4108.6%409465397.4(P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) 
	TK261102_lung_cytoE18_2_step11.2557.2557.2	3.3662	0.5987	2773.44	1	3600.0%	3	R.TMHGHDHNVSSVAIMPNGDHIVSASR.D
	TK261102_lung_cytoE18_2_step07.3229.3229.1	1.3166	0.0341	902.7	10	5000.0%	1	R.GVLFHSGGK.F
UGCAA_MOUSE99.6%469.1%330363897.4(P01863) Ig gamma-2A chain C region, A allele 
	TK261102_lung_cytoE18_2_step10.1867.1867.2	1.9541	0.2868	1255.41	1	6000.0%	1	R.GPTIKPCPPCK.C
	TK261102_lung_cytoE18_2_step11.1830.1830.2	1.6396	0.4352	2208.87	1	3890.0%	2	R.NSYSCSVVHEGLHNHHTTK.S
UQ9D91099.6%1110.0%210224516.5(Q9D910) 1810013B01Rik protein 
*	TK261102_lung_cytoE18_2_step08.4068.4068.2	3.4137	0.441	2482.9	1	3750.0%	1	R.VLVMEGAGHPCYLDKPDEWHK.G
UIDI1_MOUSE99.6%3511.9%227262896.2(P58044) Isopentenyl-diphosphate delta-isomerase 1 (EC 5.3.3.2) (IPP isomerase 1) (Isopentenyl pyrophosphate isomerase 1) (IPPI1) 
*	TK261102_lung_cytoE18_2_step08.2296.2296.1	1.2324	0.2712	1384.63	3	4000.0%	1	K.KNCHLNENIDK.G
*	TK261102_lung_cytoE18_2_step07.4768.4768.2	2.9662	0.4678	2038.82	1	5330.0%	2	K.WWDNLNHLSPFVDHEK.I
UQ920C799.6%4429.5%281297296.1(Q920C7) CDV-3B (Pp36) (Carnitine deficiency-associated protein CDV3B) 
	TK261102_lung_cytoE18_2_step11.0848.0848.2	0.6269	0.0373	1099.52	153	2500.0%	1	R.SLDNFFAKR.D
	TK261102_lung_cytoE18_2_step05.0370.0370.3	1.4318	0.2611	3243.87	1	1690.0%	1	K.TAPVQAPPAPVTVTETPEPAMPSGVYRPPGAR.L
	TK261102_lung_cytoE18_2_step06.0739.0739.2	0.9199	0.1558	1946.48	28	1670.0%	1	K.REDPGDNWEEGGGGSGAEK.S
	TK261102_lung_cytoE18_2_step05.0410.0410.2	3.2412	0.4199	2521.4	1	3860.0%	1	R.KTPQGPPEIYSDTQFPSLQSTAK.H
UMLEN_MOUSE99.6%95127.0%141157314.9(Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) 
	TK261102_lung_cytoE18_2_step01.4994.4994.2	3.5431	0.5469	1891.16	1	5330.0%	1	K.VLDFEHFLPMLQTVAK.N
	TK261102_lung_cytoE18_2_step06.5185.5185.1	1.2695	0.0311	1483.74	4	2920.0%	1	K.EAFQLFDRTGDGK.I
	TK261102_lung_cytoE18_2_step07.3349.3349.1	3.0916	0.4036	997.76	1	6880.0%	7	R.HVLVTLGEK.M
UQ99LJ399.6%7929.0%400459185.0(Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) 
	TK261102_lung_cytoE18_2_step11.5152.5152.3	4.3186	0.5426	4367.38	1	1760.0%	1	R.AAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFK.A
*	TK261102_lung_cytoE18_2_step01.3982.3982.2	2.3108	0.3545	2444.29	1	3950.0%	1	K.IDQLECDHQLIQEALIFDNK.H
*	TK261102_lung_cytoE18_2_step10.2292.2292.1	1.5034	0.0651	1316.52	5	5000.0%	2	K.HTNYNMEHIR.V
	TK261102_lung_cytoE18_2_step09.3167.3167.2	1.6018	0.0528	2290.63	1	4470.0%	1	R.ASFNHFDRDHSGTLGPEEFK.A
	TK261102_lung_cytoE18_2_step06.4633.4633.2	3.0918	0.495	1979.96	1	5310.0%	1	R.ISIEMHGTLEDQLSHLR.Q
	TK261102_lung_cytoE18_2_step04.4802.4802.2	3.1161	0.3623	1326.58	1	9000.0%	1	R.RDQALTEEHAR.Q
UQ91WK299.6%4611.6%352398326.7(Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD) 
	TK261102_lung_cytoE18_2_step09.3413.3413.2	2.1966	0.4293	2079.84	1	3420.0%	2	K.SAVADKHELLSLASSNHLGK.S
	TK261102_lung_cytoE18_2_step08.2087.2087.1	1.2863	0.0578	963.8	2	4500.0%	1	K.GKGGSGDSAVK.Q
*	TK261102_lung_cytoE18_2_step12.1620.1620.1	1.804	0.3049	1167.18	1	6110.0%	1	K.LFKPHQAPAR.M
USBP1_MOUSE99.6%2812629.4%472523526.4(P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56) 
	TK261102_lung_cytoE18_2_step10.4819.4819.2	1.1777	0.0046	1669.62	2	4170.0%	1	R.FLYFSNWLHGDIR.Q
	TK261102_lung_cytoE18_2_step01.3804.3804.1	1.1474	0.1905	1543.94	2	3460.0%	1	K.GSFVLLDGETFEVK.G
	TK261102_lung_cytoE18_2_step06.4501.4501.2	4.3776	0.6745	1833.97	1	6330.0%	8	R.HNVMVSTEWAAPNVFK.D
	TK261102_lung_cytoE18_2_step11.3449.3449.2	4.2966	0.658	1710.92	1	6670.0%	1	K.RIPGGPQMIQLSLDGK.R
	TK261102_lung_cytoE18_2_step01.3167.3167.1	1.0035	0.0487	1557.57	6	2860.0%	2	R.IPGGPQMIQLSLDGK.R
*	TK261102_lung_cytoE18_2_step08.4687.4687.3	1.2443	0.0494	4684.27	4	990.0%	1	K.CNVSSLHTSHCLASGEVMVSTLGDLQGNGKGSFVLLDGETFEVK.G
	TK261102_lung_cytoE18_2_step07.2452.2452.1	1.5394	0.1983	1216.76	1	4440.0%	4	K.SPQYSQVIHR.L
*	TK261102_lung_cytoE18_2_step03.0521.0521.2	3.6459	0.5837	2476.27	1	4250.0%	2	K.GTWEKPGDAAPMGYDFWYQPR.H
	TK261102_lung_cytoE18_2_step07.5236.5236.2	4.4946	0.5387	2222.43	1	6110.0%	5	R.HEIIQTLQMTDGLIPLEIR.F
US142_MOUSE99.6%72710.2%403463007.1(Q99J08) SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) 
	TK261102_lung_cytoE18_2_step06.2636.2636.1	1.4363	0.3353	687.56	1	7500.0%	1	K.HVEFR.K
	TK261102_lung_cytoE18_2_step09.4318.4318.2	2.5321	0.391	2094.18	1	4120.0%	5	R.GSSHQVEYEILFPGCVLR.W
*	TK261102_lung_cytoE18_2_step05.3397.3397.3	1.1147	0.0824	2070.45	90	1760.0%	1	K.IISWQPPEVIQQYLSGGR.C
UMDHC_MOUSE99.6%113321.0%333363466.6(P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) 
	TK261102_lung_cytoE18_2_step09.2746.2746.2	1.1041	0.2168	2441.05	5	1960.0%	1	K.VIVVGNPANTNCLTASKSAPSIPK.E
	TK261102_lung_cytoE18_2_step01.1539.1539.1	0.6691	0.0047	701.56	54	3330.0%	1	K.SAPSIPK.E
	TK261102_lung_cytoE18_2_step08.3869.3869.2	4.3029	0.5645	2284.33	1	5260.0%	5	K.NVIIWGNHSSTQYPDVNHAK.V
*	TK261102_lung_cytoE18_2_step01.0152.0152.1	1.2643	0.1464	660.01	4	7000.0%	2	K.SQIALK.L
	TK261102_lung_cytoE18_2_step04.0334.0334.1	1.2975	0.1152	616.46	9	6250.0%	1	R.KDLLK.A
	TK261102_lung_cytoE18_2_step01.3676.3676.2	1.9825	0.2707	1752.85	1	5360.0%	1	K.EVGVYEALKDDSWLK.G
UCLP2_MOUSE99.6%51113.1%305331567.6(Q08093) Calponin H2, smooth muscle 
	TK261102_lung_cytoE18_2_step09.1197.1197.1	0.8483	0.0572	525.7	16	6670.0%	1	K.YSEK.Q
	TK261102_lung_cytoE18_2_step07.4832.4832.2	2.4343	0.1631	1989.85	1	5000.0%	3	R.SMQNWHQLENLSNFIK.A
*	TK261102_lung_cytoE18_2_step11.3337.3337.2	2.8527	0.3009	2308.54	1	3680.0%	1	K.NHILPPMDHCTISLQMGTNK.C
UQ9DAB499.6%244.3%391428906.7(Q9DAB4) 1700015E05Rik protein 
	TK261102_lung_cytoE18_2_step10.3332.3332.2	3.0332	0.4826	1819.78	1	5000.0%	2	K.HQSLGGQYGVQGFPTIK.I
USAHH_MOUSE99.6%4107.4%431475576.5(P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) 
*	TK261102_lung_cytoE18_2_step09.3710.3710.2	1.5603	0.2953	2233.91	1	3610.0%	1	K.QAQYLGMPINGPFKPDHYR.Y
	TK261102_lung_cytoE18_2_step05.0048.0048.1	1.685	0.1688	1380.82	1	4170.0%	3	K.KLDEAVAEAHLGK.L
UQ9D0A999.6%1119.9%1461746110.4(Q9D0A9) 2610030F17Rik protein 
	TK261102_lung_cytoE18_2_step01.4268.4268.3	3.1596	0.5257	3452.58	1	2320.0%	1	K.EQQEAIEHIDEVQNEIDRLNEQASEEILK.V
UCAZ1_MOUSE99.6%51312.3%284327525.6(P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment) 
	TK261102_lung_cytoE18_2_step06.4521.4521.2	2.5529	0.5405	2090.97	1	5290.0%	2	K.FITHAPPGEFNEVFNDVR.L
	TK261102_lung_cytoE18_2_step06.3400.3400.2	1.392	0.1318	2031.65	2	3440.0%	3	K.IQVHYYEDGNVQLVSHK.D
UBIN1_MOUSE99.6%466.5%588644705.0(O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) 
	TK261102_lung_cytoE18_2_step11.2494.2494.3	1.6609	0.0121	2779.93	6	2070.0%	1	R.VGFYVNTFQSIAGLEENFHKEMSK.L
	TK261102_lung_cytoE18_2_step10.2005.2005.1	1.9705	0.451	1215.65	1	5000.0%	2	R.HHYESLQTAK.K
	TK261102_lung_cytoE18_2_step08.1959.1959.1	0.8154	0.0181	517.53	16	5000.0%	1	K.KLTR.A
ULDHB_MOUSE99.6%51117.1%333364416.1(P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H) 
	TK261102_lung_cytoE18_2_step10.3927.3927.2	3.8244	0.531	2174.87	1	5560.0%	1	K.LKGEMMDLQHGSLFLQTPK.I
	TK261102_lung_cytoE18_2_step07.3460.3460.3	1.3615	3.0E-4	3236.89	33	1520.0%	1	K.GMYGIENEVFLSLPCILNARGLTSVINQK.L
	TK261102_lung_cytoE18_2_step08.3105.3105.1	1.3979	0.1743	1013.5	6	4380.0%	3	R.IHPVSTMVK.G
UPSD8_MOUSE99.6%246.2%257300266.4(Q9CX56) 26S proteasome non-ATPase regulatory subunit 8 (26S proteasome regulatory subunit S14) 
	TK261102_lung_cytoE18_2_step07.4452.4452.2	2.5721	0.5802	1895.69	1	5000.0%	2	K.HPVSLEQYLMEGSYNK.V
UPDX1_MOUSE99.6%154933.2%199221768.1(P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) 
*	TK261102_lung_cytoE18_2_step01.2016.2016.1	1.0517	0.1076	1006.8	1	5000.0%	1	K.IGYPAPNFK.A
*	TK261102_lung_cytoE18_2_step07.4398.4398.2	3.1407	0.4113	1767.86	1	5940.0%	4	K.KQGGLGPMNIPLISDPK.R
*	TK261102_lung_cytoE18_2_step01.3564.3564.2	3.5037	0.3238	1640.52	1	5670.0%	1	K.QGGLGPMNIPLISDPK.R
*	TK261102_lung_cytoE18_2_step09.2734.2734.2	3.674	0.4515	2396.42	1	4290.0%	5	K.HGEVCPAGWKPGSDTIKPDVNK.S
	TK261102_lung_cytoE18_2_step01.3156.3156.1	2.2523	0.2523	922.9	4	6430.0%	2	R.GLFIIDDK.G
	TK261102_lung_cytoE18_2_step01.2595.2595.1	1.9295	0.3044	1198.09	3	5560.0%	1	R.LVQAFQFTDK.H
UIDE_HUMAN99.6%578.4%10181178906.8(P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) 
*	TK261102_lung_cytoE18_2_step06.2920.2920.3	1.3672	0.1527	2721.28	65	1790.0%	1	K.NVPLPEFPEHPFQEEHLKQLYK.I
*	TK261102_lung_cytoE18_2_step12.3999.3999.2	3.8534	0.6654	2515.49	1	3700.0%	2	K.SNPGHYLGHLIGHEGPGSLLSELK.S
*	TK261102_lung_cytoE18_2_step06.5546.5546.2	0.945	0.0844	2852.34	1	2050.0%	1	K.YWGEIISQQYNFDRDNTEVAYLK.T
*	TK261102_lung_cytoE18_2_step10.3605.3605.2	0.9676	0.1586	2180.96	7	1880.0%	1	R.FAQFFLCPLFDESCKDR.E
UU2AF_MOUSE99.6%4415.6%475535179.1(P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) 
	TK261102_lung_cytoE18_2_step11.2693.2693.3	1.1922	0.0304	2950.23	81	1560.0%	1	R.RLYVGNIPFGITEEAMMDFFNAQMR.L
	TK261102_lung_cytoE18_2_step12.1933.1933.1	0.9675	0.0097	1106.02	48	2780.0%	1	K.ELLTSFGPLK.A
	TK261102_lung_cytoE18_2_step12.3659.3659.3	4.1788	0.6885	3562.67	1	3120.0%	1	R.RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK.L
	TK261102_lung_cytoE18_2_step04.0110.0110.1	0.9486	0.0581	747.17	45	5000.0%	1	R.QLNENK.Q
UBAG3_MOUSE99.6%61217.0%577618287.5(Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) 
*	TK261102_lung_cytoE18_2_step11.5165.5165.3	1.2191	0.026	4629.82	49	870.0%	1	K.QCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGR.S
*	TK261102_lung_cytoE18_2_step07.2525.2525.2	2.9843	0.5469	2301.58	1	4170.0%	3	K.THYPAQQGEYQPQQPVYHK.I
*	TK261102_lung_cytoE18_2_step10.1805.1805.1	0.65	0.0195	544.56	61	3750.0%	1	K.GPENK.D
*	TK261102_lung_cytoE18_2_step12.5507.5507.2	1.2805	0.1924	3044.34	10	1730.0%	1	R.GYIPIPVIHEQNITRPAAQPSFHQAQK.T
UQ99PC399.6%355.9%3924659810.0(Q99PC3) CGI-74-like SR-rich protein 
	TK261102_lung_cytoE18_2_step10.2952.2952.2	4.0862	0.5617	1866.99	1	7000.0%	1	K.SHLLNCCPHDVLSGTR.M
	TK261102_lung_cytoE18_2_step05.0011.0011.1	1.5818	0.3164	823.64	1	7500.0%	2	K.VHDLALR.A
UQ8VEH599.6%6128.6%606700965.9(Q8VEH5) Similar to KIAA0766 gene product 
	TK261102_lung_cytoE18_2_step11.2408.2408.1	1.2066	0.0423	748.89	2	7000.0%	1	K.LIFSLR.K
	TK261102_lung_cytoE18_2_step10.3903.3903.2	3.0214	0.6176	2249.8	1	4720.0%	3	R.NQHTLSQPLTDEHLQALFR.V
*	TK261102_lung_cytoE18_2_step06.3741.3741.2	3.1317	0.5488	2142.56	1	6180.0%	1	R.RPEFQPLLTESESEHGER.V
*	TK261102_lung_cytoE18_2_step05.3244.3244.1	0.8181	0.0164	1021.42	37	2500.0%	1	R.VATTEMDPR.W
UPEPD_MOUSE99.6%3511.6%492549975.9(Q11136) Xaa-Pro dipeptidase (EC 3.4.13.9) (X-Pro dipeptidase) (Proline dipeptidase) (Prolidase) (Imidodipeptidase) (Peptidase 4) 
*	TK261102_lung_cytoE18_2_step12.2277.2277.2	1.105	0.0782	1955.17	1	4000.0%	1	K.FNVNNTILHPEIVECR.V
*	TK261102_lung_cytoE18_2_step10.5095.5095.3	3.9044	0.598	4699.19	1	2060.0%	2	R.HLEPGMVLTVEPGIYFIDHLLDQALADPAQACFFNQEVLQR.F
UCYPH_MOUSE99.6%4649660.7%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) 
	TK261102_lung_cytoE18_2_step01.3376.3376.1	2.0722	0.34	1382.03	1	5450.0%	4	R.VSFELFADKVPK.T
	TK261102_lung_cytoE18_2_step01.3264.3264.2	2.7041	0.4942	1833.15	1	5360.0%	1	R.SIYGEKFEDENFILK.H
*	TK261102_lung_cytoE18_2_step01.4192.4192.2	3.5516	0.6285	2008.41	1	4410.0%	2	-.VNPTVFFDITADDEPLGR.V
	TK261102_lung_cytoE18_2_step07.4854.4854.2	0.8623	0.0364	2795.91	7	1730.0%	14	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
	TK261102_lung_cytoE18_2_step07.1764.1764.1	0.8403	0.0422	690.58	96	4000.0%	2	K.GSSFHR.I
	TK261102_lung_cytoE18_2_step01.3298.3298.1	1.7896	0.1948	1057.76	3	6250.0%	1	R.VSFELFADK.V
	TK261102_lung_cytoE18_2_step07.2729.2729.1	1.3917	0.2596	689.57	1	7000.0%	16	K.HVVFGK.V
	TK261102_lung_cytoE18_2_step06.3113.3113.2	0.6881	0.036	1728.23	30	1070.0%	1	K.EGMNIVEAMERFGSR.N
UST13_MOUSE99.6%10586.5%371416565.3(Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) 
	TK261102_lung_cytoE18_2_step07.4504.4504.2	4.6832	0.6826	1936.69	1	7500.0%	3	R.LLGHWEEAAHDLALACK.L
*	TK261102_lung_cytoE18_2_step08.1849.1849.1	1.5595	0.1857	751.66	1	6670.0%	7	K.VPPATHK.A
UY076_HUMAN99.6%7136.2%16981911875.9(Q14999) Hypothetical protein KIAA0076 (HA0936) 
*	TK261102_lung_cytoE18_2_step08.5123.5123.2	0.9046	0.0954	3197.82	12	1110.0%	1	K.AHGDEGLHIDQLVCLVLEAWQKGPCPPR.G
*	TK261102_lung_cytoE18_2_step11.1480.1480.1	1.209	0.0328	1577.92	11	3460.0%	1	R.SEFASGNTYALYVR.D
*	TK261102_lung_cytoE18_2_step07.3861.3861.2	1.6059	0.0617	2401.76	1	3160.0%	3	K.DPRVLDLLMHMLSSPDYQIR.W
*	TK261102_lung_cytoE18_2_step10.3727.3727.2	2.8196	0.5673	1747.8	1	5670.0%	1	R.VPLGPGLHAYPDELIR.Q
*	TK261102_lung_cytoE18_2_step10.4700.4700.3	1.9677	0.0575	3069.17	2	1760.0%	1	R.MIQALSSHDAGTRTQILLSLSQQEAIEK.H
URL26_HUMAN99.6%1813015.9%1451725810.6(Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26 
	TK261102_lung_cytoE18_2_step07.2741.2741.1	0.9869	0.1348	1420.73	18	2310.0%	8	K.ANGTTVHVGIHPSK.V
	TK261102_lung_cytoE18_2_step11.1834.1834.1	1.4133	0.1314	1079.59	27	4380.0%	1	R.HFNAPSHIR.R
UFAS_MOUSE99.6%20607.5%838912137.7(P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) 
	TK261102_lung_cytoE18_2_step01.2296.2296.1	1.302	0.2792	1110.71	1	5620.0%	1	R.EHDLVLPMR.E
	TK261102_lung_cytoE18_2_step08.3957.3957.1	1.7482	0.1133	950.82	1	5620.0%	2	K.AVAHILGIR.D
	TK261102_lung_cytoE18_2_step05.4077.4077.3	1.4164	0.3229	3692.84	6	1290.0%	1	K.VSVHIIEGDHRTLLEGSGLESIINIIHSSLAEPR.V
	TK261102_lung_cytoE18_2_step10.1517.1517.1	0.7635	0.0982	416.81	6	5000.0%	4	K.AGIR.D
	TK261102_lung_cytoE18_2_step08.2008.2008.1	1.3939	0.2338	841.46	5	6670.0%	2	R.CLAQHGR.F
	TK261102_lung_cytoE18_2_step07.3022.3022.1	1.2328	0.1366	1264.74	13	2500.0%	4	K.VSVHIIEGDHR.T
	TK261102_lung_cytoE18_2_step06.5501.5501.2	4.0778	0.635	2452.08	1	4090.0%	3	R.TLLEGSGLESIINIIHSSLAEPR.V
UQ9CR8699.6%61844.6%148160628.2(Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) 
	TK261102_lung_cytoE18_2_step12.2271.2271.1	1.1577	0.0534	1297.15	110	3180.0%	1	R.ASQGPVYKGVCK.C
	TK261102_lung_cytoE18_2_step08.4829.4829.2	1.9803	0.4754	1677.45	1	3330.0%	4	K.LQAVEVVITHLAPGTK.H
	TK261102_lung_cytoE18_2_step08.5257.5257.3	1.0724	0.0888	4075.06	15	1010.0%	1	R.SKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYK.M
UCAP1_MOUSE99.6%102420.0%474515757.5(P40124) Adenylyl cyclase-associated protein 1 (CAP 1) 
*	TK261102_lung_cytoE18_2_step01.2598.2598.1	1.2061	0.1825	1227.48	1	5000.0%	1	K.KEPALLELEGK.K
	TK261102_lung_cytoE18_2_step11.1377.1377.1	1.9212	0.3585	909.34	1	6430.0%	2	K.THKNPALK.A
*	TK261102_lung_cytoE18_2_step02.0010.0010.3	5.9764	0.6325	3631.27	1	3420.0%	1	K.ELSGLPSGPSVGSGPPPPPPGPPPPPIPTSSGSDDSASR.S
*	TK261102_lung_cytoE18_2_step12.4067.4067.2	0.7275	0.1201	2431.06	71	1000.0%	1	K.LSDLLAPISEQIQEVITFREK.N
	TK261102_lung_cytoE18_2_step10.2275.2275.1	2.1443	0.4265	1124.73	1	5560.0%	4	K.HAEMVHTGLK.L
*	TK261102_lung_cytoE18_2_step10.4701.4701.3	1.1272	0.1116	4182.04	1	1420.0%	1	K.TGPVAKELSGLPSGPSVGSGPPPPPPGPPPPPIPTSSGSDDSASR.S
URBB9_MOUSE99.6%41030.6%186209126.0(O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) 
*	TK261102_lung_cytoE18_2_step01.4080.4080.3	1.3168	0.1545	4427.34	4	1060.0%	1	K.TIIIGHSSGAIAAMRYAETHQVYALVLVSAYTSDLGDENER.A
*	TK261102_lung_cytoE18_2_step10.3939.3939.2	3.1409	0.5454	1887.36	1	6000.0%	3	R.GHFQNTEFHELISVVK.S
UPTB_MOUSE99.6%3314.6%527564788.3(P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) 
	TK261102_lung_cytoE18_2_step08.4092.4092.2	0.7654	0.0595	2038.74	12	2350.0%	1	R.VTPQSLFILFGVYGDVQR.V
	TK261102_lung_cytoE18_2_step11.5148.5148.2	3.3519	0.5772	2489.89	1	4500.0%	1	R.IIVENLFYPVTLDVLHQIFSK.F
	TK261102_lung_cytoE18_2_step07.3674.3674.3	1.3417	0.1549	4056.75	14	1080.0%	1	K.NFQNIFPPSATLHLSNIPPSVSEDDLKSLFSSNGGVVK.G
UTBA1_HUMAN99.6%6961155.7%451501525.1(P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) 
	TK261102_lung_cytoE18_2_step06.4212.4212.2	1.896	0.4471	2417.04	1	3250.0%	1	R.QLFHPEQLITGKEDAANNYAR.G
	TK261102_lung_cytoE18_2_step01.3142.3142.2	1.7345	0.3963	1413.62	5	4550.0%	6	R.QLFHPEQLITGK.E
	TK261102_lung_cytoE18_2_step05.0893.0893.2	1.8832	0.1695	2751.8	1	3480.0%	3	K.AYHEQLSVAEITNACFEPANQMVK.C
	TK261102_lung_cytoE18_2_step08.3444.3444.2	2.1402	0.3562	1874.95	8	3570.0%	1	R.RNLDIERPTYTNLNR.L
	TK261102_lung_cytoE18_2_step06.4829.4829.2	3.1824	0.6451	1761.03	1	5670.0%	17	R.IHFPLATYAPVISAEK.A
	TK261102_lung_cytoE18_2_step01.3823.3823.2	3.0674	0.5011	1705.26	1	5710.0%	1	R.AVFVDLEPTVIDEVR.T
	TK261102_lung_cytoE18_2_step01.1952.1952.1	0.8403	0.0215	1015.66	16	5000.0%	1	K.DVNAAIATIK.T
	TK261102_lung_cytoE18_2_step01.3262.3262.2	3.3564	0.5732	2009.76	1	4210.0%	1	K.TIGGGDDSFNTFFSETGAGK.H
	TK261102_lung_cytoE18_2_step01.2042.2042.2	1.7352	0.0418	1721.06	3	4620.0%	1	R.NLDIERPTYTNLNR.L
	TK261102_lung_cytoE18_2_step01.3672.3672.1	2.0352	0.3803	1586.69	1	5000.0%	1	R.SIQFVDWCPTGFK.V
	TK261102_lung_cytoE18_2_step01.4426.4426.2	3.6244	0.4394	2412.61	1	4750.0%	1	R.FDGALNVDLTEFQTNLVPYPR.I
	TK261102_lung_cytoE18_2_step01.3671.3671.1	1.4194	0.1607	1087.71	7	5000.0%	1	K.EIIDLVLDR.I
	TK261102_lung_cytoE18_2_step09.4477.4477.3	3.5643	0.4779	4301.02	1	1760.0%	4	R.ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDK.T
	TK261102_lung_cytoE18_2_step09.5454.5454.2	2.2005	0.4618	2332.2	1	3680.0%	7	R.AFVHWYVGEGMEEGEFSEAR.E
	TK261102_lung_cytoE18_2_step01.2554.2554.2	2.2283	0.4352	1826.86	1	5000.0%	1	K.VGINYQPPTVVPGGDLAK.V
	TK261102_lung_cytoE18_2_step06.2416.2416.1	1.4158	0.2495	777.76	2	5830.0%	7	R.GHYTIGK.E
	TK261102_lung_cytoE18_2_step10.1184.1184.1	1.0127	0.1167	510.72	2	6670.0%	12	K.HVPR.A
UQ9JM6599.6%116.8%308345675.1(Q9JM65) Nonclathrin coat protein epsilon-COP (Coatomer protein complex, subunit epsilon) 
*	TK261102_lung_cytoE18_2_step06.4157.4157.2	3.2273	0.5059	2301.03	1	5000.0%	1	R.KYGVVLDEIKPSSAPELQAVR.M
UQ9D1P499.6%82219.6%331373517.9(Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) 
	TK261102_lung_cytoE18_2_step10.3176.3176.2	3.6529	0.4658	1849.64	1	6330.0%	2	K.FQEHIIQAPKPVEAIK.R
*	TK261102_lung_cytoE18_2_step10.3176.3176.3	1.7404	0.205	2773.95	13	1630.0%	1	K.ELSELKPKFQEHIIQAPKPVEAIK.R
	TK261102_lung_cytoE18_2_step11.1492.1492.2	2.4908	0.4	1715.29	1	4640.0%	1	R.HNSEKPPEPVKPEVK.T
*	TK261102_lung_cytoE18_2_step06.4848.4848.2	2.3725	0.1119	3011.37	1	2400.0%	4	K.TYQGLQSLEEVCVYHSGVPIFHEGMK.Y
UQ9QWJ799.6%241.0%21542509285.5(Q9QWJ7) Non-erythrocyte beta spectrin 
	TK261102_lung_cytoE18_2_step10.3853.3853.2	2.7401	0.5404	2319.76	1	3500.0%	2	R.MPLATSTDHGHNLQTVQLLIK.K
URNT1_MOUSE99.6%555.1%11131226576.7(Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) 
	TK261102_lung_cytoE18_2_step01.1242.1242.1	0.4238	0.2004	403.39	5	3330.0%	1	R.GTPK.T
	TK261102_lung_cytoE18_2_step08.2747.2747.2	0.9883	0.121	2411.73	4	2000.0%	1	R.FMTTAMYDAREAIIPGSVYDR.S
	TK261102_lung_cytoE18_2_step01.3575.3575.3	1.4573	0.0241	1913.37	11	2060.0%	1	K.AGAKPDQIGIITPYEGQR.S
	TK261102_lung_cytoE18_2_step10.2621.2621.2	2.366	0.4533	1491.88	1	5770.0%	1	R.GNTSGSHIVNHLVR.A
UTCPE_MOUSE99.6%82212.6%541596246.0(P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) 
	TK261102_lung_cytoE18_2_step10.2892.2892.3	1.4641	0.0026	2117.32	34	2640.0%	1	R.QMAEIAVNAVLTVADMERR.D
	TK261102_lung_cytoE18_2_step08.5555.5555.2	1.8109	0.3306	3117.2	1	2410.0%	4	K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
*	TK261102_lung_cytoE18_2_step07.3498.3498.1	1.4266	0.0432	1464.07	1	4090.0%	1	K.HKLDVMSVEDYK.A
	TK261102_lung_cytoE18_2_step06.2338.2338.1	1.2962	0.1271	757.48	1	6670.0%	2	K.SHIMAAK.A
UPGK1_MOUSE99.6%2318113.9%416444057.6(P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) 
	TK261102_lung_cytoE18_2_step07.5054.5054.2	3.2073	0.2484	1771.35	1	5620.0%	4	K.ALESPERPFLAILGGAK.V
	TK261102_lung_cytoE18_2_step07.3006.3006.1	2.488	0.3436	1369.87	1	6250.0%	12	R.AHSSMVGVNLPQK.A
	TK261102_lung_cytoE18_2_step01.3711.3711.2	2.7807	0.4595	2025.6	1	4410.0%	1	K.ITLPVDFVTADKFDENAK.T
	TK261102_lung_cytoE18_2_step04.0070.0070.2	2.0899	0.1519	1204.31	4	6670.0%	4	K.IQLINNMLDK.V
UPGK1_HUMAN99.6%2210.8%417445978.1(P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) 
*	TK261102_lung_cytoE18_2_step11.3330.3330.2	0.9845	0.0959	2782.71	51	1400.0%	1	K.DCVGPEVEKACANPAAGSVILLENLR.F
*	TK261102_lung_cytoE18_2_step10.3487.3487.2	3.6852	0.4849	2036.31	1	5000.0%	1	K.SVVLMSHLGRPDGVPMPDK.Y
UUBA1_MOUSE99.6%269018.8%10581178095.7(Q02053) Ubiquitin-activating enzyme E1 1 
	TK261102_lung_cytoE18_2_step08.4984.4984.2	1.2655	0.1413	2526.43	3	2050.0%	1	R.QLLHNFPPDQLTSSGAPFWSGPK.R
	TK261102_lung_cytoE18_2_step12.1389.1389.3	1.521	0.1957	2358.79	29	2240.0%	1	K.VLGPYTFSICDTSNFSDYIR.G
	TK261102_lung_cytoE18_2_step07.4356.4356.2	3.4341	0.5753	1840.72	1	7500.0%	2	R.HQYYNQEWTLWDR.F
	TK261102_lung_cytoE18_2_step01.2611.2611.2	1.4588	0.2641	1372.18	44	2920.0%	1	K.ATLPSPDKLPGFK.M
*	TK261102_lung_cytoE18_2_step06.4858.4858.2	3.3003	0.5257	2539.98	1	4050.0%	1	K.AVTLHDQGTTQWADLSSQFYLR.E
*	TK261102_lung_cytoE18_2_step09.1604.1604.2	1.2428	0.0325	1800.82	5	3000.0%	1	R.SPPSVKQNSLDEDLIR.K
	TK261102_lung_cytoE18_2_step08.2927.2927.1	1.1849	0.1512	622.62	5	7500.0%	1	K.KISFK.S
	TK261102_lung_cytoE18_2_step07.3233.3233.1	1.1678	0.1083	1246.57	1	5000.0%	6	R.KPLLESGTLGTK.G
	TK261102_lung_cytoE18_2_step01.2192.2192.1	1.7234	0.0924	813.89	2	7140.0%	1	K.NIILGGVK.A
*	TK261102_lung_cytoE18_2_step06.2374.2374.1	1.0451	0.0575	991.38	5	5000.0%	1	R.VGEFCHSR.G
	TK261102_lung_cytoE18_2_step08.5008.5008.2	2.8217	0.4592	1437.99	1	7500.0%	2	R.QFLFRPWDVTK.L
	TK261102_lung_cytoE18_2_step07.4652.4652.2	2.3745	0.4636	1700.6	1	5380.0%	6	K.NFPNAIEHTLQWAR.D
	TK261102_lung_cytoE18_2_step12.4948.4948.3	1.4096	0.0372	3698.91	13	1210.0%	1	K.IIPAIATTTAAVVGLVCLELYKVVQGHQQLDSYK.N
UENOB_HUMAN99.6%5136.9%433468567.7(P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) 
*	TK261102_lung_cytoE18_2_step06.5132.5132.2	3.4349	0.0105	3026.28	1	3280.0%	3	R.HIADLAGNPDLILPVPAFNVINGGSHAGNK.L
UEF2_MOUSE99.6%4921721.7%857951836.8(P58252) Elongation factor 2 (EF-2) 
	TK261102_lung_cytoE18_2_step12.1504.1504.2	0.8874	0.0038	2326.89	13	1580.0%	1	K.YRCELLYEGPPDDEAAMGIK.S
	TK261102_lung_cytoE18_2_step08.3440.3440.2	3.1062	0.5298	1617.52	1	6150.0%	4	K.TGTITTFEHAHNMR.V
	TK261102_lung_cytoE18_2_step07.3004.3004.1	2.6953	0.4989	1309.73	1	5910.0%	10	R.NMSVIAHVDHGK.S
	TK261102_lung_cytoE18_2_step01.1806.1806.1	1.5529	0.2793	1567.77	1	5420.0%	1	K.DLEEDHACIPIKK.S
	TK261102_lung_cytoE18_2_step06.5146.5146.2	2.8393	0.5375	2234.37	1	4210.0%	2	R.KIWCFGPDGTGPNILTDITK.G
	TK261102_lung_cytoE18_2_step11.3377.3377.2	3.1634	0.5742	2119.47	1	4440.0%	1	K.RGHVFEESQVAGTPMFVVK.A
	TK261102_lung_cytoE18_2_step08.2520.2520.1	1.26	0.0398	882.48	7	5000.0%	2	K.KVEDMMK.K
	TK261102_lung_cytoE18_2_step10.1077.1077.1	0.3298	2.0E-4	446.71	4	1670.0%	4	K.SPNK.H
*	TK261102_lung_cytoE18_2_step01.2150.2150.1	1.5184	0.0891	1094.28	7	5000.0%	1	R.VFSGVVSTGLK.V
	TK261102_lung_cytoE18_2_step01.3126.3126.2	1.5507	0.1825	1965.94	1	4410.0%	2	R.GHVFEESQVAGTPMFVVK.A
	TK261102_lung_cytoE18_2_step11.5132.5132.2	4.3188	0.6378	2604.73	1	4570.0%	1	R.WLPAGDALLQMITIHLPSPVTAQK.Y
	TK261102_lung_cytoE18_2_step11.1053.1053.1	0.9097	0.0517	513.72	2	8330.0%	5	K.KLPR.T
	TK261102_lung_cytoE18_2_step01.2048.2048.1	1.5099	0.0115	1274.97	4	6110.0%	1	K.EDLYLKPIQR.T
	TK261102_lung_cytoE18_2_step03.0393.0393.2	3.3828	0.3976	2147.17	1	4210.0%	3	K.ARPFPDGLAEDIDKGEVSAR.Q
	TK261102_lung_cytoE18_2_step01.0147.0147.1	1.6752	0.1272	755.58	1	8330.0%	2	K.NPADLPK.L
	TK261102_lung_cytoE18_2_step06.3320.3320.1	2.3059	0.4095	1404.71	1	5500.0%	3	K.KEDLYLKPIQR.T
UGR78_MOUSE99.6%6107.6%655724225.2(P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) 
	TK261102_lung_cytoE18_2_step06.3753.3753.2	1.936	0.2774	1888.59	2	3120.0%	1	K.VTHAVVTVPAYFNDAQR.Q
	TK261102_lung_cytoE18_2_step05.0336.0336.2	3.356	0.5647	1589.65	1	7860.0%	2	K.KSDIDEIVLVGGSTR.I
	TK261102_lung_cytoE18_2_step01.3580.3580.2	2.1977	0.2942	1936.75	2	4710.0%	1	K.DNHLLGTFDLTGIPPAPR.G
UGBLP_HUMAN99.6%51124.9%317350777.7(P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) 
	TK261102_lung_cytoE18_2_step11.5326.5326.2	0.9635	0.0876	2964.84	3	1850.0%	1	R.GHSHFVSDVVISSDGQFALSGSWDGTLR.L
	TK261102_lung_cytoE18_2_step10.3068.3068.2	3.1817	0.5196	2745.96	1	2880.0%	3	K.TNHIGHTGYLNTVTVSPDGSLCASGGK.D
	TK261102_lung_cytoE18_2_step10.4500.4500.2	1.7523	0.3577	2628.99	1	3700.0%	1	K.GHNGWVTQIATTPQFPDMILSASR.D
URS15_HUMAN99.6%81445.1%1441690910.4(P11174) 40S ribosomal protein S15 (RIG protein) (P11174) 40S ribosomal protein S15 (RIG protein) 
	TK261102_lung_cytoE18_2_step12.4623.4623.2	1.3073	0.0813	3170.03	1	1920.0%	1	K.TFNQVEIKPEMIGHYLGEFSITYKPVK.H
	TK261102_lung_cytoE18_2_step07.4042.4042.2	1.0838	0.0112	1334.08	1	5000.0%	1	K.HGRPGIGATHSSR.F
	TK261102_lung_cytoE18_2_step07.2522.2522.1	2.7345	0.4793	1482.63	1	5420.0%	1	K.KEAPPMEKPEVVK.T
	TK261102_lung_cytoE18_2_step10.1868.1868.1	0.8977	0.1119	715.62	12	6250.0%	3	R.KFTYR.G
	TK261102_lung_cytoE18_2_step11.1864.1864.1	1.2765	0.0411	853.65	10	5830.0%	1	R.KQHSLLK.R
UUBC7_HUMAN99.6%3524.0%154178628.5(P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) 
	TK261102_lung_cytoE18_2_step01.4795.4795.2	4.1709	0.5464	2485.53	1	4290.0%	2	K.TDQVIQSLIALVNDPQPEHPLR.A
	TK261102_lung_cytoE18_2_step01.3567.3567.2	2.4679	0.4232	1791.84	1	6070.0%	1	R.IEINFPAEYPFKPPK.I
UQ9Z2L799.6%337.0%442495595.0(Q9Z2L7) Cytokine receptor related protein 4 
	TK261102_lung_cytoE18_2_step08.3211.3211.1	0.951	0.0029	758.62	2	7000.0%	1	R.RELGQR.L
	TK261102_lung_cytoE18_2_step12.3855.3855.3	5.1544	0.6004	2697.74	1	3850.0%	1	K.HGTVASRPPVQIEELIEKPGGIIVR.W
UQ923D899.6%336.8%439504256.4(Q923D8) Similar to Rho GTPase activating protein 1 
	TK261102_lung_cytoE18_2_step05.3552.3552.2	3.3555	0.4833	1588.15	1	6540.0%	1	R.HQIVEVAGDDKYGR.K
	TK261102_lung_cytoE18_2_step06.5745.5745.2	0.8611	0.078	1211.34	46	2000.0%	1	R.HQIVEVAGDDK.Y
*	TK261102_lung_cytoE18_2_step04.0899.0899.2	0.9975	0.0387	1892.84	3	3000.0%	1	K.TLLILFKPLISFKFGR.K
UA1T1_MOUSE99.6%3512.8%413460035.7(P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) 
	TK261102_lung_cytoE18_2_step08.5356.5356.3	5.5514	0.6079	3501.19	1	3080.0%	2	K.SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK.L
	TK261102_lung_cytoE18_2_step01.4263.4263.2	5.5515	0.6411	2408.88	1	6190.0%	1	K.DQSPASHEIATNLGDFAISLYR.E
UKPYR_MOUSE99.6%225.4%574623097.1(P53657) Pyruvate kinase, isozymes R/L (EC 2.7.1.40) (L-PK) 
*	TK261102_lung_cytoE18_2_step11.2660.2660.2	3.8635	0.6232	2183.41	1	5280.0%	1	R.LNFSHGSHEYHAESIANIR.E
	TK261102_lung_cytoE18_2_step09.2163.2163.2	1.1895	0.1723	1369.51	2	5450.0%	1	K.IISKIENHEGVK.K
UDPP3_MOUSE99.6%5711.8%738829115.3(Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) 
	TK261102_lung_cytoE18_2_step05.0430.0430.3	1.1858	0.0116	3684.49	14	1290.0%	1	K.DKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLR.Q
	TK261102_lung_cytoE18_2_step10.4320.4320.2	2.2475	0.4669	2034.84	1	3950.0%	2	K.GPSFDVQVGLHELLGHGSGK.L
*	TK261102_lung_cytoE18_2_step10.4079.4079.2	0.6734	0.0527	2297.57	5	1320.0%	1	R.LVVSAEQLLKELPWPPAFEK.D
*	TK261102_lung_cytoE18_2_step11.2493.2493.2	2.3999	0.4135	1684.03	1	5830.0%	1	K.RYEFQGNHFQVTR.G
UALBU_MOUSE99.6%11387334.2%608686936.1(P07724) Serum albumin precursor 
*	TK261102_lung_cytoE18_2_step01.4479.4479.3	3.2378	0.4753	3500.65	1	2670.0%	1	K.AHCLSEVEHDTMPADLPAIAADFVEDQEVCK.N
*	TK261102_lung_cytoE18_2_step11.4196.4196.2	3.7941	0.5381	1956.89	1	6250.0%	1	K.SLHTLFGDKLCAIPNLR.E
*	TK261102_lung_cytoE18_2_step06.5137.5137.2	1.7242	0.0269	1883.1	5	2940.0%	2	K.APQVSTPTLVEAARNLGR.V
*	TK261102_lung_cytoE18_2_step01.2110.2110.1	2.1187	0.2836	1151.91	1	6670.0%	2	K.LVQEVTDFAK.T
	TK261102_lung_cytoE18_2_step11.0872.0872.1	0.6108	0.1043	509.65	5	5000.0%	2	K.HKPK.A
*	TK261102_lung_cytoE18_2_step01.1796.1796.1	1.7841	0.3941	1252.72	1	5560.0%	2	R.YNDLGEQHFK.G
*	TK261102_lung_cytoE18_2_step06.2953.2953.1	1.4384	0.0165	900.52	21	5830.0%	5	R.VCLLHEK.T
*	TK261102_lung_cytoE18_2_step01.4874.4874.2	4.5202	0.6307	1664.41	1	8460.0%	1	R.LPCVEDYLSAILNR.V
*	TK261102_lung_cytoE18_2_step12.3572.3572.1	0.8789	0.1343	1459.12	60	2270.0%	10	R.RHPDYSVSLLLR.L
*	TK261102_lung_cytoE18_2_step01.1566.1566.1	1.323	0.1163	762.51	2	6670.0%	1	K.LATDLTK.V
*	TK261102_lung_cytoE18_2_step08.4513.4513.2	2.7783	0.5105	1904.24	1	6000.0%	8	K.ENPTTFMGHYLHEVAR.R
*	TK261102_lung_cytoE18_2_step06.0671.0671.1	1.0175	0.1604	1301.97	1	4000.0%	11	R.HPDYSVSLLLR.L
*	TK261102_lung_cytoE18_2_step01.2736.2736.2	1.1389	0.0070	2154.64	1	2940.0%	3	K.AETFTFHSDICTLPEKEK.Q
	TK261102_lung_cytoE18_2_step01.2618.2618.1	2.3007	0.2224	1019.98	1	6880.0%	14	K.SLHTLFGDK.L
*	TK261102_lung_cytoE18_2_step08.5415.5415.3	6.7572	0.652	3630.21	1	3150.0%	2	K.KAHCLSEVEHDTMPADLPAIAADFVEDQEVCK.N
*	TK261102_lung_cytoE18_2_step05.0446.0446.2	2.0474	0.2683	1886.61	1	4000.0%	11	R.RPCFSALTVDETYVPK.E
*	TK261102_lung_cytoE18_2_step06.3633.3633.1	2.2237	0.2821	1102.71	1	6670.0%	9	K.KQTALAELVK.H
*	TK261102_lung_cytoE18_2_step01.1954.1954.1	2.0639	0.4869	1441.84	1	5000.0%	2	K.APQVSTPTLVEAAR.N
*	TK261102_lung_cytoE18_2_step04.0566.0566.1	1.5538	0.0977	983.49	1	5710.0%	2	K.KYEATLEK.C
*	TK261102_lung_cytoE18_2_step04.4841.4841.1	1.372	0.0748	1000.47	1	5000.0%	5	K.TPVSEHVTK.C
*	TK261102_lung_cytoE18_2_step01.2178.2178.1	1.0885	0.0765	957.94	13	5710.0%	2	K.LCAIPNLR.E
UDYHC_MOUSE99.6%26368.4%46445320306.4(Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) 
*	TK261102_lung_cytoE18_2_step05.3693.3693.1	0.8253	0.0857	872.11	261	3570.0%	1	R.TGNVLKLK.V
	TK261102_lung_cytoE18_2_step01.2292.2292.2	0.9965	0.0489	2272.46	105	2350.0%	1	R.FTQDTQPHYIYSPREMTR.W
	TK261102_lung_cytoE18_2_step04.0479.0479.3	1.8266	0.3081	2801.85	2	1700.0%	1	R.IFVGLCQVGAWGCFDEFNRLEER.M
	TK261102_lung_cytoE18_2_step08.2772.2772.2	0.9284	0.0391	1622.4	34	2500.0%	1	R.LLNTFLERLFTTR.S
	TK261102_lung_cytoE18_2_step01.4682.4682.2	3.6108	0.6452	2601.55	1	4550.0%	1	R.FGNPLLVQDVESYDPVLNPVLNR.E
	TK261102_lung_cytoE18_2_step07.4924.4924.2	1.2592	0.1057	2789.2	100	1360.0%	1	K.VFYEEELDVPLVLFNEVLDHVLR.I
*	TK261102_lung_cytoE18_2_step12.3060.3060.3	1.6504	0.085	2913.84	6	1900.0%	1	-.MSEPGGGEDGSAGLEVSAVQNVADVAVLQK.H
	TK261102_lung_cytoE18_2_step05.5124.5124.3	1.4366	0.0356	3001.97	104	1440.0%	1	R.MNTLLANGEVPGLFEGDEYATLMTQCK.E
*	TK261102_lung_cytoE18_2_step08.3273.3273.2	1.9022	0.2901	1754.91	3	4000.0%	2	K.RAPVIDADKPVSSQLR.V
	TK261102_lung_cytoE18_2_step01.0158.0158.1	1.1838	0.0502	472.72	6	8330.0%	1	R.VLLK.A
	TK261102_lung_cytoE18_2_step10.4507.4507.2	1.3929	0.1436	2693.86	2	2170.0%	1	R.HVPVVYVDYPGPASLTQIYGTFNR.A
	TK261102_lung_cytoE18_2_step08.4787.4787.2	1.8725	0.0769	2529.66	1	3410.0%	3	K.TKPVTGNLRPEEALQALTIYEGK.F
	TK261102_lung_cytoE18_2_step12.4807.4807.2	2.5369	0.5047	2062.85	1	5670.0%	1	R.HYLDFINHYANLFHEK.R
	TK261102_lung_cytoE18_2_step06.3288.3288.2	1.1227	0.2545	2266.93	3	2630.0%	1	R.WQASSLPADDLCTENAIMLK.R
*	TK261102_lung_cytoE18_2_step01.2312.2312.1	0.8059	0.0635	1087.1	71	3120.0%	1	K.QDGDSFRMK.L
	TK261102_lung_cytoE18_2_step11.1689.1689.1	0.9772	0.0735	538.63	6	6670.0%	1	K.SYIR.E
*	TK261102_lung_cytoE18_2_step11.5493.5493.3	1.2537	0.1789	4574.26	9	880.0%	1	R.ITTVPLPTAPNVPIIDYEVSISGEWSPWQAKVPQIEVETHK.V
	TK261102_lung_cytoE18_2_step11.0806.0806.1	0.829	0.0102	604.4	20	5000.0%	1	K.ANMLR.T
	TK261102_lung_cytoE18_2_step11.3716.3716.2	3.9026	0.5512	1617.23	1	7920.0%	2	R.KLEHLITELVHQR.D
	TK261102_lung_cytoE18_2_step11.4224.4224.2	1.598	0.1852	1636.65	1	4230.0%	1	K.NVHLAPGWLMQLEK.K
*	TK261102_lung_cytoE18_2_step08.4245.4245.2	1.042	0.2637	2306.86	1	1940.0%	1	R.YIQRYLVYAILWSLSGDSR.L
*	TK261102_lung_cytoE18_2_step10.4841.4841.2	0.6406	0.0233	1889.02	156	1560.0%	1	K.LLTLPNGERLSLPPNVR.I
UANX2_MOUSE99.6%5713.3%338385457.7(P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV) 
	TK261102_lung_cytoE18_2_step12.4072.4072.1	1.1601	0.0964	1543.84	6	3460.0%	1	K.GVDEVTIVNILTNR.S
	TK261102_lung_cytoE18_2_step08.3681.3681.1	1.1249	0.1013	873.7	3	5000.0%	1	R.KLMVALAK.G
	TK261102_lung_cytoE18_2_step09.5031.5031.2	4.3397	0.5532	1652.33	1	6670.0%	2	K.SALSGHLETVILGLLK.T
*	TK261102_lung_cytoE18_2_step06.2137.2137.1	1.2807	0.0742	871.5	5	6670.0%	1	R.SVCHLQK.V
UPDX4_MOUSE99.6%51112.8%274310537.2(O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) 
	TK261102_lung_cytoE18_2_step06.3016.3016.1	1.4558	0.1987	1293.59	1	5000.0%	3	R.VSVADHSLHLSK.A
	TK261102_lung_cytoE18_2_step07.3636.3636.2	3.3753	0.5538	2405.95	1	5000.0%	1	K.HGEVCPAGWKPGSETIIPDPAGK.L
UMTPN_MOUSE99.6%4623.9%117127305.5(P80144) Myotrophin (V-1 protein) (Granule cell differentiation protein) 
	TK261102_lung_cytoE18_2_step12.3577.3577.2	4.1324	0.5748	2150.89	1	5280.0%	2	K.HHITPLLSAVYEGHVSCVK.L
	TK261102_lung_cytoE18_2_step11.3528.3528.3	5.0203	0.5763	3029.97	1	3060.0%	1	K.GADINAPDKHHITPLLSAVYEGHVSCVK.L
UPAB1_MOUSE99.6%4417.5%636706439.5(P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1) 
	TK261102_lung_cytoE18_2_step08.5345.5345.3	1.0475	0.0264	4269.88	25	720.0%	1	R.WTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPR.V
*	TK261102_lung_cytoE18_2_step11.4505.4505.2	1.5172	0.164	1623.61	1	4290.0%	1	R.LFPLIQAMHPSLAGK.I
	TK261102_lung_cytoE18_2_step06.3596.3596.2	4.3876	0.638	1694.3	1	7330.0%	1	R.SKVDEAVAVLQAHQAK.E
	TK261102_lung_cytoE18_2_step12.2969.2969.3	4.3701	0.4971	4460.37	1	2310.0%	1	R.NPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQK.Q
UCOF1_MOUSE99.6%104234.3%166185608.1(P18760) Cofilin, non-muscle isoform 
*	TK261102_lung_cytoE18_2_step12.4825.4825.2	2.2707	0.4624	2019.67	1	4060.0%	2	K.KEDLVFIFWAPENAPLK.S
	TK261102_lung_cytoE18_2_step06.2597.2597.1	1.2916	0.1417	661.74	5	6000.0%	6	K.KLTGIK.H
*	TK261102_lung_cytoE18_2_step01.3502.3502.2	2.9839	0.5131	2197.34	1	5000.0%	1	K.EILVGDVGQTVDDPYTTFVK.M
	TK261102_lung_cytoE18_2_step05.0738.0738.2	3.5509	0.6012	1792.32	1	6540.0%	1	K.HELQANCYEEVKDR.C
UQ99K8699.6%5716.6%650708586.5(Q99K86) Lutheran blood group (Auberger b antigen included) 
	TK261102_lung_cytoE18_2_step12.2772.2772.3	1.4256	0.0541	4530.65	25	1000.0%	1	K.LHVAYLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTVR.W
	TK261102_lung_cytoE18_2_step11.4345.4345.2	1.7107	0.314	2931.19	1	2920.0%	1	R.LTLHYPTEHVEFWVGSPSTTEGWVR.E
	TK261102_lung_cytoE18_2_step09.2687.2687.3	1.462	0.083	2691.45	13	2390.0%	1	R.NQSGIYGCRVEDYDADEEVQLVK.K
	TK261102_lung_cytoE18_2_step10.2484.2484.2	3.5053	0.5752	2156.08	1	5280.0%	2	R.DANFHCAAHYDLPSGQHGR.L
UQ9DCF299.6%1114.5%241266526.2(Q9DCF2) 0610039H12Rik protein 
	TK261102_lung_cytoE18_2_step10.4776.4776.3	3.8101	0.4632	3923.18	1	2130.0%	1	R.ALPEFTGVQTQDPNAVVIGLAPEHFHYQLLNQAFR.L
UQ99K8899.6%101828.8%365381477.7(Q99K88) Hypothetical 38.1 kDa protein 
	TK261102_lung_cytoE18_2_step10.4425.4425.2	2.1595	0.1722	1309.25	1	7000.0%	3	R.ILVTLLHTLER.V
	TK261102_lung_cytoE18_2_step01.4972.4972.3	3.4795	0.4961	3594.23	1	2500.0%	1	R.MGEVPLADSILCDGLTDAFHNYHMGITAENVAK.K
	TK261102_lung_cytoE18_2_step09.2197.2197.1	1.0571	0.0623	803.65	10	6000.0%	2	K.KWQVSR.E
	TK261102_lung_cytoE18_2_step06.0135.0135.2	1.0507	0.0223	2379.42	3	2390.0%	1	R.VGGTRGVAALCIGGGMGVAMCVQR.G
	TK261102_lung_cytoE18_2_step12.1719.1719.1	1.2056	0.1215	945.94	30	4290.0%	1	K.APHLTHLR.T
	TK261102_lung_cytoE18_2_step01.3882.3882.2	1.2865	0.2248	2325.1	1	2950.0%	1	R.IVSWSQAGVEPSVMGVGPIPAIK.Q
UQ99KY399.6%3510.7%428450396.8(Q99KY3) Hypothetical 45.0 kDa protein (Fragment) 
*	TK261102_lung_cytoE18_2_step10.4308.4308.2	1.0088	0.1073	2270.28	12	2140.0%	1	R.AGGPGLERGEAGIPAEFSIWTR.E
	TK261102_lung_cytoE18_2_step06.3441.3441.2	3.3348	0.5858	2696.88	1	3910.0%	2	K.VHSPSGAVEECHVSELEPDKYAVR.F
UACTZ_HUMAN99.6%227.2%376426146.6(P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) 
	TK261102_lung_cytoE18_2_step06.1970.1970.1	0.9246	0.0098	555.49	4	6250.0%	1	K.KLAPK.D
	TK261102_lung_cytoE18_2_step01.3430.3430.2	3.6859	0.6019	2537.58	1	4290.0%	1	K.DQLQTFSEEHPVLLTEAPLNPR.K
UTALI_MOUSE99.6%3110511.2%25412698316.1(P26039) Talin 
	TK261102_lung_cytoE18_2_step10.2211.2211.1	1.4106	0.2258	1011.79	1	6430.0%	2	K.KLEQLKPR.A
	TK261102_lung_cytoE18_2_step01.4603.4603.2	0.748	0.0397	3056.61	185	960.0%	1	R.DPVQLNLLYVQARDDILNGSHPVSFDK.A
	TK261102_lung_cytoE18_2_step07.2868.2868.2	1.1836	0.0622	2396.4	241	1840.0%	1	K.ACEFAGFQCQIQFGPHNEQK.H
	TK261102_lung_cytoE18_2_step03.0179.0179.2	0.9762	0.0454	1242.11	266	3000.0%	1	K.LKPLPGETMEK.C
	TK261102_lung_cytoE18_2_step03.0412.0412.3	2.0154	0.2196	2913.88	3	1770.0%	1	K.TVTDMLMTICARIGITNHDEYSLVR.E
	TK261102_lung_cytoE18_2_step07.3520.3520.1	2.4226	0.3289	1336.89	1	5830.0%	6	K.VSHVLAALQAGNR.G
	TK261102_lung_cytoE18_2_step07.4069.4069.3	1.1961	0.0064	4532.83	5	1060.0%	1	R.ELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAK.N
	TK261102_lung_cytoE18_2_step07.1630.1630.2	0.4799	0.1061	968.58	2	2500.0%	4	K.AHATGAGPAGR.Y
*	TK261102_lung_cytoE18_2_step05.0906.0906.3	1.2326	0.0941	4452.54	8	1070.0%	1	K.SNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIK.H
	TK261102_lung_cytoE18_2_step12.4675.4675.2	0.7733	0.1282	3038.37	56	1210.0%	1	R.ELVAQGKVGAIPANALDDGQWSQGLISAAR.M
*	TK261102_lung_cytoE18_2_step01.3862.3862.2	3.0772	0.5944	2151.69	1	5000.0%	1	K.LLAALLEDEGGNGRPLLQAAK.G
	TK261102_lung_cytoE18_2_step07.2013.2013.1	1.1675	0.0452	741.64	152	5000.0%	1	R.ALAVNPR.D
	TK261102_lung_cytoE18_2_step06.3490.3490.2	1.9598	0.1436	1712.23	1	3930.0%	1	K.TLSHPQQMALLDQTK.T
	TK261102_lung_cytoE18_2_step05.0263.0263.1	1.3183	0.2519	1379.74	1	5000.0%	1	K.VEHGSVALPAIMR.S
UGDIC_MOUSE99.6%112716.0%445505376.2(Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) 
	TK261102_lung_cytoE18_2_step09.4946.4946.2	4.1104	0.5281	2299.23	1	5260.0%	4	K.KFDLGQDVIDFTGHSLALYR.T
	TK261102_lung_cytoE18_2_step07.4514.4514.2	2.1264	0.3152	2972.8	1	2800.0%	2	K.KVLHMDQNPYYGGESASITPLEDLYK.R
	TK261102_lung_cytoE18_2_step09.3249.3249.1	0.8636	0.1381	1285.31	13	2730.0%	1	K.VIEGSFVYKGGK.I
	TK261102_lung_cytoE18_2_step01.4834.4834.2	1.2684	0.0479	2170.93	1	3330.0%	1	K.FDLGQDVIDFTGHSLALYR.T
	TK261102_lung_cytoE18_2_step11.2760.2760.2	2.6073	0.3369	1386.55	3	5830.0%	1	R.FKLPGQPPASMGR.G
UNIBL_MOUSE99.6%6810.8%749848195.9(Q8R1F1) Niban-like protein 
	TK261102_lung_cytoE18_2_step11.3126.3126.3	1.7286	0.074	2748.46	3	2070.0%	1	R.EQMDNAVYTFETLLHQELGKGPTK.E
	TK261102_lung_cytoE18_2_step08.2336.2336.1	0.9561	0.1479	702.62	1	7500.0%	2	K.HNLYR.D
	TK261102_lung_cytoE18_2_step10.5059.5059.2	3.3966	0.5141	2930.08	1	3200.0%	1	R.NHVQPYIPSILEALMVPTSQGFTEVR.D
*	TK261102_lung_cytoE18_2_step06.3190.3190.1	0.9207	0.1824	1114.78	60	3330.0%	1	R.ARPAMEAVIR.T
*	TK261102_lung_cytoE18_2_step05.0837.0837.2	4.4122	0.5491	1833.29	1	7670.0%	1	R.HEIEGTGPPQAQLLWR.K
UARP2_HUMAN99.6%5134.6%394447616.7(O15142) Actin-like protein 2 (Actin-related protein 2) 
*	TK261102_lung_cytoE18_2_step06.0675.0675.1	2.5422	0.4372	1394.77	1	6000.0%	3	K.HLWDYTFGPEK.L
*	TK261102_lung_cytoE18_2_step07.2601.2601.1	1.325	0.0343	801.61	1	6670.0%	2	R.RLDIAGR.D
UQ91V8699.6%5816029.5%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) 
*	TK261102_lung_cytoE18_2_step11.2957.2957.1	1.9425	0.3804	1408.92	1	5380.0%	1	K.VVAGVAAALAHKYH.-
*	TK261102_lung_cytoE18_2_step08.3543.3543.2	3.1126	0.5973	1110.15	1	8640.0%	24	K.VVAGVAAALAHK.Y
UAAC2_MOUSE99.6%101813.2%8941036535.5(Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) 
	TK261102_lung_cytoE18_2_step10.2401.2401.1	1.4961	0.1657	1303.6	5	4440.0%	2	K.HTNYTMEHIR.V
	TK261102_lung_cytoE18_2_step09.2589.2589.2	2.1173	0.4972	1754.55	1	5710.0%	3	R.KHEAFESDLAAHQDR.V
	TK261102_lung_cytoE18_2_step08.4108.4108.2	1.0022	0.15	2092.56	61	2500.0%	1	K.VQEKCQLEINFNTLQTK.L
	TK261102_lung_cytoE18_2_step09.2923.2923.2	1.3531	0.0501	1650.24	3	4230.0%	1	R.KAGTQIENIEEDFR.N
	TK261102_lung_cytoE18_2_step09.2325.2325.3	1.7595	0.0167	1788.45	8	3000.0%	1	R.NGLKLMLLLEVISGER.L
	TK261102_lung_cytoE18_2_step07.1825.1825.1	1.3401	0.0228	871.5	4	6670.0%	1	K.EQILLQK.D
	TK261102_lung_cytoE18_2_step12.5663.5663.3	1.5122	0.0072	4579.03	7	1120.0%	1	K.RAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFK.A
UQ9QXD899.6%3310.2%668714216.4(Q9QXD8) LIM domains containing protein 1 
*	TK261102_lung_cytoE18_2_step12.1756.1756.1	1.7237	0.458	1324.98	1	4550.0%	1	K.GPSPAPLHQHHF.-
*	TK261102_lung_cytoE18_2_step08.5043.5043.3	1.5041	0.0198	3618.93	44	1180.0%	1	K.LAADGAAKPPLAVPTVAPGLATTTAAAQPSYPSQEQR.I
*	TK261102_lung_cytoE18_2_step09.3086.3086.2	3.6007	0.3482	2330.37	1	5830.0%	1	K.IHLQQQQQQQLLQEEALPR.A
UMCM7_MOUSE99.6%7136.0%719812116.4(Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) 
*	TK261102_lung_cytoE18_2_step11.2572.2572.2	2.7851	0.3074	1295.37	1	7000.0%	1	K.YGTQLVHLAHR.E
	TK261102_lung_cytoE18_2_step12.1676.1676.2	3.1844	0.5104	1592.26	1	7080.0%	1	R.LAQHITYVHQHSR.Q
*	TK261102_lung_cytoE18_2_step07.5213.5213.2	3.2166	0.6221	2021.67	1	5000.0%	3	R.IAQPGDHVSVTGIFLPVLR.T
UTAGL_MOUSE99.6%62614.5%200224458.8(P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27) 
*	TK261102_lung_cytoE18_2_step10.3996.3996.3	1.3486	0.0748	1926.01	33	2210.0%	1	R.TLMALGSLAVTKNDGNYR.G
	TK261102_lung_cytoE18_2_step09.2846.2846.1	1.5441	0.203	1213.03	1	5500.0%	5	K.HVIGLQMGSNR.G
UQ9DAJ699.6%62018.4%152171826.0(Q9DAJ6) 1500026J17Rik protein 
	TK261102_lung_cytoE18_2_step09.4125.4125.2	4.1622	0.5244	2199.44	1	5260.0%	4	R.YFHVVIAGPQDSPFEGGTFK.L
	TK261102_lung_cytoE18_2_step04.0587.0587.1	1.3559	0.1633	985.75	17	5000.0%	2	K.IYHPNVDK.L
UIQG1_MOUSE99.6%152112.1%16571887556.5(Q9JKF1) Ras GTPase-activating-like protein IQGAP1 
	TK261102_lung_cytoE18_2_step09.5077.5077.2	3.8829	0.6165	2960.12	1	3390.0%	1	K.IGGILANELSVDEAALHAAVIAINEAIDR.R
*	TK261102_lung_cytoE18_2_step01.0242.0242.1	0.7252	0.0532	1322.75	7	3000.0%	1	R.LFQTALQEEIK.S
	TK261102_lung_cytoE18_2_step01.4404.4404.2	3.1792	0.5521	2056.33	1	5880.0%	1	K.LEGVLAEVAQHYQDTLIR.A
*	TK261102_lung_cytoE18_2_step10.3859.3859.3	1.9117	0.2212	3522.18	6	1670.0%	1	K.GGYHYYHNLETQAGGWAEPPDFVQNSVQLSR.E
*	TK261102_lung_cytoE18_2_step11.4144.4144.2	1.1525	0.0178	2348.84	1	3160.0%	1	R.ERDVYEELLTQAEIQGNVNK.V
*	TK261102_lung_cytoE18_2_step11.1982.1982.1	2.9556	0.4138	1540.59	1	6670.0%	1	R.LAYLHSHKDEVVK.I
	TK261102_lung_cytoE18_2_step01.4535.4535.2	1.6314	0.2154	1883.93	2	4120.0%	1	R.ILAIGLINEALDEGDAQK.T
*	TK261102_lung_cytoE18_2_step08.3465.3465.1	0.9494	0.0375	1041.56	163	3890.0%	1	K.ALQSLALGLR.G
	TK261102_lung_cytoE18_2_step08.5109.5109.2	1.7547	0.2824	2579.63	1	2750.0%	2	R.KFVHLLDQSDQDFQEELDLMK.M
*	TK261102_lung_cytoE18_2_step01.3915.3915.2	1.9892	0.2237	2872.07	1	2500.0%	2	R.FQPGETLTEILETPATNEQEAEHQR.A
	TK261102_lung_cytoE18_2_step06.1441.1441.1	0.7987	0.0125	579.77	1	6670.0%	2	R.QEFR.S
UQ9JJU699.6%3519.0%373411077.2(Q9JJU6) B-Raf protein (Fragment) 
*	TK261102_lung_cytoE18_2_step06.0372.0372.3	4.1441	0.4133	4567.42	1	2150.0%	1	K.FFEHHPVPQEEASFPETALPSGSSSAPPSDSTGPQILTSPSPSK.S
	TK261102_lung_cytoE18_2_step12.4787.4787.2	0.9124	0.0656	3007.46	13	1540.0%	2	R.SSSAPNVHINTIEPVNIDDLIRDQGFR.G
UPDL1_MOUSE99.6%5119.5%326357176.8(O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) 
	TK261102_lung_cytoE18_2_step08.4144.4144.2	3.5756	0.5004	2106.67	1	5000.0%	3	K.MNLASEPQEVLHIGSAHNR.S
	TK261102_lung_cytoE18_2_step06.2938.2938.1	1.0697	0.0552	955.46	30	5000.0%	1	K.QELNEPPK.Q
	TK261102_lung_cytoE18_2_step09.1103.1103.1	0.6542	0.033	546.87	17	6670.0%	1	R.HPYK.M
UPUA2_MOUSE99.6%356.1%456501506.6(P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase) 
	TK261102_lung_cytoE18_2_step09.3585.3585.2	3.9462	0.2575	2210.74	1	6110.0%	2	R.AHIVFDFHQAADGIQEQQR.Q
*	TK261102_lung_cytoE18_2_step07.2962.2962.1	0.9704	0.0184	1007.75	48	4380.0%	1	K.GIRPVYSSK.A
UGTP1_MOUSE99.6%61031.1%209234067.8(P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) 
	TK261102_lung_cytoE18_2_step06.3273.3273.2	2.2995	0.389	1939.82	1	3820.0%	2	K.AFLSSPEHVNRPINGNGK.Q
	TK261102_lung_cytoE18_2_step12.3751.3751.2	3.3189	0.33	2136.15	1	5000.0%	2	K.ALPGHLKPFETLLSQNQGGK.A
*	TK261102_lung_cytoE18_2_step07.4662.4662.2	1.1767	0.0486	1762.12	1	4000.0%	1	R.EAAQVDMVNDGVEDLR.G
	TK261102_lung_cytoE18_2_step01.2391.2391.1	0.7057	0.0567	1276.8	126	2000.0%	1	R.MLLADQGQSWK.E
UMYG1_MOUSE99.6%4416.6%380427237.0(Q9JK81) MYG1 protein (Gamm1 protein) 
*	TK261102_lung_cytoE18_2_step07.3366.3366.2	0.9315	0.0146	2660.23	5	1600.0%	1	R.EGALNMARATLAQRPAPVPLANAVVQ.-
*	TK261102_lung_cytoE18_2_step06.3618.3618.1	1.9269	0.1633	1583.73	1	5830.0%	1	K.EHLYHLESELSPK.V
*	TK261102_lung_cytoE18_2_step09.3002.3002.3	2.2574	0.0626	2935.1	3	2280.0%	1	R.YDHHQRTFTETMSSLCPGKPWQTK.L
UPDA3_MOUSE99.6%112117.7%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) 
*	TK261102_lung_cytoE18_2_step06.4714.4714.2	3.2927	0.6029	2281.39	1	4440.0%	1	K.KFIQDSIFGLCPHMTEDNK.D
	TK261102_lung_cytoE18_2_step07.2809.2809.1	0.8854	0.0641	1042.19	4	3330.0%	2	R.TADGIVSHLK.K
	TK261102_lung_cytoE18_2_step06.2114.2114.1	1.3202	0.0298	586.61	2	7500.0%	1	K.KLTPK.K
	TK261102_lung_cytoE18_2_step10.2345.2345.1	2.0763	0.226	916.61	1	6430.0%	2	K.KFLDAGHK.L
*	TK261102_lung_cytoE18_2_step01.2994.2994.1	1.1107	0.1487	1394.95	5	3640.0%	1	R.DLFSDGHSEFLK.A
*	TK261102_lung_cytoE18_2_step06.4085.4085.3	1.4123	0.0424	2729.42	24	1740.0%	1	R.VSDTGSAGLMLVEFFAPWCGHCKR.L
*	TK261102_lung_cytoE18_2_step05.0135.0135.1	1.9991	0.3115	1260.77	1	6000.0%	3	R.FAHTNIESLVK.E
UNTF2_HUMAN99.6%51321.3%127144785.4(P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) 
	TK261102_lung_cytoE18_2_step09.4621.4621.2	2.5498	0.4206	3007.92	1	2310.0%	3	K.IQHSITAQDHQPTPDSCIISMVVGQLK.A
UDEST_MOUSE99.6%123817.6%165185228.0(Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) 
*	TK261102_lung_cytoE18_2_step12.4887.4887.2	3.182	0.467	2081.21	1	5310.0%	3	R.KEELMFFLWAPEQAPLK.S
	TK261102_lung_cytoE18_2_step06.3650.3650.1	1.9458	0.2039	1059.78	7	5000.0%	4	K.HFVGMLPEK.D
	TK261102_lung_cytoE18_2_step10.3032.3032.1	2.0483	0.3496	1490.79	2	4090.0%	3	K.HFVGMLPEKDCR.Y
URL3_MOUSE99.6%7924.4%4024599310.2(P27659) 60S ribosomal protein L3 (J1 protein) 
	TK261102_lung_cytoE18_2_step08.2691.2691.1	0.9261	0.0223	884.62	87	3570.0%	1	K.AGMTHIVR.E
*	TK261102_lung_cytoE18_2_step07.5821.5821.2	0.7826	0.0276	3151.86	5	1430.0%	1	K.SINPLGGFVHYGEVTNDFIMLKGCVVGTK.K
	TK261102_lung_cytoE18_2_step07.3686.3686.3	1.2605	0.1256	3211.3	5	1720.0%	1	K.EVVEAVTIVETPPMVVVGIVGYVETPRGLR.T
	TK261102_lung_cytoE18_2_step09.3042.3042.2	3.3991	0.3611	1827.68	1	5310.0%	1	K.KAHLMEIQVNGGTVAEK.L
*	TK261102_lung_cytoE18_2_step10.1992.1992.1	1.3177	0.0909	970.54	4	5710.0%	2	R.IIAHTQMR.L
	TK261102_lung_cytoE18_2_step09.1950.1950.1	1.0341	0.0691	705.55	4	6000.0%	1	R.KFSAPR.H
UGDIR_MOUSE99.6%115340.2%204234075.2(Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) 
	TK261102_lung_cytoE18_2_step01.2152.2152.2	2.7964	0.5116	1919.58	1	5000.0%	1	K.SIQEIQELDKDDESLR.K
	TK261102_lung_cytoE18_2_step06.4932.4932.2	3.5979	0.5813	2368.4	1	4720.0%	7	R.FTDDDKTDHLSWEWNLTIK.K
	TK261102_lung_cytoE18_2_step07.1994.1994.1	1.1762	0.1698	980.52	20	5000.0%	1	K.YIQHTYR.K
	TK261102_lung_cytoE18_2_step01.0136.0136.1	0.9872	0.0437	763.76	100	5000.0%	1	R.EIVSGMK.Y
	TK261102_lung_cytoE18_2_step12.3392.3392.3	1.1926	0.011	3696.85	62	1250.0%	1	-.MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQK.S
UG3P_MOUSE99.6%4924953.9%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) 
	TK261102_lung_cytoE18_2_step08.1595.1595.1	0.6166	0.0371	474.53	2	5000.0%	3	K.KVVK.Q
*	TK261102_lung_cytoE18_2_step01.1827.1827.1	2.0719	0.3805	1371.71	1	5000.0%	2	R.GAAQNIIPASTGAAK.A
	TK261102_lung_cytoE18_2_step11.0848.0848.3	0.9713	0.0669	1648.78	67	1790.0%	1	K.VIPELNGKLTGMAFR.V
	TK261102_lung_cytoE18_2_step11.3658.3658.2	3.728	0.5954	2371.58	1	4520.0%	2	K.RVIISAPSADAPMFVMGVNHEK.Y
	TK261102_lung_cytoE18_2_step01.2571.2571.3	2.7988	0.0926	2335.1	2	2620.0%	1	K.LTGMAFRVPTPNVSVVDLTCR.L
	TK261102_lung_cytoE18_2_step03.0481.0481.2	2.585	0.371	2216.69	1	3750.0%	3	R.VIISAPSADAPMFVMGVNHEK.Y
*	TK261102_lung_cytoE18_2_step01.5360.5360.3	1.4488	0.2097	4050.51	7	1220.0%	1	K.GILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVK.L
*	TK261102_lung_cytoE18_2_step01.5390.5390.2	1.8598	0.4648	2295.41	1	3500.0%	9	K.WGEAGAEYVVESTGVFTTMEK.A
	TK261102_lung_cytoE18_2_step01.2572.2572.1	1.2971	0.2595	1560.5	2	3460.0%	2	R.VPTPNVSVVDLTCR.L
*	TK261102_lung_cytoE18_2_step01.3303.3303.2	2.4935	0.4754	1630.49	1	6150.0%	2	K.LVINGKPITIFQER.D
	TK261102_lung_cytoE18_2_step06.2052.2052.1	1.324	0.1052	598.54	1	6000.0%	5	K.AGAHLK.G
	TK261102_lung_cytoE18_2_step12.4971.4971.2	5.0932	0.6934	2599.29	1	4780.0%	8	K.VIHDNFGIVEGLMTTVHAITATQK.T
*	TK261102_lung_cytoE18_2_step06.0647.0647.2	2.0305	0.2053	2299.05	1	3680.0%	5	K.LVINGKPITIFQERDPTNIK.W
UNED4_MOUSE99.6%4410.8%9571099685.6(P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) 
*	TK261102_lung_cytoE18_2_step06.2488.2488.2	1.9362	0.2321	2172.23	4	2750.0%	1	R.LAVCGNPATSQPVTSSNHSSR.G
*	TK261102_lung_cytoE18_2_step09.0098.0098.2	0.9111	0.0494	3153.53	3	1540.0%	1	K.RPSPDDDLTDEDNDDMQLQAQRAFTTR.R
	TK261102_lung_cytoE18_2_step06.4836.4836.2	3.1659	0.5558	2084.83	1	6250.0%	1	R.FIIDEELFGQTHQHELK.T
	TK261102_lung_cytoE18_2_step07.1857.1857.3	1.1454	0.0884	4560.17	62	470.0%	1	K.EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFK.F
UQ9D8J699.6%3338.5%252268425.0(Q9D8J6) 1810073G14Rik protein 
	TK261102_lung_cytoE18_2_step09.2550.2550.3	1.2349	0.0868	3169.94	23	1610.0%	1	K.DPPESPVVTGVASTLKDENCEPVEKPEDK.S
	TK261102_lung_cytoE18_2_step10.2489.2489.2	3.0242	0.5602	2542.19	1	4350.0%	1	R.KRPETKPSSDLEASALPAQETASK.D
	TK261102_lung_cytoE18_2_step06.4925.4925.3	1.5527	0.3412	4308.88	63	870.0%	1	K.NAGENGSLLVAAPFGMLSTISTAVQSTGKSVISGGLDALEFIGK.K
URS7_HUMAN99.6%4621.6%1942212710.1(P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) 
	TK261102_lung_cytoE18_2_step11.4760.4760.1	1.9691	0.2049	1339.79	1	5910.0%	1	K.AIIIFVPVPQLK.S
	TK261102_lung_cytoE18_2_step11.2484.2484.1	1.2169	0.1362	969.54	1	6430.0%	1	K.HVVFIAQR.R
	TK261102_lung_cytoE18_2_step04.2500.2500.2	3.6544	0.5938	2370.46	1	5240.0%	2	R.TLTAVHDAILEDLVFPSEIVGK.R
UQ9EST599.6%2210.3%272310794.0(Q9EST5) Proliferation related acidic leucine rich protein PAL31 (Similar to acidic protein rich in leucines) 
	TK261102_lung_cytoE18_2_step01.2219.2219.1	1.54	0.1126	1016.99	1	6250.0%	1	K.DISTLEPLK.R
*	TK261102_lung_cytoE18_2_step01.3463.3463.2	2.9659	0.5587	2064.89	1	4440.0%	1	R.LAEELPSLTHLNLSGNNLK.D
UPRS4_HUMAN99.6%5719.5%440491856.2(Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) 
	TK261102_lung_cytoE18_2_step07.5313.5313.2	1.3358	0.039	2155.69	7	3680.0%	2	K.VHAVIGVLMDDTDPLVTVMK.V
	TK261102_lung_cytoE18_2_step10.2669.2669.1	1.039	0.0595	1321.6	1	5000.0%	1	K.LPLVTPHTQCR.L
	TK261102_lung_cytoE18_2_step08.5121.5121.2	3.7352	0.5596	1701.02	1	8750.0%	1	R.IKDYLLMEEEFIR.N
	TK261102_lung_cytoE18_2_step03.0508.0508.3	1.1057	0.0539	4775.22	46	850.0%	1	K.APQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPK.G
UQ91ZP199.6%228.5%236270548.1(Q91ZP1) Fibrinogen B-beta-chain (Fragment) 
*	TK261102_lung_cytoE18_2_step06.2900.2900.1	2.3111	0.495	1508.5	1	5380.0%	1	K.AHYGGFTVQNEASK.Y
	TK261102_lung_cytoE18_2_step06.2817.2817.1	1.3304	0.0786	836.58	1	8000.0%	1	R.KWDPYK.K
UHNT1_MOUSE99.6%51136.0%125136466.9(P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) 
	TK261102_lung_cytoE18_2_step12.3945.3945.2	2.6963	0.3687	2292.14	1	4210.0%	1	R.CLAFHDISPQAPTHFLVIPK.K
*	TK261102_lung_cytoE18_2_step06.5124.5124.2	3.5058	0.5858	2594.12	1	3910.0%	3	K.HISQISVADDDDESLLGHLMIVGK.K
*	TK261102_lung_cytoE18_2_step11.4313.4313.2	2.9177	0.4366	2722.56	1	3120.0%	1	K.KHISQISVADDDDESLLGHLMIVGK.K
UTSN_MOUSE99.6%103611.0%228262016.4(Q62348) Translin 
	TK261102_lung_cytoE18_2_step11.1853.1853.1	1.4107	0.1218	911.53	1	7000.0%	1	R.FHEHWR.F
	TK261102_lung_cytoE18_2_step07.4040.4040.1	1.1837	0.1208	1452.74	1	5000.0%	5	K.KVEEVVYDLSIR.G
	TK261102_lung_cytoE18_2_step07.2430.2430.1	1.4134	0.4091	799.65	1	5830.0%	3	K.THLTSLK.T
UQ99KS199.6%1116.0%144165117.8(Q99KS1) Hypothetical 16.5 kDa protein (Fragment) 
	TK261102_lung_cytoE18_2_step11.4477.4477.2	3.9014	0.5979	2554.15	1	4090.0%	1	K.NELHNLLDKPQLQGIPVLVLGNK.R
UQ9CTV999.6%226.5%565622975.3(Q9CTV9) 5830475I06Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step04.0766.0766.1	1.2102	0.0204	1138.74	37	4090.0%	1	R.VSGGTAVFITGK.D
*	TK261102_lung_cytoE18_2_step05.0386.0386.2	4.0137	0.5327	2941.89	1	4790.0%	1	K.AHSEYEEALSQGHQAYLLEEDDYSR.D
UQ9DCS799.6%229.3%227257158.0(Q9DCS7) 0610011D08Rik protein 
*	TK261102_lung_cytoE18_2_step09.4606.4606.2	1.6911	0.0227	2529.17	1	2750.0%	1	K.RIQTYLESTKPIIDLYEEMGK.V
*	TK261102_lung_cytoE18_2_step01.4270.4270.2	3.052	0.6018	2375.08	1	4210.0%	1	R.IQTYLESTKPIIDLYEEMGK.V
UPAK2_HUMAN99.6%339.0%524580056.0(Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) 
*	TK261102_lung_cytoE18_2_step06.3417.3417.2	2.9314	0.4633	2059.37	1	4720.0%	1	K.DPLSANHSLKPLPSVPEEK.K
*	TK261102_lung_cytoE18_2_step11.3409.3409.2	1.4863	0.1491	3157.43	25	1380.0%	1	R.MSSTIFSTGGKDPLSANHSLKPLPSVPEEK.K
*	TK261102_lung_cytoE18_2_step08.4663.4663.2	2.7703	0.5333	2079.44	1	5940.0%	1	R.ECLQALEFLHANQVIHR.D
UQ9Z1R299.6%333.6%11541210375.7(Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) 
*	TK261102_lung_cytoE18_2_step07.2641.2641.2	2.9833	0.5376	2817.64	1	3500.0%	1	R.APPQTQLPSGASSGTGSASATHGGAPLPGTR.G
	TK261102_lung_cytoE18_2_step07.2668.2668.1	0.9248	0.0429	1135.54	4	4440.0%	1	K.KLQEYNVGGK.V
UP9782599.6%83052.6%154160815.3(P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) 
*	TK261102_lung_cytoE18_2_step09.3682.3682.2	2.649	0.5393	2530.42	1	2830.0%	5	R.VLRPPGGGSNFSLGFDEPAEQPVR.K
*	TK261102_lung_cytoE18_2_step11.4249.4249.3	1.5454	0.1163	4399.01	1	1520.0%	2	K.GEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSR.R
*	TK261102_lung_cytoE18_2_step04.2441.2441.1	0.7471	0.0085	1550.96	182	1790.0%	1	K.SSGGREDSESPGTQR.S
ULDHA_MOUSE99.6%185437.8%331363677.7(P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) 
*	TK261102_lung_cytoE18_2_step01.4766.4766.2	1.4868	0.3261	1917.89	1	3440.0%	1	K.DLADELALVDVMEDKLK.G
*	TK261102_lung_cytoE18_2_step09.4002.4002.2	2.4406	0.4762	1848.3	1	5330.0%	1	K.LKGEMMDLQHGSLFLK.T
	TK261102_lung_cytoE18_2_step07.5368.5368.2	4.4776	0.6072	1946.51	1	7190.0%	3	K.LLIVSNPVDILTYVAWK.I
*	TK261102_lung_cytoE18_2_step12.2240.2240.2	1.9332	0.2804	1182.48	1	7780.0%	1	R.RVHPISTMIK.G
*	TK261102_lung_cytoE18_2_step06.1874.1874.1	1.055	0.0785	791.5	1	6000.0%	1	K.YSPHCK.L
	TK261102_lung_cytoE18_2_step01.2056.2056.1	1.3664	0.0644	734.66	1	8000.0%	1	R.NVNIFK.F
*	TK261102_lung_cytoE18_2_step08.3515.3515.1	1.6636	0.278	1027.6	1	5620.0%	6	R.VHPISTMIK.G
*	TK261102_lung_cytoE18_2_step06.1235.1235.2	1.1484	0.1129	2917.59	7	1670.0%	1	K.EEQAPQNKITVVGVGAVGMACAISILMK.D
*	TK261102_lung_cytoE18_2_step01.0055.0055.1	0.973	0.0015	860.51	26	5000.0%	1	K.TPKIVSSK.D
	TK261102_lung_cytoE18_2_step01.2466.2466.1	2.322	0.2728	1120.75	1	5560.0%	1	K.SADTLWGIQK.E
*	TK261102_lung_cytoE18_2_step01.3516.3516.1	1.5932	0.1872	1056.15	9	5620.0%	1	K.DQLIVNLLK.E
UQ9D1L099.6%1115.7%153156619.6(Q9D1L0) Ethanol induced 6 
*	TK261102_lung_cytoE18_2_step12.1499.1499.2	3.6032	0.6608	2155.7	1	5220.0%	1	R.RAPAAQPPAAAAPSAVGSPAAAPR.Q
UPDA4_MOUSE99.6%11256.6%638719735.3(P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) 
*	TK261102_lung_cytoE18_2_step04.0830.0830.1	0.4793	0.0135	1247.57	10	2000.0%	1	K.QLEPIYTSLGK.K
*	TK261102_lung_cytoE18_2_step12.2172.2172.1	1.7085	0.2146	1316.71	6	4500.0%	4	K.FHHTFSPEIAK.F
	TK261102_lung_cytoE18_2_step07.2269.2269.1	1.298	0.0216	716.64	16	5000.0%	1	K.EILTLK.Q
*	TK261102_lung_cytoE18_2_step12.2295.2295.1	0.8556	0.0765	1002.15	2	4380.0%	2	K.HALPLVGHR.K
*	TK261102_lung_cytoE18_2_step07.1853.1853.1	1.2792	0.1033	599.58	10	6250.0%	1	K.KNPIK.F
UKINH_MOUSE99.6%12306.3%9631095496.3(Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) 
	TK261102_lung_cytoE18_2_step11.3697.3697.1	1.7649	0.0296	1158.8	2	5560.0%	1	R.SHSIFLINVK.Q
*	TK261102_lung_cytoE18_2_step10.2717.2717.1	1.1575	0.1202	1338.63	22	2730.0%	1	K.EKANLEAFTADK.D
	TK261102_lung_cytoE18_2_step08.2381.2381.1	1.9047	0.3421	1483.67	1	3750.0%	4	R.HVAVTNMNEHSSR.S
	TK261102_lung_cytoE18_2_step11.2305.2305.2	2.2361	0.2329	1372.83	1	7500.0%	1	R.KLHELTVMQDR.R
	TK261102_lung_cytoE18_2_step01.0215.0215.1	0.9336	0.1551	1596.23	5	3210.0%	1	K.LSGKLYLVDLAGSEK.V
UVIME_MOUSE99.6%136119.4%465535575.1(P20152) Vimentin 
	TK261102_lung_cytoE18_2_step09.3962.3962.2	0.6266	0.0074	2426.13	8	1250.0%	1	K.TVETRDGQVINETSQHHDDLE.-
*	TK261102_lung_cytoE18_2_step09.4222.4222.3	5.5651	0.5821	4038.89	1	2940.0%	3	K.KLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALR.D
*	TK261102_lung_cytoE18_2_step08.3592.3592.3	1.4593	0.0374	2367.95	3	2250.0%	1	R.EEAESTLQSFRQDVDNASLAR.L
	TK261102_lung_cytoE18_2_step06.0708.0708.1	2.5868	0.3832	1536.87	1	5420.0%	7	R.KVESLQEEIAFLK.K
UUBP5_MOUSE99.6%102410.7%858958335.0(P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) 
	TK261102_lung_cytoE18_2_step07.2400.2400.3	1.3376	0.0628	1871.6	11	2500.0%	1	-.MAELSEEALLSVLPTIR.V
*	TK261102_lung_cytoE18_2_step07.2904.2904.1	1.2168	0.1646	729.75	4	7000.0%	3	K.HAFNLK.Q
	TK261102_lung_cytoE18_2_step10.0044.0044.2	1.794	0.4072	2860.85	1	2600.0%	1	R.IGEWELIQESGVPLKPLFGPGYTGIR.N
*	TK261102_lung_cytoE18_2_step06.3670.3670.2	3.5819	0.5661	2826.7	1	3850.0%	2	K.LGHGLLSGEYSKPALESGDGEQVPEQK.E
	TK261102_lung_cytoE18_2_step05.3416.3416.2	1.4024	0.2257	1824.44	1	4000.0%	3	R.YFDGSGGNNHAVEHYR.E
UQ9DAS899.6%6616.5%637693016.0(Q9DAS8) 1600029N02Rik protein 
*	TK261102_lung_cytoE18_2_step12.2343.2343.2	0.7449	0.0334	3131.29	18	1300.0%	1	K.SNGGNLLCAVDESNDHVLSVWDWAKESK.V
*	TK261102_lung_cytoE18_2_step01.3138.3138.2	0.7146	0.0739	2572.45	152	800.0%	1	R.SIEDPARSAGFHPSGSVLAVGTVTGR.W
*	TK261102_lung_cytoE18_2_step08.4617.4617.3	1.3234	0.1007	3811.44	76	1210.0%	1	R.AVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAK.E
	TK261102_lung_cytoE18_2_step07.2348.2348.1	1.7223	0.1946	1211.56	1	6670.0%	1	R.HYLGHNDDIK.C
*	TK261102_lung_cytoE18_2_step12.1987.1987.2	0.8306	0.0228	1837.53	38	2330.0%	1	-.MLIPDELAPTYSLDTR.S
*	TK261102_lung_cytoE18_2_step11.3516.3516.2	4.712	0.612	1962.72	1	7330.0%	1	K.LVHLWSSETHQPVWSR.S
UIF2A_HUMAN99.6%51113.4%314359815.1(P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) 
*	TK261102_lung_cytoE18_2_step09.2783.2783.1	1.0017	0.0486	1245.55	2	3000.0%	1	K.RPGYGAYDAFK.H
*	TK261102_lung_cytoE18_2_step01.2327.2327.1	0.7948	0.0702	1396.01	46	2000.0%	1	-.PGLSCRFYQHK.F
*	TK261102_lung_cytoE18_2_step08.4840.4840.2	2.0014	0.2937	2437.17	1	4210.0%	3	R.HVAEVLEYTKDEQLESLFQR.T
UQ922Y799.6%157111.2%464510285.3(Q922Y7) Unknown (Protein for MGC:6388) 
	TK261102_lung_cytoE18_2_step01.4283.4283.3	1.9389	0.1179	4059.42	4	1500.0%	1	K.IIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYK.G
	TK261102_lung_cytoE18_2_step07.4430.4430.2	2.3405	0.4005	1521.11	1	5360.0%	5	R.LLIHQSLAGGIIGVK.G
	TK261102_lung_cytoE18_2_step06.5048.5048.3	2.2781	0.2035	4185.91	1	1460.0%	3	K.KIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYK.G
UQ9CY4099.6%3535126.2%122131848.8(Q9CY40) Hemoglobin, beta adult major chain 
	TK261102_lung_cytoE18_2_step09.4470.4470.2	3.4414	0.5464	2996.03	1	3100.0%	8	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK261102_lung_cytoE18_2_step12.4505.4505.3	2.1769	0.2276	3134.77	1	2250.0%	1	K.VADALANAAGHLDDLPGALSALSDLHAHKLR.V
	TK261102_lung_cytoE18_2_step04.2336.2336.2	1.0277	0.025	2868.1	1	2140.0%	15	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UHBB1_MOUSE99.6%195664384.9%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major) 
	TK261102_lung_cytoE18_2_step03.0172.0172.2	2.1874	0.468	1139.62	1	7270.0%	8	K.VVAGVATALAHK.Y
	TK261102_lung_cytoE18_2_step01.2938.2938.2	3.4627	0.534	1760.17	1	6670.0%	6	K.VITAFNDGLNHLDSLK.G
	TK261102_lung_cytoE18_2_step01.2211.2211.1	2.2199	0.3937	1467.92	2	3750.0%	14	K.GTFASLSELHCDK.L
	TK261102_lung_cytoE18_2_step11.2758.2758.2	3.1225	0.4413	1437.82	1	6920.0%	1	K.VVAGVATALAHKYH.-
*	TK261102_lung_cytoE18_2_step01.2238.2238.1	1.6511	0.2411	992.97	1	6250.0%	2	K.AAVSCLWGK.V
	TK261102_lung_cytoE18_2_step01.1942.1942.1	3.0284	0.4631	1296.69	1	6820.0%	5	K.DFTPAAQAAFQK.V
	TK261102_lung_cytoE18_2_step07.4556.4556.2	2.859	0.635	2576.54	1	3810.0%	73	K.GTFASLSELHCDKLHVDPENFR.L
	TK261102_lung_cytoE18_2_step01.1391.1391.2	1.5122	0.2201	915.93	2	6430.0%	2	-.VHLTDAEK.A
	TK261102_lung_cytoE18_2_step07.4106.4106.2	5.0249	0.4913	1888.47	1	5940.0%	15	K.KVITAFNDGLNHLDSLK.G
	TK261102_lung_cytoE18_2_step01.2010.2010.1	1.6006	0.2517	1128.85	3	4380.0%	8	K.LHVDPENFR.L
	TK261102_lung_cytoE18_2_step01.0338.0338.2	4.4166	0.6533	1984.24	1	6110.0%	6	R.YFDSFGDLSSASAIMGNAK.V
	TK261102_lung_cytoE18_2_step01.3622.3622.1	0.9736	0.0997	1277.06	8	5000.0%	2	R.LLVVYPWTQR.Y
	TK261102_lung_cytoE18_2_step01.0191.0191.1	1.45	0.1087	1303.06	1	5420.0%	1	K.VNSDEVGGEALGR.L
UTBBX_HUMAN99.6%4129944.4%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain 
	TK261102_lung_cytoE18_2_step06.5378.5378.2	4.6521	0.5646	1962.33	1	7940.0%	8	K.GHYTEGAELVDSVLDVVR.K
	TK261102_lung_cytoE18_2_step09.4933.4933.3	1.5663	0.0091	3443.42	10	1480.0%	1	R.KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK.I
	TK261102_lung_cytoE18_2_step01.2630.2630.1	1.5351	0.2659	1321.23	1	5450.0%	1	R.IMNTFSVVPSPK.V
	TK261102_lung_cytoE18_2_step12.4716.4716.2	2.1451	0.3458	1622.35	1	4620.0%	2	R.LHFFMPGFAPLTSR.G
	TK261102_lung_cytoE18_2_step01.3659.3659.2	1.5174	0.2287	3107.04	1	2310.0%	6	K.FWEVISDEHGIDPTGTYHGDSDLQLDR.I
	TK261102_lung_cytoE18_2_step10.4588.4588.2	4.1677	0.5109	2802.78	1	4000.0%	13	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK261102_lung_cytoE18_2_step01.1870.1870.2	2.2227	0.4148	1823.97	1	5000.0%	1	R.EIVHIQAGQCGNQIGAK.F
	TK261102_lung_cytoE18_2_step01.3296.3296.2	1.6632	0.173	1617.11	1	4290.0%	1	R.AILVDLEPGTMDSVR.S
	TK261102_lung_cytoE18_2_step01.4614.4614.2	4.2703	0.6895	2712.79	1	4170.0%	2	K.LTTPTYGDLNHLVSATMSGVTTCLR.F
	TK261102_lung_cytoE18_2_step01.3218.3218.1	1.1119	0.0431	1232.01	40	3330.0%	1	R.ISEQFTAMFR.R
UQ8R1K599.6%3515.8%222216349.4(Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) 
*	TK261102_lung_cytoE18_2_step11.2077.2077.3	1.198	0.0193	2075.67	140	1930.0%	1	R.GGGSGNFMGRGGNFGGGGGNFGR.G
	TK261102_lung_cytoE18_2_step06.2370.2370.1	2.1674	0.416	1473.51	1	5000.0%	2	K.YHTINGHNCEVK.K
UQ9DBY699.6%7158.1%407446548.5(Q9DBY6) 1200009K13Rik protein 
	TK261102_lung_cytoE18_2_step08.3245.3245.1	1.3297	0.1409	700.56	22	6000.0%	1	K.GFVLHK.S
	TK261102_lung_cytoE18_2_step08.3307.3307.2	4.3569	0.5372	2113.5	1	6180.0%	1	K.SKSEEAHAEDSVMDHHFR.K
	TK261102_lung_cytoE18_2_step07.2662.2662.1	1.7996	0.1181	1177.7	3	5620.0%	3	R.RFEKPLEEK.G
UPCB2_MOUSE99.6%3510.2%362382226.8(Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) 
	TK261102_lung_cytoE18_2_step12.3163.3163.3	3.4487	0.4495	3387.35	1	2170.0%	2	K.LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK.G
	TK261102_lung_cytoE18_2_step08.2795.2795.1	1.2576	0.1094	698.56	35	5000.0%	1	R.LLMHGK.E
URHOA_MOUSE99.6%4813.5%193217826.1(Q9QUI0) Transforming protein RhoA 
	TK261102_lung_cytoE18_2_step06.2182.2182.1	1.898	0.2545	1427.67	1	4090.0%	2	K.MKQEPVKPEEGR.D
	TK261102_lung_cytoE18_2_step11.3696.3696.2	3.4901	0.5357	1609.54	1	7690.0%	2	K.HFCPNVPIILVGNK.K
UQ8VCM799.6%115512.8%436493915.9(Q8VCM7) Similar to fibrinogen, gamma polypeptide 
	TK261102_lung_cytoE18_2_step08.2901.2901.2	1.221	0.3103	1567.71	5	3570.0%	2	R.LSIGEGQQHHMGGSK.Q
	TK261102_lung_cytoE18_2_step01.2302.2302.2	2.6127	0.541	2563.36	1	3640.0%	1	K.AIQVYYNPDQPPKPGMIDSATQK.S
	TK261102_lung_cytoE18_2_step11.1732.1732.2	2.9538	0.5328	1987.87	1	5000.0%	1	K.CHAGHLNGVYHQGGTYSK.S
UQ91WT799.6%51714.2%323371897.2(Q91WT7) Hypothetical 37.2 kDa protein (Expressed sequence AW557061) 
*	TK261102_lung_cytoE18_2_step06.4852.4852.2	2.117	0.2768	2525.37	1	3040.0%	4	R.VVLNDGHFIPALGFGTTVPDKVPK.D
*	TK261102_lung_cytoE18_2_step11.5938.5938.2	1.0917	0.2028	2720.64	54	1430.0%	1	R.NLRYNTASYFDDHPNHPFTDEY.-
UACTA_HUMAN99.6%72183833.7%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) 
	TK261102_lung_cytoE18_2_step01.2971.2971.2	2.8267	0.5116	1793.13	1	6000.0%	2	K.SYELPDGQVITIGNER.F
	TK261102_lung_cytoE18_2_step06.4222.4222.2	3.1065	0.3981	1964.31	1	5330.0%	6	K.YPIEHGIITNWDDMEK.I
	TK261102_lung_cytoE18_2_step01.2970.2970.1	2.0959	0.2355	1000.92	2	6430.0%	1	R.DLTDYLMK.I
	TK261102_lung_cytoE18_2_step11.3026.3026.2	2.2025	0.3448	1504.23	1	7500.0%	3	K.IWHHSFYNELR.V
	TK261102_lung_cytoE18_2_step01.2386.2386.1	0.8706	0.0051	644.62	8	6000.0%	1	R.GILTLK.Y
	TK261102_lung_cytoE18_2_step01.1984.1984.1	2.1903	0.3119	1163.81	1	6000.0%	1	K.EITALAPSTMK.I
	TK261102_lung_cytoE18_2_step05.0945.0945.2	3.0951	0.5598	3198.22	1	2930.0%	2	R.TTGIVLDSGDGVTHNVPIYEGYALPHAIMR.L
	TK261102_lung_cytoE18_2_step05.3522.3522.2	2.25	0.3662	1174.01	1	7000.0%	9	R.HQGVMVGMGQK.D
	TK261102_lung_cytoE18_2_step01.2650.2650.2	1.7202	0.1982	1958.35	1	3820.0%	2	R.VAPEEHPTLLTEAPLNPK.A
UPYRG_MOUSE99.6%71312.2%591667116.6(P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) 
	TK261102_lung_cytoE18_2_step08.4012.4012.3	1.3865	0.0342	3383.28	84	1290.0%	1	R.ENFCNIHVSLVPQPSSTGEQKTKPTQNSVR.E
	TK261102_lung_cytoE18_2_step09.3435.3435.2	1.7809	0.1283	2528.83	1	3330.0%	1	K.RENFCNIHVSLVPQPSSTGEQK.T
*	TK261102_lung_cytoE18_2_step09.2533.2533.1	1.1347	0.2099	898.6	3	5830.0%	1	R.LPHYLQK.G
*	TK261102_lung_cytoE18_2_step09.3091.3091.2	3.4781	0.5223	2393.55	1	4290.0%	3	K.TSHPVVIDMPEHNPGQMGGTMR.L
	TK261102_lung_cytoE18_2_step08.3136.3136.1	2.0299	0.3592	1304.74	1	5450.0%	1	K.ALEHSALAINHK.L
UQ9CRK799.6%61449.2%118128626.8(Q9CRK7) 9430095H01Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step06.4996.4996.2	1.1098	0.0066	2002.49	48	2500.0%	1	R.MLVTFDEELRPLPVSVR.V
	TK261102_lung_cytoE18_2_step07.5373.5373.2	2.7405	0.5051	2459.86	1	4050.0%	2	R.AELATEEFLPVTPILEGFVILR.K
	TK261102_lung_cytoE18_2_step10.3439.3439.2	1.9696	0.3051	2083.18	1	3610.0%	3	K.TITGFQTHTTPVLLAHGER.A
UAPA4_MOUSE99.6%6813.9%395450295.6(P06728) Apolipoprotein A-IV precursor (Apo-AIV) 
*	TK261102_lung_cytoE18_2_step06.0368.0368.3	4.549	0.6169	2872.8	1	3370.0%	1	K.LQEHLKPYAVDLQDQINTQTQEMK.L
*	TK261102_lung_cytoE18_2_step01.2655.2655.1	1.4548	0.1469	1548.15	12	3330.0%	1	K.LNHQMEGLAFQMK.K
*	TK261102_lung_cytoE18_2_step09.1766.1766.1	0.9402	0.0044	681.84	71	5000.0%	2	K.GHLTPR.A
*	TK261102_lung_cytoE18_2_step12.1951.1951.1	1.3804	0.0247	1414.86	17	3640.0%	1	R.EKVNSFMSTLEK.K
UG6PI_MOUSE99.6%163223.3%557626377.9(P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) 
*	TK261102_lung_cytoE18_2_step12.1269.1269.1	0.7542	0.3016	991.86	27	2140.0%	1	K.EWFLEAAK.D
*	TK261102_lung_cytoE18_2_step01.3039.3039.3	1.849	0.137	3002.32	6	1700.0%	1	K.SITDIINIGIGGSDLGPLMVTEALKPYSK.G
	TK261102_lung_cytoE18_2_step11.4041.4041.3	3.71	0.5798	3319.59	1	2590.0%	2	R.VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK.M
	TK261102_lung_cytoE18_2_step11.1041.1041.1	0.8609	0.1619	591.52	2	6250.0%	1	K.GLHHK.I
*	TK261102_lung_cytoE18_2_step01.3480.3480.3	2.2727	0.3428	2849.09	1	2600.0%	2	K.KIEPELEGSSAVTSHDSSTNGLISFIK.Q
	TK261102_lung_cytoE18_2_step06.3509.3509.1	1.1519	0.1016	878.82	7	5000.0%	3	R.AVLHVALR.N
	TK261102_lung_cytoE18_2_step08.1700.1700.1	0.559	7.0E-4	525.95	1	6670.0%	1	K.YITK.S
	TK261102_lung_cytoE18_2_step03.0247.0247.2	0.7585	0.0329	845.45	154	3570.0%	1	R.KELQAAGK.S
	TK261102_lung_cytoE18_2_step05.3790.3790.1	1.413	0.3629	1190.88	1	4500.0%	3	K.HFVALSTNTAK.V
UDVL2_MOUSE99.6%339.1%736788036.0(Q60838) Segment polarity protein dishevelled homolog DVL-2 (Dishevelled-2) (DSH homolog 2) 
*	TK261102_lung_cytoE18_2_step10.3033.3033.1	1.1561	0.0233	1551.78	4	3440.0%	1	R.RGGEPGGTGDGGPPPSR.G
	TK261102_lung_cytoE18_2_step07.3786.3786.3	3.3686	0.4614	3882.45	1	1930.0%	1	R.TSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLR.R
	TK261102_lung_cytoE18_2_step11.2056.2056.1	1.2802	0.1371	1499.72	5	3850.0%	1	K.AMAAPESGLEVRDR.M
UTCPB_MOUSE99.6%122019.8%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) 
	TK261102_lung_cytoE18_2_step06.3149.3149.1	2.3604	0.5043	1539.84	1	5710.0%	2	R.AAHSEGHITAGLDMK.E
	TK261102_lung_cytoE18_2_step12.3119.3119.2	2.5997	0.5194	1436.3	1	6360.0%	1	K.KIHPQTIISGWR.E
	TK261102_lung_cytoE18_2_step12.1133.1133.2	0.7065	0.1131	1133.66	8	3750.0%	1	K.HGINCFINR.Q
	TK261102_lung_cytoE18_2_step01.0143.0143.1	1.2051	0.0455	861.8	2	6430.0%	1	R.EAESLIAK.K
	TK261102_lung_cytoE18_2_step11.1150.1150.1	1.5547	0.3919	1018.69	1	5710.0%	3	K.RVPDHHPC.-
	TK261102_lung_cytoE18_2_step09.0108.0108.3	1.5405	0.0347	4325.58	51	1010.0%	1	K.HGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVER.L
	TK261102_lung_cytoE18_2_step09.3134.3134.2	0.8229	0.0729	2689.05	59	1250.0%	1	K.ALRMLPTIIADNAGYDSADLVAQLR.A
UTERA_MOUSE99.6%265624.2%806893085.3(Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] 
	TK261102_lung_cytoE18_2_step01.4286.4286.3	6.361	0.603	3675.61	1	2940.0%	1	K.LADDVDLEQVANETHGHVGADLAALCSEAALQAIR.K
	TK261102_lung_cytoE18_2_step01.2652.2652.1	1.5546	0.3093	1174.14	1	5000.0%	2	R.GILLYGPPGTGK.T
	TK261102_lung_cytoE18_2_step07.2513.2513.1	1.6096	0.3313	1192.75	4	3750.0%	4	R.RDHFEEAMR.F
	TK261102_lung_cytoE18_2_step04.0147.0147.3	2.1344	0.0175	1803.81	6	3210.0%	1	R.LDQLIYIPLPDEKSR.V
	TK261102_lung_cytoE18_2_step07.3702.3702.1	1.8831	0.1862	1094.88	1	6880.0%	1	R.LEILQIHTK.N
	TK261102_lung_cytoE18_2_step01.2443.2443.2	2.0082	0.2901	1827.19	1	5360.0%	1	R.ELQELVQYPVEHPDK.F
	TK261102_lung_cytoE18_2_step03.4132.4132.1	0.8098	0.0719	651.33	87	5000.0%	1	R.EIFDK.A
	TK261102_lung_cytoE18_2_step07.3704.3704.1	1.2461	0.0424	947.77	14	5000.0%	2	R.KGDIFLVR.G
	TK261102_lung_cytoE18_2_step10.2664.2664.1	1.4643	0.1689	714.69	6	7000.0%	4	R.HPALFK.A
	TK261102_lung_cytoE18_2_step08.2487.2487.1	1.2908	0.1391	837.79	5	5000.0%	1	K.AIGVKPPR.G
	TK261102_lung_cytoE18_2_step12.4100.4100.2	1.4662	0.1093	2522.4	6	2500.0%	1	K.NVFIIGATNRPDIIDPAILRPGR.L
	TK261102_lung_cytoE18_2_step01.0150.0150.1	1.0798	0.0084	545.99	1	7500.0%	1	K.TLLAK.A
	TK261102_lung_cytoE18_2_step07.1682.1682.1	1.1752	0.2118	629.56	1	6000.0%	1	R.KSPVAK.D
	TK261102_lung_cytoE18_2_step12.3272.3272.2	1.2711	0.0316	1890.13	7	2810.0%	1	R.LGDVISIQPCPDVKYGK.R
	TK261102_lung_cytoE18_2_step01.3872.3872.2	2.2415	0.578	2501.43	1	3570.0%	1	R.ETVVEVPQVTWEDIGGLEDVKR.E
UQ8VI5299.6%228.8%386432395.7(Q8VI52) Endophilin B1b 
	TK261102_lung_cytoE18_2_step09.3414.3414.2	0.9167	0.0269	2053.7	84	1940.0%	1	K.LAADAGTFLSRAVQFTEEK.L
	TK261102_lung_cytoE18_2_step12.3247.3247.2	3.1601	0.594	1685.55	1	6070.0%	1	R.LLLEGISSTHAHHLR.C
UCLH1_HUMAN99.6%255317.1%16751916135.7(Q00610) Clathrin heavy chain 1 (CLH-17) 
	TK261102_lung_cytoE18_2_step07.2448.2448.1	1.5666	0.119	1069.46	1	6880.0%	1	R.AHIAQLCEK.A
*	TK261102_lung_cytoE18_2_step04.2396.2396.2	2.7271	0.4668	2885.29	1	3000.0%	3	R.RPLIDQVVQTALSETQDPEEVSVTVK.A
*	TK261102_lung_cytoE18_2_step04.0570.0570.2	1.964	0.3666	1778.21	1	5000.0%	1	R.IHEGCEEPATHNALAK.I
*	TK261102_lung_cytoE18_2_step06.2458.2458.1	0.9386	0.0023	1368.69	45	3180.0%	1	K.NNRPSEGPLQTR.L
*	TK261102_lung_cytoE18_2_step05.0159.0159.1	1.1113	0.0884	943.73	7	5000.0%	1	K.HELIEFR.R
*	TK261102_lung_cytoE18_2_step11.5036.5036.2	3.9258	0.6282	2371.4	1	4250.0%	2	R.KFDVNTSAVQVLIEHIGNLDR.A
*	TK261102_lung_cytoE18_2_step04.0156.0156.3	0.9951	0.0565	1437.12	340	1880.0%	1	K.SVDPTLALSVYLR.A
*	TK261102_lung_cytoE18_2_step12.4328.4328.3	1.0761	0.0082	3663.71	10	1410.0%	1	K.EAIDSYIKADDPSSYMEVVQAANTSGNWEELVK.Y
*	TK261102_lung_cytoE18_2_step01.4358.4358.2	2.5297	0.4357	3148.65	1	2780.0%	2	R.FQEHLQLQNLGINPANIGFSTLTMESDK.F
*	TK261102_lung_cytoE18_2_step05.0838.0838.3	1.5593	0.1188	2362.98	37	1900.0%	3	K.MEGNAEESTLFCFAVRGQAGGK.L
*	TK261102_lung_cytoE18_2_step09.3566.3566.2	3.4982	0.5627	1948.64	1	5590.0%	4	K.LHIIEVGTPPTGNQPFPK.K
*	TK261102_lung_cytoE18_2_step09.4955.4955.3	0.9996	0.0236	3235.42	2	1350.0%	1	K.DAMQYASESKDTELAEELLQWFLQEEK.R
*	TK261102_lung_cytoE18_2_step07.2978.2978.1	1.5682	0.2424	1557.94	3	3570.0%	1	R.RPISADSAIMNPASK.V
	TK261102_lung_cytoE18_2_step12.4087.4087.2	1.2535	0.1858	1714.39	9	2860.0%	1	R.AHMGMFTELAILYSK.F
*	TK261102_lung_cytoE18_2_step09.3139.3139.2	2.289	0.5117	1846.65	1	5310.0%	1	R.KVSQPIEGHAASFAQFK.M
*	TK261102_lung_cytoE18_2_step11.3740.3740.3	1.495	0.0292	3108.59	15	1730.0%	1	K.FDVNTSAVQVLIEHIGNLDRAYEFAER.C
UCDC2_MOUSE99.6%245.1%297341078.4(P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) 
	TK261102_lung_cytoE18_2_step10.4040.4040.2	3.7769	0.5336	1803.44	1	7140.0%	2	K.KPLFHGDSEIDQLFR.I
UCRP1_MOUSE99.6%4447.4%7684198.6(P04006) Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP) 
	TK261102_lung_cytoE18_2_step11.1960.1960.1	1.6425	0.307	1113.61	1	5710.0%	1	K.DWHRPCLK.C
*	TK261102_lung_cytoE18_2_step12.2648.2648.3	3.8121	0.4614	3135.92	1	3150.0%	1	K.TLTSGGHAEHEGKPYCNHPCYSAMFGPK.G
UFAAA_MOUSE99.6%467.6%419461047.4(P35505) Fumarylacetoacetase (EC 3.7.1.2) (Fumarylacetoacetate hydrolase) (Beta-diketonase) (FAA) 
*	TK261102_lung_cytoE18_2_step11.4554.4554.2	3.878	0.4848	2545.1	1	4760.0%	1	K.HQHVFDETTLNNFMGLGQAAWK.E
*	TK261102_lung_cytoE18_2_step09.3085.3085.1	1.854	0.3121	1072.08	1	5560.0%	2	K.HLFTGPALSK.H
UQ9UEV999.6%10144.3%26022781905.7(Q9UEV9) Actin-binding protein homolog ABP-278 
	TK261102_lung_cytoE18_2_step12.4236.4236.2	0.7535	0.0195	2834.8	4	1880.0%	1	K.DGTCTVTYLPTLPGDYSILVKYNDK.H
	TK261102_lung_cytoE18_2_step09.3555.3555.2	1.9228	0.3699	2196.45	1	3100.0%	2	K.AHGPGLEGGLVGKPAEFTIDTK.G
	TK261102_lung_cytoE18_2_step09.1328.1328.3	1.0472	0.0052	1272.79	3	2290.0%	1	K.CLATGPGIASTVK.T
	TK261102_lung_cytoE18_2_step12.1584.1584.1	1.666	0.0926	1051.23	1	5560.0%	2	K.LKPGAPLKPK.L
	TK261102_lung_cytoE18_2_step11.1922.1922.3	1.7053	4.0E-4	3036.69	2	1850.0%	1	K.ANEPTHFTVDCTEAGEGDVSVGIKCDAR.V
	TK261102_lung_cytoE18_2_step11.2941.2941.1	2.3849	0.4512	1278.12	1	5000.0%	1	R.AWGPGLHGGIVGR.S
ULKHA_MOUSE99.6%174320.0%610688906.4(P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) 
	TK261102_lung_cytoE18_2_step07.4949.4949.2	3.0354	0.4898	2409.72	1	3810.0%	4	K.SLSNVIAHEISHSWTGNLVTNK.T
	TK261102_lung_cytoE18_2_step11.2561.2561.1	1.2218	0.0851	947.74	9	3750.0%	2	K.APLPLGHIK.R
*	TK261102_lung_cytoE18_2_step11.2949.2949.3	1.6889	0.0229	2110.38	5	2500.0%	1	K.VVINGQEVKYTLGESQGYK.G
*	TK261102_lung_cytoE18_2_step08.2180.2180.1	2.6922	0.3845	1581.63	1	6250.0%	4	K.SHDQAVHTYQEHK.A
	TK261102_lung_cytoE18_2_step10.4199.4199.2	3.086	0.583	2204.88	1	5310.0%	1	K.TWDHFWLNEGHTVYLER.H
*	TK261102_lung_cytoE18_2_step08.4181.4181.1	1.3151	0.1038	1369.71	4	3750.0%	1	K.ASMHPVTAMLVGR.D
*	TK261102_lung_cytoE18_2_step01.4514.4514.2	3.2556	0.5141	1972.76	1	6560.0%	1	K.DLSSHQLNEFLAQVLQK.A
	TK261102_lung_cytoE18_2_step11.1860.1860.1	1.2969	0.0129	904.59	7	5830.0%	1	R.TQHLHLR.C
	TK261102_lung_cytoE18_2_step10.1373.1373.1	0.7214	0.0245	571.85	6	3750.0%	1	R.QIGPR.T
UQ91Y3799.6%3310.4%623695665.6(Q91Y37) Cytosolic aminopeptidase P 
*	TK261102_lung_cytoE18_2_step11.1880.1880.1	1.3586	0.0595	1044.68	4	5560.0%	1	R.SAGHHLVPVK.E
	TK261102_lung_cytoE18_2_step11.4564.4564.3	5.0	0.6023	3634.91	1	2580.0%	1	R.SALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYK.T
*	TK261102_lung_cytoE18_2_step06.0068.0068.3	1.1094	0.042	2339.3	20	1380.0%	1	R.VDAPGVKQHLLLDLGLEAEYR.I
UQ9Z1F999.6%7919.9%638705695.2(Q9Z1F9) ARX 
*	TK261102_lung_cytoE18_2_step08.4971.4971.3	5.0907	0.7267	3587.66	1	3280.0%	2	K.ESVLQFHPQANIEAHHDSIMNPDYNVEFFR.Q
	TK261102_lung_cytoE18_2_step09.5470.5470.2	1.4191	0.1357	2739.69	12	1800.0%	1	R.MCLAADVPLIESGTAGYLGQVTTIKK.G
	TK261102_lung_cytoE18_2_step06.2446.2446.2	2.3287	0.3512	1862.35	1	5360.0%	1	K.GVTECYECHPKPTQR.T
	TK261102_lung_cytoE18_2_step09.1378.1378.3	1.0641	0.0255	1784.66	2	2330.0%	1	R.VHLAEKGDGAELIWDK.D
	TK261102_lung_cytoE18_2_step05.0302.0302.3	1.4617	0.1072	3188.01	22	1390.0%	1	R.NGSRLQADDFLQDYTLLINILHSEDLGK.D
	TK261102_lung_cytoE18_2_step01.3367.3367.1	1.0394	0.0352	1379.97	36	3180.0%	1	K.EWAKSTGYDPVK.L
UQ8R2X099.6%4615.6%443500256.4(Q8R2X0) Similar to EH-domain containing 2 
	TK261102_lung_cytoE18_2_step09.2173.2173.3	1.8381	0.0824	3188.85	108	1340.0%	1	R.FMCAQLPNQVLESISIIDTPGILSGAKQR.V
*	TK261102_lung_cytoE18_2_step12.2703.2703.2	0.6956	0.0532	2484.16	39	1820.0%	1	-.MHGETEGTVPGNALVVDPEKPFR.K
	TK261102_lung_cytoE18_2_step07.3381.3381.2	3.8722	0.6331	2021.65	1	6250.0%	2	K.IQLEHHISPGDFPDCQK.M
UARF1_HUMAN99.6%3323.3%180205666.8(P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 
	TK261102_lung_cytoE18_2_step10.3899.3899.2	4.1351	0.5063	2154.27	1	7650.0%	1	R.HYFQNTQGLIFVVDSNDR.E
	TK261102_lung_cytoE18_2_step06.0726.0726.1	1.4589	0.2338	1089.71	2	5560.0%	1	R.DAVLLVFANK.Q
	TK261102_lung_cytoE18_2_step01.3472.3472.1	1.2202	0.1682	1568.09	26	3080.0%	1	K.NISFTVWDVGGQDK.I
URO60_MOUSE99.6%7721.2%538601247.9(O08848) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP) 
*	TK261102_lung_cytoE18_2_step08.4927.4927.2	3.0533	0.5814	2189.23	1	5880.0%	1	R.TKDDLEVIHLIEEHQLVR.E
	TK261102_lung_cytoE18_2_step09.2681.2681.1	1.2084	0.0796	1104.66	1	6880.0%	1	R.EHLLTNHLK.S
*	TK261102_lung_cytoE18_2_step11.4005.4005.2	0.8417	0.0525	3044.63	17	1460.0%	1	K.DDLEVIHLIEEHQLVREHLLTNHLK.S
	TK261102_lung_cytoE18_2_step11.2706.2706.2	2.0091	0.3066	1680.86	1	4000.0%	1	R.LSHLKPSSEGLAIVTK.Y
*	TK261102_lung_cytoE18_2_step09.2634.2634.3	1.4062	0.1626	2179.82	3	2240.0%	1	K.MTANSVLEPGNSEVSLICEK.L
	TK261102_lung_cytoE18_2_step10.4489.4489.2	1.3812	0.0974	1884.61	3	3440.0%	1	K.ALLQEMPLTALLRNLGK.M
*	TK261102_lung_cytoE18_2_step10.5044.5044.3	1.8904	0.2013	3790.41	12	1290.0%	1	R.TEKESSVVAFACDMVPFPVTTDMTLQQVLTAMNK.V
UPDI_MOUSE99.6%176920.6%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) 
	TK261102_lung_cytoE18_2_step11.5880.5880.2	1.0392	0.0201	2327.9	16	2000.0%	1	K.DHENIIIAKMDSTANEVEAVK.V
	TK261102_lung_cytoE18_2_step07.4770.4770.2	3.6235	0.5913	1967.97	1	6250.0%	5	K.HNQLPLVIEFTEQTAPK.I
	TK261102_lung_cytoE18_2_step10.5363.5363.2	0.6031	0.0285	2097.05	3	1390.0%	1	R.LAKVDATEESDLAQQYGVR.G
	TK261102_lung_cytoE18_2_step10.2792.2792.1	1.3497	0.2006	930.89	1	5000.0%	6	K.VHSFPTLK.F
	TK261102_lung_cytoE18_2_step11.4125.4125.1	1.6691	0.0475	1084.65	1	5000.0%	2	K.THILLFLPK.S
	TK261102_lung_cytoE18_2_step10.4493.4493.2	3.0397	0.4121	1836.64	1	6430.0%	1	K.ILFIFIDSDHTDNQR.I
	TK261102_lung_cytoE18_2_step11.2773.2773.2	3.1868	0.3667	1953.0	1	5330.0%	1	K.IKPHLMSQEVPEDWDK.Q
UQ920Q699.6%483.5%346369398.5(Q920Q6) RNA-binding protein Musashi2-L 
	TK261102_lung_cytoE18_2_step09.2234.2234.2	2.6459	0.4989	1362.3	1	6820.0%	2	K.VLGQPHHELDSK.T
UQ8VCI599.6%117.0%299327334.3(Q8VCI5) Peroxisomal farnesylated protein 
*	TK261102_lung_cytoE18_2_step11.1561.1561.2	4.1249	0.587	2086.73	1	5500.0%	1	K.AKPSPEHAPTISAPDASGPQK.R
URANG_MOUSE99.6%41611.3%203235825.2(P34022) Ran-specific GTPase-activating protein (Ran binding protein 1) (RANBP1) 
	TK261102_lung_cytoE18_2_step08.5131.5131.2	2.8038	0.5378	2741.82	1	4090.0%	4	R.AWVWNTHADFADECPKPELLAIR.F
UPDX2_MOUSE99.6%5741.9%198217795.4(Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) 
*	TK261102_lung_cytoE18_2_step01.4732.4732.2	1.824	0.3676	1709.08	1	3750.0%	1	K.EGGLGPLNIPLLADVTK.S
	TK261102_lung_cytoE18_2_step09.5473.5473.2	0.9742	0.0263	2702.12	106	1520.0%	1	K.LGCEVLGVSVDSQFTHLAWINTPR.K
	TK261102_lung_cytoE18_2_step12.3831.3831.3	1.5234	0.3284	4559.12	2	1120.0%	1	R.SVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSK.E
*	TK261102_lung_cytoE18_2_step04.2356.2356.2	4.5404	0.5758	1837.73	1	7350.0%	2	R.KEGGLGPLNIPLLADVTK.S
UCYPB_MOUSE99.6%4106.7%208227139.5(P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) 
	TK261102_lung_cytoE18_2_step09.3138.3138.2	2.3518	0.4497	1478.28	1	6540.0%	1	K.HYGPGWVSMANAGK.D
UO3549999.6%71511.3%773839544.4(O35499) Nuclear autoantigenic sperm protein 
*	TK261102_lung_cytoE18_2_step06.4160.4160.3	1.7548	0.0306	3792.13	6	1430.0%	1	K.DGSSVEEVKAELVPEQEEAMLPVEESEAAGDGVETK.V
	TK261102_lung_cytoE18_2_step06.5488.5488.2	3.2495	0.4224	2354.74	1	4090.0%	3	K.HLVMGDIPAAVNAFQEAASLLGK.K
	TK261102_lung_cytoE18_2_step06.3606.3606.2	2.2799	0.5204	2144.39	1	5000.0%	1	R.KPTDGASSSNCVTDISHLVR.K
	TK261102_lung_cytoE18_2_step07.3328.3328.1	1.7809	0.3248	856.73	1	6430.0%	2	K.KLLGLGQK.H
UQ9CQR699.6%113.3%305351595.7(Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit) 
	TK261102_lung_cytoE18_2_step10.2124.2124.1	2.3085	0.4856	1182.51	1	6110.0%	1	R.AHQLVHEGYK.F
UTBCA_MOUSE99.6%2415.9%107126265.3(P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A) 
*	TK261102_lung_cytoE18_2_step01.3887.3887.2	4.4903	0.6046	2010.83	1	6880.0%	2	R.RLEAAYTDLQQILESEK.D
UTPIS_MOUSE99.6%81228.2%248265817.3(P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) 
	TK261102_lung_cytoE18_2_step01.2147.2147.2	2.9063	0.3722	1460.94	1	7500.0%	1	R.HVFGESDELIGQK.V
	TK261102_lung_cytoE18_2_step09.3021.3021.2	3.8978	0.4136	1615.86	1	8460.0%	2	R.RHVFGESDELIGQK.V
	TK261102_lung_cytoE18_2_step01.4530.4530.2	1.7357	0.2439	3032.04	1	1960.0%	1	K.ELASQPDVDGFLVGGASLKPEFVDIINAK.Q
	TK261102_lung_cytoE18_2_step09.3409.3409.1	1.3265	0.0735	1082.33	1	5620.0%	1	R.KFFVGGNWK.M
*	TK261102_lung_cytoE18_2_step07.4757.4757.2	4.2239	0.5529	1825.74	1	6180.0%	1	K.VSHALAEGLGVIACIGEK.L
UENOA_MOUSE99.6%3821450.1%433470106.8(P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) 
*	TK261102_lung_cytoE18_2_step01.4542.4542.2	3.36	0.5924	2974.66	1	3540.0%	1	K.SFVQNYPVVSIEDPFDQDDWGAWQK.F
	TK261102_lung_cytoE18_2_step01.1908.1908.1	1.2523	0.1138	901.74	1	5000.0%	1	K.TIAPALVSK.K
*	TK261102_lung_cytoE18_2_step06.5390.5390.2	1.3572	0.281	2194.82	5	2630.0%	1	K.AGYTDQVVIGMDVAASEFYR.S
	TK261102_lung_cytoE18_2_step01.2356.2356.1	1.3545	0.0146	1409.24	2	3750.0%	1	R.GNPTVEVDLYTAK.G
*	TK261102_lung_cytoE18_2_step06.5173.5173.3	5.3467	0.0261	3026.3	1	2930.0%	6	R.HIADLAGNPEVILPVPAFNVINGGSHAGNK.L
	TK261102_lung_cytoE18_2_step01.0429.0429.2	2.1372	0.5484	2035.09	1	3680.0%	2	K.FTASAGIQVVGDDLTVTNPK.R
*	TK261102_lung_cytoE18_2_step04.0631.0631.1	1.6986	0.226	1181.99	2	4500.0%	2	K.GVSQAVEHINK.T
	TK261102_lung_cytoE18_2_step01.1427.1427.1	1.0843	0.0195	542.58	2	6250.0%	2	R.NPLAK.-
	TK261102_lung_cytoE18_2_step05.3622.3622.1	1.9724	0.1742	1144.44	17	5560.0%	3	R.IGAEVYHNLK.N
	TK261102_lung_cytoE18_2_step05.0654.0654.3	0.7208	0.0698	1283.5	255	1250.0%	1	K.LMIEMDGTENK.S
*	TK261102_lung_cytoE18_2_step01.3236.3236.1	2.4183	0.2878	1442.03	1	5450.0%	2	R.YITPDQLADLYK.S
*	TK261102_lung_cytoE18_2_step04.0122.0122.2	1.9484	0.1396	1073.37	1	7500.0%	1	K.KVNVVEQEK.I
	TK261102_lung_cytoE18_2_step01.2290.2290.2	1.9652	0.3365	1544.38	1	5770.0%	1	K.LAQSNGWGVMVSHR.S
	TK261102_lung_cytoE18_2_step06.4637.4637.3	2.1174	0.0322	2997.73	3	1850.0%	1	R.SGETEDTFIADLVVGLCTGQIKTGAPCR.S
UP2CG_MOUSE99.6%5178.7%542587284.4(Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13) 
*	TK261102_lung_cytoE18_2_step06.2988.2988.3	6.7238	0.7049	4061.41	1	2500.0%	1	K.GHTGFSSNSEHGTEAGQISEPGTATGEAGPSCSSASDKLPR.V
*	TK261102_lung_cytoE18_2_step08.1908.1908.1	0.9951	0.1105	680.64	9	5000.0%	4	K.VPPHTK.S
UQ9JKR699.6%559.1%9991111815.2(Q9JKR6) 170 kDa glucose regulated protein GRP170 precursor 
*	TK261102_lung_cytoE18_2_step08.3797.3797.2	1.2215	0.09	1724.13	9	3080.0%	1	R.SRFPEHELIVDPQR.Q
	TK261102_lung_cytoE18_2_step09.4747.4747.2	3.1811	0.5732	2730.49	1	4550.0%	1	R.YSHDFNFHINYGDLGFLGPEDLR.V
	TK261102_lung_cytoE18_2_step12.5240.5240.2	0.733	0.0712	2596.56	5	1300.0%	1	R.MAGLKVLQLINDNTATALSYGVFR.R
*	TK261102_lung_cytoE18_2_step11.3405.3405.3	1.5704	0.1024	3135.93	5	1720.0%	1	R.VPGPVQQALQSAEMSLDQIEQVILVGGATR.V
UQ9D89299.6%118.1%198219465.9(Q9D892) 2010016I08Rik protein 
	TK261102_lung_cytoE18_2_step10.4263.4263.2	3.0125	0.5492	1796.62	1	6000.0%	1	K.LKPEGLHQLLAGFEDK.S
URL28_MOUSE99.6%115.9%1361560212.0(P41105) 60S ribosomal protein L28 
	TK261102_lung_cytoE18_2_step07.1992.1992.1	2.0667	0.5191	921.53	1	7140.0%	1	R.KPATSYVR.T
URS3_MOUSE99.6%71521.0%243266749.7(P17073) 40S ribosomal protein S3 
	TK261102_lung_cytoE18_2_step01.1891.1891.1	1.6657	0.2308	1573.72	1	3330.0%	1	K.GGKPEPPAMPQPVPTA.-
	TK261102_lung_cytoE18_2_step01.3752.3752.2	2.7716	0.593	2472.48	1	3570.0%	1	K.FVDGLMIHSGDPVNYYVDTAVR.H
	TK261102_lung_cytoE18_2_step10.2759.2759.2	2.2284	0.4073	1461.24	1	5830.0%	2	K.KPLPDHVSIVEPK.D
UFKB3_MOUSE99.6%61421.0%224251489.3(Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) 
*	TK261102_lung_cytoE18_2_step07.4377.4377.2	1.2497	0.0718	3128.17	1	2220.0%	3	K.KGDVVHCWYTGTLPDGTVFDTNIQTSSK.K
*	TK261102_lung_cytoE18_2_step07.3886.3886.2	2.9772	0.5184	1687.69	1	5770.0%	2	K.DHLVNAYNHLFESK.R
	TK261102_lung_cytoE18_2_step04.0334.0334.1	1.2975	0.1152	616.46	9	6250.0%	1	K.KDIIK.F
UCCT1_MOUSE99.6%577.6%724805668.7(Q9QWV9) Cyclin T1 (Cyclin T) (CycT1) 
*	TK261102_lung_cytoE18_2_step08.1856.1856.1	0.9581	0.0234	700.61	5	6000.0%	1	K.RPSDPK.H
*	TK261102_lung_cytoE18_2_step07.4776.4776.2	1.322	0.0080	1953.26	53	2500.0%	1	R.WLSSQPPFKLEAAQGHR.T
*	TK261102_lung_cytoE18_2_step12.2284.2284.1	2.5183	0.4313	1372.21	1	5830.0%	2	R.HSHLQLPAGPVSK.R
*	TK261102_lung_cytoE18_2_step10.5453.5453.3	1.0887	0.063	1934.63	27	1530.0%	1	R.GPPEETGAAVFDHPAKIAK.S
UTKT_MOUSE99.6%4122325.7%623676317.5(P40142) Transketolase (EC 2.2.1.1) (TK) (P68) 
	TK261102_lung_cytoE18_2_step01.2750.2750.2	3.9424	0.6604	2020.7	1	5560.0%	1	K.ILATPPQEDAPSVDIANIR.M
	TK261102_lung_cytoE18_2_step07.2408.2408.1	1.3126	0.0646	980.64	5	3750.0%	9	K.HQPTAIIAK.T
*	TK261102_lung_cytoE18_2_step06.4466.4466.2	2.3139	0.3572	2487.56	1	4250.0%	1	R.CEAFGWHTIIVDGHSVEELCK.A
	TK261102_lung_cytoE18_2_step08.2724.2724.2	2.3728	0.4907	1395.9	1	6670.0%	5	R.KISSDLDGHPVPK.Q
*	TK261102_lung_cytoE18_2_step06.4814.4814.2	1.3651	0.3844	3190.6	1	2170.0%	1	R.ILTVEDHYYEGGIGEAVSAAVVGEPGVTVTR.L
*	TK261102_lung_cytoE18_2_step06.5416.5416.2	0.9138	0.0618	2624.66	1	1800.0%	3	K.SKDDQVTVIGAGVTLHEALAAAESLK.K
*	TK261102_lung_cytoE18_2_step10.2277.2277.1	2.4656	0.3288	1164.71	1	6110.0%	3	K.EAWHGKPLPK.N
*	TK261102_lung_cytoE18_2_step01.5019.5019.2	1.2154	0.1883	2011.01	3	2810.0%	1	K.NMAEQIIQEIYSQVQSK.K
	TK261102_lung_cytoE18_2_step07.2609.2609.1	1.6291	0.2726	1265.74	1	5450.0%	1	K.ISSDLDGHPVPK.Q
*	TK261102_lung_cytoE18_2_step04.2532.2532.2	1.6053	0.1822	2410.51	1	2390.0%	1	K.DDQVTVIGAGVTLHEALAAAESLK.K
*	TK261102_lung_cytoE18_2_step01.3283.3283.2	2.9027	0.5263	1537.91	1	7310.0%	1	K.MFGIDKDAIVQAVK.G
UQ6081799.6%4106.0%215233844.6(Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) 
	TK261102_lung_cytoE18_2_step08.4945.4945.1	2.68	0.4076	1551.96	1	5830.0%	1	K.NILFVITKPDVYK.S
UQ91YJ299.6%2214.4%450517785.8(Q91YJ2) Similar to sorting nexin 4 
*	TK261102_lung_cytoE18_2_step07.4412.4412.2	3.655	0.6417	2178.09	1	6110.0%	1	R.KHELMQYDLETAAQDLAAK.K
*	TK261102_lung_cytoE18_2_step06.5458.5458.3	1.2841	0.1214	4723.75	3	1220.0%	1	K.LLQPGPLEPLGGPGAVLEAAVGEENEGTREDGSGVDTMTGNNFWLK.K
UANX6_MOUSE99.6%154112.8%672757555.5(P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II) 
	TK261102_lung_cytoE18_2_step08.5004.5004.1	0.4852	0.0253	1031.49	19	1880.0%	1	K.TLIEILATR.T
	TK261102_lung_cytoE18_2_step10.1167.1167.1	0.6828	0.0414	553.69	20	6670.0%	2	K.QHLR.L
	TK261102_lung_cytoE18_2_step10.1696.1696.1	1.2214	0.0322	603.48	1	8750.0%	1	K.SHFGR.D
	TK261102_lung_cytoE18_2_step09.2257.2257.1	1.1249	0.1854	772.56	5	7000.0%	2	R.SYPHLR.R
	TK261102_lung_cytoE18_2_step06.0623.0623.3	0.7112	0.0124	3962.23	17	510.0%	1	K.MLVVLLQGTRENDDVVSEDLVQQDVQDLYEAGELK.W
*	TK261102_lung_cytoE18_2_step05.4101.4101.1	1.5384	0.1391	1361.45	1	5000.0%	2	K.KTNYDIEHVIK.K
	TK261102_lung_cytoE18_2_step07.5016.5016.2	2.7342	0.4996	1712.59	1	5000.0%	5	K.GIGTDEATIIDIVTHR.S
UAMP2_MOUSE99.6%224.6%478529225.8(O08663) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2) (Peptidase M 2) (Initiation factor 2 associated 67 kDa glycoprotein) (p67) (p67eIF2) 
	TK261102_lung_cytoE18_2_step10.3664.3664.2	3.4135	0.478	2124.63	1	4410.0%	1	K.GSYTAQFEHTILLRPTCK.E
	TK261102_lung_cytoE18_2_step07.1542.1542.1	0.5641	0.0195	532.3	8	5000.0%	1	R.QVRK.Y
UCRTC_MOUSE99.6%144219.2%416479954.5(P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) 
	TK261102_lung_cytoE18_2_step08.5085.5085.2	3.0428	0.5511	2860.95	1	3410.0%	5	R.CKDDEFTHLYTLIVRPDNTYEVK.I
	TK261102_lung_cytoE18_2_step01.1936.1936.2	2.9617	0.5347	2761.05	1	3480.0%	1	K.IDDPTDSKPEDWDKPEHIPDPDAK.K
	TK261102_lung_cytoE18_2_step12.2711.2711.1	2.7908	0.4095	1149.79	1	7500.0%	2	K.KVHVIFNYK.G
	TK261102_lung_cytoE18_2_step01.3306.3306.2	2.1332	0.4495	2964.99	1	3260.0%	2	K.KPEDWDEEMDGEWEPPVIQNPEYK.G
	TK261102_lung_cytoE18_2_step10.3160.3160.1	1.2151	0.0060	1019.66	1	5710.0%	2	K.VHVIFNYK.G
UP9731599.6%95118.7%193205838.6(P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) 
	TK261102_lung_cytoE18_2_step11.1350.1350.3	2.0919	0.2474	1846.65	2	3280.0%	1	K.HEEAPGHRPTTNPNASK.F
	TK261102_lung_cytoE18_2_step09.4387.4387.2	1.0567	0.0749	1921.69	18	2220.0%	1	K.YGPKGYGYGQGAGTLSTDK.G
UACF7_MOUSE99.6%26327.6%53276079845.5(Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) 
*	TK261102_lung_cytoE18_2_step11.0645.0645.2	0.9361	0.0644	1442.32	3	3750.0%	1	R.YADITLTSSKALR.T
	TK261102_lung_cytoE18_2_step01.4266.4266.3	0.955	0.0353	4402.91	9	920.0%	1	K.LTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIR.Q
	TK261102_lung_cytoE18_2_step05.4718.4718.2	1.089	0.0628	1922.33	18	2350.0%	1	R.GALPDDTEALQSLIDTHK.E
	TK261102_lung_cytoE18_2_step11.0673.0673.3	0.9692	0.0419	2229.81	5	1580.0%	1	R.FRGALPDDTEALQSLIDTHK.E
	TK261102_lung_cytoE18_2_step08.3868.3868.3	1.4918	0.0696	3420.85	2	1900.0%	1	R.DGDGYIDYYEFVAALHPNKDAYRPTTDADK.I
*	TK261102_lung_cytoE18_2_step11.4108.4108.3	2.9468	0.2899	3963.76	1	1740.0%	2	R.HQELLSQQQNFIVATQSAQSFLDQHSHNLTPEER.Q
	TK261102_lung_cytoE18_2_step03.3871.3871.2	0.9118	0.1061	1327.15	15	2500.0%	1	R.DQEPIPQNIDR.V
	TK261102_lung_cytoE18_2_step06.1948.1948.1	1.4236	0.066	624.6	6	6250.0%	2	K.KTFTK.W
*	TK261102_lung_cytoE18_2_step06.4177.4177.3	1.6384	0.135	2912.86	30	1600.0%	1	R.FVTISGQKVLETENNFEEGQEPSATR.N
	TK261102_lung_cytoE18_2_step11.2434.2434.2	0.8769	0.1774	2080.29	11	1430.0%	1	R.TSLAGDTSNSSSPASTGAKANR.A
*	TK261102_lung_cytoE18_2_step11.5978.5978.3	1.3848	0.1201	4569.77	17	1050.0%	1	K.WIEETTAQQEMMKPGQAEDSRVLSEQLSQQTELFAEIER.N
*	TK261102_lung_cytoE18_2_step01.3347.3347.2	0.815	0.1002	2943.37	41	1350.0%	1	R.EAEEELAASGGQSPTGEQIPQFQQRQK.E
*	TK261102_lung_cytoE18_2_step09.4026.4026.3	1.3003	0.0087	3579.53	32	1210.0%	1	K.LQKAAHDLLDIEGEPALDCRPIQETTDSISSR.F
	TK261102_lung_cytoE18_2_step06.2964.2964.1	1.0486	0.0307	770.48	1	6000.0%	1	K.QEHVEK.V
*	TK261102_lung_cytoE18_2_step12.2665.2665.2	1.476	0.1924	3142.61	1	2220.0%	1	K.ENLDTLEHLVTTLGSCGFALDLSQHQDK.I
*	TK261102_lung_cytoE18_2_step12.3464.3464.2	1.488	0.1523	2294.53	1	3500.0%	1	R.KGHFSSLELVPPSTLTTTHLK.A
*	TK261102_lung_cytoE18_2_step07.4905.4905.2	1.6422	0.3497	1638.96	1	5420.0%	1	K.FHSTYEELTGWLR.E
*	TK261102_lung_cytoE18_2_step09.2303.2303.1	1.1263	0.18	907.76	7	5830.0%	1	K.IHQQIIR.H
	TK261102_lung_cytoE18_2_step06.3050.3050.1	1.16	0.0492	1022.61	45	4290.0%	1	K.QQVQFMLK.E
*	TK261102_lung_cytoE18_2_step10.4211.4211.3	1.4709	0.0328	4309.79	18	1220.0%	1	K.FHSTYEELTGWLREAEEELAASGGQSPTGEQIPQFQQR.Q
	TK261102_lung_cytoE18_2_step11.2658.2658.2	1.3149	0.0559	1297.48	254	3890.0%	1	K.GSQLQERWHR.V
	TK261102_lung_cytoE18_2_step08.2424.2424.1	2.5411	0.511	1405.74	1	5450.0%	2	R.ESIAEHKPHIDK.I
UQ99LE799.6%358.5%378417827.5(Q99LE7) Similar to paxillin (Fragment) 
	TK261102_lung_cytoE18_2_step11.2745.2745.2	3.1675	0.4525	2414.25	1	4170.0%	2	K.TWHPEHFVCTHCQEEIGSR.N
	TK261102_lung_cytoE18_2_step06.3202.3202.1	1.196	0.3107	1300.43	1	4170.0%	1	K.KPIAGQVVTAMGK.T
UHS47_MOUSE99.6%82017.0%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) 
*	TK261102_lung_cytoE18_2_step01.5082.5082.2	4.1672	0.6722	2583.99	1	4200.0%	1	K.DQAVENILLSPLVVASSLGLVSLGGK.A
	TK261102_lung_cytoE18_2_step05.0283.0283.1	2.6187	0.4705	1338.84	1	5830.0%	3	K.HLAGLGLTEAIDK.N
*	TK261102_lung_cytoE18_2_step06.4300.4300.2	2.4714	0.1853	1740.94	1	5000.0%	3	K.LRDEEVHTGLGELLR.S
	TK261102_lung_cytoE18_2_step12.4117.4117.2	1.3523	0.1085	1984.97	1	3120.0%	1	K.LSSLIILMPHHVEPLER.L
UPRS6_MOUSE99.6%81419.1%418472815.3(P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21) 
	TK261102_lung_cytoE18_2_step09.2826.2826.1	1.7208	0.1917	1421.8	1	5000.0%	3	R.ELLKPNASVALHK.H
	TK261102_lung_cytoE18_2_step11.3578.3578.2	0.9581	0.1156	2569.28	11	1430.0%	1	R.EAVELPLTHFELYKQIGIDPPR.G
	TK261102_lung_cytoE18_2_step11.2152.2152.2	1.9868	0.4287	1295.55	1	6820.0%	1	K.AVAHHTTAAFIR.V
*	TK261102_lung_cytoE18_2_step01.4459.4459.3	4.416	0.5173	3675.59	1	2660.0%	1	K.IQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSR.Y
UDYNA_MOUSE99.6%10208.3%12811417276.0(O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) 
*	TK261102_lung_cytoE18_2_step07.5381.5381.2	0.9829	0.0551	3144.51	26	1540.0%	1	K.DSPLLLQQISAMRLHISQLQHENSILR.G
	TK261102_lung_cytoE18_2_step05.4044.4044.1	0.8271	0.1461	1347.32	19	1820.0%	1	R.AESLQQEVEALK.E
*	TK261102_lung_cytoE18_2_step11.3024.3024.1	1.4555	0.1063	1573.1	13	3750.0%	2	K.VQTRLDETQTLLR.K
	TK261102_lung_cytoE18_2_step05.0123.0123.2	1.9084	0.3312	2783.57	3	2080.0%	1	K.LATAMQEGEYDAERPPSKPPPVELR.A
	TK261102_lung_cytoE18_2_step10.2939.2939.2	3.847	0.5671	1703.23	1	6150.0%	2	R.LVLTQEQLHQLHSR.L
*	TK261102_lung_cytoE18_2_step10.2833.2833.2	2.4293	0.5173	1734.55	1	5360.0%	3	K.LNQLSTHTHVVDITR.S
UTHIO_MOUSE99.6%41011.5%104115444.9(P10639) Thioredoxin (ATL-derived factor) (ADF) 
*	TK261102_lung_cytoE18_2_step11.3568.3568.1	2.9884	0.383	1525.9	1	5910.0%	3	K.MIKPFFHSLCDK.Y
UQ9D3T699.6%118.4%179201886.4(Q9D3T6) 4933436C10Rik protein 
	TK261102_lung_cytoE18_2_step11.1980.1980.2	3.3021	0.5592	1851.71	1	5710.0%	1	K.VLQCHKPVHAEYLEK.L
UQ9CWE499.6%114.1%271296556.5(Q9CWE4) 2410153K17Rik protein 
	TK261102_lung_cytoE18_2_step12.1577.1577.1	2.1711	0.4613	1231.39	1	5500.0%	1	R.VPFGHAHEHAK.M
UQ9D6E699.6%1110.5%172198614.8(Q9D6E6) 2900073G15Rik protein 
*	TK261102_lung_cytoE18_2_step01.3827.3827.2	4.1447	0.5513	2022.92	1	5880.0%	1	R.DGFIDKEDLHDMLASMGK.N
UHS9B_MOUSE99.6%3517721.2%723831945.0(P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) 
	TK261102_lung_cytoE18_2_step08.4119.4119.2	3.7797	0.4777	1786.2	1	6790.0%	7	K.HLEINPDHPIVETLR.Q
	TK261102_lung_cytoE18_2_step12.2668.2668.2	3.6601	0.476	1912.79	1	6000.0%	2	K.KHLEINPDHPIVETLR.Q
	TK261102_lung_cytoE18_2_step01.5018.5018.2	1.0609	0.0277	2376.46	1	2220.0%	1	R.VFIMDSCDELIPEYLNFIR.G
	TK261102_lung_cytoE18_2_step08.3816.3816.1	1.3625	0.2327	887.78	10	5000.0%	2	R.RLSELLR.Y
	TK261102_lung_cytoE18_2_step01.2511.2511.2	2.1041	0.3605	2177.91	1	4720.0%	1	R.YHTSQSGDEMTSLSEYVSR.M
	TK261102_lung_cytoE18_2_step08.2468.2468.1	1.0523	0.1168	1299.69	38	2500.0%	1	K.LGIHEDSTNRR.R
	TK261102_lung_cytoE18_2_step09.4149.4149.2	3.9285	0.521	2605.96	1	4250.0%	1	K.RGFEVVYMTEPIDEYCVQQLK.E
	TK261102_lung_cytoE18_2_step08.5213.5213.2	4.0055	0.6344	1813.06	1	6790.0%	10	K.HSQFIGYPITLYLEK.E
	TK261102_lung_cytoE18_2_step12.4135.4135.2	3.1283	0.6033	1940.96	1	5330.0%	2	K.KHSQFIGYPITLYLEK.E
	TK261102_lung_cytoE18_2_step01.2811.2811.1	1.4342	0.1682	1529.98	1	3750.0%	2	K.SLTNDWEDHLAVK.H
	TK261102_lung_cytoE18_2_step06.4533.4533.2	2.7214	0.3236	1237.77	1	6670.0%	2	R.RAPFDLFENK.K
	TK261102_lung_cytoE18_2_step05.2845.2845.1	1.2131	0.0505	1010.51	5	5710.0%	1	K.AKFENLCK.L
	TK261102_lung_cytoE18_2_step01.2919.2919.1	1.2426	0.1594	1352.26	1	5000.0%	1	R.TLTLVDTGIGMTK.A
UACBP_MOUSE99.6%51739.5%8698698.8(P31786) Acyl-CoA-binding protein (ACBP) (Diazepam binding inhibitor) (DBI) (Endozepine) (EP) 
*	TK261102_lung_cytoE18_2_step01.2638.2638.2	1.5796	0.3088	1913.28	1	4410.0%	1	K.QATVGDVNTDRPGLLDLK.G
*	TK261102_lung_cytoE18_2_step06.4980.4980.2	3.0543	0.6127	1989.67	1	5000.0%	4	K.TQPTDEEMLFIYSHFK.Q
UQ9QZ8399.6%4165.6%393436015.2(Q9QZ83) Gamma actin-like protein 
*	TK261102_lung_cytoE18_2_step03.0443.0443.2	3.7325	0.5805	2346.24	1	4520.0%	4	R.KDLYANTVLSGGTTMYPGLADR.M
UQ9Z1K199.6%3313.1%396437695.0(Q9Z1K1) HS1 binding protein 3 
*	TK261102_lung_cytoE18_2_step12.2480.2480.2	1.864	0.2822	2257.38	4	2630.0%	1	R.QVQNAHTGLDLSVPQHQEVR.G
*	TK261102_lung_cytoE18_2_step10.2245.2245.2	2.9057	0.5599	1834.25	1	4440.0%	1	R.KPTLPASVGPSEPGSGPQK.Q
	TK261102_lung_cytoE18_2_step01.4440.4440.1	1.0172	0.0567	1557.7	123	2920.0%	1	K.HRPEDVVQFLVSK.K
UPCB1_HUMAN99.6%3515.7%356375267.1(Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) 
*	TK261102_lung_cytoE18_2_step09.3434.3434.2	1.6904	0.2404	2609.45	1	2920.0%	2	R.QQSHFAMMHGGTGFAGIDSSSPEVK.G
*	TK261102_lung_cytoE18_2_step11.5077.5077.3	3.5388	0.5067	3381.27	1	2500.0%	1	K.AFAMIIDKLEEDINSSMTNSTAASRPPVTLR.L
UMAP4_MOUSE99.6%7172.9%11251176755.0(P27546) Microtubule-associated protein 4 (MAP 4) 
*	TK261102_lung_cytoE18_2_step11.1640.1640.2	2.4241	0.336	1651.79	2	4060.0%	2	R.TSPSKPSSAPALKPGPK.T
*	TK261102_lung_cytoE18_2_step12.1848.1848.1	1.9167	0.3151	1579.75	1	4330.0%	3	K.KPMSLASGSVPAAPHK.R
UPPCE_MOUSE99.6%183615.9%710807525.7(Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) 
*	TK261102_lung_cytoE18_2_step11.3198.3198.1	1.4636	0.0727	1238.84	11	3640.0%	2	R.HMGGVLAVANIR.G
*	TK261102_lung_cytoE18_2_step12.2345.2345.3	1.0701	0.0345	2871.98	184	1200.0%	1	K.DSEIFYQFTSFLSPGVIYHCDLTK.E
	TK261102_lung_cytoE18_2_step09.3165.3165.2	3.6455	0.6191	1494.58	1	7080.0%	1	R.KQSNPLLIHVDTK.A
	TK261102_lung_cytoE18_2_step05.3706.3706.1	1.2352	0.0545	893.19	2	5000.0%	2	R.VVPLHSLK.F
	TK261102_lung_cytoE18_2_step06.2737.2737.1	1.5837	0.23	957.63	1	5710.0%	3	K.YSPLHNVK.L
*	TK261102_lung_cytoE18_2_step12.1880.1880.1	1.1609	0.0196	1102.28	18	4290.0%	1	K.QHFEWLLK.Y
*	TK261102_lung_cytoE18_2_step08.5112.5112.2	1.6637	0.2647	2179.46	1	4410.0%	1	K.VLVPEHEKDVLEWVACVR.S
	TK261102_lung_cytoE18_2_step11.0702.0702.2	1.2207	0.1518	995.85	12	4500.0%	2	K.AGHGAGKPTAK.V
*	TK261102_lung_cytoE18_2_step11.5913.5913.3	2.2898	0.3176	2440.96	1	2840.0%	1	R.HMGGVLAVANIRGGGEYGETWHK.G
UENPL_MOUSE99.6%81613.8%802924764.8(P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) 
*	TK261102_lung_cytoE18_2_step06.3689.3689.2	4.0643	0.6203	2252.33	1	5280.0%	2	R.FQSSHHSTDITSLDQYVER.M
	TK261102_lung_cytoE18_2_step11.2468.2468.3	1.5258	0.0268	3459.41	20	1420.0%	1	K.ESDDPMAYIHFTAEGEVTFKSILFVPTSAPR.G
	TK261102_lung_cytoE18_2_step11.1778.1778.1	1.1219	0.1086	637.59	1	7500.0%	3	R.HPLIR.D
	TK261102_lung_cytoE18_2_step08.5164.5164.2	1.6834	0.2314	3078.71	1	3000.0%	1	K.KGYEVIYLTEPVDEYCIQALPEFDGK.R
*	TK261102_lung_cytoE18_2_step06.3457.3457.3	1.4112	0.0596	3553.78	22	1380.0%	1	K.YSQFINFPIYVWSSKTETVEEPLEEDEAAK.E
UGYS1_MOUSE99.6%5515.0%738839566.2(Q9Z1E4) Glycogen [starch] synthase, muscle (EC 2.4.1.11) 
	TK261102_lung_cytoE18_2_step10.1833.1833.1	1.0714	0.085	560.53	10	7500.0%	1	K.EAGER.Q
	TK261102_lung_cytoE18_2_step11.4593.4593.2	1.7164	0.3745	3037.74	3	1900.0%	1	R.SNSVDTGPSSSLSTPTEPLSPTSSLGEERN.-
*	TK261102_lung_cytoE18_2_step06.4744.4744.3	1.2725	0.0236	4001.61	58	1250.0%	1	K.AFPDHFTYEPHEVDATQGYRYPRPVSVPPSPSLSR.H
	TK261102_lung_cytoE18_2_step10.3228.3228.2	3.2391	0.5423	1776.93	1	6430.0%	1	K.FSAMHEFQNLHAQSK.A
	TK261102_lung_cytoE18_2_step11.2010.2010.3	1.321	0.0013	3049.01	104	1500.0%	1	R.VKVIFHPEFLSSTSPLLPVDYEEFVR.G
UQ8R1H099.6%72735.6%7382824.9(Q8R1H0) Hypothetical 8.3 kDa protein 
*	TK261102_lung_cytoE18_2_step06.0714.0714.2	4.3809	0.589	2525.74	1	4770.0%	5	K.HPDPTTLCLIAAEAGLTEEQTQK.W
*	TK261102_lung_cytoE18_2_step12.3731.3731.2	0.6572	0.0277	2987.57	1	1400.0%	1	K.HPDPTTLCLIAAEAGLTEEQTQKWFK.Q
URAN_HUMAN99.6%123422.2%216244237.5(P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) 
	TK261102_lung_cytoE18_2_step07.2597.2597.1	1.906	0.1644	1090.53	3	5620.0%	2	R.HLTGEFEKK.Y
	TK261102_lung_cytoE18_2_step11.3794.3794.2	3.1147	0.6094	2055.42	1	5290.0%	3	K.YVATLGVEVHPLVFHTNR.G
	TK261102_lung_cytoE18_2_step04.0639.0639.1	1.5162	0.1542	962.65	2	6430.0%	2	R.HLTGEFEK.K
	TK261102_lung_cytoE18_2_step07.2572.2572.1	1.0307	0.0705	922.55	8	6670.0%	1	K.NVPNWHR.D
	TK261102_lung_cytoE18_2_step08.5419.5419.2	2.4267	0.4504	1786.66	1	4620.0%	4	K.SNYNFEKPFLWLAR.K
URL30_HUMAN99.6%2416.7%114126539.6(P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 
	TK261102_lung_cytoE18_2_step07.5034.5034.2	0.8546	0.0153	2016.91	127	1940.0%	2	K.TGVHHYSGNNIELGTACGK.Y
UQ9CV4599.6%41010.2%225255225.3(Q9CV45) 2310038O07Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step10.3572.3572.2	1.9786	0.3581	1939.46	1	4710.0%	3	R.VALVTFNSAAHNKPSLIR.D
	TK261102_lung_cytoE18_2_step11.0877.0877.1	0.4443	0.0	658.09	109	2500.0%	1	R.KELIR.E
UAOP2_MOUSE99.6%4622.9%223247396.0(O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) 
	TK261102_lung_cytoE18_2_step06.0606.0606.1	2.2748	0.1543	1151.77	1	6110.0%	2	R.VVFIFGPDKK.L
	TK261102_lung_cytoE18_2_step01.2978.2978.2	3.9226	0.5705	2156.45	1	5260.0%	1	R.VVDSLQLTGTKPVATPVDWK.K
*	TK261102_lung_cytoE18_2_step01.3318.3318.2	3.2062	0.5895	2143.22	1	5500.0%	1	-.PGGLLLGDEAPNFEANTTIGR.I
UO5518199.6%2514319.3%280318898.4(O55181) RBP associated molecule RAM14-1 
*	TK261102_lung_cytoE18_2_step07.3112.3112.1	1.5441	0.1945	1198.65	1	6430.0%	2	R.YWHDNCFR.C
*	TK261102_lung_cytoE18_2_step01.2202.2202.1	1.3996	0.292	1491.36	3	2920.0%	9	K.CLHPLASETFVSK.D
*	TK261102_lung_cytoE18_2_step08.2056.2056.1	1.1812	0.0674	719.51	4	6250.0%	6	R.HCCLK.C
	TK261102_lung_cytoE18_2_step06.3662.3662.2	4.0404	0.63	2419.76	1	4210.0%	3	K.GSSVVAYEGQSWHDYCFHCK.K
*	TK261102_lung_cytoE18_2_step06.1952.1952.1	1.4871	0.2799	829.68	3	5000.0%	3	R.KPISADAK.E
USMD3_HUMAN99.6%3518.3%1261391610.3(P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) 
	TK261102_lung_cytoE18_2_step08.4293.4293.2	0.6189	0.0019	2600.57	30	1140.0%	1	K.VLHEAEGHIVTCETNTGEVYRGK.L
	TK261102_lung_cytoE18_2_step05.0747.0747.2	3.5728	0.5263	2418.31	1	4750.0%	2	K.VLHEAEGHIVTCETNTGEVYR.G
UVINC_MOUSE99.6%669.4%10651166745.9(Q64727) Vinculin (Metavinculin) 
	TK261102_lung_cytoE18_2_step11.2444.2444.1	1.135	0.0017	1120.46	288	3120.0%	1	R.QDLLAKCDR.V
	TK261102_lung_cytoE18_2_step12.1054.1054.2	0.7731	0.0935	1973.12	14	1470.0%	1	K.LVQAAQMLQSDPYSVPAR.D
	TK261102_lung_cytoE18_2_step01.3190.3190.2	1.0936	0.0038	2450.98	1	2750.0%	1	R.EAFQPQEPDFPPPPPDLEQLR.L
	TK261102_lung_cytoE18_2_step01.5048.5048.2	2.4752	0.5575	2077.27	1	5500.0%	1	K.AIPDLTAPVAAVQAAVSNLVR.V
	TK261102_lung_cytoE18_2_step05.0344.0344.1	1.0613	0.1459	1003.65	131	4380.0%	1	R.IPTISTQLK.I
	TK261102_lung_cytoE18_2_step01.2696.2696.2	1.1096	0.121	2382.58	1	2860.0%	1	K.LLAVAATAPPDAPNREEVFDER.A
URL5_MOUSE99.6%8207.8%296342699.8(P47962) 60S ribosomal protein L5 
	TK261102_lung_cytoE18_2_step08.2083.2083.1	1.1427	0.1349	638.59	4	6000.0%	3	K.AHAAIR.E
	TK261102_lung_cytoE18_2_step07.3526.3526.1	1.6055	0.0758	1436.98	1	5450.0%	3	K.HIMGQNVADYMR.Y
	TK261102_lung_cytoE18_2_step09.1844.1844.1	0.8629	0.0206	672.7	2	7500.0%	1	R.RLLNR.F
UQ9JII699.6%133334.0%324364567.4(Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase) 
	TK261102_lung_cytoE18_2_step01.2984.2984.1	1.4134	0.32	1508.98	1	4580.0%	1	R.DAGHPLYPFNDPY.-
	TK261102_lung_cytoE18_2_step10.5076.5076.2	3.1814	0.6312	2902.29	1	2950.0%	1	K.TLADLQLEYLDLYLMHWPYAFER.G
*	TK261102_lung_cytoE18_2_step01.4482.4482.2	3.1879	0.4225	2100.24	1	5280.0%	1	R.HPDEPVLLEEPVVLALAEK.H
	TK261102_lung_cytoE18_2_step08.2852.2852.1	2.1727	0.2974	1301.66	1	5500.0%	4	K.HHPEDVEPALR.K
*	TK261102_lung_cytoE18_2_step08.2377.2377.1	1.1603	0.1816	874.75	1	7140.0%	3	K.HALSAGYR.H
*	TK261102_lung_cytoE18_2_step10.0074.0074.3	1.2374	0.0129	4109.83	5	1430.0%	1	R.QIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHAR.G
UIF41_HUMAN99.6%5116.2%406461545.5(P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) 
	TK261102_lung_cytoE18_2_step06.2500.2500.1	1.0428	0.0443	763.63	107	6000.0%	1	R.RYLSPK.Y
	TK261102_lung_cytoE18_2_step10.2065.2065.1	0.937	0.0804	581.58	3	8330.0%	1	K.KFMR.D
	TK261102_lung_cytoE18_2_step03.0392.0392.2	3.0493	0.471	1620.04	1	6430.0%	3	K.LQMEAPHIIVGTPGR.V
UA2HS_MOUSE99.6%199719.7%345373266.5(P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) 
*	TK261102_lung_cytoE18_2_step06.2368.2368.2	1.8388	0.3541	1973.73	1	4060.0%	4	R.VMHTQCHSTPDSAEDVR.K
*	TK261102_lung_cytoE18_2_step08.0228.0228.1	1.1578	0.2359	777.5	3	6000.0%	3	K.QHGFCK.A
*	TK261102_lung_cytoE18_2_step06.5520.5520.2	4.6899	0.6395	2546.76	1	5430.0%	6	R.AQNVPLPVSTLVEFVIAATDCTAK.E
*	TK261102_lung_cytoE18_2_step07.3686.3686.2	1.5539	0.1749	2141.2	1	3500.0%	6	R.HAFSPVASVESASGETLHSPK.V
ULDHL_HUMAN99.6%394.5%381419438.6(Q9BYZ2) L-lactate dehydrogenase A-like (EC 1.1.1.27) 
*	TK261102_lung_cytoE18_2_step07.5368.5368.2	4.4776	0.6072	1946.51	1	7190.0%	3	K.LIIVSNPVDILTYVAWK.L
UPSD7_MOUSE99.6%51113.4%321365406.8(P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) 
	TK261102_lung_cytoE18_2_step07.2234.2234.1	1.3447	0.1346	1009.8	66	4380.0%	1	R.ITNQVHGLK.G
	TK261102_lung_cytoE18_2_step10.2968.2968.1	1.8435	0.3896	1159.66	1	5560.0%	3	R.IVGWYHTGPK.L
	TK261102_lung_cytoE18_2_step06.4801.4801.2	3.7935	0.6199	2682.35	1	4570.0%	1	K.TFEHVTSEIGAEEAEEVGVEHLLR.D
UPSB2_MOUSE99.6%3522.9%201229067.0(Q9R1P3) Proteasome subunit beta type 2 (EC 3.4.25.1) (Proteasome component C7-I) (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I) 
*	TK261102_lung_cytoE18_2_step05.0885.0885.2	3.004	0.5297	1924.38	1	4380.0%	2	R.VIDKDGIHNLENIAFPK.R
	TK261102_lung_cytoE18_2_step07.4018.4018.2	0.8792	0.0987	3181.98	105	1250.0%	1	-.MEYLIGIQGPDYVLVASDRVAASNIVQMK.D
UQ9DCA399.6%1116.7%203235965.2(Q9DCA3) RAN binding protein 1 
*	TK261102_lung_cytoE18_2_step01.2935.2935.3	5.0476	0.6069	3891.08	1	2580.0%	1	K.DSHEDHDTSTENADESNHDPQFEPIVSLPEQEIK.T
UQ9CQL899.6%1110.5%172197794.8(Q9CQL8) 1500001M02Rik protein 
	TK261102_lung_cytoE18_2_step01.4102.4102.2	3.6901	0.5287	2005.41	1	5290.0%	1	R.DGFIDKEDLHDMLASLGK.N
UCOPB_MOUSE99.6%101414.5%9531070666.0(Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP) 
	TK261102_lung_cytoE18_2_step09.3149.3149.2	0.9275	0.0271	2264.16	25	2220.0%	1	K.TTPDGRLLHEMILVCDAYR.K
	TK261102_lung_cytoE18_2_step09.1299.1299.1	0.5531	0.0039	432.99	1	3330.0%	2	K.ANVK.V
	TK261102_lung_cytoE18_2_step11.1536.1536.3	1.7109	0.086	2541.65	33	1850.0%	1	R.GFLLDGDFFVAASLATTLTKIALR.Y
	TK261102_lung_cytoE18_2_step05.4006.4006.1	0.708	0.0447	1258.26	26	2730.0%	1	K.EAADPLASKLNK.V
	TK261102_lung_cytoE18_2_step11.3405.3405.2	3.3065	0.6116	2090.96	1	4720.0%	1	K.LVEKPSPLTLAPHDFANIK.A
*	TK261102_lung_cytoE18_2_step10.3908.3908.2	1.9905	0.4394	3130.88	1	2070.0%	2	R.SIFGEDALANVSIEKPVHQGPDAAVTGHIR.I
	TK261102_lung_cytoE18_2_step06.4986.4986.2	0.9386	0.1746	1796.52	10	2060.0%	1	K.YEAAGTLVTLSSAPTAIK.A
	TK261102_lung_cytoE18_2_step05.0877.0877.3	1.5589	0.0031	3151.88	22	1550.0%	1	K.YEAAGTLVTLSSAPTAIKAAAQCYIDLIIK.E
UQ9CQM999.6%82023.4%337377785.6(Q9CQM9) Thioredoxin-like 2 
*	TK261102_lung_cytoE18_2_step05.0303.0303.3	1.6857	0.0379	3254.45	96	1250.0%	1	R.QGLKTYSNWPTYPQLYVSGELIGGLDIIK.E
*	TK261102_lung_cytoE18_2_step05.4968.4968.3	1.312	0.0379	2860.01	2	2190.0%	1	K.LEAEAVPEVSEKYEISSVPTFLFFK.N
*	TK261102_lung_cytoE18_2_step10.2608.2608.1	1.2629	0.1584	1081.6	1	5000.0%	3	K.EHPHVSFVK.L
*	TK261102_lung_cytoE18_2_step09.2486.2486.2	2.8965	0.6117	1708.72	1	6000.0%	3	R.HVSSGAFPPSTNEHLK.E
UPMG1_MOUSE99.6%3626854.2%253287017.2(Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) 
	TK261102_lung_cytoE18_2_step10.5035.5035.2	2.6724	0.5035	3027.52	1	3270.0%	12	K.HLEGLSEEAIMELNLPTGIPIVYELDK.N
	TK261102_lung_cytoE18_2_step09.2619.2619.1	1.6686	0.3144	1151.75	1	6000.0%	5	R.VLIAAHGNSLR.G
	TK261102_lung_cytoE18_2_step01.2692.2692.2	1.6911	0.3603	2421.62	4	2250.0%	3	R.SYDVPPPPMEPDHPFYSNISK.D
	TK261102_lung_cytoE18_2_step08.3175.3175.1	2.3117	0.3674	1061.62	1	5000.0%	9	R.HYGGLTGLNK.A
	TK261102_lung_cytoE18_2_step10.5131.5131.2	3.5561	0.5253	2157.16	1	5290.0%	1	R.TLWTVLDAIDQMWLPVVR.T
	TK261102_lung_cytoE18_2_step03.0283.0283.2	1.399	0.2227	1316.35	11	4500.0%	1	R.HGESAWNLENR.F
	TK261102_lung_cytoE18_2_step11.3473.3473.2	2.9072	0.3182	2117.15	1	5590.0%	2	K.NLKPIKPMQFLGDEETVR.K
	TK261102_lung_cytoE18_2_step12.3183.3183.3	1.5474	0.0934	2361.08	87	1750.0%	1	R.GGQALRDAGYEFDICFTSVQK.R
UHBB2_MOUSE99.6%137324.7%146157478.1(P02089) Hemoglobin beta-2 chain (B2) (Minor) 
*	TK261102_lung_cytoE18_2_step05.4328.4328.1	2.1183	0.2361	1222.34	1	6000.0%	8	K.KVITAFNEGLK.N
	TK261102_lung_cytoE18_2_step01.1510.1510.1	2.0013	0.0945	716.7	5	7000.0%	2	K.NLDNLK.G
*	TK261102_lung_cytoE18_2_step01.3604.3604.2	4.2248	0.6507	2009.42	1	6390.0%	2	R.YFDSFGDLSSASAIMGNPK.V
UKCRB_MOUSE99.6%81417.1%381427135.7(Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) 
	TK261102_lung_cytoE18_2_step06.2789.2789.1	1.0926	0.103	983.56	9	4290.0%	1	R.GIWHNDNK.T
*	TK261102_lung_cytoE18_2_step11.3418.3418.2	3.5566	0.5874	2456.33	1	5250.0%	1	K.LRFPAEDEFPDLSSHNNHMAK.V
*	TK261102_lung_cytoE18_2_step06.2001.2001.2	1.3469	0.1153	1256.4	1	6000.0%	1	R.HGGYQPSDEHK.T
	TK261102_lung_cytoE18_2_step07.2041.2041.1	1.3088	0.1186	626.57	8	5000.0%	3	R.AGVHIK.L
*	TK261102_lung_cytoE18_2_step10.4496.4496.2	1.32	0.2436	1673.19	1	4580.0%	1	K.TFLVWINEEDHLR.V
*	TK261102_lung_cytoE18_2_step11.2040.2040.1	1.0127	0.1231	664.55	1	6000.0%	1	K.LPHLGK.H
UICAL_MOUSE99.6%13458.0%788849225.5(P51125) Calpain inhibitor (Calpastatin) 
	TK261102_lung_cytoE18_2_step07.1861.1861.1	2.8669	0.4748	1495.27	1	6250.0%	4	K.KPQSSEQPVVHEK.K
	TK261102_lung_cytoE18_2_step09.2421.2421.1	1.5537	0.0705	870.7	31	4290.0%	1	K.DGKPLLPK.E
*	TK261102_lung_cytoE18_2_step09.2173.2173.2	2.8759	0.4592	2126.24	1	3100.0%	5	K.AASLGSSQPSRPHVGEAATATK.V
	TK261102_lung_cytoE18_2_step05.3448.3448.1	0.9277	0.1117	1167.43	21	3890.0%	1	K.DKPEKPPTKK.T
	TK261102_lung_cytoE18_2_step01.2956.2956.1	0.811	0.0895	1227.56	1	3330.0%	1	K.EKIKPEHSEK.L
UPSA7_MOUSE99.6%118.9%248278558.5(Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1) 
	TK261102_lung_cytoE18_2_step01.3838.3838.2	2.7793	0.5755	2451.74	1	4520.0%	1	R.AITVFSPDGHLFQVEYAQEAVK.K
UQ9DCT899.6%5534.1%208227278.6(Q9DCT8) 0610010I23Rik protein (Cysteine-rich protein 2) 
*	TK261102_lung_cytoE18_2_step12.1228.1228.3	1.1972	0.1538	3844.24	18	1140.0%	1	K.GVNIGGAGSYIYEKPQTEAPQVTGPIEVPVVRTEER.K
*	TK261102_lung_cytoE18_2_step01.3326.3326.3	6.1049	0.7072	3330.0	1	3150.0%	1	K.GVNIGGAGSYIYEKPQTEAPQVTGPIEVPVVR.T
*	TK261102_lung_cytoE18_2_step04.0183.0183.1	0.9019	0.1042	714.76	32	5000.0%	1	R.KTSGPPK.G
	TK261102_lung_cytoE18_2_step12.3329.3329.2	1.5237	0.3682	3139.39	2	1850.0%	1	K.TLTPGGHAEHDGQPYCHKPCYGILFGPK.G
USERA_MOUSE99.6%393.9%485514496.9(Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) 
	TK261102_lung_cytoE18_2_step05.0107.0107.2	3.5531	0.5194	2051.1	1	5560.0%	3	R.ALVDHENVISCPHLGASTK.E
USPCN_HUMAN99.6%7132.2%24722842815.3(Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) 
*	TK261102_lung_cytoE18_2_step05.1158.1158.3	1.8559	0.1545	2786.61	8	2100.0%	1	K.ALINADELASDVAGAEALLDRHQEHK.G
	TK261102_lung_cytoE18_2_step06.3086.3086.2	3.0852	0.5289	1610.58	1	7310.0%	1	K.HQAFEAELHANADR.I
*	TK261102_lung_cytoE18_2_step11.1892.1892.2	4.4729	0.666	1685.88	1	7140.0%	1	K.KHQALQAEIAGHEPR.I
*	TK261102_lung_cytoE18_2_step12.1723.1723.2	1.9922	0.159	1560.33	6	3080.0%	3	K.HQALQAEIAGHEPR.I
UO8854499.6%113.7%406462855.8(O88544) COP9 complex subunit 4 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 4) (ARABIDOPSIS) 
	TK261102_lung_cytoE18_2_step11.2456.2456.2	3.4335	0.5989	1665.33	1	6790.0%	1	K.HALHCTILASAGQQR.S
UQ9JJH099.6%81611.7%359399947.1(Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase 
	TK261102_lung_cytoE18_2_step07.2984.2984.1	2.6947	0.4306	1305.58	1	6670.0%	3	R.HLEFSHDQYK.E
	TK261102_lung_cytoE18_2_step07.1957.1957.1	1.069	0.0088	614.5	6	6250.0%	2	K.HSWGK.T
	TK261102_lung_cytoE18_2_step01.3162.3162.2	1.4175	0.1326	1868.7	7	3530.0%	1	K.GSDHSASLEPGELAELVR.S
	TK261102_lung_cytoE18_2_step04.0838.0838.2	1.8136	0.2375	1142.93	9	4380.0%	1	R.HITLDKTWK.G
UQ8R01699.6%101819.3%455525116.5(Q8R016) Similar to bleomycin hydrolase 
*	TK261102_lung_cytoE18_2_step07.5070.5070.2	1.1189	0.2508	3192.82	5	1430.0%	1	R.LAFGESLMTHAMTFTAVSEKDNQEGTFVK.W
*	TK261102_lung_cytoE18_2_step12.2585.2585.3	2.2149	0.4159	2885.86	1	2400.0%	1	R.RATVQGAQHVFQHVVPQEGKPVTNQK.S
*	TK261102_lung_cytoE18_2_step11.2672.2672.2	3.1991	0.5109	2729.83	1	3750.0%	1	R.ATVQGAQHVFQHVVPQEGKPVTNQK.S
	TK261102_lung_cytoE18_2_step07.3628.3628.1	1.4809	0.2802	1488.96	1	4090.0%	3	K.EHVKPLFNMEDK.I
	TK261102_lung_cytoE18_2_step07.1944.1944.1	1.8369	0.3575	926.76	1	7500.0%	1	R.NLVHSGATK.G
*	TK261102_lung_cytoE18_2_step10.2597.2597.1	1.297	0.1845	1512.97	38	2730.0%	2	K.ICFVNDPRPQHK.Y
UEF11_MOUSE99.6%5257237.0%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) 
	TK261102_lung_cytoE18_2_step01.1683.1683.1	1.3297	0.2296	786.57	1	8330.0%	1	K.KLEDGPK.F
	TK261102_lung_cytoE18_2_step10.5569.5569.2	1.8391	0.2984	2914.15	1	2320.0%	21	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK261102_lung_cytoE18_2_step01.1962.1962.1	0.8757	0.0371	1025.93	9	4500.0%	1	K.IGGIGTVPVGR.V
	TK261102_lung_cytoE18_2_step01.1914.1914.1	1.801	0.2606	870.84	2	6430.0%	1	K.QLIVGVNK.M
	TK261102_lung_cytoE18_2_step04.0626.0626.1	1.0395	0.0387	936.7	81	5830.0%	1	K.RYEEIVK.E
	TK261102_lung_cytoE18_2_step01.3863.3863.2	1.9047	0.2987	2519.41	1	3040.0%	7	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK261102_lung_cytoE18_2_step06.2816.2816.1	1.2459	0.0263	1121.59	1	5000.0%	3	K.STTTGHLIYK.C
	TK261102_lung_cytoE18_2_step10.3197.3197.1	0.9876	0.05	1407.98	3	3180.0%	6	K.YYVTIIDAPGHR.D
	TK261102_lung_cytoE18_2_step06.0650.0650.1	2.3034	0.3042	1315.62	1	6360.0%	2	R.EHALLAYTLGVK.Q
	TK261102_lung_cytoE18_2_step01.3806.3806.2	1.4162	0.2511	2996.34	1	2410.0%	1	K.SGDAAIVDMVPGKPMCVESFSDYPPLGR.F
	TK261102_lung_cytoE18_2_step06.0666.0666.1	1.8161	0.0364	1589.15	1	5000.0%	1	K.THINIVVIGHVDSGK.S
	TK261102_lung_cytoE18_2_step01.2118.2118.1	1.5048	0.0764	975.91	1	6430.0%	1	R.LPLQDVYK.I
UKC21_MOUSE99.6%71312.5%391451628.0(Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37) 
	TK261102_lung_cytoE18_2_step11.1765.1765.2	3.5109	0.4721	1727.52	1	7310.0%	1	R.DVKPHNVMIDHEHR.K
	TK261102_lung_cytoE18_2_step09.1951.1951.2	1.4069	0.0667	1358.39	10	5000.0%	1	R.VYTDVNTHRPR.E
	TK261102_lung_cytoE18_2_step10.1549.1549.1	1.1018	0.0123	473.58	4	8330.0%	1	R.KLGR.G
	TK261102_lung_cytoE18_2_step06.4800.4800.2	3.8274	0.5583	2328.04	1	5530.0%	3	R.FVHSENQHLVSPEALDFLDK.L
UPSA6_MOUSE99.6%6268.9%246273726.7(Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) 
	TK261102_lung_cytoE18_2_step01.3300.3300.1	1.1339	0.2587	1363.98	24	2270.0%	1	K.LLDSSTVTHLFK.I
	TK261102_lung_cytoE18_2_step07.3673.3673.1	1.2247	0.0264	1158.83	1	5000.0%	5	R.HITIFSPEGR.L
UGSHC_MOUSE99.6%61826.4%201222827.2(P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase) 
*	TK261102_lung_cytoE18_2_step08.4932.4932.2	3.1044	0.4934	1960.63	1	5310.0%	4	K.YVRPGGGFEPNFTLFEK.C
*	TK261102_lung_cytoE18_2_step11.4128.4128.1	1.3209	0.0065	1103.58	13	4380.0%	1	K.AHPLFTFLR.N
*	TK261102_lung_cytoE18_2_step10.4908.4908.2	1.0768	0.3028	3058.45	9	1730.0%	1	R.NALPTPSDDPTALMTDPKYIIWSPVCR.N
UHS9A_MOUSE99.6%6639837.4%732846575.0(P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) 
	TK261102_lung_cytoE18_2_step08.4352.4352.2	3.4212	0.4598	1788.91	1	7140.0%	4	K.HLEINPDHSIIETLR.Q
	TK261102_lung_cytoE18_2_step11.3110.3110.2	3.7847	0.4511	1918.0	1	6670.0%	1	K.KHLEINPDHSIIETLR.Q
	TK261102_lung_cytoE18_2_step01.2686.2686.1	1.278	0.0621	1514.91	3	3080.0%	1	R.GVVDSEDLPLNISR.E
	TK261102_lung_cytoE18_2_step01.2203.2203.2	1.5106	0.2098	1834.98	1	4290.0%	1	R.NPDDITNEEYGEFYK.S
	TK261102_lung_cytoE18_2_step01.0122.0122.1	1.3333	0.2422	1039.82	3	5620.0%	1	R.YESLTDPSK.L
*	TK261102_lung_cytoE18_2_step05.4517.4517.1	2.2565	0.4217	1211.44	1	6110.0%	9	K.HIYFITGETK.D
	TK261102_lung_cytoE18_2_step10.4624.4624.2	3.4672	0.4578	1780.1	1	6070.0%	3	K.HSQFIGYPITLFVEK.E
	TK261102_lung_cytoE18_2_step06.4606.4606.1	1.5355	0.0751	1267.95	6	3330.0%	4	R.RAPFDLFENR.K
	TK261102_lung_cytoE18_2_step06.0688.0688.1	1.9039	0.2361	1351.15	3	4500.0%	10	K.HFSVEGQLEFR.A
	TK261102_lung_cytoE18_2_step08.4156.4156.3	1.3325	0.1618	3660.84	35	1180.0%	1	K.SGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEK.V
	TK261102_lung_cytoE18_2_step06.0351.0351.2	3.8668	0.5747	2257.47	1	5790.0%	1	K.HNDDEQYAWESSAGGSFTVR.T
	TK261102_lung_cytoE18_2_step10.4668.4668.2	1.277	0.0045	2579.44	1	3250.0%	2	K.HGLEVIYMIEPIDEYCVQQLK.E
	TK261102_lung_cytoE18_2_step08.3609.3609.1	1.1316	0.0647	724.7	66	4000.0%	10	K.VILHLK.E
*	TK261102_lung_cytoE18_2_step08.3469.3469.3	1.2968	0.0608	3952.37	1	1600.0%	1	R.MIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR.M
*	TK261102_lung_cytoE18_2_step01.2887.2887.1	2.2371	0.3362	1165.63	2	5560.0%	2	K.ELHINLIPSK.Q
	TK261102_lung_cytoE18_2_step07.3521.3521.1	1.355	0.0694	858.91	3	7500.0%	1	K.KLSELLR.Y
	TK261102_lung_cytoE18_2_step01.2919.2919.1	1.2426	0.1594	1352.26	1	5000.0%	1	R.TLTIVDTGIGMTK.A
	TK261102_lung_cytoE18_2_step07.2241.2241.1	1.3161	0.1643	1296.69	26	4500.0%	1	K.LGIHEDSQNRK.K
	TK261102_lung_cytoE18_2_step09.1194.1194.1	0.5698	0.018	551.56	1	3330.0%	1	K.ENYK.K
	TK261102_lung_cytoE18_2_step10.3279.3279.2	1.3274	0.1392	2019.12	1	3000.0%	7	K.VILHLKEDQTEYLEER.R
UEZRI_MOUSE99.6%247814.2%585692156.1(P26040) Ezrin (p81) (Cytovillin) (Villin 2) 
	TK261102_lung_cytoE18_2_step11.2138.2138.2	3.3284	0.3498	1175.95	1	8120.0%	1	R.IQVWHAEHR.G
	TK261102_lung_cytoE18_2_step09.4277.4277.1	1.0517	0.0367	1556.32	82	2730.0%	1	K.EDEVEEWQHRAK.E
	TK261102_lung_cytoE18_2_step10.3639.3639.2	0.7763	0.0044	1934.18	176	1790.0%	1	K.RILQLCMGNHELYMR.R
	TK261102_lung_cytoE18_2_step06.2425.2425.1	1.1835	0.0525	743.66	4	7000.0%	1	K.FGDYNK.E
	TK261102_lung_cytoE18_2_step07.2558.2558.1	2.6117	0.5353	1495.71	1	5910.0%	5	R.THNDIIHNENMR.Q
	TK261102_lung_cytoE18_2_step08.2871.2871.2	2.2763	0.5114	1475.7	1	6820.0%	3	R.RKPDTIEVQQMK.A
	TK261102_lung_cytoE18_2_step04.0396.0396.1	1.0864	0.0975	946.68	6	3570.0%	1	R.QIRQGNTK.Q
	TK261102_lung_cytoE18_2_step10.2821.2821.1	1.7953	0.1899	1088.82	1	6250.0%	1	K.FVIKPIDKK.A
UPSA3_MOUSE99.6%448.7%254282745.4(O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) 
	TK261102_lung_cytoE18_2_step11.1580.1580.1	1.0878	0.125	935.54	138	4290.0%	1	K.GRHEIVPK.D
	TK261102_lung_cytoE18_2_step09.3914.3914.1	1.3131	0.2243	1382.85	2	3850.0%	1	R.HVGMAVAGLLADAR.S
	TK261102_lung_cytoE18_2_step04.0007.0007.1	1.0658	0.144	722.28	1	8000.0%	1	R.HEIVPK.D
UTCPY_MOUSE99.6%41011.1%531581847.7(Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) 
*	TK261102_lung_cytoE18_2_step06.0558.0558.2	2.8901	0.6014	2318.21	1	4250.0%	3	K.DGNVLLHEMQIQHPTASIIAK.V
*	TK261102_lung_cytoE18_2_step01.3839.3839.3	0.6844	0.0565	4217.68	62	610.0%	1	K.VHAELADILTEAVVDSVLAIRRPGVPIDLFMVEIVEMR.H
UFKB4_MOUSE99.6%113912.5%457514415.7(P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) 
	TK261102_lung_cytoE18_2_step11.3002.3002.1	2.4628	0.4374	1509.93	1	5420.0%	2	R.LASHLNLAMCHLK.L
	TK261102_lung_cytoE18_2_step09.3665.3665.2	4.1284	0.5433	2042.94	1	5280.0%	5	K.GEHSIVYLKPSYAFGSVGK.E
*	TK261102_lung_cytoE18_2_step08.3955.3955.2	2.7265	0.4892	1686.01	1	7500.0%	3	R.RGEAHLAVNDFDLAR.A
*	TK261102_lung_cytoE18_2_step08.2561.2561.2	1.1198	0.1444	1183.96	183	2780.0%	1	K.ESWEMSSAEK.L
UQ9CPS199.6%2213.1%329355607.9(Q9CPS1) 2510002C21Rik protein 
*	TK261102_lung_cytoE18_2_step09.3609.3609.2	3.1873	0.6145	1766.76	1	5710.0%	1	K.KHFEGFPTDGNFELK.T
*	TK261102_lung_cytoE18_2_step09.4246.4246.2	1.1776	0.144	2875.45	25	1300.0%	1	K.LPLSLALGTVGMPGLTAYFGLLDICGVK.G
USEP2_MOUSE99.6%61213.3%361415266.5(P42208) Septin 2 (NEDD5 protein) 
	TK261102_lung_cytoE18_2_step06.2333.2333.1	1.4853	0.2686	767.5	2	7000.0%	1	R.HIIDNR.V
	TK261102_lung_cytoE18_2_step09.4514.4514.3	2.0726	0.4523	2863.4	1	2500.0%	1	R.TMLITHMQDLQEVTQDLHYENFR.S
	TK261102_lung_cytoE18_2_step01.4050.4050.2	1.7243	0.3999	2286.94	1	3060.0%	1	R.LYPWGVVEVENPEHNDFLK.L
UHBA_MOUSE99.6%129409787.9%141149548.2(P01942) Hemoglobin alpha chain 
	TK261102_lung_cytoE18_2_step12.4219.4219.3	2.1253	0.2296	3853.85	1	1690.0%	2	R.VDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDK.F
	TK261102_lung_cytoE18_2_step05.0925.0925.1	1.3214	0.1026	1254.81	1	5450.0%	3	K.FLASVSTVLTSK.Y
	TK261102_lung_cytoE18_2_step01.1775.1775.1	1.2531	0.038	532.52	1	6250.0%	2	K.AAWGK.I
	TK261102_lung_cytoE18_2_step01.2310.2310.1	1.6256	0.3233	1032.0	1	6250.0%	5	R.MFASFPTTK.T
	TK261102_lung_cytoE18_2_step01.1812.1812.1	1.1694	0.0336	820.6	24	5000.0%	1	R.VDPVNFK.L
	TK261102_lung_cytoE18_2_step05.0118.0118.1	1.6065	0.1277	1089.86	13	5620.0%	3	K.LRVDPVNFK.L
	TK261102_lung_cytoE18_2_step03.0165.0165.2	3.0131	0.1584	1532.88	1	6790.0%	17	K.IGGHGAEYGAEALER.M
	TK261102_lung_cytoE18_2_step12.3044.3044.2	2.3263	0.5114	1823.97	1	4670.0%	57	K.TYFPHFDVSHGSAQVK.G
	TK261102_lung_cytoE18_2_step12.4447.4447.2	3.4104	0.5924	3054.49	1	3520.0%	4	K.LLSHCLLVTLASHHPADFTPAVHASLDK.F
*	TK261102_lung_cytoE18_2_step07.5325.5325.2	1.6972	0.0774	2966.64	1	2240.0%	1	K.KVADALASAAGHLDDLPGALSALSDLHAHK.L
	TK261102_lung_cytoE18_2_step12.3792.3792.2	1.6825	0.266	2829.88	1	2080.0%	1	R.MFASFPTTKTYFPHFDVSHGSAQVK.G
UWDR1_MOUSE99.6%91914.0%606664076.6(O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) 
	TK261102_lung_cytoE18_2_step05.0910.0910.2	3.8442	0.5234	2586.56	1	4380.0%	3	K.AHDGGIYAISWSPDSTHLLSASGDK.T
	TK261102_lung_cytoE18_2_step12.3689.3689.2	1.6712	0.2717	2786.09	1	2500.0%	2	R.LHHVSSLAWLDEHTLVTTSHDASVK.E
*	TK261102_lung_cytoE18_2_step01.2862.2862.2	1.8683	0.2038	2421.62	4	2620.0%	1	R.NIDNPAIADIYTEHAHQVVVAK.Y
*	TK261102_lung_cytoE18_2_step06.2089.2089.1	1.2113	0.0385	925.52	12	5710.0%	1	K.NNPSKPLR.V
	TK261102_lung_cytoE18_2_step04.0115.0115.1	0.8082	0.0249	639.92	11	6250.0%	2	K.EHLLK.Y
UFLNA_HUMAN99.6%21476.1%26472807596.1(P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) 
*	TK261102_lung_cytoE18_2_step06.5770.5770.1	0.4681	0.3822	413.19	5	3330.0%	2	R.VVVP.-
*	TK261102_lung_cytoE18_2_step10.4152.4152.2	1.1995	0.09	1945.31	14	2650.0%	2	K.HTAMVSWGGVSIPNSPFR.V
*	TK261102_lung_cytoE18_2_step11.3704.3704.2	1.4869	0.124	2685.19	1	2610.0%	1	R.CSYQPTMEGVHTVHVTFAGVPIPR.S
*	TK261102_lung_cytoE18_2_step11.1581.1581.2	3.2821	0.6368	1638.82	1	6000.0%	2	R.VHGPGIQSGTTNKPNK.F
*	TK261102_lung_cytoE18_2_step07.2116.2116.1	2.0427	0.4663	1110.64	1	5000.0%	3	R.ALTQTGGPHVK.A
*	TK261102_lung_cytoE18_2_step09.4381.4381.2	0.7857	0.1104	2238.15	192	1390.0%	1	R.LLGWIQNKLPQLPITNFSR.D
*	TK261102_lung_cytoE18_2_step10.3111.3111.1	0.9912	0.1212	1155.83	9	4500.0%	1	R.NGHVGISFVPK.E
*	TK261102_lung_cytoE18_2_step10.2980.2980.2	1.4861	0.2013	2587.68	2	2730.0%	1	K.KTHIQDNHDGTYTVAYVPDVTGR.Y
*	TK261102_lung_cytoE18_2_step06.3388.3388.2	1.1638	0.075	1699.87	4	3000.0%	4	R.TGVELGKPTHFTVNAK.A
*	TK261102_lung_cytoE18_2_step12.1635.1635.1	1.1113	0.0364	1078.09	50	3890.0%	1	K.LKPGAPLRPK.L
*	TK261102_lung_cytoE18_2_step06.2692.2692.1	1.6956	0.4208	1150.58	1	5560.0%	2	K.ETGEHLVHVK.K
UQ91VM999.6%114.8%330381157.0(Q91VM9) Similar to pyrophosphatase (Inorganic) 
*	TK261102_lung_cytoE18_2_step12.3315.3315.2	3.4706	0.3737	1831.7	1	5330.0%	1	K.HVAGHYISPFHDIPLK.A
URL12_MOUSE99.6%51714.5%165177919.4(P35979) 60S ribosomal protein L12 
	TK261102_lung_cytoE18_2_step08.4788.4788.2	2.8098	0.5608	1687.42	1	5000.0%	4	K.HSGNITFDEIVNIAR.Q
	TK261102_lung_cytoE18_2_step01.2295.2295.1	1.3777	0.0686	881.71	11	5620.0%	1	K.IGPLGLSPK.K
UQ9CW6499.6%112.8%748810075.6(Q9CW64) 1200003G01Rik protein (Fragment) 
*	TK261102_lung_cytoE18_2_step12.3436.3436.2	2.7006	0.5799	2163.23	1	4000.0%	1	K.SAAHIGLPPVTVHPGQALQLR.L
UADHA_MOUSE99.6%3517349.2%374396408.1(P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) 
*	TK261102_lung_cytoE18_2_step11.5885.5885.2	1.0225	0.0187	2847.98	4	1550.0%	1	K.VTPGSTCAVFGLGGVGLSVIIGCKAAGAAR.I
*	TK261102_lung_cytoE18_2_step01.2926.2926.1	1.4745	0.2351	1562.91	12	3330.0%	1	K.VIPLFSPQCGECR.I
*	TK261102_lung_cytoE18_2_step07.5397.5397.3	1.0559	0.0656	4727.02	3	1220.0%	1	R.LDTMTSALLSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWK.G
*	TK261102_lung_cytoE18_2_step01.3195.3195.1	1.6353	0.0938	1091.0	1	6250.0%	1	K.INEAFDLLR.S
*	TK261102_lung_cytoE18_2_step07.1898.1898.1	1.394	0.1223	1135.65	2	5000.0%	4	K.HPESNFCSR.S
*	TK261102_lung_cytoE18_2_step06.5477.5477.2	3.338	0.5311	1768.71	1	6790.0%	1	K.FPLDPLITHVLPFEK.I
*	TK261102_lung_cytoE18_2_step10.4503.4503.2	3.5787	0.5933	2507.63	1	4760.0%	7	K.AAVLWELHKPFTIEDIEVAPPK.A
*	TK261102_lung_cytoE18_2_step11.5426.5426.2	1.6628	0.0764	1895.85	6	3330.0%	6	K.KFPLDPLITHVLPFEK.I
*	TK261102_lung_cytoE18_2_step06.5204.5204.3	4.781	0.6668	4088.27	1	2440.0%	7	R.SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK.V
UALDR_MOUSE99.6%189418.1%315356017.2(P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) 
	TK261102_lung_cytoE18_2_step09.2911.2911.2	1.2986	0.3058	1246.11	1	6110.0%	1	K.HKDYPFHAEV.-
	TK261102_lung_cytoE18_2_step07.4621.4621.2	1.9985	0.1478	2200.99	27	2000.0%	2	K.MPTLGLGTWKSPPGQVTEAVK.V
	TK261102_lung_cytoE18_2_step08.3509.3509.2	2.1241	0.3187	2222.39	1	3240.0%	4	K.YKPAVNQIECHPYLTQEK.L
	TK261102_lung_cytoE18_2_step08.2764.2764.1	1.6112	0.1173	884.74	17	5710.0%	8	R.ILNKPGLK.Y
UFKB1_MOUSE99.6%52515.9%107117918.2(P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) 
	TK261102_lung_cytoE18_2_step10.2963.2963.2	3.2273	0.6345	1955.13	1	5310.0%	5	K.RGQTCVVHYTGMLEDGK.K
UQ99KQ299.6%144623.0%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) 
	TK261102_lung_cytoE18_2_step06.4226.4226.2	4.1321	0.6394	2203.32	1	4740.0%	5	R.LVSNHSLHETSSVFVDSLTK.V
	TK261102_lung_cytoE18_2_step01.3282.3282.2	1.6999	0.2978	2468.17	1	3180.0%	1	K.FNEEHIPDSPFVVPVASPSGDAR.R
	TK261102_lung_cytoE18_2_step01.2470.2470.1	1.0491	0.065	1302.82	9	4090.0%	1	K.FNGTHIPGSPFK.I
	TK261102_lung_cytoE18_2_step11.1978.1978.3	1.318	0.2393	2558.62	4	2080.0%	1	K.GQHVPGSPFQFTVGPLGEGGAHKVR.A
	TK261102_lung_cytoE18_2_step10.3252.3252.1	1.771	0.1995	1436.76	1	4620.0%	1	K.AGNNMLLVGVHGPR.T
	TK261102_lung_cytoE18_2_step06.0383.0383.2	3.8935	0.5144	2770.02	1	4350.0%	4	K.VHSPSGALEECYVTEIDQDKYAVR.F
UALFA_MOUSE99.6%2010636.9%363392258.1(P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) 
*	TK261102_lung_cytoE18_2_step12.0481.0481.2	0.8534	0.0508	3047.06	3	1210.0%	1	R.TVPPAVTGVTFLSGGQSEEEASINLNAINK.C
	TK261102_lung_cytoE18_2_step01.3504.3504.3	2.5244	0.385	3179.96	1	2220.0%	1	R.YASICQQNGIVPIVEPEILPDGDHDLKR.C
	TK261102_lung_cytoE18_2_step06.0751.0751.2	3.5465	0.6193	2109.34	1	5260.0%	3	K.IGEHTPSALAIMENANVLAR.Y
	TK261102_lung_cytoE18_2_step06.2602.2602.1	2.0586	0.3278	1070.63	1	6250.0%	3	K.KELSDIAHR.I
*	TK261102_lung_cytoE18_2_step10.2472.2472.2	2.3697	0.3275	1380.38	1	6360.0%	2	-.PHPYPALTPEQK.K
*	TK261102_lung_cytoE18_2_step07.4968.4968.3	1.4691	0.0683	3862.38	22	1320.0%	1	K.VLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQK.F
UTF1B_MOUSE99.6%194923.3%834888475.8(Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) 
	TK261102_lung_cytoE18_2_step06.1973.1973.1	1.41	0.1252	698.63	1	8000.0%	2	K.HATLQK.N
*	TK261102_lung_cytoE18_2_step03.0463.0463.2	1.8908	0.3217	2568.35	1	2930.0%	1	R.GAAAAAAGQAGTVPPGAPGAPPLPGMAIVK.E
*	TK261102_lung_cytoE18_2_step08.5733.5733.3	0.865	0.0712	4192.01	22	550.0%	1	R.LLPCLHSACSACLGPATPAAANNSGDGGSAGDGAMVDCPVCK.Q
	TK261102_lung_cytoE18_2_step12.1899.1899.2	0.7548	0.038	3104.37	8	1670.0%	1	K.HEPLVLFCESCDTLTCRDCQLNAHK.D
*	TK261102_lung_cytoE18_2_step11.1784.1784.2	3.0521	0.4875	2006.78	1	4470.0%	1	K.IVAERPGTNSTGPGPMAPPR.A
	TK261102_lung_cytoE18_2_step11.1678.1678.1	1.3044	0.2513	934.66	4	5000.0%	2	K.HQEHILR.F
*	TK261102_lung_cytoE18_2_step10.3052.3052.3	4.7801	0.6346	3329.31	1	2650.0%	4	K.RPAASSAAAASAAASSPAGGGGEAQELLEHCGVCR.E
	TK261102_lung_cytoE18_2_step01.2627.2627.1	2.3808	0.2363	1522.26	1	5450.0%	2	K.DHQYQFLEDAVR.N
*	TK261102_lung_cytoE18_2_step12.4857.4857.3	1.2636	0.1322	4502.92	7	980.0%	1	K.VFPGSTTEDYNLIVIERGAAAAAAGQAGTVPPGAPGAPPLPGMAIVK.E
	TK261102_lung_cytoE18_2_step06.0612.0612.2	4.7422	0.6301	2140.72	1	6560.0%	4	K.HEPLVLFCESCDTLTCR.D
UPA1B_HUMAN99.6%2225.3%229255695.9(Q29459) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) 
*	TK261102_lung_cytoE18_2_step12.4935.4935.2	4.6747	0.4918	2451.11	1	5530.0%	1	K.ICKPLHELIMQLLEETPEEK.Q
*	TK261102_lung_cytoE18_2_step12.3493.3493.3	0.8771	0.0926	4083.01	12	680.0%	1	K.LANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAK.I
UFUMH_MOUSE99.6%71314.2%507543719.0(P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) 
*	TK261102_lung_cytoE18_2_step06.0895.0895.2	0.876	0.0101	3168.93	108	1300.0%	1	R.THTQDAVPLTLGQEFSGYVQQVQYAMVR.I
*	TK261102_lung_cytoE18_2_step12.1319.1319.1	2.8327	0.4212	1286.76	1	7000.0%	3	K.KPVHPNDHVNK.S
	TK261102_lung_cytoE18_2_step04.0458.0458.1	0.7157	0.0198	726.9	27	4000.0%	1	R.STMNFK.I
	TK261102_lung_cytoE18_2_step10.4712.4712.2	1.1531	0.0605	3068.82	2	1920.0%	1	K.NGSTLKETAIELGYLTAEQFDEWVKPK.D
UQ9JK3199.6%332.9%13061384884.8(Q9JK31) ATFa-associated factor 
*	TK261102_lung_cytoE18_2_step04.0812.0812.1	0.9488	0.0354	1222.5	35	2000.0%	1	K.MSTPEGEKSEK.G
	TK261102_lung_cytoE18_2_step12.1917.1917.2	2.9933	0.5782	1814.43	1	4690.0%	1	R.LPPEAASTSLPQKPHLK.L
*	TK261102_lung_cytoE18_2_step12.1727.1727.1	1.396	0.0386	1195.29	6	4440.0%	1	R.QQLDAVHRVK.G
UPE15_MOUSE99.6%61422.3%130150545.0(Q62048) Astrocytic phosphoprotein PEA-15 
	TK261102_lung_cytoE18_2_step10.4349.4349.2	1.822	0.4259	1479.73	1	5450.0%	1	R.RPDLLTMVVDYR.T
	TK261102_lung_cytoE18_2_step07.5160.5160.2	4.2155	0.5718	2093.66	1	6250.0%	3	K.LDKDNLSYIEHIFEISR.R
UQ8VDM699.6%101416.8%859960026.6(Q8VDM6) Similar to E1B-55 kDa-associated protein 5 
	TK261102_lung_cytoE18_2_step05.0805.0805.2	1.0709	0.0196	1480.98	14	3750.0%	1	K.KYNILGTNAIMDK.M
*	TK261102_lung_cytoE18_2_step07.3414.3414.2	3.3982	0.576	2110.62	1	5000.0%	2	R.RPLDMEPQQQVYHPELK.T
	TK261102_lung_cytoE18_2_step09.4182.4182.2	1.7017	0.2296	2394.8	4	3330.0%	1	K.AECEILMMVGLPAAGKTTWAIK.H
*	TK261102_lung_cytoE18_2_step01.1504.1504.3	1.6621	0.0598	1770.68	6	2890.0%	1	R.GGFQNRGGGGGSGGGGGNYR.G
	TK261102_lung_cytoE18_2_step09.2426.2426.1	1.1411	0.1191	1486.58	71	1670.0%	2	K.HLPSTEPDPHVVR.I
*	TK261102_lung_cytoE18_2_step06.1873.1873.1	1.0966	0.0657	841.53	20	5000.0%	1	R.IRGTIGPK.S
	TK261102_lung_cytoE18_2_step06.0084.0084.2	1.2743	0.0267	1592.97	45	2500.0%	1	K.EALGGQALYPHVLVK.N
*	TK261102_lung_cytoE18_2_step09.3858.3858.3	1.0168	0.0496	3936.55	3	1210.0%	1	R.GNYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPAR.N
UQ9QYB199.6%4420.2%253287295.6(Q9QYB1) Intracellular chloride channel protein 
	TK261102_lung_cytoE18_2_step12.3653.3653.3	4.096	0.5417	2623.67	1	3480.0%	1	R.KPADLQNLAPGTHPPFITFNSEVK.T
	TK261102_lung_cytoE18_2_step01.4167.4167.1	1.229	0.1488	1592.37	1	3750.0%	1	K.EEDKEPLIELFVK.A
	TK261102_lung_cytoE18_2_step01.2340.2340.1	1.238	0.1085	1518.06	1	2690.0%	1	K.HPESNTAGMDIFAK.F
UHBD_HUMAN99.6%1820415.1%146159248.0(P02042) Hemoglobin delta chain 
*	TK261102_lung_cytoE18_2_step01.2258.2258.1	1.8476	0.255	1523.81	2	3750.0%	2	K.GTFSQLSELHCDK.L
*	TK261102_lung_cytoE18_2_step07.4136.4136.2	3.6698	0.4527	2633.72	1	4050.0%	14	K.GTFSQLSELHCDKLHVDPENFR.L
UMCM3_MOUSE99.6%165011.5%812915465.6(P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) 
	TK261102_lung_cytoE18_2_step08.3261.3261.1	2.2769	0.5174	1425.79	1	5420.0%	5	R.SLAPSIHGHDYVK.K
*	TK261102_lung_cytoE18_2_step06.2916.2916.2	1.8863	0.122	1782.5	2	4290.0%	1	R.EEPFSSEEIQACLSR.M
	TK261102_lung_cytoE18_2_step09.1086.1086.1	1.5423	0.1665	595.65	2	8750.0%	1	K.HVSPR.T
*	TK261102_lung_cytoE18_2_step12.4468.4468.3	1.4289	0.0091	2997.34	2	1700.0%	1	K.YIHVAKIIKPTLTQESAAYIAEEYSR.L
	TK261102_lung_cytoE18_2_step04.4816.4816.3	1.4808	0.0647	2234.31	9	2370.0%	1	R.RYSDLTTLVAFPSSSVYPTK.D
*	TK261102_lung_cytoE18_2_step08.2688.2688.1	1.5267	0.2512	1009.57	1	4380.0%	4	K.HDSLLHGTK.K
*	TK261102_lung_cytoE18_2_step09.1679.1679.1	1.0322	0.096	734.5	3	7500.0%	1	R.MHQYR.A
UCAH2_MOUSE99.6%219512.4%259289607.0(P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) 
	TK261102_lung_cytoE18_2_step06.2217.2217.1	1.7684	0.3925	1121.45	1	5620.0%	6	K.HNGPENWHK.D
	TK261102_lung_cytoE18_2_step05.4289.4289.1	1.0397	0.0462	1012.29	6	4380.0%	3	K.VLEALHSIK.T
	TK261102_lung_cytoE18_2_step12.3260.3260.1	2.1886	0.4306	1585.52	1	6250.0%	6	K.YAAELHLVHWNTK.Y
	TK261102_lung_cytoE18_2_step11.3256.3256.2	2.4851	0.3973	1710.83	1	6540.0%	1	K.KYAAELHLVHWNTK.Y
UPEBP_MOUSE99.6%81246.0%187208605.4(P70296) Phosphatidylethanolamine-binding protein (PEBP) 
	TK261102_lung_cytoE18_2_step12.3625.3625.1	1.2988	0.2154	1443.51	2	3500.0%	2	R.EWHHFLVVNMK.G
*	TK261102_lung_cytoE18_2_step01.3200.3200.3	1.2175	0.0624	2647.89	12	1360.0%	1	K.KYNLGAPVAGTCYQAEWDDYVPK.L
*	TK261102_lung_cytoE18_2_step01.3331.3331.2	1.5341	0.1777	2499.62	1	2270.0%	1	K.VLTPTQVMNRPSSISWDGLDPGK.L
*	TK261102_lung_cytoE18_2_step06.4966.4966.2	4.1926	0.5952	2714.09	1	4050.0%	1	R.YVWLVYEQEQPLSCDEPILSNK.S
*	TK261102_lung_cytoE18_2_step07.3306.3306.1	1.3124	0.1601	926.7	2	6670.0%	2	K.FKVETFR.K
UP137_MOUSE99.6%354.9%656735485.4(Q60865) GPI-anchored protein p137 (p137GPI) 
	TK261102_lung_cytoE18_2_step06.2534.2534.2	0.9948	0.0446	1565.4	72	2500.0%	1	R.LKTVLELQYVLDK.L
	TK261102_lung_cytoE18_2_step07.5240.5240.2	2.982	0.5636	2296.15	1	5560.0%	2	R.LNEQYEHASIHLWDLLEGK.E
UQ9CQ9999.6%2239.1%115116514.5(Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) 
	TK261102_lung_cytoE18_2_step01.1890.1890.2	3.5302	0.6051	2775.39	1	3440.0%	1	K.LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK.K
*	TK261102_lung_cytoE18_2_step01.3903.3903.3	1.0334	0.1521	4001.01	15	970.0%	1	K.NIEDVIAQGVGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK.K
UHMG1_MOUSE99.6%3834819.6%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) 
	TK261102_lung_cytoE18_2_step06.1388.1388.1	0.9063	0.025	530.87	1	5000.0%	1	K.KGVVK.A
	TK261102_lung_cytoE18_2_step01.2070.2070.1	1.3329	0.0583	1464.77	1	4170.0%	2	K.HPDASVNFSEFSK.K
	TK261102_lung_cytoE18_2_step01.1784.1784.1	1.4957	0.1008	925.72	1	5710.0%	1	K.GKFEDMAK.A
	TK261102_lung_cytoE18_2_step12.2044.2044.1	1.7431	0.4273	1522.92	1	4290.0%	9	K.IKGEHPGLSIGDVAK.K
	TK261102_lung_cytoE18_2_step10.2863.2863.1	2.0624	0.4849	1280.7	1	6250.0%	2	K.GEHPGLSIGDVAK.K
	TK261102_lung_cytoE18_2_step06.3625.3625.1	0.9339	0.1763	1596.32	11	2690.0%	15	K.KHPDASVNFSEFSK.K
UQ9CVT399.6%5544.3%201223707.8(Q9CVT3) 1700037H04Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step06.2913.2913.2	3.3727	0.5505	2071.07	1	5000.0%	1	R.FAAGHDAEGSQSHVHFDEK.L
	TK261102_lung_cytoE18_2_step10.0022.0022.3	1.5066	0.0559	4200.31	18	1220.0%	1	R.FAAGHDAEGSQSHVHFDEKLHDSVVMVTQESDNSFLVK.V
*	TK261102_lung_cytoE18_2_step10.3829.3829.2	1.5198	0.0452	2485.78	12	2140.0%	1	R.HHGTPMLLDGVSVWALSWSMTR.N
	TK261102_lung_cytoE18_2_step08.3101.3101.3	1.3863	0.2043	2693.86	5	2170.0%	1	K.LHDSVVMVTQESDNSFLVKVGFLK.I
	TK261102_lung_cytoE18_2_step12.2233.2233.3	1.8951	0.2246	2640.3	3	1740.0%	1	R.ETPVHSLHLKLLSVTPTSEGYSIK.C
UQ9D7P799.6%5737.2%207235516.5(Q9D7P7) 2300003G24Rik protein 
*	TK261102_lung_cytoE18_2_step07.3276.3276.2	3.5274	0.4735	1626.67	1	6540.0%	2	R.APLDHELAQEPHLR.E
*	TK261102_lung_cytoE18_2_step08.2603.2603.3	1.6002	0.1131	1871.8	52	2330.0%	1	K.NPVPTQDNALYQQLLR.A
*	TK261102_lung_cytoE18_2_step09.4393.4393.2	0.8489	0.127	3139.01	2	1920.0%	1	K.TDTLQIEEFLEETLGPPDFPSLAPRYR.E
*	TK261102_lung_cytoE18_2_step10.3303.3303.2	4.1225	0.6495	2282.63	1	5790.0%	1	K.YTCPHSAEILAAYQPAVHPR.-
UPLSL_MOUSE99.6%8268.5%627702025.4(Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65) 
	TK261102_lung_cytoE18_2_step06.4104.4104.2	2.8287	0.5683	2541.81	1	3330.0%	3	K.YPALHKPENQDIDWGALEGETR.E
*	TK261102_lung_cytoE18_2_step08.3087.3087.1	1.506	0.0498	702.38	1	6000.0%	4	K.VFHGLK.T
	TK261102_lung_cytoE18_2_step01.5052.5052.2	3.1771	0.5601	2699.68	1	3120.0%	1	K.ISTSLPVLDLIDAIQPGSINYDLLK.T
URL7_MOUSE99.6%135921.5%2703142010.9(P14148) 60S ribosomal protein L7 
	TK261102_lung_cytoE18_2_step10.2783.2783.1	1.1033	0.0768	1157.67	50	3750.0%	1	R.EDQINRLIR.R
	TK261102_lung_cytoE18_2_step10.5067.5067.2	4.5104	0.5551	2140.06	1	5590.0%	2	K.FGIICMEDLIHEIYTVGK.R
	TK261102_lung_cytoE18_2_step05.3701.3701.1	1.9039	0.124	1083.36	2	5560.0%	2	K.KVPAVPETLK.K
	TK261102_lung_cytoE18_2_step09.1638.1638.3	1.5249	0.0563	1487.68	8	2880.0%	1	K.KTTHFVEGGDAGNR.E
	TK261102_lung_cytoE18_2_step10.1476.1476.1	0.8607	0.0947	698.5	1	6670.0%	7	K.KVPAGPK.T
UQ9Z0P599.6%61217.5%349394716.8(Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) 
*	TK261102_lung_cytoE18_2_step10.1564.1564.1	1.0863	0.0034	1234.75	27	3890.0%	1	K.QKTVNYIQLK.L
	TK261102_lung_cytoE18_2_step12.5139.5139.2	0.7827	0.0532	2807.03	7	1460.0%	1	K.TEISVESKHQTLQGLAFPLQPEAQR.A
	TK261102_lung_cytoE18_2_step12.5135.5135.2	0.9793	0.1059	2959.09	32	1400.0%	1	K.IEIGDGAELTAEFLYDEVHPKQHAFK.Q
	TK261102_lung_cytoE18_2_step08.4415.4415.2	3.611	0.5672	1936.07	1	5940.0%	3	K.HQTLQGLAFPLQPEAQR.A
UQ9EQR099.6%32848.8%25042724266.6(Q9EQR0) Fatty acid synthase 
	TK261102_lung_cytoE18_2_step01.3102.3102.1	1.5225	0.2205	1253.8	2	5000.0%	1	K.FDASFFGVHPK.Q
*	TK261102_lung_cytoE18_2_step01.2250.2250.2	2.5023	0.4271	1968.13	1	4410.0%	1	K.LFDHPEVPTPPESASVSR.L
*	TK261102_lung_cytoE18_2_step05.0106.0106.1	1.9189	0.4412	1146.82	1	6880.0%	1	K.HDLVMNVYR.D
*	TK261102_lung_cytoE18_2_step07.3712.3712.1	1.0425	0.0987	850.73	1	5710.0%	3	K.ALHLVGLK.R
*	TK261102_lung_cytoE18_2_step08.2123.2123.1	1.2482	0.1756	693.58	28	6000.0%	1	R.HPQALK.D
*	TK261102_lung_cytoE18_2_step11.4980.4980.2	0.9296	0.0318	1762.51	10	2670.0%	1	K.MKVAEVLAGEGHLYSR.I
*	TK261102_lung_cytoE18_2_step06.5066.5066.2	3.3786	0.5931	1792.86	1	6430.0%	3	R.DHKDNLEFFLTNLGK.V
*	TK261102_lung_cytoE18_2_step05.0100.0100.1	0.8672	0.1391	1293.84	142	2500.0%	2	R.LQVVDRPLPVR.G
*	TK261102_lung_cytoE18_2_step10.3153.3153.1	1.1121	0.0091	981.79	20	5620.0%	1	R.KALHLVGLK.R
*	TK261102_lung_cytoE18_2_step07.2869.2869.1	2.3927	0.272	1271.68	1	7220.0%	5	R.HFQLEQDKPK.E
*	TK261102_lung_cytoE18_2_step12.4787.4787.3	1.094	0.0652	4510.69	17	1090.0%	1	K.LSVPTYGLQCTQAAPLDSIPNLAAYYIDCIKQVQPEGPYR.I
*	TK261102_lung_cytoE18_2_step11.4569.4569.2	2.8354	0.4829	2500.72	1	3860.0%	1	K.VHLTGINVNPNALFPPVEFPAPR.G
*	TK261102_lung_cytoE18_2_step06.3330.3330.1	1.6665	0.3158	1064.63	1	4440.0%	2	R.GTPLISPHIK.W
*	TK261102_lung_cytoE18_2_step01.5014.5014.2	2.9797	0.5457	2035.46	1	6110.0%	1	R.LLLPEDPLISGLLNSQALK.A
*	TK261102_lung_cytoE18_2_step11.5102.5102.2	2.2384	0.5227	2466.28	1	3410.0%	2	R.TGGLAFHSYFMEGIAPTLLQALK.K
UQ9CQ6099.6%104214.4%257272545.8(Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) 
*	TK261102_lung_cytoE18_2_step01.2058.2058.1	1.1571	0.0088	1482.76	8	3330.0%	1	R.DLPAAAAPAGPASFAR.W
	TK261102_lung_cytoE18_2_step06.2768.2768.2	3.0473	0.5702	1603.85	1	5710.0%	4	K.IVAPISDSPKPPPQR.V
*	TK261102_lung_cytoE18_2_step08.2572.2572.1	1.3559	0.07	700.75	2	6000.0%	5	R.THLLSK.L
UQ9Z1Y499.6%3313.8%480509347.3(Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) 
*	TK261102_lung_cytoE18_2_step11.3273.3273.1	1.183	0.1494	1381.68	34	3330.0%	1	R.GPTWVGSHGTPQR.L
*	TK261102_lung_cytoE18_2_step12.1931.1931.2	3.5575	0.5697	1779.17	1	5880.0%	1	R.GALGPPTAHGATLQPHPR.V
	TK261102_lung_cytoE18_2_step09.4039.4039.3	1.5869	0.0162	4178.68	2	1400.0%	1	R.SFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCK.A
UHMG2_MOUSE99.6%1910918.7%209240317.3(P30681) High mobility group protein 2 (HMG-2) 
*	TK261102_lung_cytoE18_2_step01.1895.1895.1	2.1084	0.4538	1338.84	1	5000.0%	1	K.IEHPGLSIGDTAK.K
*	TK261102_lung_cytoE18_2_step09.3062.3062.1	2.1977	0.4576	1581.7	1	4640.0%	9	K.IKIEHPGLSIGDTAK.K
	TK261102_lung_cytoE18_2_step08.3683.3683.1	2.9651	0.1993	1594.78	1	5000.0%	4	K.KHPDSSVNFAEFSK.K
	TK261102_lung_cytoE18_2_step12.1008.1008.1	1.1249	0.266	984.73	14	3890.0%	1	K.KGPGRPTGSK.K
URS20_HUMAN99.6%1110.1%119133739.9(P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 
	TK261102_lung_cytoE18_2_step01.2574.2574.1	2.1613	0.4377	1351.93	1	5910.0%	1	R.LIDLHSPSEIVK.Q
UHGD_MOUSE99.6%2211.9%445499907.2(O09173) Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) 
*	TK261102_lung_cytoE18_2_step12.2992.2992.2	0.7936	0.0131	2276.36	18	1580.0%	1	-.MAELKYISGFGNECASEDPR.C
*	TK261102_lung_cytoE18_2_step12.3220.3220.3	3.707	0.5977	3751.12	1	2340.0%	1	R.ILPSVSHKPFESIDQGHVTHNWDEVGPDPNQLR.W
UACTB_HUMAN99.6%83170733.9%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) 
	TK261102_lung_cytoE18_2_step01.1850.1850.1	1.111	0.1555	1132.75	1	5000.0%	1	R.GYSFTTTAER.E
	TK261102_lung_cytoE18_2_step03.0443.0443.2	3.7325	0.5805	2346.24	1	4520.0%	4	R.KDLYANTVLSGGTTMYPGIADR.M
	TK261102_lung_cytoE18_2_step11.5444.5444.2	3.0303	0.5606	1519.66	1	7500.0%	17	K.IWHHTFYNELR.V
	TK261102_lung_cytoE18_2_step01.1727.1727.1	0.9221	0.102	1516.7	5	2500.0%	1	K.QEYDESGPSIVHR.K
	TK261102_lung_cytoE18_2_step01.2722.2722.2	2.9675	0.5867	1958.01	1	5590.0%	3	R.VAPEEHPVLLTEAPLNPK.A
	TK261102_lung_cytoE18_2_step01.5311.5311.2	4.1203	0.6857	2554.44	1	4320.0%	6	K.LCYVALDFEQEMATAASSSSLEK.S
	TK261102_lung_cytoE18_2_step07.4728.4728.2	2.6866	0.5461	3188.48	1	3100.0%	9	R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L
UTRM3_MOUSE99.6%5712.0%744807757.8(Q9R1R2) Tripartite motif protein 3 (RING finger protein 22) (RING finger protein HAC1) 
	TK261102_lung_cytoE18_2_step11.2218.2218.2	1.2083	0.0684	2399.32	1	2750.0%	1	R.IVVADSNNQCIQVFSNEGQFK.F
	TK261102_lung_cytoE18_2_step09.4430.4430.2	0.7034	0.0791	3174.24	163	1110.0%	1	K.VLQTQLDTLRQGQEHIGSSCSFAEQALR.L
	TK261102_lung_cytoE18_2_step12.5309.5309.2	1.0451	0.1992	2739.42	6	1730.0%	1	R.RSVLNLGALLTTSATAHETVATGEGLR.Q
*	TK261102_lung_cytoE18_2_step12.2600.2600.1	2.5372	0.5023	1439.98	1	5000.0%	2	R.HFAGPHFVAVNNK.N
UQ91YZ899.6%336.3%615678539.5(Q91YZ8) Hypothetical 67.9 kDa protein 
	TK261102_lung_cytoE18_2_step11.1701.1701.1	1.27	0.0369	682.43	15	5000.0%	1	K.YASSVR.S
	TK261102_lung_cytoE18_2_step10.3169.3169.2	3.3304	0.6324	1703.43	1	6670.0%	1	R.SKVDEAVAVLQAHHAK.K
*	TK261102_lung_cytoE18_2_step09.2274.2274.2	1.0429	0.1083	1712.11	22	2500.0%	1	R.HLAPTGVPTAVPNLAPR.A
UTCPZ_MOUSE99.6%4109.2%531580047.1(P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) 
*	TK261102_lung_cytoE18_2_step06.0438.0438.2	1.0193	0.0245	2751.42	9	1670.0%	1	R.AVKNAIDDGCVVPGAGAVEVALAEALIK.Y
	TK261102_lung_cytoE18_2_step06.0558.0558.2	2.8901	0.6014	2318.21	1	4250.0%	3	K.DGNVLLHEMQIQHPTASLIAK.V
UBHMT_MOUSE99.6%4418.4%407450217.9(O35490) Betaine--homocysteine S-methyltransferase (EC 2.1.1.5) 
	TK261102_lung_cytoE18_2_step12.3299.3299.2	3.9314	0.503	1966.45	1	6560.0%	1	K.HGSWGSGLDMHTKPWIR.A
*	TK261102_lung_cytoE18_2_step05.4326.4326.3	0.9733	0.1354	3799.09	30	780.0%	1	K.AYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPR.V
	TK261102_lung_cytoE18_2_step01.2279.2279.2	1.8139	0.3358	1819.56	1	4380.0%	1	K.AGPWTPEAAVEHPEAVR.Q
	TK261102_lung_cytoE18_2_step12.1025.1025.2	1.205	0.02	1102.07	37	5000.0%	1	R.QLHREFLR.A
UAAC1_HUMAN99.6%11377.7%8921029745.4(P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein) 
	TK261102_lung_cytoE18_2_step12.1153.1153.1	1.4095	0.2645	721.56	2	7000.0%	5	R.LHKPPK.V
	TK261102_lung_cytoE18_2_step12.3945.3945.3	1.5948	0.0287	3437.71	12	1550.0%	1	R.LSNRPAFMPSEGRMVSDINNAWGCLEQVEK.G
	TK261102_lung_cytoE18_2_step06.0587.0587.2	0.9564	0.1225	2742.18	58	1360.0%	1	K.NVNIQNFHISWKDGLGFCALIHR.H
	TK261102_lung_cytoE18_2_step10.2760.2760.2	3.2233	0.5157	1229.66	1	7220.0%	1	R.HRPELIDYGK.L
URCN1_MOUSE99.6%114.9%325381134.8(Q05186) Reticulocalbin 1 precursor 
	TK261102_lung_cytoE18_2_step06.3769.3769.2	3.8012	0.5789	1951.75	1	6670.0%	1	R.HWILPQDYDHAQAEAR.H
UQ8VDD599.6%17338.5%19602263555.7(Q8VDD5) Nonmuscle heavy chain myosin II-A 
	TK261102_lung_cytoE18_2_step06.0035.0035.3	1.1931	0.0036	3020.46	7	2120.0%	1	R.DLGEELEALKTELEDTLDSTAAQQELR.S
	TK261102_lung_cytoE18_2_step10.3076.3076.2	1.2843	0.1575	1456.44	1	5000.0%	1	K.VIQYLAHVASSHK.S
*	TK261102_lung_cytoE18_2_step11.1976.1976.2	1.5988	0.0676	1957.37	25	2500.0%	1	K.LEMDLKDLEAHIDTANK.N
	TK261102_lung_cytoE18_2_step07.4574.4574.1	2.0355	0.3196	1573.9	1	3850.0%	4	K.VSHLLGINVTDFTR.G
*	TK261102_lung_cytoE18_2_step11.3900.3900.2	1.053	0.044	1884.74	15	3000.0%	1	R.VAEFTTNLMEEEEKSK.S
*	TK261102_lung_cytoE18_2_step07.4710.4710.2	1.1577	0.2039	2974.56	10	1460.0%	1	K.DMFQETMEAMRIMGIPEDEQMGLLR.V
	TK261102_lung_cytoE18_2_step12.4329.4329.2	0.8089	0.01	3017.85	39	1200.0%	1	K.NMDPLNDNIATLLHQSSDKFVSELWK.D
	TK261102_lung_cytoE18_2_step06.3526.3526.2	1.3016	0.0958	1952.31	2	3330.0%	1	R.LQQELDDLLVDLDHQR.Q
	TK261102_lung_cytoE18_2_step07.3404.3404.1	2.2572	0.2726	1587.8	1	5000.0%	2	K.NKHEAMITDLEER.L
UGRBA_MOUSE99.6%337.9%621704729.0(Q60760) Growth factor receptor-bound protein 10 (GRB10 adaptor protein) 
	TK261102_lung_cytoE18_2_step10.3607.3607.2	3.482	0.5461	2631.2	1	3810.0%	1	K.SHCVDDNSWTLVEHHPQLGLER.C
	TK261102_lung_cytoE18_2_step08.4869.4869.2	0.9159	0.1395	2028.19	31	3120.0%	1	K.KQYNAPNEHGMCIKPNK.A
	TK261102_lung_cytoE18_2_step12.1280.1280.1	1.0714	0.0133	1315.69	20	3330.0%	1	R.RLQEEDQQLR.T
UDHSO_MOUSE99.6%448.3%375400917.0(Q64442) Sorbitol dehydrogenase (EC 1.1.1.14) (L-iditol 2-dehydrogenase) (Fragment) 
	TK261102_lung_cytoE18_2_step11.1497.1497.1	1.7134	0.0853	822.59	2	5830.0%	1	K.HLKPGDR.V
	TK261102_lung_cytoE18_2_step11.1926.1926.2	2.915	0.5077	1539.93	1	6790.0%	1	K.KPMVLGHEAAGTVTK.V
	TK261102_lung_cytoE18_2_step08.2421.2421.1	1.1133	0.1604	944.54	223	3750.0%	1	K.GVGLKVMIK.C
UNDR3_MOUSE99.6%5729.1%375415555.2(Q9QYF9) NDRG3 protein (Ndr3 protein) 
*	TK261102_lung_cytoE18_2_step10.4581.4581.3	1.0992	0.0689	4787.24	1	1160.0%	1	K.GWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYR.L
	TK261102_lung_cytoE18_2_step06.2757.2757.1	1.2928	0.0241	602.59	6	7500.0%	1	R.LKTLK.C
*	TK261102_lung_cytoE18_2_step10.3551.3551.2	0.9766	0.0786	2930.0	4	1960.0%	2	R.NFQDFDCQEHDIETPHGMVHVTIR.G
*	TK261102_lung_cytoE18_2_step11.0071.0071.3	1.2065	0.1086	3990.19	12	740.0%	1	K.SIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAK.G
UNDR1_MOUSE99.6%358.4%394430096.1(Q62433) NDRG1 protein (N-myc downstream regulated gene 1 protein) (Protein Ndr1) 
*	TK261102_lung_cytoE18_2_step01.2831.2831.2	2.8175	0.5133	1835.51	1	6330.0%	1	R.ELHDVDLAEVKPLVEK.G
	TK261102_lung_cytoE18_2_step12.2837.2837.2	3.3756	0.4096	1967.23	1	5000.0%	2	K.GNRPVILTYHDIGMNHK.T
ULA_MOUSE99.6%468.7%415477569.8(P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) 
	TK261102_lung_cytoE18_2_step06.2669.2669.1	1.1982	0.0766	945.55	39	4380.0%	2	K.GSHVFTAAR.R
	TK261102_lung_cytoE18_2_step10.4284.4284.2	3.1554	0.586	2073.28	1	5670.0%	1	K.ICHQIEYYFGDFNLPR.D
	TK261102_lung_cytoE18_2_step07.1817.1817.1	1.0812	0.0802	1087.55	213	5000.0%	1	K.GNRPGYAGAPK.G
UTRFE_MOUSE99.6%6430623.2%697767247.2(Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) 
*	TK261102_lung_cytoE18_2_step01.0167.0167.1	1.2363	0.1042	815.8	1	6670.0%	2	K.NPAEWAK.N
*	TK261102_lung_cytoE18_2_step07.3561.3561.1	1.7427	0.2421	1173.67	8	5000.0%	2	K.WCALSHLER.T
	TK261102_lung_cytoE18_2_step07.1856.1856.1	0.8928	4.0E-4	889.6	5	5000.0%	5	K.SCHTGLGR.S
*	TK261102_lung_cytoE18_2_step01.3547.3547.1	1.9096	0.3754	1240.47	1	6000.0%	1	K.DFQLFSSPLGK.D
*	TK261102_lung_cytoE18_2_step08.3347.3347.2	4.038	0.4941	2011.72	1	5880.0%	6	K.DFASCHLAQAPNHVVVSR.K
*	TK261102_lung_cytoE18_2_step07.5362.5362.1	1.4937	0.314	1562.06	1	3850.0%	1	R.SAGWVIPIGLLFCK.L
*	TK261102_lung_cytoE18_2_step06.3268.3268.2	3.2907	0.515	2039.57	1	5000.0%	2	K.HQTVLDNTEGKNPAEWAK.N
*	TK261102_lung_cytoE18_2_step07.3828.3828.1	1.3871	0.2439	1421.95	2	3640.0%	7	R.LYLGHNYVTAIR.N
	TK261102_lung_cytoE18_2_step01.2626.2626.1	1.3829	0.1231	663.9	1	7500.0%	1	K.DLLFR.D
	TK261102_lung_cytoE18_2_step04.0160.0160.2	1.1951	0.1386	916.12	4	6430.0%	1	K.VAQEHFGK.G
*	TK261102_lung_cytoE18_2_step01.4670.4670.1	1.767	0.0669	1159.9	3	6250.0%	1	K.EDLIWEILK.V
*	TK261102_lung_cytoE18_2_step12.2153.2153.2	1.5516	0.2747	1960.49	30	2350.0%	2	K.GDVAFVKHQTVLDNTEGK.N
*	TK261102_lung_cytoE18_2_step08.2344.2344.1	1.1926	0.0308	951.63	13	3750.0%	9	R.IPSHAVVAR.K
*	TK261102_lung_cytoE18_2_step06.0467.0467.1	1.999	0.1393	1316.95	2	6500.0%	5	K.HTTIFEVLPEK.A
*	TK261102_lung_cytoE18_2_step08.3667.3667.1	1.1584	0.0261	878.71	144	4290.0%	2	K.DSAFGLLR.V
*	TK261102_lung_cytoE18_2_step10.2599.2599.1	1.3115	0.1431	1257.65	6	3890.0%	2	R.LLEACTFHKH.-
	TK261102_lung_cytoE18_2_step01.2522.2522.1	1.6414	0.0385	635.56	1	7500.0%	1	K.DLLFK.D
UQ9WTQ599.6%222.9%16841806944.4(Q9WTQ5) SSECKS (PKC binding protein SSECKS) 
*	TK261102_lung_cytoE18_2_step07.3224.3224.3	4.7313	0.5983	3907.73	1	2130.0%	1	K.TEQASEEHEQETAAPEHEGTHPKPVLTADMPHSER.G
*	TK261102_lung_cytoE18_2_step04.4816.4816.2	1.241	0.2438	1489.88	2	4230.0%	1	K.EHAADGPQHQSLAK.A
UTRXB_MOUSE99.6%467.4%499544976.3(Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR) 
	TK261102_lung_cytoE18_2_step12.3007.3007.3	2.807	0.1145	2284.02	2	3180.0%	1	R.VVGFHVLGPNAGEVTQGFAAALK.C
*	TK261102_lung_cytoE18_2_step12.3007.3007.2	3.4703	0.556	1523.02	1	8080.0%	1	K.KLMHQAALLGQALK.D
UQ9DCL899.6%4623.8%206231194.8(Q9DCL8) 0610025N14Rik protein 
	TK261102_lung_cytoE18_2_step11.2202.2202.1	2.6564	0.3603	1330.76	1	6500.0%	2	R.KLHYNEGLNIK.L
*	TK261102_lung_cytoE18_2_step07.0094.0094.3	3.6229	0.5497	4206.64	1	2030.0%	1	K.DLHDDDEDEEMAETADGDSMNVEESSQGSTTSDHLQHK.S
UHS7C_MOUSE99.6%93210927.4%646708715.5(P08109) Heat shock cognate 71 kDa protein 
	TK261102_lung_cytoE18_2_step05.0146.0146.1	2.7314	0.4152	1483.91	1	6150.0%	16	K.SQIHDIVLVGGSTR.I
	TK261102_lung_cytoE18_2_step05.0247.0247.1	1.8918	0.1782	1237.83	1	6110.0%	8	R.MVNHFIAEFK.R
	TK261102_lung_cytoE18_2_step01.3231.3231.1	1.4358	0.2116	1255.68	5	4440.0%	1	R.FEELNADLFR.G
	TK261102_lung_cytoE18_2_step12.3728.3728.2	1.3712	0.392	1655.5	1	3850.0%	3	K.HWPFMVVNDAGRPK.V
	TK261102_lung_cytoE18_2_step09.5581.5581.2	1.6624	0.3757	3001.79	1	2310.0%	3	R.TLSSSTQASIEIDSLYEGIDFYTSITR.A
	TK261102_lung_cytoE18_2_step06.5604.5604.2	4.1278	0.5893	2518.32	1	4570.0%	41	R.GVPQIEVTFDIDANGILNVSAVDK.S
	TK261102_lung_cytoE18_2_step08.4416.4416.2	2.1926	0.2306	2264.48	1	4290.0%	3	K.GPAVGIDLGTTYSCVGVFQHGK.V
	TK261102_lung_cytoE18_2_step04.0450.0450.2	1.2601	0.0063	1747.73	13	3460.0%	1	K.NQTAEKEEFEHQQK.E
	TK261102_lung_cytoE18_2_step01.1866.1866.2	2.4052	0.3347	1411.56	1	6820.0%	1	R.RFDDAVVQSDMK.H
	TK261102_lung_cytoE18_2_step01.0138.0138.1	1.5782	0.1866	775.55	2	6670.0%	1	K.DNNLLGK.F
	TK261102_lung_cytoE18_2_step01.2794.2794.1	1.4398	0.1364	1199.99	1	5000.0%	1	K.DAGTIAGLNVLR.I
	TK261102_lung_cytoE18_2_step07.3304.3304.1	1.0008	0.0473	1253.58	4	4500.0%	1	K.MKEIAEAYLGK.T
US23A_HUMAN99.6%4105.8%765861477.1(Q15436) Protein transport protein Sec23A (SEC23-related protein A) 
*	TK261102_lung_cytoE18_2_step01.3856.3856.2	0.7939	0.0065	2951.39	54	1350.0%	1	R.NWADAQTQIQNIAASFDQEAAAILMAR.L
*	TK261102_lung_cytoE18_2_step07.4268.4268.2	4.0067	0.5891	1945.81	1	6880.0%	3	R.HLLQAPVDDAQEILHSR.F
UHBAZ_MOUSE99.6%94514.9%141161047.6(P06467) Hemoglobin zeta chain 
*	TK261102_lung_cytoE18_2_step11.3357.3357.2	3.8116	0.5816	1987.07	1	6000.0%	6	K.TYFPHFDLHHGSQQLR.A
*	TK261102_lung_cytoE18_2_step09.1774.1774.1	1.5186	0.4196	559.63	1	7500.0%	3	R.AHGFK.I
UMCA1_MOUSE99.6%41012.6%310339978.4(P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] 
	TK261102_lung_cytoE18_2_step01.3694.3694.2	1.0485	0.0879	2020.67	11	2940.0%	1	R.TVVSGLVNHVPLEQMQNR.M
*	TK261102_lung_cytoE18_2_step08.3763.3763.2	2.087	0.4271	2298.95	1	4250.0%	3	K.KHPDADSLYVEEVDVGEAAPR.T
UQ9ERD399.6%41042.8%159175434.2(Q9ERD3) Telokin 
*	TK261102_lung_cytoE18_2_step09.4435.4435.3	4.2814	0.6458	4551.77	1	2320.0%	3	K.SSTGSPTSPINAEKLESEDDVSQAFLEAVAEEKPHVKPYFSK.T
*	TK261102_lung_cytoE18_2_step11.5614.5614.2	0.8896	0.0626	3017.35	1	1800.0%	1	R.HFQIDYDEDGNCTLIISDVCGDDDAK.Y
UQ99K3099.6%5710.3%729822297.2(Q99K30) Similar to hypothetical protein FLJ21935 
*	TK261102_lung_cytoE18_2_step06.2734.2734.2	3.585	0.5434	2472.98	1	4130.0%	2	K.HSLSSESQAPEDIAPPGSSPHANR.G
	TK261102_lung_cytoE18_2_step01.2950.2950.3	1.6827	0.1554	2644.63	106	1700.0%	1	-.MSQSASMSCCPGAANGSLGRSDGVPR.M
	TK261102_lung_cytoE18_2_step11.1201.1201.1	0.7332	0.01	900.2	57	3570.0%	1	R.KLVQLSSK.E
	TK261102_lung_cytoE18_2_step06.4166.4166.3	1.8412	0.1345	1998.77	35	2500.0%	1	R.ARPPSEGEFVDCFQKTK.L
UARF4_MOUSE99.6%2215.6%179202657.2(P36403) ADP-ribosylation factor 4 
*	TK261102_lung_cytoE18_2_step10.5115.5115.2	3.4308	0.4092	2077.41	1	5880.0%	1	K.MLLEDELQDAVLLLFANK.Q
*	TK261102_lung_cytoE18_2_step10.5115.5115.3	2.2905	0.4681	3115.62	1	2040.0%	1	R.IQEGAAVLQKMLLEDELQDAVLLLFANK.Q
UQ99K3599.6%119.2%315362694.8(Q99K35) Similar to hypothetical protein LOC57333 (Fragment) 
*	TK261102_lung_cytoE18_2_step12.2675.2675.3	4.8397	0.5941	3256.25	1	3390.0%	1	R.VHHGTPLSEAPHDDAHGNFQYDHEAFLGR.D
USAD1_MOUSE99.6%576.7%627726508.0(Q60710) SAM domain and HD domain-containing protein 1 (Interferon-gamma inducible protein Mg11) 
*	TK261102_lung_cytoE18_2_step06.0727.0727.2	1.5573	0.2083	2244.79	1	3330.0%	2	K.HEQGSIEMFEHLVNSNELK.L
	TK261102_lung_cytoE18_2_step01.0134.0134.2	1.1665	0.0882	916.32	17	4290.0%	1	K.RNGIDVDK.W
*	TK261102_lung_cytoE18_2_step07.2673.2673.1	1.443	0.2311	853.44	1	7000.0%	1	R.VHFYCK.S
*	TK261102_lung_cytoE18_2_step10.1168.1168.1	0.6639	0.0514	1098.68	13	1880.0%	1	K.RPRCDGSPR.T
ULEG3_MOUSE99.6%245.3%263273848.4(P16110) Galectin-3 (Galactose-specific lectin 3) (MAC-2 antigen) (IgE-binding protein) (35 kDa lectin) (Carbohydrate binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-34 galactoside-binding lectin) 
	TK261102_lung_cytoE18_2_step09.2821.2821.2	3.1647	0.5159	1650.56	1	6540.0%	2	K.VAVNDAHLLQYNHR.M
UQ9CVL399.6%484.2%263282868.2(Q9CVL3) 1810024J13Rik protein (Fragment) 
*	TK261102_lung_cytoE18_2_step10.3140.3140.1	2.6163	0.4028	1318.85	1	5500.0%	2	K.KPIPEEHLILK.T
UQ8VC3099.6%4411.8%578596916.9(Q8VC30) Similar to DKFZP586B1621 protein 
*	TK261102_lung_cytoE18_2_step09.1468.1468.1	0.5317	0.0074	630.72	37	4000.0%	1	R.GVKVAR.A
	TK261102_lung_cytoE18_2_step10.3276.3276.2	3.158	0.4977	1962.01	1	5250.0%	1	R.VALLSGGGSGHEPAHAGFIGK.G
*	TK261102_lung_cytoE18_2_step06.3804.3804.3	1.2603	0.0829	3591.52	1	1360.0%	1	K.MVNSVEGCADDALAGLVASNPDLQLLQGHRVALR.S
*	TK261102_lung_cytoE18_2_step05.2404.2404.1	0.6943	0.0426	775.06	1	5000.0%	1	K.RVSVIAK.T
USYD_MOUSE99.6%468.0%501571176.5(Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) 
	TK261102_lung_cytoE18_2_step06.0615.0615.2	1.8331	0.0302	1741.42	2	3570.0%	1	R.YGISSMIQSQEKPDR.V
	TK261102_lung_cytoE18_2_step10.2804.2804.1	2.1646	0.2919	1436.62	1	5000.0%	1	R.FGAPPHAGGGIGLER.V
	TK261102_lung_cytoE18_2_step10.2533.2533.1	2.6293	0.398	1134.74	1	6110.0%	2	R.ALHHGIDLEK.I
UTES_MOUSE99.6%226.6%423479838.3(P47226) Testin (TES1/TES2) 
*	TK261102_lung_cytoE18_2_step06.1974.1974.1	1.5693	0.3797	851.47	1	6250.0%	1	R.HAPAAVASK.D
	TK261102_lung_cytoE18_2_step08.2889.2889.2	3.2104	0.4815	2205.5	2	4170.0%	1	K.NHAVVCQGCHNAIDPEVQR.V
UQ9CSP799.6%246.7%268287435.3(Q9CSP7) 2700017M01Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step12.1803.1803.2	3.1962	0.4569	1693.88	1	5000.0%	2	R.LPSRPPLPGSGGSQSGAK.M
UQ91VJ399.5%4418.6%361401496.2(Q91VJ3) Similar to Adenosin kinase 
	TK261102_lung_cytoE18_2_step08.3297.3297.1	1.608	0.0347	1592.66	1	4580.0%	1	R.RTGCTFPEKPDFH.-
*	TK261102_lung_cytoE18_2_step01.5075.5075.3	3.3423	0.4091	3548.14	1	2340.0%	1	K.VEAPQALSENVLFGMGNPLLDISAVVDKDFLDK.Y
	TK261102_lung_cytoE18_2_step08.4284.4284.1	1.5538	0.1932	1259.91	10	4440.0%	1	K.HKELFDELVK.K
*	TK261102_lung_cytoE18_2_step05.0168.0168.1	1.8127	0.0561	1348.69	2	5000.0%	1	K.VAQWLIQEPHK.A
URL15_MOUSE99.5%133518.7%2142466811.1(Q9CZM2) 60S ribosomal protein L15 
	TK261102_lung_cytoE18_2_step10.2712.2712.2	1.3116	0.1343	1565.11	1	4580.0%	2	R.NPDTQWITKPVHK.H
	TK261102_lung_cytoE18_2_step11.1761.1761.2	2.0898	0.4569	1708.64	1	4670.0%	2	K.GATYGKPVHHGVNQLK.F
	TK261102_lung_cytoE18_2_step11.2276.2276.2	2.4367	0.4782	1719.86	1	5000.0%	1	R.RNPDTQWITKPVHK.H
*	TK261102_lung_cytoE18_2_step07.3402.3402.1	1.2302	0.0992	510.58	6	8330.0%	1	K.IHIQ.-
	TK261102_lung_cytoE18_2_step12.0580.0580.1	0.9701	0.2957	725.28	1	5000.0%	4	R.KRPVPK.G
UAAC4_MOUSE99.5%256118.8%9121049775.4(P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) 
	TK261102_lung_cytoE18_2_step07.2497.2497.1	2.0946	0.3576	1327.65	1	5500.0%	3	K.RDHALLEEQSK.Q
	TK261102_lung_cytoE18_2_step11.2604.2604.2	2.4874	0.4671	1569.42	1	6360.0%	1	R.HRPELIEYDKLR.K
*	TK261102_lung_cytoE18_2_step12.5648.5648.2	0.947	0.1662	2715.03	11	1960.0%	1	R.IMSVVDPNHSGLVTFQAFIDFMSR.E
*	TK261102_lung_cytoE18_2_step11.0022.0022.3	1.7549	0.0689	4271.27	2	1500.0%	3	-.MVDYHAANQAYQYGPNSGGGNGAGGGGSMGDYMAQEDDWDR.D
	TK261102_lung_cytoE18_2_step06.5080.5080.1	1.1691	0.0384	1170.78	14	3750.0%	1	K.QQSNEHLRR.Q
	TK261102_lung_cytoE18_2_step08.3461.3461.2	1.8991	0.1862	1463.69	2	5000.0%	4	R.LSNRPAFMPSEGR.M
	TK261102_lung_cytoE18_2_step08.3819.3819.2	2.8866	0.5023	2203.97	1	6050.0%	2	R.ASFNHFDKDHGGALGPEEFK.A
	TK261102_lung_cytoE18_2_step11.1068.1068.1	1.3175	0.4604	705.72	1	7000.0%	3	R.VHKPPK.V
	TK261102_lung_cytoE18_2_step10.2696.2696.1	1.5296	0.2118	1302.73	11	3890.0%	2	R.HRPELIEYDK.L
	TK261102_lung_cytoE18_2_step08.2165.2165.1	1.2231	0.0583	739.56	4	7000.0%	2	R.LPKPER.G
*	TK261102_lung_cytoE18_2_step06.4450.4450.2	1.2407	0.1091	3034.48	11	1610.0%	1	R.MAPYQGPDAAPGALDYKSFSTALYGESDL.-
UQ922D899.5%17598.6%9351012567.1(Q922D8) Similar to C1-tetrahydrofolate synthase 
	TK261102_lung_cytoE18_2_step07.1990.1990.1	1.0397	0.1109	739.8	32	4170.0%	6	R.HAVVVGR.S
	TK261102_lung_cytoE18_2_step11.2894.2894.2	1.8155	0.4459	1533.96	2	4670.0%	1	K.MHGGGPTVTAGLPLPK.A
	TK261102_lung_cytoE18_2_step11.4150.4150.2	2.162	0.2452	2580.21	1	3640.0%	1	K.IVGAPMHDLLLWNNATVTTCHSK.T
	TK261102_lung_cytoE18_2_step10.2316.2316.1	2.2773	0.197	1392.73	1	6360.0%	4	K.THLSLSHNPEQK.G
*	TK261102_lung_cytoE18_2_step06.2678.2678.2	1.1734	0.0843	1204.12	7	4500.0%	1	R.KITIGQSPTEK.G
*	TK261102_lung_cytoE18_2_step07.4016.4016.2	1.132	0.0539	2526.3	2	2050.0%	1	K.THLSLSHNPEQKGVPTGFVLPIR.D
UCALU_MOUSE99.5%61215.9%315370644.7(O35887) Calumenin precursor 
	TK261102_lung_cytoE18_2_step09.3687.3687.2	1.1859	0.0479	2701.06	33	1960.0%	1	K.EEIVDKYDLFVGSQATDFGEALVR.H
	TK261102_lung_cytoE18_2_step09.1943.1943.1	2.6045	0.336	1191.57	1	7780.0%	3	R.VHHEPQLSDK.V
	TK261102_lung_cytoE18_2_step05.4720.4720.2	1.0884	0.0363	1888.0	47	2670.0%	1	K.DWILPSDYDHAEAEAR.H
UGTA4_MOUSE99.5%6205.9%222255647.4(P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4) 
*	TK261102_lung_cytoE18_2_step07.3082.3082.1	1.9263	0.39	1454.74	6	3750.0%	4	R.KPPPDGPYVEVVR.T
UDP30_MOUSE99.5%2416.2%99112134.9(Q99LT0) Dpy-30-like protein 
	TK261102_lung_cytoE18_2_step10.5092.5092.2	3.1417	0.3486	1888.47	1	5000.0%	2	K.ERPPNPIEFLASYLLK.N
UQ9305299.5%352.8%612657467.4(Q93052) LIPOMA PREFERRED partner (LPP) 
*	TK261102_lung_cytoE18_2_step05.4434.4434.1	0.8412	0.1595	1123.45	7	3120.0%	1	K.FAPRCSVCK.E
*	TK261102_lung_cytoE18_2_step10.2255.2255.1	2.4375	0.386	1135.6	1	7140.0%	2	R.DFHVHCYR.C
UGFA1_MOUSE99.5%469.1%680765926.8(P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) 
*	TK261102_lung_cytoE18_2_step09.4286.4286.2	1.1515	0.197	3075.66	1	1920.0%	1	R.NTPVFRDDVCFFISQSGETADTLMGLR.Y
*	TK261102_lung_cytoE18_2_step10.2284.2284.2	2.4358	0.4893	1828.05	1	5000.0%	2	R.WATHGEPNPVNSHPQR.S
	TK261102_lung_cytoE18_2_step06.4168.4168.2	1.3656	0.0651	2220.46	1	2780.0%	1	R.SDKNNEFIVIHNGIITNYK.D
UPYR5_MOUSE99.5%2213.1%481522926.6(P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] 
*	TK261102_lung_cytoE18_2_step06.4785.4785.2	0.8662	0.2059	3125.8	10	1540.0%	1	R.LHAVCTLSQMLEILQQQEKIDADMVGR.V
*	TK261102_lung_cytoE18_2_step11.3797.3797.3	3.265	0.4013	3937.37	1	2140.0%	1	R.VSMKPEFLHLTPGVQLETGGDHLGQQYNSPQEVIGK.R
UARR1_HUMAN99.4%4615.6%418470666.2(P49407) Beta-arrestin 1 (Arrestin, beta 1) 
*	TK261102_lung_cytoE18_2_step09.3129.3129.2	2.0074	0.3484	1699.02	1	4290.0%	2	K.LKHEDTNLASSTLLR.E
*	TK261102_lung_cytoE18_2_step11.1616.1616.2	2.2271	0.3505	2127.09	1	3330.0%	1	R.KVQYAPERPGPQPTAETTR.Q
*	TK261102_lung_cytoE18_2_step11.2950.2950.3	1.6534	0.1752	3411.12	43	1580.0%	1	K.LGEHAYPFTFEIPPNLPCSVTLQPGPEDTGK.A
UQ8R3G199.4%3319.7%351385287.4(Q8R3G1) Similar to protein phosphatase 1, regulatory (Inhibitor) subunit 8 
	TK261102_lung_cytoE18_2_step10.3217.3217.2	2.7271	0.5289	2410.42	1	4290.0%	1	R.LEPHKPQQIPIDSTVSFGASTR.A
	TK261102_lung_cytoE18_2_step05.4365.4365.1	0.7153	0.0827	1187.52	71	2000.0%	1	R.NMVQTAVVPVK.K
*	TK261102_lung_cytoE18_2_step01.3634.3634.3	0.751	0.0011	3734.04	46	500.0%	1	-.MAAAVNSGSSLPLFDCPTWAGKPPPGLHLDVVKGDK.L
URS23_HUMAN99.4%81622.4%1431580810.5(P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23 
	TK261102_lung_cytoE18_2_step11.1914.1914.2	2.755	0.3926	1206.79	1	7270.0%	1	R.KGHAVGDIPGVR.F
	TK261102_lung_cytoE18_2_step07.2490.2490.1	1.8745	0.2495	812.74	2	7140.0%	3	K.AHLGTALK.A
	TK261102_lung_cytoE18_2_step08.2705.2705.1	1.813	0.197	1058.2	1	5500.0%	1	K.ANPFGGASHAK.G
	TK261102_lung_cytoE18_2_step11.1805.1805.1	2.0571	0.4107	940.67	1	5000.0%	2	K.KAHLGTALK.A
	TK261102_lung_cytoE18_2_step06.2909.2909.1	1.1556	0.1019	1078.63	8	4000.0%	1	K.GHAVGDIPGVR.F
UILK_MOUSE99.4%6810.6%452513478.1(O55222) Integrin-linked protein kinase (EC 2.7.1.-) 
	TK261102_lung_cytoE18_2_step08.2573.2573.1	0.7924	0.108	823.22	1	5000.0%	1	K.FALDMAR.G
	TK261102_lung_cytoE18_2_step10.4687.4687.2	2.2729	0.4479	1594.91	1	5770.0%	1	R.GMAFLHTLEPLIPR.H
	TK261102_lung_cytoE18_2_step11.2116.2116.2	2.894	0.5159	1583.98	1	6070.0%	1	R.GDDTPLHLAASHGHR.D
	TK261102_lung_cytoE18_2_step09.1671.1671.2	1.9195	0.1233	1462.09	1	6360.0%	2	K.ICMNEDPAKRPK.F
UFABE_MOUSE99.4%71948.1%135151376.5(Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) 
*	TK261102_lung_cytoE18_2_step12.4936.4936.2	1.7614	0.0666	2455.45	8	2860.0%	1	R.KMAAMAKPDCIITCDGNNITVK.T
*	TK261102_lung_cytoE18_2_step01.2494.2494.1	1.9	0.1721	1501.84	1	5450.0%	1	R.LMESHGFEEYMK.E
*	TK261102_lung_cytoE18_2_step01.2820.2820.1	1.0841	0.072	928.95	9	4380.0%	1	K.ELGVGLALR.K
*	TK261102_lung_cytoE18_2_step05.0140.0140.2	2.903	0.4188	2578.54	1	3810.0%	4	R.KTETVCTFQDGALVQHQQWDGK.E
UO3594599.4%4164.8%501545887.7(O35945) Aldehyde dehydrogenase Ahd-2-like 
*	TK261102_lung_cytoE18_2_step07.3892.3892.2	2.2911	0.3854	2679.33	1	2610.0%	4	K.YILGNPLNSGINQGPQIDKEQHNK.I
USYS_MOUSE99.4%5711.2%511582586.3(P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) 
	TK261102_lung_cytoE18_2_step01.3178.3178.1	1.4479	0.1288	1511.14	6	4090.0%	1	R.DEWLRPEDLPIK.Y
	TK261102_lung_cytoE18_2_step09.4758.4758.2	2.4441	0.509	1694.3	1	4640.0%	1	K.KLDLEAWFPGSGAFR.E
	TK261102_lung_cytoE18_2_step07.1913.1913.1	1.2175	0.0718	787.52	5	6000.0%	2	R.VHQFEK.I
*	TK261102_lung_cytoE18_2_step12.2433.2433.2	0.7613	0.0549	2665.25	62	1090.0%	1	R.EIGNLLHPSVPISNDEDADNKVER.I
UG3PT_HUMAN99.4%113.4%408445018.2(O14556) Putative glyceraldehyde 3-phosphate dehydrogenase, testis-specific (EC 1.2.1.12) (GAPDH-2) 
*	TK261102_lung_cytoE18_2_step01.2584.2584.2	2.86	0.5175	1561.24	1	5770.0%	1	R.VPTPDVSVVDLTCR.L
UQ9CSH099.4%71315.6%588633916.9(Q9CSH0) 2810036L13Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step11.1964.1964.1	0.7424	0.0055	1049.43	9	5000.0%	1	K.LCFSTSSHL.-
	TK261102_lung_cytoE18_2_step07.2416.2416.1	1.8332	0.372	1427.52	1	5000.0%	3	R.SMPLSTEGGGSHHK.V
	TK261102_lung_cytoE18_2_step10.4415.4415.3	1.1028	0.0037	4478.07	41	910.0%	1	R.DTPELVAYPLPQASSSYMHGGSPSGSVVMVSGLHQLKMNCSR.V
	TK261102_lung_cytoE18_2_step06.0190.0190.2	1.0188	0.1353	3068.5	1	1730.0%	1	K.ECVTFAADVPVYIAGQQAFFNYSTSKR.I
UPRS8_HUMAN99.4%81212.1%406456267.5(P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) 
	TK261102_lung_cytoE18_2_step09.2615.2615.1	2.0046	0.2691	1429.71	1	5910.0%	2	R.AVAHHTDCTFIR.V
	TK261102_lung_cytoE18_2_step10.3151.3151.2	2.592	0.4971	1760.83	1	6430.0%	1	R.RVHVTQEDFEMAVAK.V
	TK261102_lung_cytoE18_2_step08.4831.4831.1	2.2548	0.0076	1551.86	2	5000.0%	1	K.HPELFEALGIAQPK.G
	TK261102_lung_cytoE18_2_step06.5154.5154.2	0.8681	0.0494	2458.87	81	1190.0%	1	K.EVIELPVKHPELFEALGIAQPK.G
UQ91ZJ599.4%4412.2%508569797.6(Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2 
*	TK261102_lung_cytoE18_2_step05.0031.0031.1	1.371	0.0227	1586.78	30	2690.0%	1	K.ILTTAASHEFEHTK.K
	TK261102_lung_cytoE18_2_step01.4875.4875.2	1.1738	0.1171	2550.22	87	1590.0%	1	K.AMSQDGASQFQEVILQELELSVK.K
*	TK261102_lung_cytoE18_2_step10.2708.2708.2	2.5386	0.5191	1714.03	1	5000.0%	1	K.ILTTAASHEFEHTKK.D
	TK261102_lung_cytoE18_2_step09.4825.4825.2	1.8733	0.4245	2707.22	1	2830.0%	1	R.RFESIPDMLELDHLTVSGDVTFGK.N
URL2A_MOUSE99.4%101826.5%1471645811.1(P14115) 60S ribosomal protein L27a (L29) 
	TK261102_lung_cytoE18_2_step09.1830.1830.1	1.3245	0.1312	685.64	38	6000.0%	2	K.QPVIVK.A
	TK261102_lung_cytoE18_2_step12.0992.0992.1	1.6009	0.4565	945.63	1	5620.0%	2	R.GHVSHGHGR.I
	TK261102_lung_cytoE18_2_step12.1108.1108.2	1.7878	0.1256	1075.44	3	5560.0%	1	R.GNAGGMHHHR.I
	TK261102_lung_cytoE18_2_step08.3209.3209.1	1.1575	0.0361	970.61	3	5000.0%	2	K.YHPGYFGK.V
	TK261102_lung_cytoE18_2_step11.1036.1036.1	1.237	0.2276	651.67	8	6000.0%	1	R.KHPGGR.G
USPS1_HUMAN99.4%359.9%383422686.4(P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1) 
	TK261102_lung_cytoE18_2_step06.5250.5250.3	1.9702	0.2865	4268.62	1	1490.0%	1	R.LGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGR.I
	TK261102_lung_cytoE18_2_step06.5250.5250.2	2.5613	0.5062	2846.08	1	3540.0%	2	R.HGGLSLVQTTDYIYPIVDDPYMMGR.I
UQ91Y3899.4%462.8%10461169806.7(Q91Y38) UDP-N-acetylglucosaminyltransferase 
	TK261102_lung_cytoE18_2_step12.2036.2036.1	1.2785	0.3162	1575.71	3	2920.0%	2	K.INVLHKPPYEHPK.D
	TK261102_lung_cytoE18_2_step05.3400.3400.2	0.9659	0.0891	1591.77	7	2670.0%	1	-.MASSVGNVADSTEPTK.R
UVAA1_MOUSE99.4%6811.7%617682685.9(P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) 
	TK261102_lung_cytoE18_2_step06.0059.0059.1	1.4622	0.2454	1308.8	9	4090.0%	1	R.VGHSELVGEIIR.L
*	TK261102_lung_cytoE18_2_step05.3444.3444.1	1.0359	0.1029	1121.6	55	3120.0%	2	R.EHMGEILYK.L
*	TK261102_lung_cytoE18_2_step11.5518.5518.3	1.1725	0.1436	4185.92	6	720.0%	1	R.TGKPRSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.G
	TK261102_lung_cytoE18_2_step11.2258.2258.2	2.2298	0.4563	1317.6	1	7270.0%	1	K.LPANHPLLTGQR.V
UQ9CWI499.4%247.4%312349088.2(Q9CWI4) Esterase 10 
	TK261102_lung_cytoE18_2_step01.4527.4527.2	2.8905	0.5257	2728.68	1	3410.0%	2	R.MYSYVTEELPQLINANFPVDPQR.M
UQ9CPS099.4%245.0%357382497.0(Q9CPS0) Sorbitol dehydrogenase 1 
*	TK261102_lung_cytoE18_2_step11.2740.2740.2	2.2668	0.554	2128.17	1	5000.0%	2	K.MHSVGICGSDVHYWEHGR.I
UQ9CXZ299.4%126213.5%163174037.1(Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence 
	TK261102_lung_cytoE18_2_step01.2167.2167.1	1.6927	0.2075	890.64	1	5620.0%	3	K.AAVSGLWGK.V
	TK261102_lung_cytoE18_2_step01.0195.0195.1	1.1907	0.0844	1290.15	14	3330.0%	7	K.VNADEVGGEALGR.L
UQ9CV3199.4%245.6%284321105.0(Q9CV31) 2310014J01Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step06.3637.3637.1	2.3418	0.4185	1568.01	1	4670.0%	2	K.HGGGGIVANLSEQSLK.D
USPCB_MOUSE99.4%663.7%21282452485.3(P15508) Spectrin beta chain, erythrocyte (Beta-I spectrin) 
	TK261102_lung_cytoE18_2_step08.3323.3323.2	2.9658	0.5287	1931.73	1	5000.0%	1	R.VHLENMGSHDIVDGNHR.L
	TK261102_lung_cytoE18_2_step09.3255.3255.1	1.5476	0.0908	1257.36	9	5000.0%	1	K.HRPDLIDFDK.L
*	TK261102_lung_cytoE18_2_step08.4903.4903.2	1.1294	0.1983	2718.5	1	2270.0%	1	K.QIFQEADDMVAQKQFGHPQIETR.V
*	TK261102_lung_cytoE18_2_step01.1602.1602.1	0.6656	0.0237	520.54	15	5000.0%	1	R.SGEVK.Q
*	TK261102_lung_cytoE18_2_step09.1507.1507.1	1.0892	0.0883	544.57	10	6250.0%	1	K.QLAGR.A
*	TK261102_lung_cytoE18_2_step12.2689.2689.3	1.4597	0.0174	2000.68	362	2210.0%	1	R.ETGAIGQERVDNVTIIER.L
UALFA_HUMAN99.4%7373.3%363392898.1(P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1) 
*	TK261102_lung_cytoE18_2_step07.2902.2902.1	1.624	0.3379	1436.78	4	5000.0%	6	-.PYQYPALTPEQK.K
UASSY_MOUSE99.4%102015.8%412465858.2(P16460) Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) 
	TK261102_lung_cytoE18_2_step06.1885.1885.1	1.4619	0.1909	919.61	1	5620.0%	1	K.YVSHGATGK.G
	TK261102_lung_cytoE18_2_step01.0116.0116.1	0.9143	0.059	858.76	1	6430.0%	1	K.IKQGLGLK.F
	TK261102_lung_cytoE18_2_step09.1623.1623.1	0.8404	0.0329	524.48	4	7500.0%	2	K.HGVGR.I
	TK261102_lung_cytoE18_2_step09.2878.2878.1	1.1738	0.1633	1188.68	5	4000.0%	3	K.QHGIPIPVTPK.S
	TK261102_lung_cytoE18_2_step09.4633.4633.2	2.7586	0.5046	2375.18	1	4170.0%	1	K.FAELVYTGFWHSPECEFVR.H
*	TK261102_lung_cytoE18_2_step01.3119.3119.1	1.4684	0.3743	1461.95	3	3330.0%	2	K.APNSPDVLEIEFK.K
UQ9CRY599.4%2215.5%251294695.2(Q9CRY5) 3010001M15Rik protein (Fragment) 
*	TK261102_lung_cytoE18_2_step11.2010.2010.2	0.9539	0.118	2033.01	6	2670.0%	1	K.REGIDPAPYYWYTDQR.K
*	TK261102_lung_cytoE18_2_step09.5006.5006.2	2.9514	0.5119	2790.36	1	3860.0%	1	R.HLAEFTHVEAECPFLTFEDLLNR.L
UQ9DC4999.4%115.1%2352510410.3(Q9DC49) Repeat family 3 gene 
	TK261102_lung_cytoE18_2_step01.2847.2847.1	2.1487	0.4067	1465.1	1	6360.0%	1	K.SPYQEFTDHLVK.T
UQ99J1099.4%114.0%420438238.1(Q99J10) Hypothetical 43.8 kDa protein 
*	TK261102_lung_cytoE18_2_step12.1871.1871.2	2.715	0.5122	1706.44	1	5000.0%	1	R.LALAPAAKPPPPGTCSR.C
UANX4_MOUSE99.4%5713.5%318358595.6(P97429) Annexin A4 (Annexin IV) 
	TK261102_lung_cytoE18_2_step11.3633.3633.1	2.1049	0.4029	1416.7	1	6000.0%	2	R.NHLLHVFDEYK.R
	TK261102_lung_cytoE18_2_step09.0891.0891.1	0.4123	0.2109	453.51	2	6670.0%	1	R.ASFK.R
	TK261102_lung_cytoE18_2_step06.5516.5516.2	1.4741	0.2914	3085.38	1	2500.0%	1	K.SELSSNFEQVILGLMTPTVLYDVQELR.R
	TK261102_lung_cytoE18_2_step11.3512.3512.2	1.8455	0.0609	1573.66	1	7270.0%	1	R.NHLLHVFDEYKR.I
UO5520199.4%463.7%10821206645.0(O55201) Chromatin structural protein homolog Supt5hp (Similar to suppressor of Ty (S.cerevisiae) 5 homolog) 
	TK261102_lung_cytoE18_2_step07.2044.2044.1	1.0599	0.0553	802.59	17	5000.0%	1	K.VILGEDR.E
*	TK261102_lung_cytoE18_2_step06.3717.3717.2	1.2005	0.0889	2059.08	278	2060.0%	1	K.DNRFAVALDSDQNNIHVK.D
	TK261102_lung_cytoE18_2_step09.2137.2137.2	2.3944	0.516	1653.63	1	4290.0%	2	R.TPHYGSQTPLHDGSR.T
UQ9CT1099.4%6634.2%333358705.0(Q9CT10) 2610024N24Rik protein (Fragment) 
*	TK261102_lung_cytoE18_2_step05.0298.0298.2	2.56	0.5169	3127.16	1	2960.0%	1	K.TPHGTSEEGHCEEEQAAPQAFVFGQNLR.D
	TK261102_lung_cytoE18_2_step08.3525.3525.1	1.4903	0.2266	1381.68	5	4090.0%	1	K.DTGQLYAALHHR.I
*	TK261102_lung_cytoE18_2_step09.1524.1524.1	0.864	0.0113	1224.59	397	2270.0%	1	K.ESPAESAAAYTK.A
*	TK261102_lung_cytoE18_2_step05.5048.5048.2	1.0432	0.0162	1906.64	101	2060.0%	1	R.AEQEQEAKAPPPEPGATR.A
	TK261102_lung_cytoE18_2_step11.2164.2164.2	0.9589	0.0533	2315.88	60	2000.0%	1	K.VFLISASSKDTGQLYAALHHR.I
*	TK261102_lung_cytoE18_2_step06.0830.0830.3	1.6162	0.1869	4278.89	1	1480.0%	1	K.APPPEPGATRATEEEDSDEDAVLAPPGVTGAGTGDEGDGQAPGST.-
UO3573799.4%5910.0%449491996.3(O35737) Heterogeneous nuclear ribonucleoprotein H 
	TK261102_lung_cytoE18_2_step06.2917.2917.2	2.3385	0.5099	2100.07	1	4440.0%	2	R.YGDGGSTFQSTTGHCVHMR.G
	TK261102_lung_cytoE18_2_step05.3821.3821.1	1.118	0.2906	1094.9	2	3330.0%	2	R.VHIEIGPDGR.V
	TK261102_lung_cytoE18_2_step10.1676.1676.2	1.1751	0.0258	1683.85	3	4000.0%	1	K.HTGPNSPDTANDGFVR.L
URBB4_MOUSE99.4%2210.2%461517715.1(Q60972) Chromatin assembly factor 1 subunit C (CAF-1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF-I 48 kDa subunit) (CAF-Ip48) (Retinoblastoma binding protein p48) (Retinoblastoma-binding protein 4) (RBBP-4) 
	TK261102_lung_cytoE18_2_step11.3632.3632.3	3.1897	0.4397	3598.42	1	1920.0%	1	K.LHSFESHKDEIFQVQWSPHNETILASSGTDR.R
	TK261102_lung_cytoE18_2_step10.1779.1779.2	2.3847	0.3401	1807.5	1	4670.0%	1	K.HPSKPDPSGECNPDLR.L
UQ96A9099.4%3912.0%217235738.5(Q96A90) G6b-C protein precursor 
*	TK261102_lung_cytoE18_2_step11.4948.4948.3	2.203	0.2034	3012.07	1	2300.0%	3	R.FDHSLDLLCPPHIAPLVKTEPQRPVK.E
UMCM2_MOUSE99.4%667.6%9041020475.8(P97310) DNA replication licensing factor MCM2 
	TK261102_lung_cytoE18_2_step04.0424.0424.3	1.3368	0.0062	1652.1	12	2880.0%	1	R.HIESMIRMAEAHAR.M
*	TK261102_lung_cytoE18_2_step08.2459.2459.3	1.8527	0.0187	1947.67	89	2330.0%	1	R.VMMESFIDTQKFSVMR.S
	TK261102_lung_cytoE18_2_step06.3060.3060.1	1.262	0.1702	885.55	6	6670.0%	1	R.HIESMIR.M
	TK261102_lung_cytoE18_2_step11.1776.1776.1	1.345	0.1709	989.72	19	5000.0%	1	R.ITNHIHVR.I
	TK261102_lung_cytoE18_2_step11.1746.1746.1	2.0339	0.3955	1378.6	1	5450.0%	1	R.THVDSHGHNVFK.E
*	TK261102_lung_cytoE18_2_step05.0228.0228.2	0.8086	0.0161	2250.87	1	1940.0%	1	K.ARQINIHNLSAFYDSDLFK.F
UO7014099.4%5922.7%247283187.8(O70140) Calcyclin binding protein (Fragment) 
*	TK261102_lung_cytoE18_2_step06.3864.3864.2	2.9532	0.4276	2444.81	1	4550.0%	2	K.KPELDNEKPAAVVAPLTTGYTVK.I
	TK261102_lung_cytoE18_2_step10.3959.3959.2	2.7424	0.5225	2683.16	1	3640.0%	2	K.IYITLTGVHQVPTENVQVHFTER.S
	TK261102_lung_cytoE18_2_step04.0808.0808.1	0.5903	0.0045	1206.48	152	2220.0%	1	R.TINKAWVESR.E
UQ9EPX199.4%113.6%687779946.1(Q9EPX1) Thimet oligopeptidase (EC 3.4.24.15) 
*	TK261102_lung_cytoE18_2_step10.3092.3092.2	2.3258	0.5042	2535.98	1	3750.0%	1	-.MKPPAACAGDVVDAASPASTVNHLR.W
UQ9CZB799.4%2216.3%313343578.3(Q9CZB7) Protein kinase, interferon inducible double stranded RNA dependent activator 
	TK261102_lung_cytoE18_2_step01.4906.4906.3	0.9086	0.0207	3624.33	3	1210.0%	1	K.FLAKFSNISPENHISLTNVVGHSLGCTWHSLR.N
	TK261102_lung_cytoE18_2_step11.4540.4540.2	2.5694	0.5323	2184.49	1	5000.0%	1	K.NQLNPIGSLQELAIHHGWR.L
UO0879599.4%244.0%521587934.5(O08795) Alpha glucosidase II, beta subunit 
	TK261102_lung_cytoE18_2_step09.3515.3515.2	2.6834	0.5268	2151.01	1	4500.0%	2	K.HGGSPTSLGTWGSWAGPDHDK.F
UQ924X999.4%4412.2%9341005085.0(Q924X9) Type II cAMP-dependent protein kinase anchoring protein Ht31 (Fragment) 
*	TK261102_lung_cytoE18_2_step07.2237.2237.1	2.3901	0.3916	1566.76	1	5000.0%	1	R.HSSHGSDVSLPQTSK.L
*	TK261102_lung_cytoE18_2_step06.4686.4686.3	1.1755	0.0212	2869.47	84	1560.0%	1	R.ESWCAIEPCPEAASLLASKQSSECR.S
*	TK261102_lung_cytoE18_2_step11.2965.2965.3	1.5178	0.0286	3449.08	1	1830.0%	1	R.ESESEPAGSGEMEEEEMDSITEVPANCSFLR.S
*	TK261102_lung_cytoE18_2_step06.1284.1284.3	1.0256	0.0834	4691.41	55	890.0%	1	K.SISLMTISHPGLDSSRPFHSTSANLTESITEENCNFLPPSPSK.K
USYG_MOUSE99.4%7910.3%729818786.7(Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) 
	TK261102_lung_cytoE18_2_step07.1962.1962.1	1.3972	0.1536	897.53	1	5710.0%	1	K.TPHTATLR.D
	TK261102_lung_cytoE18_2_step10.2732.2732.2	3.0618	0.4692	1450.56	1	6670.0%	2	K.VPLVAEKPLKEPK.T
*	TK261102_lung_cytoE18_2_step10.2488.2488.2	1.1068	0.2118	1612.73	110	3080.0%	1	R.QIRAEVSELPNVVR.D
	TK261102_lung_cytoE18_2_step01.3383.3383.2	0.9854	0.2515	1626.18	8	3080.0%	1	K.TSYGWIEIVGCADR.S
	TK261102_lung_cytoE18_2_step11.4738.4738.2	0.8759	0.2669	2682.63	1	1400.0%	1	R.LLSAPAQPAASRSSMDSAEELLAPLR.L
UQ91YL699.4%4422.3%300340484.8(Q91YL6) Hypothetical 34.0 kDa protein 
*	TK261102_lung_cytoE18_2_step09.3045.3045.2	2.8596	0.4945	2261.77	1	3680.0%	1	R.LAAAEQYHQILCPGPSHDPR.H
*	TK261102_lung_cytoE18_2_step07.2272.2272.1	1.3806	0.067	955.53	2	6670.0%	1	K.DKDHWVR.L
*	TK261102_lung_cytoE18_2_step10.3912.3912.2	0.7848	0.0192	2850.06	2	2080.0%	1	R.LAAAEQYHQILCPGPSHDPRHPLNK.L
*	TK261102_lung_cytoE18_2_step12.2193.2193.3	0.9493	0.0551	3732.95	98	810.0%	1	R.SLFALVGTNGQGIGTSSLSQWVHACDALELTPQDR.E
USNXC_MOUSE99.4%4166.7%165191167.3(O70493) Sorting nexin 12 (SDP8 protein) 
	TK261102_lung_cytoE18_2_step07.2130.2130.1	2.0501	0.2786	1207.64	1	5000.0%	4	K.IAGHPLAQNER.C
UQ99PG299.4%112.1%633706794.8(Q99PG2) Opioid growth factor receptor 
	TK261102_lung_cytoE18_2_step12.1649.1649.1	2.3739	0.3903	1590.99	1	5420.0%	1	R.FHNLNSHSHNNLR.I
UTAL1_MOUSE99.3%7217.4%337373877.0(Q93092) Transaldolase (EC 2.2.1.2) 
	TK261102_lung_cytoE18_2_step06.3666.3666.1	2.4477	0.3027	1441.75	1	6360.0%	4	R.ILDWHVANTDKK.S
	TK261102_lung_cytoE18_2_step11.1286.1286.1	0.9256	0.0088	570.79	19	6250.0%	2	K.KIPGR.V
*	TK261102_lung_cytoE18_2_step01.1888.1888.1	0.8266	0.1552	798.88	2	5710.0%	1	K.LAPALSVK.A
UPPI2_MOUSE99.3%71320.4%270313566.9(P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) 
	TK261102_lung_cytoE18_2_step12.2213.2213.2	1.7873	0.3334	1025.81	1	6880.0%	1	K.RGPLGPNWK.K
	TK261102_lung_cytoE18_2_step06.2645.2645.1	1.4743	0.1275	888.53	4	6670.0%	2	K.IYHLKSK.V
	TK261102_lung_cytoE18_2_step09.4041.4041.2	2.1575	0.5043	2801.41	1	2610.0%	2	K.IETWHKPDLGTLENVHGLDPNTWK.T
	TK261102_lung_cytoE18_2_step11.2120.2120.2	0.9635	0.2237	1863.47	91	2500.0%	2	R.TIVTNEYMKDDFFIK.I
URS4_HUMAN99.3%143417.2%2622946710.2(P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) 
	TK261102_lung_cytoE18_2_step07.3550.3550.1	1.0078	0.1014	829.49	3	6000.0%	1	K.HWMLDK.L
	TK261102_lung_cytoE18_2_step12.2097.2097.1	1.4224	0.1021	1509.1	1	4170.0%	3	R.ERHPGSFDVVHVK.D
	TK261102_lung_cytoE18_2_step11.2213.2213.1	1.4951	0.2382	1217.08	5	4500.0%	1	K.GIPHLVTHDAR.T
	TK261102_lung_cytoE18_2_step10.3404.3404.1	1.0888	0.0107	1168.85	4	4440.0%	4	K.GNKPWISLPR.G
	TK261102_lung_cytoE18_2_step12.2228.2228.1	1.4768	0.3818	1221.99	1	6500.0%	2	R.HPGSFDVVHVK.D
	TK261102_lung_cytoE18_2_step08.2349.2349.1	0.8577	0.0144	629.76	12	7500.0%	1	R.FAVHR.I
URL7A_MOUSE99.3%133723.4%2652984510.6(P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) 
	TK261102_lung_cytoE18_2_step10.4208.4208.2	1.3699	0.1796	1811.3	49	2670.0%	1	R.LKVPPAINQFTQALDR.Q
	TK261102_lung_cytoE18_2_step12.2324.2324.1	1.2789	0.2836	1222.75	10	4500.0%	2	R.RHWGGNVLGPK.S
	TK261102_lung_cytoE18_2_step01.1444.1444.1	1.3813	0.0896	851.47	3	5620.0%	1	K.VAPAPAVVK.K
	TK261102_lung_cytoE18_2_step04.0092.0092.2	1.9059	0.0199	1218.37	30	5500.0%	1	K.NFGIGQDIQPK.R
	TK261102_lung_cytoE18_2_step11.1736.1736.1	0.9436	9.0E-4	737.71	10	5000.0%	2	K.RPPVLR.A
	TK261102_lung_cytoE18_2_step06.3686.3686.1	1.3763	0.1828	1073.78	1	6880.0%	1	K.KVVNPLFEK.R
	TK261102_lung_cytoE18_2_step10.2831.2831.1	2.1638	0.3895	1066.68	2	5560.0%	5	R.HWGGNVLGPK.S
UCAN2_MOUSE99.3%112110.7%700798725.0(O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80) 
*	TK261102_lung_cytoE18_2_step06.4480.4480.2	1.1604	0.0353	1912.75	4	3120.0%	1	K.LPPGEYVLVPSTFEPHK.D
	TK261102_lung_cytoE18_2_step06.0124.0124.2	2.4665	0.4263	2004.08	1	4120.0%	3	K.RPTEICADPQFIIGGATR.T
*	TK261102_lung_cytoE18_2_step05.3648.3648.2	1.0908	0.113	1412.64	2	3750.0%	1	K.IMVDMLDEDGSGK.L
*	TK261102_lung_cytoE18_2_step06.4789.4789.2	1.0279	0.1658	2776.19	1	2170.0%	1	K.LPPGEYVLVPSTFEPHKDGDFCIR.V
*	TK261102_lung_cytoE18_2_step07.4314.4314.2	1.182	0.0193	2278.31	10	2110.0%	1	K.ALEEAGFKLPCQLHQVIVAR.F
*	TK261102_lung_cytoE18_2_step11.2640.2640.2	2.4142	0.2168	1434.8	1	6820.0%	2	K.LPCQLHQVIVAR.F
UQ9CXT499.3%127015.5%200231614.4(Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence 
	TK261102_lung_cytoE18_2_step01.2219.2219.1	1.54	0.1126	1016.99	1	6250.0%	1	K.DLSTIEPLK.K
	TK261102_lung_cytoE18_2_step07.2369.2369.1	1.9096	0.3863	884.58	1	6430.0%	8	K.HLNLSGNK.I
	TK261102_lung_cytoE18_2_step04.0632.0632.1	1.766	0.3265	990.71	1	6430.0%	2	K.KLELSENR.I
	TK261102_lung_cytoE18_2_step06.2468.2468.1	1.4924	0.0123	745.57	1	8000.0%	1	K.KLENLK.S
UPDX5_MOUSE99.3%1613028.6%210218978.9(P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) 
	TK261102_lung_cytoE18_2_step07.4512.4512.1	2.0435	0.3024	1062.76	1	6880.0%	2	K.KVNLAELFK.G
	TK261102_lung_cytoE18_2_step08.3208.3208.3	1.9707	0.0993	2348.01	25	2380.0%	1	K.GAQVVACLSVNDVFVIEEWGR.A
	TK261102_lung_cytoE18_2_step01.3544.3544.1	1.1918	0.0351	1596.77	13	3000.0%	2	K.GVLFGVPGAFTPGCSK.T
	TK261102_lung_cytoE18_2_step05.0243.0243.1	1.1091	0.1172	1471.25	28	1920.0%	11	K.THLPGFVEQAGALK.A
UG3P1_HUMAN99.3%356.9%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) 
*	TK261102_lung_cytoE18_2_step01.1827.1827.1	2.0719	0.3805	1371.71	1	5000.0%	2	R.GAAQNLIPASTGAAK.A
*	TK261102_lung_cytoE18_2_step01.1843.1843.1	1.0743	0.098	870.87	3	5710.0%	1	K.VIPELDGK.L
UAPA1_MOUSE99.3%91515.9%264305875.9(Q00623) Apolipoprotein A-I precursor (Apo-AI) 
*	TK261102_lung_cytoE18_2_step06.2366.2366.1	2.0442	0.3914	1297.75	1	5500.0%	1	R.TQLAPHSEQMR.E
*	TK261102_lung_cytoE18_2_step04.0123.0123.2	1.7812	0.276	828.16	1	6670.0%	1	R.THVDSLR.T
*	TK261102_lung_cytoE18_2_step05.0130.0130.1	1.3535	0.0845	1237.74	10	4380.0%	1	K.WKEDVELYR.Q
	TK261102_lung_cytoE18_2_step08.1577.1577.1	0.8981	0.0037	498.68	5	5000.0%	1	K.THLK.T
*	TK261102_lung_cytoE18_2_step08.4803.4803.1	1.957	0.3224	1302.98	1	5000.0%	3	R.HSLMPMLETLK.T
UDAG1_MOUSE99.3%241.1%893969058.4(Q62165) Dystroglycan precursor (Dystrophin-associated glycoprotein 1) [Contains: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)] 
	TK261102_lung_cytoE18_2_step06.3097.3097.1	1.8908	0.3849	1279.53	1	5560.0%	2	K.HEYFMHATDK.G
UGTT1_MOUSE99.3%51115.1%239272457.3(Q64471) Glutathione S-transferase theta 1 (EC 2.5.1.18) (GST class-theta) 
*	TK261102_lung_cytoE18_2_step08.3349.3349.1	2.0306	0.3563	1232.77	1	4000.0%	3	R.KGEHLSDAFAR.V
*	TK261102_lung_cytoE18_2_step08.3909.3909.2	2.4342	0.4918	1919.13	1	5360.0%	1	K.YKVPDHWYPQDLQAR.A
*	TK261102_lung_cytoE18_2_step07.2896.2896.1	1.3393	0.0365	1143.72	5	5000.0%	1	K.DCPPADLIIK.Q
UPSE1_MOUSE99.3%2213.3%249286736.0(P97371) Proteasome activator complex subunit 1 (Proteasome activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) 
	TK261102_lung_cytoE18_2_step01.2804.2804.1	1.7808	0.3883	1519.57	3	3460.0%	1	K.APLDIPVPDPVKEK.E
	TK261102_lung_cytoE18_2_step06.3593.3593.3	2.1299	0.2361	2154.25	3	2220.0%	1	K.GPPCGPVNCNEKIVVLLQR.L
UEF1G_MOUSE99.3%81215.1%437500616.7(Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) 
	TK261102_lung_cytoE18_2_step05.0356.0356.1	1.4245	0.1016	1242.63	4	4440.0%	1	K.STFVLDEFKR.K
	TK261102_lung_cytoE18_2_step12.2967.2967.2	2.3825	0.4923	1709.05	1	5000.0%	2	R.VLSAPPHFHFGQTNR.T
	TK261102_lung_cytoE18_2_step01.4712.4712.3	1.3978	0.1009	2703.55	38	1560.0%	1	R.KNAFASVILFGTNNSSSISGVWVFR.G
	TK261102_lung_cytoE18_2_step08.2299.2299.1	1.1952	0.0906	647.62	1	7000.0%	1	R.KFPAGK.V
	TK261102_lung_cytoE18_2_step11.2198.2198.1	1.5233	0.1319	1125.5	12	3890.0%	2	K.AKDPFAHLPK.S
UQ9DCC499.3%359.1%274286947.3(Q9DCC4) 1110058B13Rik protein 
	TK261102_lung_cytoE18_2_step10.1683.1683.1	1.4528	0.1017	721.62	1	7000.0%	1	K.HPAQLR.T
	TK261102_lung_cytoE18_2_step08.4215.4215.2	2.7635	0.4459	2003.05	1	4440.0%	2	R.TDVLTPAGTTIHGLHALER.G
UCO3_MOUSE99.2%11178.7%16631864826.8(P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] 
*	TK261102_lung_cytoE18_2_step12.3152.3152.2	1.4708	0.1172	2372.65	93	1670.0%	1	R.IILQGSPVVQMAEDAVDGERLK.H
*	TK261102_lung_cytoE18_2_step01.1902.1902.1	1.3913	0.153	880.77	3	5710.0%	1	R.DHVLGLAR.S
*	TK261102_lung_cytoE18_2_step06.3110.3110.1	2.1923	0.2875	1566.82	1	5000.0%	1	R.FYHPEKDDGMLSK.L
*	TK261102_lung_cytoE18_2_step04.4200.4200.2	0.9458	0.1959	3009.43	2	1670.0%	1	R.IFTVDNNLLPVGKTVVILIETPDGIPVK.R
*	TK261102_lung_cytoE18_2_step11.4712.4712.2	1.6181	0.2919	2388.04	1	3330.0%	1	R.SHFPQSWLWTIEELKEPEK.N
*	TK261102_lung_cytoE18_2_step08.4255.4255.2	2.5665	0.412	1898.07	1	5330.0%	3	R.MELKPGDNLNVNFHLR.T
*	TK261102_lung_cytoE18_2_step09.1828.1828.1	1.0212	0.0277	1020.43	7	4290.0%	1	R.RSVQLMER.R
*	TK261102_lung_cytoE18_2_step11.1977.1977.1	1.4184	0.0854	872.59	21	5830.0%	1	R.KFISHIK.C
*	TK261102_lung_cytoE18_2_step06.0539.0539.2	1.6407	0.196	2586.66	1	2730.0%	1	K.QKPDGVFQEDGPVIHQEMIGGFR.N
UQ8TE4499.2%224.3%4404629810.9(Q8TE44) WIRE protein 
*	TK261102_lung_cytoE18_2_step09.2330.2330.1	0.9363	0.0095	763.59	4	6000.0%	1	R.HNSLHR.K
*	TK261102_lung_cytoE18_2_step12.1212.1212.1	1.6319	0.3814	1283.88	1	5000.0%	1	K.HSSSAPPPPPPGR.R
UQ9Y6Y899.1%352.3%10001110765.5(Q9Y6Y8) Phospholipase 
*	TK261102_lung_cytoE18_2_step12.1836.1836.1	1.4394	0.1935	931.02	2	5830.0%	2	K.QLHFQEK.Q
*	TK261102_lung_cytoE18_2_step10.3465.3465.2	3.0812	0.4403	1855.44	1	6330.0%	1	R.RLEFPSGETIVMHNPK.V
UPHS2_MOUSE99.1%337.2%842972867.1(Q9WUB3) Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) 
*	TK261102_lung_cytoE18_2_step12.2137.2137.3	1.196	0.0391	2192.5	1	2640.0%	1	R.IPELRQIIEQLSSGFFSPK.Q
	TK261102_lung_cytoE18_2_step09.4682.4682.2	0.8469	0.0244	3156.42	1	1670.0%	1	R.TNFDAFPDKVAIQLNDTHPSLAIPELMR.I
*	TK261102_lung_cytoE18_2_step12.3755.3755.2	3.0749	0.4365	1690.73	1	6150.0%	1	K.ARPEFTLPVHFYGR.V
US108_MOUSE99.1%4659.1%88101635.7(P27005) Calgranulin A (Migration inhibitory factor-related protein 8) (MRP-8) (P8) (Leukocyte L1 complex light chain) (Chemotactic cytokine CP-10) (PRO-inflammatory S100 cytokine) 
*	TK261102_lung_cytoE18_2_step08.5615.5615.2	0.8455	0.0107	3108.43	40	1480.0%	1	R.ELDINSDNAINFEEFLAMVIKVGVASHK.D
*	TK261102_lung_cytoE18_2_step11.3940.3940.2	2.6316	0.4321	2787.61	1	3040.0%	2	K.ALSNLIDVYHNYSNIQGNHHALYK.N
UARS1_MOUSE99.1%3315.8%348388234.9(O54984) Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) 
	TK261102_lung_cytoE18_2_step11.2910.2910.1	1.5873	0.4045	1074.98	1	5620.0%	1	K.LPLLPHEVR.G
	TK261102_lung_cytoE18_2_step07.2189.2189.2	1.1297	0.055	2822.11	1	2730.0%	1	K.DPEQTTFICVCIAEFLSLYETER.L
	TK261102_lung_cytoE18_2_step09.5613.5613.2	0.7472	0.142	2594.25	57	910.0%	1	K.MMQEAMSAFPGIDEAMSYAEVMR.L
UQ91V3199.1%3325.4%295328384.9(Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence) 
	TK261102_lung_cytoE18_2_step06.4886.4886.2	1.0463	0.1629	2906.96	4	1880.0%	1	R.YVDIAIPCNNKGAHSVGLMWWMLAR.E
	TK261102_lung_cytoE18_2_step09.4325.4325.2	3.0492	0.4591	2621.04	1	3180.0%	1	K.FLAAGTHLGGTNLDFQMEQYIYK.R
	TK261102_lung_cytoE18_2_step01.3748.3748.2	2.3145	0.3419	3000.85	2	2310.0%	1	R.ADHQPLTEASYVNLPTIALCNTDSPLR.Y
UTAG2_MOUSE99.1%3317.9%212235977.1(Q9WVA4) Transgelin 2 
	TK261102_lung_cytoE18_2_step01.3739.3739.1	1.3274	0.1565	1594.98	5	3460.0%	1	R.DDGLFSGDPNWFPK.K
	TK261102_lung_cytoE18_2_step06.1912.1912.1	0.8833	0.0394	665.54	116	3750.0%	1	R.ENFQK.W
	TK261102_lung_cytoE18_2_step11.5094.5094.2	2.707	0.4882	2397.27	1	4440.0%	1	K.QYDADLEQILIQWITTQCR.E
UQ8R2Y699.1%5715.9%320354248.1(Q8R2Y6) Hypothetical 35.4 kDa protein 
	TK261102_lung_cytoE18_2_step09.2231.2231.2	2.6481	0.4846	1295.96	1	5910.0%	1	R.VLSTVHTHSSVK.N
	TK261102_lung_cytoE18_2_step05.0731.0731.3	1.3383	0.051	3739.53	24	1360.0%	1	R.SPWLVGNELTVADVVLWSVLQQTGGSSGAAPTNVQR.W
	TK261102_lung_cytoE18_2_step01.3267.3267.3	0.997	0.0242	4165.87	29	1050.0%	1	R.SPWLVGNELTVADVVLWSVLQQTGGSSGAAPTNVQRWLK.S
UQ921M599.1%224.4%10801201496.5(Q921M5) Unknown (Protein for IMAGE:3597757) (Fragment) 
*	TK261102_lung_cytoE18_2_step12.1771.1771.2	2.6681	0.4846	2112.66	1	3950.0%	1	K.HASSGSTVHIHPQAAPVVCR.H
	TK261102_lung_cytoE18_2_step12.5565.5565.2	0.8785	0.0166	3040.31	16	1540.0%	1	R.TVLNQILRQSTTHLADGPFAVLVDYIR.V
UTCTP_MOUSE99.1%3321.5%172194624.9(P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein) 
*	TK261102_lung_cytoE18_2_step06.2126.2126.1	2.2832	0.0959	1213.65	1	6110.0%	1	K.GKLEEQKPER.V
*	TK261102_lung_cytoE18_2_step01.3598.3598.2	2.6827	0.478	1696.73	1	6540.0%	1	R.DLISHDELFSDIYK.I
	TK261102_lung_cytoE18_2_step07.3437.3437.1	1.5558	0.1143	1420.91	3	5000.0%	1	R.VKPFMTGAAEQIK.H
UPHS3_HUMAN99.1%81012.2%843966966.9(P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) 
*	TK261102_lung_cytoE18_2_step05.0468.0468.3	1.4384	0.0221	2358.14	150	1900.0%	1	K.LIIKLVTSIGDVVNHDPVVGDR.L
*	TK261102_lung_cytoE18_2_step11.3136.3136.2	2.8554	0.3014	2020.96	1	5000.0%	1	R.INMAHLCVIGSHAVNGVAR.I
*	TK261102_lung_cytoE18_2_step11.3692.3692.2	2.6946	0.4648	1736.82	1	5770.0%	1	K.ARPEYMLPVHFYGR.V
*	TK261102_lung_cytoE18_2_step05.2666.2666.1	1.5866	0.1907	825.52	3	6670.0%	1	R.IHSEIVK.Q
*	TK261102_lung_cytoE18_2_step10.3633.3633.1	2.081	0.3321	1372.13	1	5000.0%	2	R.HLEIIYAINQR.H
*	TK261102_lung_cytoE18_2_step12.0038.0038.2	1.1047	0.1669	2879.16	42	1300.0%	1	K.TCAYTNHTVLPEALERWPVSMFEK.L
	TK261102_lung_cytoE18_2_step01.1455.1455.1	1.0675	0.0219	795.62	29	6000.0%	1	K.EPDCFK.D
UQ9Z1A199.1%4616.4%397430205.1(Q9Z1A1) TFG protein (Trk-fused gene) 
*	TK261102_lung_cytoE18_2_step01.5674.5674.2	0.7351	0.09	2999.43	8	1250.0%	2	R.EEKPAASDSSGKQSTQVMAASMSAFDPLK.N
	TK261102_lung_cytoE18_2_step08.5244.5244.2	1.0716	0.2167	2331.24	2	2780.0%	1	R.IPIHNEDITYDELVLMMQR.V
*	TK261102_lung_cytoE18_2_step11.2233.2233.2	2.7144	0.4897	1863.04	1	4060.0%	1	R.NRPPFGQGYAQPGPGYR.-
UIMD2_MOUSE99.1%92126.1%514557857.3(P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) 
	TK261102_lung_cytoE18_2_step06.5368.5368.2	1.2404	0.0256	2856.32	15	1730.0%	1	R.VGMGSGSICITQEVLACGRPQATAVYK.V
	TK261102_lung_cytoE18_2_step01.2451.2451.1	1.8664	0.358	1467.99	3	3850.0%	1	K.REDLVVAPAGVTLK.E
	TK261102_lung_cytoE18_2_step07.4868.4868.2	3.15	0.1285	1966.87	1	5000.0%	4	K.GKLPIVNENDELVAIIAR.T
	TK261102_lung_cytoE18_2_step01.2366.2366.1	1.3783	0.1851	1546.18	7	3640.0%	1	R.DIDFLKEEEHDR.F
	TK261102_lung_cytoE18_2_step11.3501.3501.2	1.8282	0.3369	2050.12	1	3160.0%	1	R.RFGVPVIADGGIQNVGHIAK.A
	TK261102_lung_cytoE18_2_step10.5553.5553.3	1.4684	0.1189	4571.21	2	1190.0%	1	K.TPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVR.K
UTCPD_MOUSE99.1%4413.7%539580668.0(P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) 
	TK261102_lung_cytoE18_2_step08.3907.3907.1	2.0544	0.3785	1457.7	1	5830.0%	1	K.GIHPTIISESFQK.A
*	TK261102_lung_cytoE18_2_step11.3253.3253.2	0.7637	0.0113	2371.71	244	1250.0%	1	K.ALEKGLEILTDMSRPVQLSDR.E
	TK261102_lung_cytoE18_2_step11.2401.2401.1	0.3813	0.0	942.48	5	1430.0%	1	R.NRHAQGEK.T
	TK261102_lung_cytoE18_2_step07.3605.3605.3	1.2308	0.0176	3377.98	69	1130.0%	1	K.VVSQYSSLLSPMSVNAVMKVIDPATATSVDLR.D
UO0030199.1%81612.0%711731617.3(O00301) KSRP 
*	TK261102_lung_cytoE18_2_step10.2375.2375.3	1.1552	4.0E-4	2501.79	118	1330.0%	1	R.GGGGPCGGGPGGGSAGGPSQPPGGGGPGIRK.D
*	TK261102_lung_cytoE18_2_step07.2918.2918.1	1.6841	0.2159	923.78	2	6250.0%	2	R.HSVGVVIGR.S
*	TK261102_lung_cytoE18_2_step10.2516.2516.1	1.8057	0.3575	1108.63	5	5560.0%	3	K.IAHIMGPPDR.C
*	TK261102_lung_cytoE18_2_step12.1935.1935.2	0.5605	0.1392	2373.78	17	1030.0%	1	R.GGGGPCGGGPGGGSAGGPSQPPGGGGPGIR.K
*	TK261102_lung_cytoE18_2_step11.2833.2833.3	0.9961	0.1265	3430.94	2	1180.0%	1	R.GGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGK.G
UQ9CR1699.1%5135.9%370407437.4(Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) 
	TK261102_lung_cytoE18_2_step07.3604.3604.1	1.9437	0.3535	1028.54	1	5620.0%	2	K.HVVFGQVIK.G
*	TK261102_lung_cytoE18_2_step10.2412.2412.1	2.1387	0.3478	1332.78	1	5830.0%	3	K.GTGSTTGKPLHFK.G
USNX3_MOUSE99.1%396.8%162187578.7(O70492) Sorting nexin 3 (SDP3 protein) 
	TK261102_lung_cytoE18_2_step07.1900.1900.1	2.0665	0.372	1192.57	1	6000.0%	3	K.VAGHPLAQNER.C
UQ8VDP499.1%111.5%9991124725.8(Q8VDP4) Hypothetical 112.5 kDa protein (Fragment) 
*	TK261102_lung_cytoE18_2_step12.3385.3385.2	2.5423	0.4902	1499.42	1	5710.0%	1	K.SPAPPLLHVAALGQK.Q
URL1X_MOUSE99.1%6269.1%1762073210.7(P11249) 60S ribosomal protein L18a 
	TK261102_lung_cytoE18_2_step08.3181.3181.1	2.1447	0.3566	929.7	2	6430.0%	5	R.AHSIQIMK.V
	TK261102_lung_cytoE18_2_step12.2828.2828.2	1.6763	0.2389	1008.14	2	7140.0%	1	K.IKFPLPHR.V
UGUAA_HUMAN99.1%8129.1%693767156.9(P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase) 
*	TK261102_lung_cytoE18_2_step11.4354.4354.2	2.4758	0.4874	2352.38	1	3160.0%	1	K.ISQMPVILTPLHFDRDPLQK.Q
*	TK261102_lung_cytoE18_2_step12.2883.2883.2	1.343	0.0126	1162.24	3	4500.0%	1	R.HPFPGPGLAIR.V
*	TK261102_lung_cytoE18_2_step08.2881.2881.1	1.9449	0.2825	1237.65	1	5000.0%	2	K.THHNDTELIR.K
*	TK261102_lung_cytoE18_2_step12.1713.1713.2	0.8815	0.0050	1388.5	80	2690.0%	1	R.SGNIVAGIANESKK.L
*	TK261102_lung_cytoE18_2_step12.1889.1889.1	1.1375	3.0E-4	995.0	2	4290.0%	2	K.KPHTLLQR.V
UQ9ET1199.1%339.5%455497796.4(Q9ET11) PIST 
*	TK261102_lung_cytoE18_2_step12.1547.1547.1	1.8699	0.3569	1141.9	1	6670.0%	1	R.AAHLHSLHQK.K
	TK261102_lung_cytoE18_2_step11.3557.3557.2	1.0505	0.1228	1934.22	101	2500.0%	1	R.CGGLHVGDAILAVNGVNLR.D
	TK261102_lung_cytoE18_2_step12.1965.1965.1	1.1056	0.0090	1413.01	103	2690.0%	1	K.EDHEGLGISITGGK.E
UACDL_MOUSE99.1%113.7%430480828.2(P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD) 
*	TK261102_lung_cytoE18_2_step10.3556.3556.2	2.6174	0.4786	2086.39	1	5670.0%	1	R.KFFQEEVIPHHTEWEK.A
UUBIQ_HUMAN99.1%41019.7%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin 
	TK261102_lung_cytoE18_2_step01.2074.2074.1	1.3601	0.1538	648.81	7	7000.0%	1	R.LIFAGK.Q
	TK261102_lung_cytoE18_2_step06.3774.3774.1	2.0545	0.3763	1069.78	1	5000.0%	3	K.ESTLHLVLR.L
UPHS1_MOUSE99.1%12305.5%850974317.1(Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) 
*	TK261102_lung_cytoE18_2_step06.2726.2726.1	1.844	0.356	869.63	1	6670.0%	3	R.HGNPWEK.A
*	TK261102_lung_cytoE18_2_step07.4740.4740.2	1.3616	0.1835	1449.51	1	5000.0%	2	K.LHSFVSDDIFLR.E
	TK261102_lung_cytoE18_2_step07.4022.4022.1	1.5826	0.0584	1401.43	2	5000.0%	3	R.HLEIIYEINQK.H
	TK261102_lung_cytoE18_2_step07.2016.2016.1	1.0969	0.0581	945.69	83	3750.0%	2	K.AAPGYHMAK.M
	TK261102_lung_cytoE18_2_step12.3072.3072.1	1.7254	0.1702	997.0	4	5000.0%	2	R.HLHFTLVK.D
UQ8R5F299.1%113.7%271312704.9(Q8R5F2) Hypothetical 31.3 kDa protein 
	TK261102_lung_cytoE18_2_step06.0480.0480.1	1.9755	0.3553	1240.06	1	5560.0%	1	K.FFEHFIEGGR.T
UCAZ2_MOUSE99.1%396.3%286329675.8(P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) 
	TK261102_lung_cytoE18_2_step07.4805.4805.2	2.1141	0.4168	2105.35	1	4120.0%	3	K.FIIHAPPGEFNEVFNDVR.L
UNDKA_MOUSE99.1%5538.2%152172087.4(P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) 
	TK261102_lung_cytoE18_2_step12.4824.4824.2	2.5594	0.4777	2118.96	1	4720.0%	1	K.YMHSGPVVAMVWEGLNVVK.T
	TK261102_lung_cytoE18_2_step01.2124.2124.1	1.1526	2.0E-4	1347.09	4	4550.0%	1	R.TFIAIKPDGVQR.G
*	TK261102_lung_cytoE18_2_step01.3055.3055.1	1.3596	0.2554	1180.99	1	5560.0%	1	K.DRPFFTGLVK.Y
	TK261102_lung_cytoE18_2_step01.1898.1898.2	2.6452	0.3624	1786.78	1	5310.0%	1	R.VMLGETNPADSKPGTIR.G
UK2C1_HUMAN99.1%71516.2%643658868.1(P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) 
*	TK261102_lung_cytoE18_2_step10.4888.4888.2	2.0477	0.2559	1995.33	1	4000.0%	2	R.THNLEPYFESFINNLR.R
*	TK261102_lung_cytoE18_2_step08.4425.4425.3	1.415	0.2002	3580.39	6	1470.0%	1	R.TLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSR.G
*	TK261102_lung_cytoE18_2_step10.4101.4101.3	2.1232	0.2658	3316.75	9	1510.0%	3	R.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G
*	TK261102_lung_cytoE18_2_step06.5377.5377.3	1.6441	0.0278	4301.39	1	1250.0%	1	R.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGR.G
UPRSX_HUMAN99.1%135714.4%389441737.5(Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) 
	TK261102_lung_cytoE18_2_step11.3277.3277.2	1.4365	0.2242	2239.26	3	2890.0%	1	K.MIMATNRPDTLDPALLRPGR.L
	TK261102_lung_cytoE18_2_step11.2481.2481.2	2.4288	0.4157	1436.17	1	5450.0%	1	R.KIHIDLPNEQAR.L
	TK261102_lung_cytoE18_2_step04.0427.0427.1	1.1328	0.171	832.27	5	5830.0%	1	-.MADPRDK.A
	TK261102_lung_cytoE18_2_step09.2065.2065.1	1.7269	0.27	838.64	1	5710.0%	7	K.IHAGPITK.H
	TK261102_lung_cytoE18_2_step05.3361.3361.1	0.7559	0.1142	969.85	33	4380.0%	1	R.FSEGTSADR.E
UC61A_MOUSE99.1%4422.7%291333405.8(P46737) C6.1A protein 
	TK261102_lung_cytoE18_2_step10.2741.2741.2	2.6228	0.4824	1351.22	1	6820.0%	1	R.IHSLTHLDSVTK.I
	TK261102_lung_cytoE18_2_step12.5592.5592.2	0.8202	0.0475	2942.66	32	1540.0%	1	R.VEISPEQLSAASTEAERLAELTGRPMR.V
	TK261102_lung_cytoE18_2_step06.4188.4188.3	1.5052	0.1006	3207.0	5	1730.0%	1	R.TQAMYQMMDQGFVGLIFSCFIEDKNTK.T
UQ8VCN599.1%2212.1%398435677.6(Q8VCN5) Hypothetical 43.6 kDa protein 
*	TK261102_lung_cytoE18_2_step11.2442.2442.2	2.4028	0.4903	1772.18	1	5330.0%	1	K.VVYPGLPSHPQHELAK.R
*	TK261102_lung_cytoE18_2_step07.3942.3942.3	0.9532	0.0754	3431.99	4	890.0%	1	K.NLKLFTLAESLGGYESLAELPAIMTHASVPEK.D
UPIMT_MOUSE99.1%82614.6%226245037.6(P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) 
	TK261102_lung_cytoE18_2_step08.3352.3352.1	0.9393	0.0063	1480.89	1	4620.0%	4	K.SGGASHSELIHNLR.K
*	TK261102_lung_cytoE18_2_step07.3549.3549.2	1.4619	0.0694	2110.86	2	3060.0%	3	K.VIGIDHIKELVDDSITNVK.K
UFCL_MOUSE99.1%2214.0%321358786.7(P23591) GDP-fucose synthetase (FX protein) (Red cell NADP(H)-binding protein) (Transplantation antigen P35B) (Tum-P35B antigen) [Includes: GDP-mannose-4-keto-6-D epimerase (EC 5.1.3.-); GDP-4-keto-6-L-galactose reductase (EC 1.-.-.-)] 
*	TK261102_lung_cytoE18_2_step09.3699.3699.2	2.6537	0.4697	1992.19	1	4410.0%	1	K.NVHINDNVLHSAFEVGAR.K
*	TK261102_lung_cytoE18_2_step08.4083.4083.2	1.3323	0.0522	3083.81	6	1920.0%	1	K.TTYPIDETMIHNGPPHSSNFGYSYAKR.M
USEP7_MOUSE99.0%356.7%436505508.6(O55131) Septin 7 (CDC10 protein homolog) 
	TK261102_lung_cytoE18_2_step10.4901.4901.2	2.1725	0.3531	2609.24	1	3410.0%	2	K.STLINSLFLTDLYSPEYPGPSHR.I
	TK261102_lung_cytoE18_2_step11.0642.0642.1	0.8381	0.0987	828.67	128	6000.0%	1	R.RHEQMK.K
UQ91YR599.0%223.9%698787576.8(Q91YR5) Hypothetical 78.8 kDa protein 
*	TK261102_lung_cytoE18_2_step08.3477.3477.2	3.0149	0.463	1698.5	1	6070.0%	1	R.YTLHVVDNPAVKPSR.D
*	TK261102_lung_cytoE18_2_step11.1854.1854.2	0.887	0.0082	1641.87	45	2730.0%	1	R.QYYAWLCSQLRR.K
UGTM2_MOUSE99.0%61017.1%217255857.4(P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5) 
	TK261102_lung_cytoE18_2_step07.2394.2394.1	1.036	0.1594	737.78	1	5000.0%	2	R.GLAHAIR.L
*	TK261102_lung_cytoE18_2_step08.3484.3484.1	2.4483	0.3483	1431.88	1	5910.0%	1	K.KKPEYLEGLPEK.M
*	TK261102_lung_cytoE18_2_step05.0370.0370.2	0.7934	0.2028	2162.92	103	1760.0%	1	K.YTMGDAPDYDRSQWLSEK.F
UPPI1_MOUSE99.0%5913.0%270317626.4(P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) 
	TK261102_lung_cytoE18_2_step06.2645.2645.1	1.4743	0.1275	888.53	4	6670.0%	2	K.IYHLQSK.V
	TK261102_lung_cytoE18_2_step07.3176.3176.2	1.6889	0.1141	2033.07	1	3750.0%	2	K.IETWHKPDLGTQENVHK.L
*	TK261102_lung_cytoE18_2_step06.5860.5860.1	0.8493	0.2874	1276.76	6	2500.0%	1	K.DDGEKGQYTHK.I
UQ9JHU998.9%113.9%557609326.4(Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1) 
*	TK261102_lung_cytoE18_2_step12.2467.2467.2	2.9007	0.4585	2322.23	1	3810.0%	1	K.MERPGPGIKPGEVVATSPLPCK.K
UQ6218998.9%2410.1%287318359.8(Q62189) Small nuclear RNA (Small nuclear ribonucleoprotein polypeptide A) 
*	TK261102_lung_cytoE18_2_step12.3147.3147.2	2.8411	0.4581	2782.03	1	3750.0%	2	K.KAVQGGAAAPVVGAVQPVPGMPPMPQAPR.I
UQ921J098.9%223.9%564643865.9(Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) 
	TK261102_lung_cytoE18_2_step12.4124.4124.2	1.2275	0.1959	2545.72	9	1900.0%	1	K.AVGHPFVIQLGRIYLDMLNVYK.C
	TK261102_lung_cytoE18_2_step11.3408.3408.1	2.2135	0.3527	1294.82	1	5450.0%	1	K.AVGHPFVIQLGR.I
UUNRI_MOUSE98.9%4619.4%351385135.1(Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) 
	TK261102_lung_cytoE18_2_step12.2084.2084.1	2.0129	0.3518	1181.91	1	5000.0%	2	K.GHFGPIHCVR.F
*	TK261102_lung_cytoE18_2_step09.4137.4137.3	1.363	0.0861	3446.09	2	1690.0%	1	K.IGFPETAEEELAEEIASENSDSIYSSTPEVKA.-
	TK261102_lung_cytoE18_2_step11.3774.3774.3	1.0375	0.1533	2952.19	6	1400.0%	1	K.SLNFNMSVSSMEYIPEGEILVITYGR.S
UQ9CQX898.9%1112.7%1021110110.0(Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) 
*	TK261102_lung_cytoE18_2_step12.2461.2461.2	3.1119	0.4152	1428.87	1	6250.0%	1	R.VVQVVKPHAPLIK.F
UPUR9_MOUSE98.8%102010.1%592641576.8(Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] 
*	TK261102_lung_cytoE18_2_step10.2300.2300.1	0.6935	0.0989	1203.4	20	3000.0%	1	R.NIPEDAADMAR.L
	TK261102_lung_cytoE18_2_step10.1989.1989.1	0.8631	0.2603	553.42	8	6670.0%	1	R.LFHH.-
*	TK261102_lung_cytoE18_2_step08.2723.2723.1	1.2512	0.0396	583.45	1	7500.0%	2	R.HLALK.A
*	TK261102_lung_cytoE18_2_step11.0520.0520.2	1.0032	0.0197	2930.1	18	1540.0%	1	K.NHARVTVVCEPEDYAGVAAEMHGSDSK.D
	TK261102_lung_cytoE18_2_step12.2555.2555.2	2.0445	0.3431	1357.17	1	5420.0%	2	K.TLHPAVHAGILAR.N
USPH2_MOUSE98.8%225.7%617656186.6(Q9JIA7) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2) 
*	TK261102_lung_cytoE18_2_step12.2684.2684.2	2.2268	0.5106	2037.65	1	4210.0%	1	K.SELVLAPAPAPAATHSPLHR.S
	TK261102_lung_cytoE18_2_step08.3147.3147.2	1.2128	0.2111	1758.01	2	3570.0%	1	R.AEAQRWATALTCLLR.G
UCOPP_MOUSE98.7%6614.5%9051024495.3(O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) 
	TK261102_lung_cytoE18_2_step06.4624.4624.2	1.3529	0.0671	1891.48	1	4000.0%	1	K.IAYQLAVEAESEQKWK.Q
	TK261102_lung_cytoE18_2_step06.4862.4862.3	1.2786	0.0144	4773.76	1	1340.0%	1	K.IWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVR.I
	TK261102_lung_cytoE18_2_step11.5909.5909.3	1.573	0.1251	3020.12	5	1920.0%	1	K.SFGSAQEFAWAHDSSEYAIRESNSIVK.I
	TK261102_lung_cytoE18_2_step11.4213.4213.3	1.2226	0.1714	3939.69	35	980.0%	1	R.VKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVK.T
	TK261102_lung_cytoE18_2_step10.3113.3113.2	1.2362	0.2396	1507.94	21	4090.0%	1	R.VHMFEAHSDYIR.C
UDHCA_MOUSE98.7%3517.4%276305977.8(P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) 
*	TK261102_lung_cytoE18_2_step09.2854.2854.2	2.5762	0.4584	1930.55	1	4120.0%	2	K.KGVHAEEGWPNSAYGVTK.I
*	TK261102_lung_cytoE18_2_step01.3803.3803.2	1.1209	0.115	3194.69	1	1900.0%	1	K.SPEEGAETPVYLALLPPDAEGPHGQFVQDK.K
UO5498898.6%7118.9%12331414855.1(O54988) Serine/threonine protein kinase 
*	TK261102_lung_cytoE18_2_step08.4361.4361.3	1.1694	0.0747	3866.95	76	920.0%	2	K.AAQSGEGDEALVPTQTLAEKPTEGPEAGGAEEEPPGGER.V
	TK261102_lung_cytoE18_2_step08.3135.3135.1	0.9474	0.0729	1393.54	1	5000.0%	1	K.CHLLVEHETQK.L
	TK261102_lung_cytoE18_2_step10.1473.1473.1	0.8874	0.0414	671.42	11	5000.0%	1	K.LQQQR.E
	TK261102_lung_cytoE18_2_step10.3955.3955.2	2.9032	0.4302	2454.09	1	4000.0%	2	R.WTTSQLLQHPFVTVDSNKPVR.E
	TK261102_lung_cytoE18_2_step09.4922.4922.3	0.9871	0.01	4040.52	11	1290.0%	1	K.DRPYDYKADVWSLGITLIEMAEIEPPHHELNPMR.V
UDD15_MOUSE98.6%3310.8%758866117.2(O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15) 
	TK261102_lung_cytoE18_2_step01.4095.4095.2	1.087	0.2332	3048.62	1	1790.0%	1	K.VVVSTNIAETSLTIDGVVFVIDPGFAKQK.V
	TK261102_lung_cytoE18_2_step06.4230.4230.3	1.2423	0.1618	3893.59	120	910.0%	1	K.MVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAK.K
	TK261102_lung_cytoE18_2_step12.4183.4183.2	2.3144	0.4636	2212.59	1	4170.0%	1	R.FAHIDGDHLTLLNVYHAFK.Q
UQ8R3E698.6%116.5%338381175.5(Q8R3E6) Similar to chromosome 14 open reading frame 3 
*	TK261102_lung_cytoE18_2_step01.4835.4835.2	2.7291	0.4461	2417.34	1	3810.0%	1	R.VFTTQELVQAFTHAPAALEADR.G
UQ9H84598.6%61216.6%621687608.0(Q9H845) Hypothetical protein FLJ13950 
*	TK261102_lung_cytoE18_2_step10.3441.3441.3	1.8712	0.0664	3429.67	4	1670.0%	1	K.AYVMESMTYLTAGMLDQPGFPDCSIEAAMVK.V
*	TK261102_lung_cytoE18_2_step07.3892.3892.3	3.0277	0.3753	4018.49	1	1740.0%	3	K.EVFPFPEVSQDELNEINQFLGPVEKFFTEEVDSR.K
*	TK261102_lung_cytoE18_2_step11.2900.2900.3	1.7201	0.0481	2721.52	17	1770.0%	1	K.SLGLFGLQVPEEYGGLGFSNTMYSR.L
*	TK261102_lung_cytoE18_2_step12.2691.2691.2	1.2737	0.0121	1532.3	54	3330.0%	1	R.ILLIFEGTNEILR.M
UPRO1_MOUSE98.6%101662.6%139148268.3(P10924) Profilin I 
	TK261102_lung_cytoE18_2_step01.2171.2171.1	2.2324	0.3475	1216.07	1	5910.0%	1	K.DSPSVWAAVPGK.T
*	TK261102_lung_cytoE18_2_step01.3287.3287.1	1.1458	0.2791	1457.38	23	2690.0%	1	R.SSFFVNGLTLGGQK.C
*	TK261102_lung_cytoE18_2_step01.3946.3946.2	2.0259	0.3354	1617.94	1	4670.0%	1	K.TFVSITPAEVGVLVGK.D
*	TK261102_lung_cytoE18_2_step06.0326.0326.2	1.9033	0.3185	1683.12	1	4380.0%	1	K.STGGAPTFNVTVTMTAK.T
	TK261102_lung_cytoE18_2_step09.2275.2275.1	1.6452	0.0735	1152.53	14	4500.0%	1	K.EGVHGGLINKK.C
	TK261102_lung_cytoE18_2_step06.4436.4436.1	1.5778	0.0131	876.69	1	7140.0%	3	K.TLVLLMGK.E
	TK261102_lung_cytoE18_2_step06.2898.2898.1	1.1139	0.1136	1166.71	1	5000.0%	1	K.CYEMASHLR.R
UENOB_MOUSE98.6%223.7%433468947.2(P21550) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (Enolase 3) 
	TK261102_lung_cytoE18_2_step10.2511.2511.1	2.22	0.3381	1168.79	2	6110.0%	1	R.IGAEVYHHLK.G
	TK261102_lung_cytoE18_2_step09.2514.2514.1	1.301	0.1159	670.44	7	6000.0%	1	R.HISGEK.L
UQ99J3698.6%337.4%350388856.1(Q99J36) Similar to hypothetical protein FLJ20274 
	TK261102_lung_cytoE18_2_step06.2621.2621.1	0.7183	0.0421	789.55	4	4170.0%	1	K.KEVGDIK.A
	TK261102_lung_cytoE18_2_step11.3101.3101.1	2.4332	0.3202	1397.8	1	6000.0%	1	K.LVHHILQDMYK.T
*	TK261102_lung_cytoE18_2_step12.1832.1832.1	0.4993	0.0284	785.6	43	2140.0%	1	R.RGDAGGPR.Q
UQ91WQ398.6%467.0%528591057.0(Q91WQ3) Similar to tyrosyl-tRNA synthetase (Hypothetical 59.1 kDa protein) (Expressed sequence AL024047) 
	TK261102_lung_cytoE18_2_step09.3702.3702.1	1.2619	0.0956	1583.84	11	3570.0%	2	R.VHLMNPMVPGLTGSK.M
	TK261102_lung_cytoE18_2_step03.0532.0532.2	0.8232	0.02	1740.03	31	2140.0%	1	K.MSSSEEESKIDLLDR.K
	TK261102_lung_cytoE18_2_step10.3541.3541.1	1.2999	0.0347	856.43	10	5830.0%	1	K.HVLFPLK.S
UQ921G598.6%114.5%268305787.1(Q921G5) Similar to methyltransferase-like 1 (S. cerevisiae) 
	TK261102_lung_cytoE18_2_step10.2253.2253.1	2.0219	0.3388	1350.74	1	5000.0%	1	R.AHSNPMADHTLR.Y
UO9575298.6%333.7%12881471826.8(O95752) Chromosome-associated polypeptide-C 
*	TK261102_lung_cytoE18_2_step07.2344.2344.1	1.8458	0.3445	1163.6	1	5560.0%	1	R.SHGIDLDHNR.F
*	TK261102_lung_cytoE18_2_step08.2433.2433.1	1.2089	0.0324	737.73	2	7000.0%	1	K.TYNITK.S
*	TK261102_lung_cytoE18_2_step04.2560.2560.3	1.322	0.1126	3774.07	1	1530.0%	1	K.YDVAISSCCHALDYIVVDSIDIAQECVNFLKR.Q
URPIA_MOUSE98.6%115.1%236260006.5(P47968) Ribose 5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase) 
*	TK261102_lung_cytoE18_2_step07.2061.2061.1	2.0943	0.346	1305.57	1	5910.0%	1	K.LASHTAVENHVK.N
UQ6112398.6%112110.2%754868235.6(Q61123) MEM3 
	TK261102_lung_cytoE18_2_step12.2509.2509.2	0.91	0.1244	1879.92	13	2190.0%	1	K.AQLAAITLIIGTFERMK.C
	TK261102_lung_cytoE18_2_step06.0648.0648.2	1.037	0.1142	2832.86	4	2050.0%	1	R.YIYFYEKENDAVTIQVLNQLIQK.I
*	TK261102_lung_cytoE18_2_step04.2237.2237.1	0.6165	0.022	1363.6	44	2500.0%	1	R.EHMCTSLWSGR.N
	TK261102_lung_cytoE18_2_step08.2205.2205.1	1.5005	0.1293	943.59	3	7500.0%	2	K.HFGAGGNQR.I
	TK261102_lung_cytoE18_2_step12.2175.2175.1	2.2412	0.2385	1306.79	1	5000.0%	3	K.HFHNTLEHLR.T
	TK261102_lung_cytoE18_2_step07.1937.1937.1	1.2352	0.0325	807.47	8	5000.0%	2	R.GVQHPLR.G
URADI_MOUSE98.6%71110.1%583684526.1(P26043) Radixin 
	TK261102_lung_cytoE18_2_step10.5703.5703.2	0.8074	0.0649	2797.35	4	1670.0%	1	K.GTELWLGVDALGLNIYEHDDKLTPK.I
	TK261102_lung_cytoE18_2_step09.2362.2362.1	1.2108	0.0554	1412.77	2	5000.0%	1	K.EIHKPGYLANDR.L
	TK261102_lung_cytoE18_2_step04.0606.0606.1	1.7753	0.332	1497.0	1	5000.0%	1	K.KTQNDVLHAENVK.A
	TK261102_lung_cytoE18_2_step08.2443.2443.1	1.5913	0.2242	1250.63	1	5000.0%	2	R.IQNWHEEHR.G
UUBL3_MOUSE98.6%3521.7%230261525.0(Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3) 
*	TK261102_lung_cytoE18_2_step12.1653.1653.1	1.8563	0.3489	1040.16	1	6250.0%	2	R.KPFPINHGK.T
	TK261102_lung_cytoE18_2_step03.3663.3663.3	1.3107	0.2039	4566.7	13	1060.0%	1	R.VTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGR.K
UQ9R0P298.6%338.6%373436866.0(Q9R0P2) KIAA312p (Fragment) 
	TK261102_lung_cytoE18_2_step07.2882.2882.1	1.6949	0.3325	1324.8	1	4440.0%	1	R.RDHVFEDSYR.E
	TK261102_lung_cytoE18_2_step09.2134.2134.1	1.1008	0.1076	567.53	2	6250.0%	1	K.HILGK.S
	TK261102_lung_cytoE18_2_step06.0463.0463.2	1.0863	0.0375	1881.41	13	1560.0%	1	R.DLKPNGANILVTEENKK.E
URL19_HUMAN98.6%82215.8%1962346611.5(P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19 
	TK261102_lung_cytoE18_2_step10.2721.2721.1	1.6416	0.038	1022.67	6	5710.0%	1	R.ILMEHIHK.L
	TK261102_lung_cytoE18_2_step08.2393.2393.1	1.6084	0.2382	644.5	1	7000.0%	4	R.HMGIGK.R
	TK261102_lung_cytoE18_2_step09.2183.2183.1	0.9479	0.111	923.9	2	5000.0%	1	R.KPVTVHSR.A
	TK261102_lung_cytoE18_2_step11.2736.2736.1	1.5021	0.0871	1193.55	1	5620.0%	2	R.HMYHSLYLK.V
UQ924D298.6%8224.9%15611699007.9(Q924D2) Myosin light chain kinase (Fragment) 
*	TK261102_lung_cytoE18_2_step07.5312.5312.2	2.0398	0.2263	1923.16	9	2810.0%	4	R.FESQPQSQEVTEGQTVK.F
*	TK261102_lung_cytoE18_2_step06.2745.2745.1	1.1402	0.0943	1302.78	26	3640.0%	2	K.RPESQGSAPVFK.E
*	TK261102_lung_cytoE18_2_step08.5408.5408.2	1.6695	0.1562	1911.27	1	3670.0%	1	R.STSFNVQDLLPDREYK.F
*	TK261102_lung_cytoE18_2_step05.0809.0809.3	0.7873	0.0376	3560.98	113	670.0%	1	K.GGWHSLCIQEVFPEDTGTYTCEAWNSAGEVR.T
UMCM4_MOUSE98.6%81011.6%862967367.2(P49717) DNA replication licensing factor MCM4 (CDC21 homolog) (P1-CDC21) 
	TK261102_lung_cytoE18_2_step07.2504.2504.2	0.7753	0.0244	1721.76	10	2500.0%	1	R.GMVSAYPRQLESLIR.L
*	TK261102_lung_cytoE18_2_step12.2345.2345.2	0.8933	0.04	1914.99	172	2190.0%	1	R.GQSDTAITKDMFEEALR.A
	TK261102_lung_cytoE18_2_step10.2753.2753.1	1.6851	0.3044	1155.8	1	5620.0%	2	K.THIDVIHYR.K
	TK261102_lung_cytoE18_2_step11.3601.3601.2	2.0844	0.2828	1865.05	1	4330.0%	1	K.KTTIENIQLPHTLLSR.F
*	TK261102_lung_cytoE18_2_step05.3621.3621.1	0.5723	0.0453	1060.36	18	2500.0%	1	R.KEELAEALR.K
	TK261102_lung_cytoE18_2_step07.2666.2666.1	1.9042	0.3322	1424.69	1	5450.0%	1	K.RLHGLDEEAEQK.L
*	TK261102_lung_cytoE18_2_step12.2313.2313.2	1.1031	0.3157	2635.42	2	2620.0%	1	R.IAEPCSCVHCHTTHSMALIHNR.S
UG25B_HUMAN98.6%4105.8%191213116.0(P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) 
	TK261102_lung_cytoE18_2_step11.2436.2436.1	1.8746	0.3482	1405.69	1	5000.0%	3	K.WVPEITHHCPK.T
UTPM1_MOUSE98.5%4610.9%284326814.7(P58771) Tropomyosin 1 alpha chain (Alpha-tropomyosin) 
	TK261102_lung_cytoE18_2_step08.0226.0226.1	1.5025	0.0402	711.45	5	6000.0%	1	K.YSEALK.D
	TK261102_lung_cytoE18_2_step06.0007.0007.2	2.8606	0.4432	1400.85	1	8000.0%	2	R.RIQLVEEELDR.A
	TK261102_lung_cytoE18_2_step08.2392.2392.1	1.1923	0.0526	1462.67	2	5000.0%	1	K.KATDAEADVASLNR.R
UGTM1_MOUSE98.4%93514.3%217258398.0(P10649) Glutathione S-transferase Mu 1 (EC 2.5.1.18) (GST class-mu 1) (Glutathione S-transferase GT8.7) (pmGT10) (GST 1-1) 
	TK261102_lung_cytoE18_2_step01.4510.4510.2	2.4934	0.4614	1901.39	1	5000.0%	1	K.LGLDFPNLPYLIDGSHK.I
*	TK261102_lung_cytoE18_2_step09.2135.2135.1	1.2997	0.1199	794.71	8	5000.0%	3	R.GLTHPIR.M
*	TK261102_lung_cytoE18_2_step06.2590.2590.1	1.6165	0.039	875.55	1	6670.0%	5	K.MAHWSNK.-
UASNS_MOUSE98.4%104014.5%560641526.6(Q61024) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Glutamine-dependent asparagine synthetase) 
*	TK261102_lung_cytoE18_2_step12.3275.3275.3	1.8932	0.1782	2271.03	23	2240.0%	1	K.TICMLDGVFAFILLDTANKK.V
*	TK261102_lung_cytoE18_2_step12.1863.1863.3	0.9526	0.0125	3461.17	26	710.0%	1	K.YHHCTDEPLHAIYDSVEKLFPGFDLETVK.N
*	TK261102_lung_cytoE18_2_step01.1151.1151.1	0.6472	0.2496	447.41	1	3750.0%	6	K.SAAKA.-
*	TK261102_lung_cytoE18_2_step09.3577.3577.2	2.5357	0.4462	2214.67	1	4710.0%	1	K.YHHCTDEPLHAIYDSVEK.L
	TK261102_lung_cytoE18_2_step07.5386.5386.2	0.7596	0.2528	2999.91	7	960.0%	1	K.VEPFLPGHYEVLDLKPNGKVASVEMVK.Y
UP2G4_MOUSE98.4%61811.7%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) 
	TK261102_lung_cytoE18_2_step07.1918.1918.1	0.971	0.0076	1125.45	258	3330.0%	1	K.YKMGGDIANR.V
	TK261102_lung_cytoE18_2_step08.3180.3180.2	2.5511	0.4438	1928.01	1	5310.0%	4	R.LVKPGNQNTQVTEAWNK.V
	TK261102_lung_cytoE18_2_step11.3597.3597.2	1.7605	0.3937	2169.32	1	3060.0%	1	K.VAHSFNCTPIEGMLSHQLK.Q
UCATA_MOUSE98.3%557.4%526596347.9(P24270) Catalase (EC 1.11.1.6) 
*	TK261102_lung_cytoE18_2_step08.2952.2952.2	2.2888	0.4454	1701.62	1	4670.0%	1	K.NAIHTYTQAGSHMAAK.G
	TK261102_lung_cytoE18_2_step08.2667.2667.2	1.0978	0.0019	1282.23	7	4500.0%	1	R.HMNGYGSHTFK.L
	TK261102_lung_cytoE18_2_step07.1785.1785.1	1.1247	0.0447	837.46	1	6670.0%	1	R.NPQTHLK.D
	TK261102_lung_cytoE18_2_step07.1619.1619.1	0.8362	0.0439	596.16	20	5000.0%	1	R.YSKAK.V
UQ9JHJ398.2%148616.3%404438046.1(Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) 
*	TK261102_lung_cytoE18_2_step09.4953.4953.2	2.2347	0.0582	2882.15	3	2690.0%	7	R.LLEFDSTNASEGAQPPGKPYPPYSLAK.F
*	TK261102_lung_cytoE18_2_step09.4977.4977.3	1.0029	0.0558	4200.78	106	590.0%	1	K.FSWNNITNSLDLANLSADFQGRPVDDPTGAFANGSLTFK.V
UQ91XC898.2%51715.7%102111559.4(Q91XC8) Similar to death-associated protein (Hypothetical 11.2 kDa protein) 
	TK261102_lung_cytoE18_2_step07.1749.1749.1	1.723	0.0897	1007.75	2	6430.0%	4	R.TQHIQQPR.K
	TK261102_lung_cytoE18_2_step07.1741.1741.1	1.1106	0.0061	776.46	14	5000.0%	1	K.AGHPPAVK.A
UMKK2_MOUSE98.2%229.9%385439528.7(P49138) MAP kinase-activated protein kinase 2 (EC 2.7.1.-) (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAPK-2) (Fragment) 
	TK261102_lung_cytoE18_2_step11.4285.4285.2	2.4865	0.4506	1922.93	1	4380.0%	1	K.SIGEAIQYLHSINIAHR.D
	TK261102_lung_cytoE18_2_step06.4768.4768.2	1.2919	0.0656	2528.54	7	2250.0%	1	K.CLLIVMECLDGGELFSRIQDR.G
UNEMO_MOUSE98.2%114.9%412479425.8(O88522) NF-kappaB essential modulator (NEMO) (NF-kappaB essential modifier) (Inhibitor of nuclear factor kappa-B kinase gamma subunit) (IkB kinase gamma subunit) (I-kappa-B kinase gamma) (IKK-gamma) (IKKG) (IkB kinase-associated protein 1) (IKKAP1) (mFIP-3) 
*	TK261102_lung_cytoE18_2_step08.5061.5061.2	2.4818	0.4465	2391.62	1	3420.0%	1	K.LAQLQAAYHQLFQDYDSHIK.S
UQ9BY1398.2%112.4%718831265.2(Q9BY13) Golgi-associated microtubule-binding protein HOOK3 
*	TK261102_lung_cytoE18_2_step06.4908.4908.2	2.464	0.4445	2142.45	1	5310.0%	1	R.HLQLQTQLEQLQEETFR.L
UU186_MOUSE98.2%1115.1%86101196.4(Q923D4) Hypothetical protein MGC11596 
	TK261102_lung_cytoE18_2_step07.3269.3269.1	1.6566	0.3248	1583.78	1	3750.0%	1	R.YTIHSQLEHLQSK.Y
UR13A_MOUSE98.2%104213.4%2022333311.0(P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen) 
	TK261102_lung_cytoE18_2_step06.3021.3021.1	1.7681	0.2437	941.7	1	6430.0%	6	R.LAHEVGWK.Y
*	TK261102_lung_cytoE18_2_step07.1865.1865.1	1.0014	0.1297	900.63	108	2860.0%	1	K.RGQAALER.L
	TK261102_lung_cytoE18_2_step11.1945.1945.1	0.8804	0.0779	652.63	2	6000.0%	2	R.GHLLGR.L
	TK261102_lung_cytoE18_2_step09.1371.1371.1	0.7924	1.0E-4	614.41	10	5000.0%	1	R.LKPTR.K
URGSA_MOUSE98.1%1112.2%181211516.8(Q9CQE5) Regulator of G-protein signaling 10 (RGS10) 
*	TK261102_lung_cytoE18_2_step11.1494.1494.2	2.635	0.4347	2294.27	1	3330.0%	1	R.KRPPSDIHDGDGSSSSGHQSLK.S
UCOTR_MOUSE98.1%4611.5%418468805.2(P07759) Contrapsin precursor 
	TK261102_lung_cytoE18_2_step10.2427.2427.3	1.1252	0.0319	2144.8	39	2160.0%	1	K.AVLDVAETGTEAAAATGVIGGIR.K
	TK261102_lung_cytoE18_2_step10.2495.2495.1	1.9989	0.1553	1126.8	4	4440.0%	2	K.KLSVSQVVHK.A
	TK261102_lung_cytoE18_2_step07.4048.4048.2	2.4008	0.4516	1862.92	1	5000.0%	1	R.HFRDEELSCSVLELK.Y
UP2AA_MOUSE98.1%3319.7%309356085.5(P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) 
	TK261102_lung_cytoE18_2_step09.3235.3235.2	2.3853	0.4459	1916.06	1	6070.0%	1	R.AHQLVMEGYNWCHDR.N
	TK261102_lung_cytoE18_2_step01.3495.3495.2	2.0903	0.4698	2511.94	1	5000.0%	1	R.LQEVPHEGPMCDLLWSDPDDR.G
	TK261102_lung_cytoE18_2_step01.4544.4544.3	1.6762	0.2112	4552.33	3	1280.0%	1	R.GAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDR.N
UQ9HC8298.1%333.9%838947815.6(Q9HC82) Rb-associated protein 
	TK261102_lung_cytoE18_2_step07.1671.1671.1	1.1165	0.0061	618.64	89	5000.0%	1	R.KLGATK.Q
	TK261102_lung_cytoE18_2_step12.2439.2439.2	2.5951	0.4414	1670.34	1	6150.0%	1	R.HLISSLQNHNHQLK.G
	TK261102_lung_cytoE18_2_step11.2764.2764.1	1.6434	0.0461	1532.57	3	4170.0%	1	R.EEKTTTTLIEPIR.L
UQ8VHA698.1%7199.4%467507006.0(Q8VHA6) SOCS box protein ASB-18 
*	TK261102_lung_cytoE18_2_step12.2323.2323.2	1.6826	0.1724	1633.38	5	3750.0%	1	R.NGRGETALSAACGAAAR.S
*	TK261102_lung_cytoE18_2_step09.4834.4834.2	1.6049	0.0933	2856.09	1	2690.0%	3	R.ELLEHGATVQLEGGPGRDTPLHVAAQR.G
ULGUL_MOUSE98.1%4169.3%183206785.5(Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) 
	TK261102_lung_cytoE18_2_step07.4197.4197.2	2.9983	0.4035	1794.74	1	5000.0%	4	R.GFGHIGIAVPDVYSACK.R
UQ923D298.0%1112.1%206221977.0(Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein) 
	TK261102_lung_cytoE18_2_step03.0484.0484.2	2.2282	0.4556	2672.02	1	3120.0%	1	K.YVAVMPPHIGDQPLTGAYTVTLDGR.G
UKNG_MOUSE98.0%5513.6%661731026.5(O08677) Kininogen precursor [Contains: Bradykinin] 
	TK261102_lung_cytoE18_2_step12.2743.2743.2	2.2182	0.2395	1062.75	1	7500.0%	1	R.RPPGFSPFR.S
	TK261102_lung_cytoE18_2_step12.4301.4301.3	1.0871	0.1182	4729.94	8	1040.0%	1	-.MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDFSLK.Q
*	TK261102_lung_cytoE18_2_step09.2626.2626.2	2.9615	0.4295	2031.54	1	4410.0%	1	R.DAETEQGPTHGHGWLHEK.Q
	TK261102_lung_cytoE18_2_step01.4631.4631.2	0.8265	0.1989	2447.51	70	1500.0%	1	K.EVLGHSIAQLNAENDHPFYYK.I
UPPS1_MOUSE98.0%61012.8%624707946.8(Q60967) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1 (PAPS synthethase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (Sulfate adenylate transferase) (SAT) (ATP-sulfurylase); Adenylylsulfate kinase (EC 2.7.1.25) (Adenylylsulfate 3'-phosphotransferase) (APS kinase) (Adenosine-5'-phosphosulfate 3'-phosphotransferase) (3'-phosphoadenosine-5'-phosphosulfate synthetase)] 
	TK261102_lung_cytoE18_2_step06.1130.1130.3	1.2361	0.0788	4611.7	69	900.0%	1	K.GFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQER.D
	TK261102_lung_cytoE18_2_step12.2045.2045.2	2.5556	0.4384	1814.02	1	5000.0%	2	R.NPVHNGHALLMQDTHK.Q
	TK261102_lung_cytoE18_2_step09.2130.2130.1	1.5599	0.1425	581.64	4	7500.0%	2	K.LHLAK.T
	TK261102_lung_cytoE18_2_step09.1983.1983.3	1.4387	0.0151	2381.73	28	2080.0%	1	R.MDYYDSEHHEDFEFISGTR.M
UMOES_MOUSE98.0%6143.8%576676366.6(P26041) Moesin (Membrane-organizing extension spike protein) 
	TK261102_lung_cytoE18_2_step08.3263.3263.1	1.6141	0.0465	1235.74	2	4380.0%	3	R.IQVWHEEHR.G
	TK261102_lung_cytoE18_2_step06.2870.2870.1	1.2833	0.1506	1530.83	2	3750.0%	1	K.KTANDMIHAENMR.L
UHBA_HUMAN97.9%62022.0%141151268.7(P01922) Hemoglobin alpha chain 
*	TK261102_lung_cytoE18_2_step05.5069.5069.2	1.7939	0.2538	1836.78	2	4000.0%	2	K.TYFPHFDLSHGSAQVK.G
*	TK261102_lung_cytoE18_2_step05.0586.0586.1	1.4023	0.0342	1532.83	2	5710.0%	4	K.VGAHAGEYGAEALER.M
URAGE_MOUSE97.9%102425.6%403426696.1(Q62151) Advanced glycosylation end product-specific receptor precursor (Receptor for advanced glycosylation end products) 
*	TK261102_lung_cytoE18_2_step08.3337.3337.1	1.6143	0.3246	1156.4	1	5620.0%	4	K.KPPQQLEWK.L
*	TK261102_lung_cytoE18_2_step09.4563.4563.3	1.3774	0.0434	3922.48	1	1390.0%	1	K.VLSPQGGPWDSVAQILPNGSLLLPATGIVDEGTFRCR.A
*	TK261102_lung_cytoE18_2_step07.5053.5053.3	1.4174	0.139	4754.48	3	1060.0%	2	K.DGAPLPLAPSPVLLLPEVGHADEGTYSCVATHPSHGPQESPPVSIR.V
*	TK261102_lung_cytoE18_2_step11.2489.2489.1	1.3892	0.2962	1279.93	1	4000.0%	1	R.RPLNTAPIQLR.V
UQ9DBL497.9%5522.5%494548516.3(Q9DBL4) 1300003M23Rik protein 
	TK261102_lung_cytoE18_2_step04.2561.2561.3	1.3263	0.0023	4537.39	10	1070.0%	1	R.EELLTDTSNSSSSTGEEGDLAALLPDLSGRLLINSVFHMGAER.L
	TK261102_lung_cytoE18_2_step10.1669.1669.1	1.572	0.3501	965.42	1	7500.0%	1	K.QRNEDFR.K
	TK261102_lung_cytoE18_2_step03.0661.0661.3	0.9239	0.0417	3755.68	9	970.0%	1	R.LLINSVFHMGAERLQQMLFSDSPFLQGFLQQR.K
*	TK261102_lung_cytoE18_2_step07.4045.4045.2	0.8281	0.0652	2879.28	129	1250.0%	1	K.EVGDVIALSDISPSGAADHSQEPSPVGSR.R
	TK261102_lung_cytoE18_2_step12.2689.2689.2	1.9484	0.0495	1334.12	12	4580.0%	1	R.ASSDADHGAEEDK.E
UAMPL_MOUSE97.9%5716.0%487526197.0(Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) 
	TK261102_lung_cytoE18_2_step09.5354.5354.3	1.5051	0.15	4635.05	2	1160.0%	1	R.AAVAAGCRQVQDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLK.Q
	TK261102_lung_cytoE18_2_step12.1469.1469.1	1.3248	0.4035	749.71	19	6000.0%	2	K.VHIRPK.S
	TK261102_lung_cytoE18_2_step06.5006.5006.2	1.4741	0.3012	2064.2	1	3610.0%	1	R.TFYGLHQDFPSVVVVGLGK.R
	TK261102_lung_cytoE18_2_step07.3753.3753.1	1.5693	0.348	1195.09	1	5000.0%	1	R.MPLFEHYTR.Q
UGLYG_MOUSE97.9%103413.0%332372715.3(Q9R062) Glycogenin-1 (EC 2.4.1.186) 
	TK261102_lung_cytoE18_2_step11.2848.2848.1	1.0429	0.1991	827.71	9	5000.0%	2	K.VVHFLGR.T
*	TK261102_lung_cytoE18_2_step07.3525.3525.1	1.2408	0.1365	1129.89	1	4440.0%	5	K.RPELGITLTK.L
	TK261102_lung_cytoE18_2_step12.5107.5107.2	0.94	0.2078	2684.45	5	1400.0%	1	-.TDQAFVTLTTNDAYAKGALVLGSSLK.Q
UGYG2_HUMAN97.9%7292.0%501552125.1(O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) 
*	TK261102_lung_cytoE18_2_step07.3525.3525.1	1.2408	0.1365	1129.89	1	4440.0%	5	K.RPELGLTLTK.L
UERF_MOUSE97.9%339.8%551590507.3(P70459) ETS-domain transcription factor ERF 
*	TK261102_lung_cytoE18_2_step12.2096.2096.2	1.5195	0.0534	2341.94	2	2950.0%	1	R.APPAPPKPEPGEAPGVAQCMPLK.L
*	TK261102_lung_cytoE18_2_step12.2532.2532.2	2.1438	0.4967	1367.02	1	6250.0%	1	R.ARPPGPPELGAFR.G
	TK261102_lung_cytoE18_2_step05.4977.4977.2	0.7289	0.025	2047.92	45	1180.0%	1	R.RVSSDLQHATAQLSLEHR.D
UIDE_MOUSE97.9%81611.8%10191177726.5(Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) 
	TK261102_lung_cytoE18_2_step11.1848.1848.2	1.069	0.0164	1365.98	5	4090.0%	1	R.EYRGLELANGIK.V
	TK261102_lung_cytoE18_2_step09.3263.3263.2	2.4068	0.2631	1844.29	1	6070.0%	1	R.FIIQSEKPPHYLESR.V
*	TK261102_lung_cytoE18_2_step08.4508.4508.2	2.137	0.5146	2218.99	1	3820.0%	2	K.NVPLPEFPEHPFQEEHLR.Q
*	TK261102_lung_cytoE18_2_step07.3926.3926.3	1.2701	0.0408	4767.55	15	1010.0%	3	R.LHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLLPSQLVR.Y
	TK261102_lung_cytoE18_2_step12.5275.5275.3	1.4788	0.0401	3853.67	1	1450.0%	1	R.GFMFFIINVDLTEEGLLHVEDIILHMFQYIQK.L
UQ8R3Q697.8%114.9%144166658.2(Q8R3Q6) Similar to CG15881 gene product (H. sapiens) 
*	TK261102_lung_cytoE18_2_step12.1585.1585.1	1.7955	0.3235	852.54	1	7500.0%	1	R.VHFKPPK.N
UQ96MZ897.8%13737.0%618678798.7(Q96MZ8) Hypothetical protein FLJ31638 
	TK261102_lung_cytoE18_2_step09.1668.1668.1	1.7757	0.2228	1459.74	1	4090.0%	6	K.QLCPAIQKLMVR.S
	TK261102_lung_cytoE18_2_step11.4472.4472.3	1.4373	0.0634	3755.76	37	1330.0%	1	K.ATCQETVEPPQTLHQQQQQQQQQQQEKLPIR.Q
UCLI1_MOUSE97.8%7377.5%241270135.2(Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) 
	TK261102_lung_cytoE18_2_step10.2899.2899.1	1.4851	0.2292	1097.37	2	4380.0%	6	K.LHIVQVVCK.K
	TK261102_lung_cytoE18_2_step01.3176.3176.1	1.0464	0.035	1038.82	25	5000.0%	1	R.GFTIPEAFR.G
UQ8R0Y697.8%446.2%902987095.9(Q8R0Y6) Similar to 10-formyltetrahydrofolate dehydrogenase 
*	TK261102_lung_cytoE18_2_step06.0088.0088.3	1.5376	0.0646	2411.23	42	1790.0%	1	K.KGGFTIFWADDGLDTGDLLLQK.E
	TK261102_lung_cytoE18_2_step08.2105.2105.1	1.2011	0.018	485.46	2	7500.0%	1	K.AGIPK.G
*	TK261102_lung_cytoE18_2_step01.1890.1890.3	1.4329	0.1611	4162.59	1	1600.0%	1	K.GGFTIFWADDGLDTGDLLLQKECDVLPDDTVSTLYNR.F
	TK261102_lung_cytoE18_2_step12.3127.3127.1	1.6715	0.3193	1489.94	1	6250.0%	1	R.HGSIIYHPSLLPR.H
UCATB_MOUSE97.8%113.8%339372805.9(P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) 
*	TK261102_lung_cytoE18_2_step07.2768.2768.1	1.7045	0.3202	1381.78	1	5000.0%	1	K.HEAGDMMGGHAIR.I
UQ9WTL797.8%3514.7%231247947.2(Q9WTL7) Lysophospholipase II (Lysophospholipase 2) 
	TK261102_lung_cytoE18_2_step08.2432.2432.1	1.422	0.2881	1013.73	3	5710.0%	2	K.YICPHAPR.I
	TK261102_lung_cytoE18_2_step07.5340.5340.2	2.4867	0.4393	2740.24	1	3200.0%	1	R.ETAAVIFLHGLGDTGHSWADALSTIR.L
UQ6148297.8%242.2%763867164.8(Q61482) CDE1-binding protein CDEBP 
*	TK261102_lung_cytoE18_2_step08.3032.3032.2	2.8776	0.3868	1652.35	1	5940.0%	2	K.GSGMAEQDGGLIGAEEK.V
URS8_HUMAN97.7%6188.7%2072407410.3(P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8 
	TK261102_lung_cytoE18_2_step09.2311.2311.2	2.8486	0.4114	1348.23	1	6820.0%	1	R.KYELGRPAANTK.I
	TK261102_lung_cytoE18_2_step12.1487.1487.1	1.0609	0.0982	781.66	11	5000.0%	1	R.RIHTVR.V
	TK261102_lung_cytoE18_2_step10.1585.1585.1	1.3056	0.0243	625.74	6	8750.0%	4	R.IHTVR.V
UQ6241897.6%3315.2%433484284.9(Q62418) Drebrin-like SH3 domain-containing protein SH3P7 
*	TK261102_lung_cytoE18_2_step12.4136.4136.2	1.8025	0.2008	1991.1	20	2370.0%	1	R.VAGTGEGGLEELVEELNSGK.V
*	TK261102_lung_cytoE18_2_step12.3229.3229.3	0.781	0.173	3191.3	25	860.0%	1	K.ASGANYSFHKESTSFQDVGPQAPVGSVYQK.T
*	TK261102_lung_cytoE18_2_step10.2168.2168.2	2.793	0.4222	1881.9	1	5330.0%	1	R.TRQEWESAGQQAPHPR.E
UK6PL_MOUSE97.5%101222.2%780853017.1(P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) 
	TK261102_lung_cytoE18_2_step06.3969.3969.1	1.0004	0.2225	1420.09	187	2730.0%	1	K.DLVVQRLGFDTR.V
	TK261102_lung_cytoE18_2_step09.1117.1117.1	0.3311	0.0	752.28	1	1000.0%	1	R.GVFDCR.T
	TK261102_lung_cytoE18_2_step11.3693.3693.2	0.7427	0.1088	2215.19	52	910.0%	1	K.AIGVLTSGGDAQGMNAAVRAVTR.M
*	TK261102_lung_cytoE18_2_step11.3668.3668.2	2.6474	0.4293	1730.75	1	5710.0%	1	R.TLPKPHLEAIVENLR.T
*	TK261102_lung_cytoE18_2_step10.2157.2157.1	1.0265	0.0214	790.61	11	6000.0%	2	K.MLAHYR.I
*	TK261102_lung_cytoE18_2_step12.4829.4829.2	0.8802	0.1393	2582.06	2	1900.0%	1	K.MLAHYRISMADYVSGELEHVTR.R
*	TK261102_lung_cytoE18_2_step01.4647.4647.3	1.521	0.2502	4377.53	9	1060.0%	1	K.VFLIYEGYEGLVEGGENIKPANWLSVSNIIQLGGTIIGSAR.C
	TK261102_lung_cytoE18_2_step06.0556.0556.3	0.9951	0.2708	4752.77	8	650.0%	1	R.YEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIK.Q
*	TK261102_lung_cytoE18_2_step11.1688.1688.1	1.265	0.1547	1202.66	1	5000.0%	1	R.HGKPISSSYVK.D
UNPL1_MOUSE97.5%104025.8%391453454.5(P28656) Nucleosome assembly protein 1-like 1 (NAP-1 related protein) (Brain protein DN38) 
	TK261102_lung_cytoE18_2_step04.0196.0196.1	1.0094	0.0326	753.36	9	7000.0%	1	K.HLKDIK.V
	TK261102_lung_cytoE18_2_step09.5253.5253.3	1.3868	0.1491	4547.04	42	940.0%	6	K.TVSNDSFFNFFAPPEVPENGDLDDDAEAILAADFEIGHFLR.E
	TK261102_lung_cytoE18_2_step07.4332.4332.1	1.6252	0.3224	1486.55	1	4550.0%	1	R.KYAVLYQPLFDK.R
	TK261102_lung_cytoE18_2_step01.1996.1996.1	1.7061	0.2488	1337.69	1	6110.0%	1	K.FYEEVHDLER.K
	TK261102_lung_cytoE18_2_step01.4420.4420.3	1.1298	0.0871	3729.55	5	1290.0%	1	-.MADIDNKEQSELDQDLEDVEEVEEEETGEETK.I
USRC8_MOUSE97.5%336.6%546612605.4(Q60598) Src substrate cortactin 
	TK261102_lung_cytoE18_2_step10.2236.2236.1	1.3716	0.2027	1193.58	42	3330.0%	1	R.ANFENLAKER.E
	TK261102_lung_cytoE18_2_step11.1605.1605.2	2.7727	0.4255	1685.56	1	5710.0%	1	K.TVQGSGHQEHINIHK.L
*	TK261102_lung_cytoE18_2_step04.0719.0719.1	0.6489	0.0286	1217.83	78	2000.0%	1	R.QDSSAVGFDYK.E
UK6A1_MOUSE97.5%577.9%724815958.1(P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) 
	TK261102_lung_cytoE18_2_step12.4984.4984.2	0.8198	0.0765	2644.33	9	1590.0%	1	R.DILADVNHPFVVKLHYAFQTEGK.L
*	TK261102_lung_cytoE18_2_step10.3159.3159.2	2.256	0.4381	1745.04	1	5000.0%	2	R.TTQAPLHSVVQQLHGK.N
	TK261102_lung_cytoE18_2_step08.2915.2915.1	1.3048	0.2811	1063.72	1	6880.0%	1	K.EISITHHVK.A
	TK261102_lung_cytoE18_2_step11.1806.1806.2	1.3148	0.2454	1133.4	1	6880.0%	1	K.MLHVDPHQR.L
USERC_MOUSE97.4%7135.9%370404738.0(Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) 
*	TK261102_lung_cytoE18_2_step11.2524.2524.1	1.3877	0.286	1241.53	2	5500.0%	2	K.KFGTVNIVHPK.L
	TK261102_lung_cytoE18_2_step11.3252.3252.1	2.2996	0.2924	1278.71	1	7000.0%	2	K.LPHSVLLEIQK.Q
UMGN_HUMAN97.3%2410.3%146171646.1(P50606) Mago nashi protein homolog (P50606) Mago nashi protein homolog 
	TK261102_lung_cytoE18_2_step09.4186.4186.2	2.7152	0.4247	1855.88	1	5360.0%	2	K.FGHEFLEFEFRPDGK.L
USNX1_HUMAN97.3%244.8%522590705.1(Q13596) Sorting nexin 1 
*	TK261102_lung_cytoE18_2_step10.5087.5087.2	2.7066	0.4268	3021.34	1	4380.0%	2	K.IEQLHQEQANNDFFLLAELLSDYIR.L
U143G_HUMAN97.3%224.1%246281714.9(P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) 
	TK261102_lung_cytoE18_2_step11.1565.1565.2	2.099	0.3753	1248.08	1	6670.0%	1	K.EHMQPTHPIR.L
UILK1_HUMAN97.2%244.4%452514198.1(Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) 
	TK261102_lung_cytoE18_2_step12.3423.3423.2	1.5197	0.2627	2144.32	2	2370.0%	2	K.VALEGLRPTIPPGISPHVCK.L
UQ9CWR997.2%115.2%231253235.5(Q9CWR9) 2410006O11Rik protein 
	TK261102_lung_cytoE18_2_step12.1589.1589.1	1.794	0.3091	1515.87	1	5910.0%	1	R.VHEHYLVHKPEK.V
UPTPA_MOUSE97.2%51117.3%323367106.4(P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) 
	TK261102_lung_cytoE18_2_step06.2698.2698.1	2.139	0.3152	1256.6	1	5500.0%	3	K.KEIHTVPDMGK.W
*	TK261102_lung_cytoE18_2_step09.2983.2983.3	1.1564	0.0953	3876.24	3	1250.0%	1	K.LDQEAENLVATVVPTHLAAAVPEVAVYLKEAVGNSTR.I
	TK261102_lung_cytoE18_2_step11.2889.2889.1	1.535	0.2511	1015.79	1	6430.0%	1	K.FPVIQHFK.F
USZ15_MOUSE97.2%116.6%167190917.3(Q9WVL7) Small inducible cytokine B15 precursor (CXCL15) (Lungkine) 
*	TK261102_lung_cytoE18_2_step07.2833.2833.1	1.7602	0.3129	1282.67	1	5500.0%	1	R.HFADLAHNSDR.N
UQ9JM1497.2%116.5%200230765.5(Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C) 
	TK261102_lung_cytoE18_2_step10.3083.3083.2	2.9281	0.3721	1636.11	1	6250.0%	1	R.RFPEEPHVPLEQR.R
UO0879497.2%685.2%9661094046.2(O08794) Alpha glucosidase II, alpha subunit 
*	TK261102_lung_cytoE18_2_step06.0516.0516.1	1.3723	0.1114	1351.85	1	4500.0%	1	K.GHLETPIWIER.V
*	TK261102_lung_cytoE18_2_step08.2719.2719.1	1.1287	0.0248	831.47	5	6670.0%	2	R.NHGLYVK.T
	TK261102_lung_cytoE18_2_step05.4676.4676.2	1.2297	0.0752	1854.65	8	3000.0%	1	K.VLLVLELQGLQKNMTR.I
	TK261102_lung_cytoE18_2_step08.2576.2576.2	1.1513	0.0074	1134.3	205	4440.0%	1	R.AHAHLDTGRR.E
*	TK261102_lung_cytoE18_2_step07.3629.3629.1	1.0078	0.0036	814.84	8	5000.0%	1	R.HEFLLR.R
UPSA_MOUSE97.2%556.2%9201033515.9(Q11011) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA) 
	TK261102_lung_cytoE18_2_step05.0583.0583.1	0.778	0.0966	1114.6	70	2500.0%	1	K.NVKPDQWVK.L
	TK261102_lung_cytoE18_2_step08.4665.4665.2	1.5681	0.0176	1875.63	1	4690.0%	1	R.LGWDPKPGEGHLDALLR.G
	TK261102_lung_cytoE18_2_step05.0110.0110.1	2.1081	0.3075	1481.73	1	6360.0%	1	R.MLHDYIGDKDFK.K
	TK261102_lung_cytoE18_2_step06.2028.2028.2	0.9697	0.0771	1360.35	39	3500.0%	1	K.LHKQADMQEEK.N
*	TK261102_lung_cytoE18_2_step08.2209.2209.1	1.4872	0.265	973.65	1	6430.0%	1	R.FKEHVEGK.Q
UCDK4_MOUSE97.1%5712.5%303337516.6(P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) 
*	TK261102_lung_cytoE18_2_step07.2628.2628.2	2.5334	0.4182	1758.56	1	5360.0%	2	R.ALQHSYLHKEESDAE.-
	TK261102_lung_cytoE18_2_step10.3017.3017.1	1.3717	0.2861	1467.83	8	3640.0%	1	R.RLEAFEHPNVVR.L
	TK261102_lung_cytoE18_2_step10.2540.2540.1	1.6094	0.1904	1209.61	1	5000.0%	1	R.DPHSGHFVALK.S
UQ9EPF197.1%338.0%648715125.8(Q9EPF1) L-gicerin/MUC18 
*	TK261102_lung_cytoE18_2_step06.0464.0464.1	1.5258	0.3619	1520.82	1	4550.0%	1	R.LQDHYVELQVFK.A
*	TK261102_lung_cytoE18_2_step04.0450.0450.3	1.2744	0.0071	2621.09	3	2290.0%	1	K.QPVPTPDLVEAEVGSTALLKCGPSR.A
*	TK261102_lung_cytoE18_2_step09.1476.1476.2	1.2	0.0264	1722.62	20	3210.0%	1	K.ESKEVTVPVFYPAEK.V
UQ91V4197.1%3514.0%215238976.2(Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) 
	TK261102_lung_cytoE18_2_step05.0142.0142.2	2.3987	0.4327	3152.3	1	2240.0%	2	K.IYQNIQDGSLDLNAAESGVQHKPSAPQGGR.L
UPRSA_MOUSE97.0%6619.2%442494935.2(O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1) 
	TK261102_lung_cytoE18_2_step04.0059.0059.1	0.8539	0.0084	704.37	60	4000.0%	1	R.SGRLDR.K
	TK261102_lung_cytoE18_2_step06.2610.2610.1	1.0316	0.1418	1056.83	26	3750.0%	1	R.VTHELQAMK.D
	TK261102_lung_cytoE18_2_step04.0379.0379.1	0.7152	0.0099	603.22	97	3750.0%	1	K.SEVLR.V
*	TK261102_lung_cytoE18_2_step08.5425.5425.2	0.8246	0.0944	3198.36	214	930.0%	1	K.MATVWDEAEQDGIGEEVLKMSTEEIVQR.T
	TK261102_lung_cytoE18_2_step07.5245.5245.2	2.3355	0.4303	1961.05	1	4120.0%	1	K.EKAPSIIFIDELDAIGTK.R
	TK261102_lung_cytoE18_2_step04.0375.0375.3	1.1143	0.0965	2012.6	9	2220.0%	1	K.LAGPQLVQMFIGDGAKLVR.D
UQ9DC1497.0%225.1%592648997.5(Q9DC14) 1200007H22Rik protein 
	TK261102_lung_cytoE18_2_step12.1395.1395.1	1.6053	0.3151	1118.69	2	4500.0%	1	K.KPPPPSAPVVK.Q
	TK261102_lung_cytoE18_2_step05.3710.3710.2	1.7611	0.292	1961.93	1	3330.0%	1	K.IDLAGSALSGILDKDLSDR.S
UCRKL_MOUSE97.0%115.0%303338176.7(P47941) Crk-like protein 
	TK261102_lung_cytoE18_2_step06.4100.4100.2	2.1316	0.4916	1741.85	1	4640.0%	1	K.IHYLDTTTLIEPAPR.Y
UROK_MOUSE97.0%5511.6%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) 
	TK261102_lung_cytoE18_2_step01.4123.4123.1	0.9908	0.0767	1341.94	1	4550.0%	1	K.IILDLISESPIK.G
	TK261102_lung_cytoE18_2_step12.2331.2331.1	1.0946	0.0974	1194.85	2	4500.0%	1	R.NLPLPPPPPPR.G
	TK261102_lung_cytoE18_2_step05.0027.0027.2	2.7421	0.3972	1737.17	1	5770.0%	1	K.RPAEDMEEEQAFKR.S
	TK261102_lung_cytoE18_2_step01.1399.1399.1	1.4272	0.2165	729.69	1	6430.0%	1	K.NAGAVIGK.G
	TK261102_lung_cytoE18_2_step01.2227.2227.1	1.4872	0.1759	873.76	1	5620.0%	1	K.DLAGSIIGK.G
UQ8R00196.9%3310.4%326369465.4(Q8R001) Similar to microtubule-associated protein, RP/EB family, member 2 (Hypothetical 36.9 kDa protein) 
	TK261102_lung_cytoE18_2_step06.3478.3478.2	0.974	0.1233	2160.37	1	1840.0%	1	R.QGQDAIPPPDPGEQIFNLPK.K
	TK261102_lung_cytoE18_2_step11.1306.1306.2	1.6713	0.2951	1379.64	1	6150.0%	1	K.KSHHANSPTAGAAK.S
UGDIB_MOUSE96.9%227.9%445505126.4(P50397) Rab GDP dissociation inhibitor beta (Rab GDI beta) (GDI-2) 
	TK261102_lung_cytoE18_2_step01.3779.3779.2	2.7084	0.4003	1779.61	1	6070.0%	1	K.EIRPALELLEPIEQK.F
*	TK261102_lung_cytoE18_2_step09.2755.2755.3	1.1457	0.0037	2438.6	27	2240.0%	1	R.TYDATTHFETTCDDIKDIYK.R
UO0913296.9%51112.0%350401656.8(O09132) A6 gene product 
	TK261102_lung_cytoE18_2_step09.3298.3298.1	1.5303	0.0521	1454.77	2	4170.0%	3	K.HQTLQGVAFPISR.D
	TK261102_lung_cytoE18_2_step12.3601.3601.2	0.9837	0.1376	2562.81	1	1670.0%	1	R.KIEIDNGDELTADFLYDEVHPK.Q
	TK261102_lung_cytoE18_2_step11.3728.3728.1	1.5598	0.1821	1017.75	3	5830.0%	1	R.YHFFLYK.H
UIRE1_MOUSE96.8%5513.8%889981407.5(P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) 
*	TK261102_lung_cytoE18_2_step01.4823.4823.3	1.5321	0.0869	4386.28	21	1040.0%	1	R.KTFLYSNSEFTLAHGSVVIAAITTCTNTSNPSVMLGAGLLAK.K
	TK261102_lung_cytoE18_2_step08.4753.4753.3	1.2706	0.1123	4711.33	25	990.0%	1	K.SPPFFESLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIAR.N
	TK261102_lung_cytoE18_2_step07.4704.4704.2	3.0332	0.264	1996.86	1	5330.0%	1	K.KNDIENILNWNVMQHK.N
	TK261102_lung_cytoE18_2_step07.4422.4422.3	1.5071	0.0838	2915.18	9	1670.0%	1	K.SIVDAYVLLNLGDSVTTDHISPAGNIAR.N
	TK261102_lung_cytoE18_2_step01.3963.3963.2	1.4528	0.3352	2424.07	1	3750.0%	1	K.INPVCPADLVIDHSIQVDFNR.R
UQ99JK296.8%224.6%438498416.9(Q99JK2) Hypothetical 49.8 kDa protein 
*	TK261102_lung_cytoE18_2_step10.2413.2413.1	1.8386	0.3059	1167.87	1	6110.0%	1	K.KVHLTENGLR.M
*	TK261102_lung_cytoE18_2_step08.3121.3121.1	1.1865	0.04	1166.38	1	3330.0%	1	R.QGDSCESIIR.R
UR37A_HUMAN96.7%93523.1%911014410.4(P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a 
	TK261102_lung_cytoE18_2_step01.0080.0080.1	1.3377	0.0026	632.02	8	7500.0%	1	R.LKELK.D
	TK261102_lung_cytoE18_2_step09.2123.2123.1	2.1171	0.2626	1055.65	1	6880.0%	3	K.KIEISQHAK.Y
	TK261102_lung_cytoE18_2_step08.2532.2532.1	1.0826	0.1661	702.54	1	5000.0%	5	K.KVGIVGK.Y
UQ6391896.5%112.6%418467645.2(Q63918) Serum deprivation response (Sdpr protein) 
	TK261102_lung_cytoE18_2_step11.1968.1968.2	2.7574	0.3838	1364.22	1	8500.0%	1	K.RLENNHAQLLR.R
UDYI2_MOUSE96.5%469.6%612683945.3(O88487) Dynein intermediate chain 2, cytosolic (DH IC-2) (Cytoplasmic dynein intermediate chain 2) 
	TK261102_lung_cytoE18_2_step12.2453.2453.1	0.9421	0.2029	1343.26	65	2500.0%	1	R.ADAEEEAATRIPA.-
	TK261102_lung_cytoE18_2_step08.5235.5235.2	2.1704	0.4408	2223.21	1	4120.0%	2	K.QQILHSEEFLSFFDHSTR.I
*	TK261102_lung_cytoE18_2_step07.4729.4729.3	1.8601	0.0054	2940.27	31	1760.0%	1	R.REAEALLQSMGLTTDSPIVPPPMSPSSK.S
UDNPE_MOUSE96.5%7917.1%473521677.1(Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21) 
	TK261102_lung_cytoE18_2_step12.3045.3045.1	1.675	0.2534	1198.89	6	5000.0%	2	R.IPHLAIHLQR.N
*	TK261102_lung_cytoE18_2_step01.5011.5011.2	1.7759	0.2527	3135.62	1	2040.0%	1	R.NINENFGPNTEIHLVPILATAVQEELEK.G
*	TK261102_lung_cytoE18_2_step04.0532.0532.1	0.9977	0.1813	915.43	17	5710.0%	1	R.RISASPQR.L
*	TK261102_lung_cytoE18_2_step10.0150.0150.3	0.9592	0.0027	4515.11	8	730.0%	1	R.NINENFGPNTEIHLVPILATAVQEELEKGTPEPGPLGATDER.H
*	TK261102_lung_cytoE18_2_step10.3464.3464.3	1.7148	0.035	2426.44	1	2760.0%	1	R.LVHIERPILRIPHLAIHLQR.N
*	TK261102_lung_cytoE18_2_step03.0284.0284.2	1.2429	0.1776	1198.77	42	4500.0%	1	R.DLTLAGRVIIK.C
UPSA2_MOUSE96.4%61218.9%233257948.3(P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) 
	TK261102_lung_cytoE18_2_step10.2068.2068.2	1.1938	0.1961	1138.06	11	4440.0%	1	R.SVHKVEPITK.H
	TK261102_lung_cytoE18_2_step07.3834.3834.1	1.5834	0.3114	1567.0	1	3850.0%	3	K.HIGLVYSGMGPDYR.V
	TK261102_lung_cytoE18_2_step11.4809.4809.2	1.1454	0.0686	2360.94	13	2110.0%	1	K.RYNEDLELEDAIHTAILTLK.E
UQ9Z2X196.4%3311.3%415457305.5(Q9Z2X1) Ribonucleoprotein F 
	TK261102_lung_cytoE18_2_step06.3258.3258.2	2.827	0.3674	2213.87	1	4720.0%	1	R.YGDSEFTVQSTTGHCVHMR.G
	TK261102_lung_cytoE18_2_step02.3938.3938.2	0.8103	0.0303	1402.84	4	3000.0%	1	K.SHRTEMDWVLK.H
	TK261102_lung_cytoE18_2_step12.2043.2043.2	1.5111	0.0586	1936.08	4	3120.0%	1	K.FMSVQRPGPYDRPGTAR.R
UMY9B_HUMAN96.4%685.1%21582435558.7(Q13459) Myosin IXb (Unconventional myosin-9b) 
*	TK261102_lung_cytoE18_2_step06.4290.4290.3	1.059	0.0732	4098.75	209	850.0%	1	R.AGAEEGGQGQAAGGQQVAEQGPEPAEDGGHLASEPEVQPSDR.S
*	TK261102_lung_cytoE18_2_step07.5242.5242.2	0.9874	0.0344	2832.91	3	1900.0%	1	R.GASEGPPAPALPCPGAPTPSPLPTVAAPPR.R
*	TK261102_lung_cytoE18_2_step11.1570.1570.3	2.1785	0.2689	1772.07	1	3120.0%	1	K.GLEAPSGQQHRHAAGEK.R
*	TK261102_lung_cytoE18_2_step11.2317.2317.2	1.0739	0.1303	1247.05	7	4090.0%	1	K.AQPAAETTDGER.S
*	TK261102_lung_cytoE18_2_step01.2727.2727.1	2.45	0.2024	1156.01	2	6250.0%	2	K.YLDEFLLNK.I
UQ9D1G196.4%117.5%201221875.7(Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) 
	TK261102_lung_cytoE18_2_step09.2058.2058.2	2.4864	0.4236	1444.17	1	5000.0%	1	R.MGPGAASGGERPNLK.I
UFSC1_HUMAN96.4%463.9%492543997.2(Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) 
	TK261102_lung_cytoE18_2_step12.3439.3439.2	2.4863	0.4216	1242.21	1	7780.0%	2	K.LINRPIIVFR.G
	TK261102_lung_cytoE18_2_step06.2876.2876.1	1.2144	0.1305	1034.41	1	5620.0%	1	R.GEHGFIGCR.K
UQ9NPL896.4%41014.4%285321938.2(Q9NPL8) C3orf1 hypothetical protein 
	TK261102_lung_cytoE18_2_step10.5001.5001.3	3.2912	0.0994	3008.84	1	2330.0%	3	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
	TK261102_lung_cytoE18_2_step11.3058.3058.1	1.257	0.0049	1168.01	41	3890.0%	1	K.KIEALLNLPR.N
UPSD9_MOUSE96.4%3510.4%222247206.4(Q9CR00) 26S proteasome non-ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27) 
	TK261102_lung_cytoE18_2_step09.2698.2698.1	1.6254	0.2697	1392.72	1	6000.0%	2	R.HNIICLQNDHK.A
	TK261102_lung_cytoE18_2_step07.3065.3065.2	2.4854	0.4125	1432.1	1	6820.0%	1	K.QVEEALHQLHAR.D
UAGM1_MOUSE96.4%4415.5%542594536.2(Q9CYR6) Phosphoacetylglucosamine mutase (EC 5.4.2.3) (PAGM) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase) 
	TK261102_lung_cytoE18_2_step07.4258.4258.3	1.0367	0.0541	4768.35	6	980.0%	1	R.DTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMVYCR.N
*	TK261102_lung_cytoE18_2_step09.3819.3819.2	1.1003	0.1216	3133.67	17	1380.0%	1	R.TLASIIDLFNQAAGDAISDMLVIEAILALK.G
*	TK261102_lung_cytoE18_2_step10.3235.3235.1	1.944	0.3006	1482.79	1	4550.0%	1	R.TNAQHLDHIMFR.M
UKAC_MOUSE96.3%41010.4%106117785.4(P01837) Ig kappa chain C region 
	TK261102_lung_cytoE18_2_step06.2132.2132.1	1.8447	0.2953	1349.55	1	5000.0%	3	R.HNSYTCEATHK.T
UDNPE_HUMAN96.3%5711.6%475524287.4(Q9ULA0) Aspartyl aminopeptidase (EC 3.4.11.21) 
	TK261102_lung_cytoE18_2_step01.4755.4755.3	0.9801	0.0065	3056.47	29	930.0%	1	R.MVTLYDNEEVGSESAQGAQSLLTELVLR.R
	TK261102_lung_cytoE18_2_step12.1668.1668.1	1.8292	0.293	1445.94	2	4500.0%	2	K.HEENHRPLFHK.G
	TK261102_lung_cytoE18_2_step06.2920.2920.2	1.0242	0.0325	1814.52	3	3000.0%	1	R.EMACTTGVLQTLTLFK.G
UROA2_MOUSE96.3%7218.2%341359938.6(O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) 
	TK261102_lung_cytoE18_2_step07.2198.2198.2	2.3902	0.4001	1414.41	1	6820.0%	2	K.YHTINGHNAEVR.K
	TK261102_lung_cytoE18_2_step01.4314.4314.2	0.9161	0.223	1879.22	6	2000.0%	1	K.LFVGGIKEDTEEHHLR.D
UPRS7_MOUSE96.3%11478.3%433486485.9(P46471) 26S protease regulatory subunit 7 (MSS1 protein) 
	TK261102_lung_cytoE18_2_step07.2614.2614.1	1.1771	0.2323	646.62	2	7500.0%	3	R.THIFK.I
	TK261102_lung_cytoE18_2_step11.3241.3241.1	1.8539	0.2973	1207.75	1	6670.0%	1	K.YQIHIPLPPK.I
	TK261102_lung_cytoE18_2_step10.1045.1045.1	1.0623	0.0932	497.06	4	8330.0%	6	K.IHAR.S
	TK261102_lung_cytoE18_2_step11.3929.3929.2	1.1177	0.245	1743.57	26	2500.0%	1	K.GVLLFGPPGTGKTLCAR.A
UHBB_HUMAN96.3%118.2%146158677.3(P02023) Hemoglobin beta chain 
	TK261102_lung_cytoE18_2_step01.0274.0274.1	1.6327	0.2944	1150.12	3	5000.0%	1	K.VVAGVANALAHK.Y
UQ9CSN896.3%114.1%369422218.5(Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) 
	TK261102_lung_cytoE18_2_step11.2428.2428.2	2.4756	0.4266	1794.48	1	5360.0%	1	K.LITQTFNHHNQLAQK.A
URLA0_MOUSE96.3%119.8%317342166.2(P14869) 60S acidic ribosomal protein P0 (L10E) 
*	TK261102_lung_cytoE18_2_step01.3170.3170.2	2.6996	0.3894	2698.14	1	3330.0%	1	K.AFLADPSAFAAAAPAAAATTAAPAAAAAPAK.A
UQ9CTB996.2%248.2%195224399.6(Q9CTB9) 1110030K07Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step08.3583.3583.2	1.184	0.1344	1865.43	1	3330.0%	2	R.TQIALSPNNHEVHIYK.K
UQ9D1J196.1%117.1%266285988.0(Q9D1J1) 1110005F07Rik protein 
*	TK261102_lung_cytoE18_2_step12.2988.2988.2	2.4182	0.4194	1773.84	1	5280.0%	1	R.ARPTSAGGLSLLPPPPGGK.S
UIF3A_MOUSE96.1%131511.5%13441619506.8(P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin) 
*	TK261102_lung_cytoE18_2_step10.3464.3464.2	2.1115	0.3253	1617.96	1	5380.0%	2	K.AIEVIRPAHILQEK.E
	TK261102_lung_cytoE18_2_step11.2924.2924.1	1.3668	0.1099	1005.5	4	4380.0%	1	R.ANEFLEVGK.K
	TK261102_lung_cytoE18_2_step06.2586.2586.1	1.0289	0.1352	1261.7	1	4000.0%	1	R.RGPAEESSSWR.D
	TK261102_lung_cytoE18_2_step11.2353.2353.2	1.892	0.3515	2658.39	1	3860.0%	1	R.HHNQSTAINLNNPESQSMHLETR.L
	TK261102_lung_cytoE18_2_step08.3000.3000.1	0.9567	0.0182	1012.79	55	3570.0%	1	R.MHLSQIQR.H
	TK261102_lung_cytoE18_2_step09.4833.4833.3	1.7252	0.0893	4277.44	5	1280.0%	1	K.EESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDR.L
	TK261102_lung_cytoE18_2_step09.1572.1572.3	1.2207	0.0275	2342.54	7	2650.0%	1	K.DLYNWLEVEFNPLKLCER.V
*	TK261102_lung_cytoE18_2_step06.2642.2642.2	1.3699	0.0151	1362.74	1	5000.0%	1	R.RGTDDDRPSWR.N
	TK261102_lung_cytoE18_2_step01.1767.1767.1	1.3698	0.0885	1518.69	3	4170.0%	1	K.KQPALDVLYDVMK.S
	TK261102_lung_cytoE18_2_step06.1395.1395.1	0.6736	0.0596	557.25	36	3750.0%	1	K.SHLAK.E
	TK261102_lung_cytoE18_2_step09.1542.1542.1	0.6805	0.0408	539.61	8	5000.0%	1	R.GPPLR.S
UQ96LJ296.0%3317.7%361408217.2(Q96LJ2) Hypothetical protein FLJ25439 
*	TK261102_lung_cytoE18_2_step11.2977.2977.2	0.8931	0.2954	1808.34	14	2330.0%	1	K.CARAPANLAYGYLTLR.G
*	TK261102_lung_cytoE18_2_step01.0324.0324.2	1.1146	0.0303	2408.87	6	2000.0%	1	K.GDRTSDLISLYEEAAQIEQLR.R
*	TK261102_lung_cytoE18_2_step10.4576.4576.3	2.7625	0.4371	3157.51	1	2400.0%	1	R.RNHNQAIQYLQQAHSVCVSLFTEVSPK.T
UMIF_MOUSE96.0%73715.8%114123737.3(P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) 
	TK261102_lung_cytoE18_2_step06.0130.0130.1	2.3048	0.2448	1287.92	1	6500.0%	1	-.PMFIVNTNVPR.A
*	TK261102_lung_cytoE18_2_step07.2341.2341.1	1.1631	0.2472	839.34	1	5830.0%	6	R.LHISPDR.V
URL18_MOUSE95.9%115.3%1872151311.8(P35980) 60S ribosomal protein L18 
	TK261102_lung_cytoE18_2_step09.2590.2590.2	2.5688	0.3981	1141.6	1	7780.0%	1	R.TNRPPLSLSR.M
UP2CA_MOUSE95.9%449.4%382424335.4(P49443) Protein phosphatase 2C alpha isoform (EC 3.1.3.16) (PP2C-alpha) (IA) (Protein phosphatase 1A) 
	TK261102_lung_cytoE18_2_step10.1097.1097.1	0.7206	0.0754	553.56	10	5000.0%	1	K.HGADR.S
	TK261102_lung_cytoE18_2_step08.2021.2021.2	1.2356	0.1304	1556.92	8	3460.0%	1	K.ERIQNAGGSVMIQR.V
	TK261102_lung_cytoE18_2_step11.2921.2921.2	2.5138	0.4044	1925.62	1	4670.0%	1	K.VHFFTQDHKPSNPLEK.E
	TK261102_lung_cytoE18_2_step11.1389.1389.1	1.0798	0.1532	681.91	14	6000.0%	1	K.KHGADR.S
UFLIH_HUMAN95.8%448.0%12691447516.1(Q13045) Flightless-I protein homolog 
*	TK261102_lung_cytoE18_2_step01.4470.4470.3	1.2012	0.1675	4059.25	54	810.0%	1	K.NMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENR.L
*	TK261102_lung_cytoE18_2_step01.2922.2922.2	0.776	0.1107	2210.3	36	830.0%	1	R.LAGASPATVAAAAAAGSGPKDPMAR.K
*	TK261102_lung_cytoE18_2_step11.2845.2845.2	2.3644	0.4097	1916.22	1	5360.0%	1	R.FVFLLDRGLDIYVWR.G
*	TK261102_lung_cytoE18_2_step11.4853.4853.3	2.3822	0.1303	3064.84	5	1900.0%	1	K.LTNLEEFMAANNNLELVPESLCRCPK.L
UQ8VCQ895.8%113.8%530604537.4(Q8VCQ8) Similar to caldesmon 1 
*	TK261102_lung_cytoE18_2_step11.2172.2172.2	2.3486	0.4232	2021.88	1	4210.0%	1	K.ASKPMKPAASDLPVPAEGVR.N
UQ9D0K495.8%1110.0%241255707.8(Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase) 
	TK261102_lung_cytoE18_2_step01.4088.4088.2	2.0964	0.5474	2397.19	1	3480.0%	1	K.NSGMPPGAAAIAVLPVTLDTPMNR.K
UFINC_HUMAN95.7%684.7%23862626045.7(P02751) Fibronectin precursor (FN) (Cold-insoluble globulin) (CIG) 
*	TK261102_lung_cytoE18_2_step01.0409.0409.3	1.2932	0.0726	4488.23	2	1040.0%	1	K.GNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPR.I
	TK261102_lung_cytoE18_2_step11.2725.2725.3	1.3908	0.0839	2990.77	69	1540.0%	2	K.RQAQQMVQPQSPVAVSQSKPGCYDNGK.H
	TK261102_lung_cytoE18_2_step06.3098.3098.1	1.8386	0.2894	1402.74	1	6110.0%	1	K.HYQINQQWER.T
	TK261102_lung_cytoE18_2_step10.1120.1120.1	0.5601	0.0059	732.21	8	3000.0%	1	K.YVHGVR.Y
*	TK261102_lung_cytoE18_2_step06.5129.5129.3	1.0628	0.0858	2635.52	34	1200.0%	1	K.TGPMKEINLAPDSSSVVVSGLMVATK.Y
UTLE4_MOUSE95.7%224.2%766829437.4(Q62441) Transducin-like enhancer protein 4 (Groucho-related protein 4) 
*	TK261102_lung_cytoE18_2_step09.2974.2974.2	1.0124	0.0189	1773.96	22	2220.0%	1	K.DAPISPASVASSSSTPSSK.S
	TK261102_lung_cytoE18_2_step12.2144.2144.2	2.1146	0.4374	1517.89	1	6250.0%	1	R.SPVVGFDPHHHMR.V
UQ9D3R695.7%242.9%409461318.0(Q9D3R6) 4933439B08Rik protein 
	TK261102_lung_cytoE18_2_step01.2652.2652.1	1.5546	0.3093	1174.14	1	5000.0%	2	K.GLLLYGPPGTGK.T
UQ9D08395.6%2223.4%201234164.6(Q9D083) 2410030K01Rik protein 
*	TK261102_lung_cytoE18_2_step12.5359.5359.3	0.995	0.0371	2813.44	2	1880.0%	1	R.DVDEDNTVTIPSAVYVAHLYHQISK.I
*	TK261102_lung_cytoE18_2_step12.2657.2657.2	2.6954	0.3698	2303.39	1	4520.0%	1	K.GIHHGPTVAQPIHLDSAQLSPK.F
UZO1_MOUSE95.6%888.0%17451947106.7(P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) 
	TK261102_lung_cytoE18_2_step10.3560.3560.3	0.9473	0.0026	3752.77	3	1470.0%	1	K.RYDPAQATPPPPPLPSQYSQPAPPLSSSSLHIHSK.G
	TK261102_lung_cytoE18_2_step01.3327.3327.2	1.6161	0.0302	1669.73	32	3080.0%	1	R.DLDSRQHPEEASER.G
	TK261102_lung_cytoE18_2_step11.4933.4933.3	1.6659	0.1369	3963.75	1	1620.0%	1	K.DVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDK.T
*	TK261102_lung_cytoE18_2_step06.2513.2513.1	1.8102	0.1882	1290.72	14	4550.0%	1	R.DGDIQEGDVVLK.I
	TK261102_lung_cytoE18_2_step11.2709.2709.2	2.5708	0.3869	2178.28	1	5000.0%	1	K.FNHNLLPSETVHKPELSSK.T
*	TK261102_lung_cytoE18_2_step08.2528.2528.1	0.9301	0.0466	1479.83	13	3180.0%	1	R.YEVSSYTDQFSR.N
	TK261102_lung_cytoE18_2_step08.3653.3653.1	0.8109	0.0065	431.28	3	6670.0%	1	K.QGVK.T
	TK261102_lung_cytoE18_2_step09.2235.2235.1	1.0735	0.0765	611.74	4	6250.0%	1	R.LHTIK.Q
UIF6_MOUSE95.6%247.3%245265114.7(O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP)) 
	TK261102_lung_cytoE18_2_step10.3267.3267.2	1.6738	0.2078	2086.32	1	3820.0%	2	R.HGLLVPNNTTDQELQHIR.N
UQ9H85395.5%9455.0%241275468.4(Q9H853) Hypothetical protein FLJ13940 
*	TK261102_lung_cytoE18_2_step01.3142.3142.2	1.7345	0.3963	1413.62	5	4550.0%	6	R.QIFHPEQLITGK.E
UFSC1_MOUSE95.3%5179.3%492542746.7(Q61553) Fascin (Singed-like protein) 
*	TK261102_lung_cytoE18_2_step07.4360.4360.2	2.3516	0.2936	1805.27	1	4670.0%	4	R.LVARPEPATGFTLEFR.S
*	TK261102_lung_cytoE18_2_step08.5509.5509.3	1.2166	0.1176	3492.67	1	1290.0%	1	K.YWTLTATGGVQSTASTKNASCYFDIEWCDR.R
UQ99J9995.2%225.1%297330236.6(Q99J99) Similar to thiosulfate sulfurtransferase (Rhodanese) 
*	TK261102_lung_cytoE18_2_step11.3485.3485.2	2.2463	0.4144	1602.47	1	5710.0%	1	R.AFGHHSVSLLDGGFR.H
UQ91X9495.2%353.5%257292839.3(Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) 
	TK261102_lung_cytoE18_2_step11.1745.1745.1	1.5168	0.3073	1045.6	1	6250.0%	1	K.KYHNVGLSK.C
	TK261102_lung_cytoE18_2_step07.2232.2232.1	1.7205	0.1916	917.61	1	6430.0%	2	K.YHNVGLSK.C
UQ9CZP195.2%5720.3%305337995.4(Q9CZP1) 2700038L12Rik protein 
	TK261102_lung_cytoE18_2_step08.4045.4045.3	1.7292	0.0422	3423.74	19	1530.0%	1	K.QMKSIDAGPVDAWTLAFSPDSQYLATGTHMGK.V
	TK261102_lung_cytoE18_2_step07.4470.4470.2	1.5906	0.2649	2119.69	1	3440.0%	1	R.TCIHTFFDHQDQVWGVK.Y
	TK261102_lung_cytoE18_2_step11.2865.2865.1	1.5718	0.2991	1487.81	1	4580.0%	1	K.LLHTLEGHAMPIR.S
UQ9D6F995.1%359.9%444495284.9(Q9D6F9) Tubulin, beta 4 
	TK261102_lung_cytoE18_2_step01.3500.3500.2	1.1403	0.026	3118.49	8	1730.0%	2	K.FWEVISDEHGIDPTGTYHGDSDLQLER.I
	TK261102_lung_cytoE18_2_step01.1870.1870.2	2.2227	0.4148	1823.97	1	5000.0%	1	R.EIVHLQAGQCGNQIGAK.F
UQ9P2F695.0%335.7%11941330158.0(Q9P2F6) Hypothetical protein KIAA1391 (Fragment) 
*	TK261102_lung_cytoE18_2_step11.4873.4873.3	1.296	0.2399	4752.86	3	890.0%	1	K.LTDMWTASCVDEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQK.D
*	TK261102_lung_cytoE18_2_step03.3833.3833.2	0.6145	0.0093	1425.55	257	1250.0%	1	K.AARPEEEKIASPK.G
*	TK261102_lung_cytoE18_2_step11.3054.3054.1	1.9668	0.272	1520.84	2	4090.0%	1	R.RCSEPNIEDQNR.K
UP2CB_MOUSE95.0%4416.4%390427955.2(P36993) Protein phosphatase 2C beta isoform (EC 3.1.3.16) (PP2C-beta) (IA) (Protein phosphatase 1B) 
	TK261102_lung_cytoE18_2_step10.2015.2015.1	1.1112	0.0067	1230.77	114	3890.0%	1	K.RHVIEAVYSR.L
	TK261102_lung_cytoE18_2_step06.2926.2926.1	1.0134	0.1137	1074.54	1	5000.0%	1	R.HVIEAVYSR.L
	TK261102_lung_cytoE18_2_step06.0895.0895.3	1.2104	0.0372	4752.89	4	1190.0%	1	R.YGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSR.V
	TK261102_lung_cytoE18_2_step10.1637.1637.1	1.9216	0.2782	1104.53	1	7500.0%	1	K.HNAHGAGNGLR.Y
UQ9Y5B095.0%221.1%9611042965.3(Q9Y5B0) RNA polymerase II CTD phosphatase 
	TK261102_lung_cytoE18_2_step09.2215.2215.2	1.4074	0.1664	1198.97	1	5500.0%	1	R.EHYHATALGAK.I
UQ9DAH094.9%3317.2%279319247.6(Q9DAH0) Four and a half LIM domains 4 
*	TK261102_lung_cytoE18_2_step11.4297.4297.3	1.4466	0.0123	4198.76	42	1030.0%	1	K.DGANYCVTCFDSHCANICQECHKPIGADSKEVCYK.E
	TK261102_lung_cytoE18_2_step01.1932.1932.1	1.6889	0.2778	833.64	1	7140.0%	1	K.NPITGFGK.G
	TK261102_lung_cytoE18_2_step07.1690.1690.1	1.2646	0.0336	665.67	3	6250.0%	1	K.KYVQK.D
UTCP1_MOUSE94.9%688.5%556603416.1(P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) 
	TK261102_lung_cytoE18_2_step08.1896.1896.3	1.7615	0.178	1534.9	36	2310.0%	1	K.SLKFATEAAITILR.I
*	TK261102_lung_cytoE18_2_step12.2947.2947.1	0.9648	0.1502	1161.76	14	2780.0%	1	R.YPINSVNILK.A
	TK261102_lung_cytoE18_2_step11.3753.3753.1	1.6886	0.279	1391.06	1	5450.0%	1	K.WIGLDLVHGKPR.D
	TK261102_lung_cytoE18_2_step08.3435.3435.1	1.3299	0.2127	1231.6	9	4000.0%	2	K.IHPTSVISGYR.L
UAP19_MOUSE94.9%247.2%111121629.1(P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) 
	TK261102_lung_cytoE18_2_step07.2126.2126.1	1.7652	0.2785	829.71	1	6430.0%	2	R.KPSLVASK.L
UPFTB_HUMAN94.9%111.6%437487745.8(P49356) Protein farnesyltransferase beta subunit (EC 2.5.1.-) (CAAX farnesyltransferase beta subunit) (RAS proteins prenyltransferase beta) (FTase-beta) 
*	TK261102_lung_cytoE18_2_step10.2508.2508.1	1.7984	0.2727	882.53	2	7500.0%	1	K.FNHLVPR.L
UHDGF_MOUSE94.8%103043.0%237262694.8(P51859) Hepatoma-derived growth factor (HDGF) 
*	TK261102_lung_cytoE18_2_step01.2846.2846.3	2.8925	0.1962	3038.02	1	2980.0%	1	K.ESGDHEEEDKEIAALEGERPLPVEVEK.N
	TK261102_lung_cytoE18_2_step09.0119.0119.2	1.2507	0.1334	2759.48	7	1670.0%	1	K.GFSEGLWEIENNPTVKASGYQSSQK.K
	TK261102_lung_cytoE18_2_step06.0504.0504.2	2.8312	0.3165	1949.03	1	4690.0%	1	R.KGFSEGLWEIENNPTVK.A
	TK261102_lung_cytoE18_2_step08.3457.3457.1	1.4207	0.313	985.63	4	5710.0%	5	K.GYPHWPAR.I
*	TK261102_lung_cytoE18_2_step12.3107.3107.3	0.9764	0.1012	3640.0	2	1100.0%	1	K.NSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVR.D
	TK261102_lung_cytoE18_2_step10.1632.1632.1	1.0751	0.0891	690.54	4	6000.0%	1	K.FGKPNK.R
UVDP_MOUSE94.8%7913.0%9411051534.9(Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment) 
*	TK261102_lung_cytoE18_2_step09.2714.2714.3	1.3539	0.0167	1472.78	21	2710.0%	1	R.LLDIITEEGNSDR.G
*	TK261102_lung_cytoE18_2_step01.5698.5698.2	1.0581	0.0373	3122.53	14	1790.0%	1	K.VTNLHLMLQLVRVLGSPTNPPGATSSCQK.A
	TK261102_lung_cytoE18_2_step06.2942.2942.1	1.3159	0.258	1598.46	2	3750.0%	1	K.TLEQHDNIVTHYK.N
	TK261102_lung_cytoE18_2_step01.2094.2094.3	1.1632	0.1621	2399.72	1	2500.0%	1	K.QPENVTLLLSLLEEFDFHVR.W
	TK261102_lung_cytoE18_2_step08.2863.2863.2	2.8129	0.31	2583.91	1	4130.0%	1	K.DNHHQGSHGDGAQVNGIQPEEISR.L
	TK261102_lung_cytoE18_2_step08.4923.4923.2	2.0268	0.3684	2739.86	1	3410.0%	2	R.ASQKPQPNFPSPEYMIFDHEFTK.L
UQ9CR4994.8%226.8%147161468.2(Q9CR49) Hemoglobin Y, beta-like embryonic chain 
*	TK261102_lung_cytoE18_2_step10.3999.3999.1	1.449	0.1562	1285.79	15	3890.0%	1	R.LLVVYPWTHR.F
UGRB2_MOUSE94.7%117.8%217252386.3(Q60631) Growth factor receptor-bound protein 2 (GRB2 adapter protein) (SH2/SH3 adapter GRB2) 
	TK261102_lung_cytoE18_2_step09.4099.4099.2	2.3835	0.3991	2119.3	1	4060.0%	1	R.RGDFIHVMDNSDPNWWK.G
URL4_MOUSE94.7%104011.0%4194715411.0(Q9D8E6) 60S ribosomal protein L4 (L1) 
	TK261102_lung_cytoE18_2_step09.1483.1483.1	1.0109	0.1872	599.7	6	5000.0%	6	K.KPAVGK.K
	TK261102_lung_cytoE18_2_step07.2661.2661.1	1.1978	0.1033	1103.64	8	4380.0%	1	K.SNYNLPMHK.M
	TK261102_lung_cytoE18_2_step05.0278.0278.1	1.6854	0.1155	1281.87	1	5560.0%	1	R.KLDELYGTWR.K
	TK261102_lung_cytoE18_2_step07.1853.1853.1	1.2792	0.1033	599.58	10	6250.0%	1	K.KNPLK.N
	TK261102_lung_cytoE18_2_step12.3631.3631.2	2.6864	0.3413	1862.99	1	4670.0%	1	K.APIRPDIVNFVHTNLR.K
UPSA1_MOUSE94.6%168836.1%263295476.4(Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) 
*	TK261102_lung_cytoE18_2_step10.4505.4505.2	1.1675	0.2578	2988.6	3	2080.0%	1	K.DLEFTIYDDDDVSPFLDGLEERPQR.K
	TK261102_lung_cytoE18_2_step06.4182.4182.1	0.9121	0.0022	1335.7	60	2500.0%	1	R.FVFDRPLPVSR.L
	TK261102_lung_cytoE18_2_step10.3476.3476.1	1.0838	0.0957	1240.68	5	5000.0%	1	K.RAQSELAAHQK.K
	TK261102_lung_cytoE18_2_step06.3648.3648.1	2.1336	0.1852	1431.64	1	5450.0%	1	R.IHQIEYAMEAVK.Q
	TK261102_lung_cytoE18_2_step07.3501.3501.1	1.6647	0.0737	954.2	1	5620.0%	9	K.THAVLVALK.R
	TK261102_lung_cytoE18_2_step04.2489.2489.2	0.8753	0.0174	3025.41	2	1730.0%	1	K.ILHVDNHIGISIAGLTADARLLCNFMR.Q
UQ6116794.6%114.4%225256785.7(Q61167) APC-binding protein EB2 (Fragment) 
	TK261102_lung_cytoE18_2_step07.3161.3161.1	2.0556	0.2568	1330.59	1	6670.0%	1	K.LEHEYIHNFK.V
UHXB3_MOUSE94.6%4109.7%433443539.2(P09026) Homeobox protein Hox-B3 (Hox-2.7) (MH-23) 
*	TK261102_lung_cytoE18_2_step01.2991.2991.2	0.8893	0.1491	3121.62	48	980.0%	3	K.LKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDK.S
UTDBP_MOUSE94.4%115.8%414445486.7(Q921F2) TAR DNA-binding protein-43 (TDP-43) 
	TK261102_lung_cytoE18_2_step06.5348.5348.2	2.3246	0.4	2626.03	1	3480.0%	1	R.LVEGILHAPDAGWGNLVYVVNYPK.D
UQ9D8F994.4%2214.7%170195064.9(Q9D8F9) 2010003J03Rik protein 
	TK261102_lung_cytoE18_2_step09.1546.1546.1	0.911	0.0172	524.62	18	6670.0%	1	K.NHVR.S
*	TK261102_lung_cytoE18_2_step10.3416.3416.2	2.3237	0.3967	2410.27	1	3500.0%	1	K.HVVQEVLGEHMVPSDHQQIVK.V
UMYHB_MOUSE94.4%885.4%19722270265.5(O08638) Myosin heavy chain, smooth muscle isoform (SMMHC) 
	TK261102_lung_cytoE18_2_step03.0236.0236.1	0.7032	0.0647	562.03	5	5000.0%	1	R.AARNK.A
	TK261102_lung_cytoE18_2_step05.3517.3517.1	0.9364	0.1392	1222.88	10	3000.0%	1	R.ASRDEIFATSK.E
	TK261102_lung_cytoE18_2_step06.4694.4694.2	2.3075	0.3477	2087.92	1	5310.0%	1	K.HTQAVEELTEQLEQFKR.A
	TK261102_lung_cytoE18_2_step11.2945.2945.2	0.7952	0.0848	2257.53	2	2500.0%	1	K.IRELEGHISDLQEDLDSER.A
	TK261102_lung_cytoE18_2_step07.2129.2129.1	0.9349	0.0231	787.51	206	4000.0%	1	R.KLLEER.V
	TK261102_lung_cytoE18_2_step10.2760.2760.3	1.1621	0.0246	1843.99	77	2320.0%	1	R.LQKEMEGLSQQYEEK.A
	TK261102_lung_cytoE18_2_step08.1944.1944.1	0.9521	0.1656	1060.69	2	3750.0%	1	R.QLVSNLEKK.Q
	TK261102_lung_cytoE18_2_step01.4212.4212.2	2.0433	0.4913	2671.31	1	3480.0%	1	R.KLEGDASDFHEQIADLQAQIAELK.M
UBUB3_MOUSE94.4%248.6%326369856.7(Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5) 
	TK261102_lung_cytoE18_2_step08.4704.4704.2	2.4769	0.389	3190.23	1	2590.0%	2	K.YQHTGAVLDCAFYDPTHAWSGGLDHQLK.M
UO8830694.4%6364.6%173183526.3(O88306) DJ-1 
	TK261102_lung_cytoE18_2_step07.1953.1953.1	1.7388	0.2393	868.72	1	5710.0%	6	K.VTTHPLAK.D
UQ9CR1594.3%4419.9%408457956.2(Q9CR15) 1110014J22Rik protein 
*	TK261102_lung_cytoE18_2_step08.5695.5695.3	0.9441	0.0387	4101.97	27	760.0%	1	R.MTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSR.F
*	TK261102_lung_cytoE18_2_step09.4082.4082.2	0.7539	0.0788	2840.41	6	1300.0%	1	R.QYLRICTVQPNPDYGGAITFLEER.A
*	TK261102_lung_cytoE18_2_step11.3142.3142.1	1.8946	0.2666	1581.7	1	5000.0%	1	K.EHWHHDPFEAFK.D
*	TK261102_lung_cytoE18_2_step09.2703.2703.1	1.5539	0.2991	1016.54	1	6430.0%	1	K.RPEFQALR.A
UQ9D0N494.3%393.1%419480646.9(Q9D0N4) 1110001I24Rik protein 
	TK261102_lung_cytoE18_2_step08.3697.3697.1	1.8029	0.2625	1509.89	1	4170.0%	3	K.EELVAEQALKHLK.Q
UQ9CVI694.3%41023.8%147170825.1(Q9CVI6) 1200015E15Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step08.3697.3697.1	1.8029	0.2625	1509.89	1	4170.0%	3	K.EELVAEQAIKHLK.Q
*	TK261102_lung_cytoE18_2_step06.0151.0151.2	0.6693	0.0116	2376.27	221	1430.0%	1	K.QNSPLLAAFTTQGQSELTLLLK.I
URS24_HUMAN94.3%72718.0%1331542310.8(P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19) 
	TK261102_lung_cytoE18_2_step06.2192.2192.1	1.7122	0.2641	705.56	1	6670.0%	5	R.THFGGGK.T
	TK261102_lung_cytoE18_2_step05.0339.0339.2	1.2798	0.0518	1237.33	7	5000.0%	1	K.QMVIDVLHPGK.A
	TK261102_lung_cytoE18_2_step06.2397.2397.1	1.1422	0.119	746.56	2	6000.0%	1	R.HGLYEK.K
URSP4_MOUSE94.2%2211.2%295327194.8(P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor) 
	TK261102_lung_cytoE18_2_step07.4030.4030.1	2.3295	0.1148	1266.0	1	5500.0%	1	R.KSDGIYIINLK.R
	TK261102_lung_cytoE18_2_step11.3564.3564.2	0.925	0.0072	2300.0	19	1900.0%	1	R.AIVAIENPADVSVISSRNTGQR.A
UQ9CZT394.1%2217.6%335379709.8(Q9CZT3) 2610529C04Rik protein 
*	TK261102_lung_cytoE18_2_step01.4838.4838.2	2.8261	0.1259	2751.38	2	2500.0%	1	R.RMMCIAGNGLVVLFFSWMLSIFR.S
	TK261102_lung_cytoE18_2_step07.4557.4557.3	1.1652	0.0045	4081.79	9	1210.0%	1	R.IFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK.R
UQ923E694.1%229.1%508555616.7(Q923E6) Unknown (Protein for IMAGE:3587102) (Fragment) 
	TK261102_lung_cytoE18_2_step05.1400.1400.2	1.0029	0.0050	2925.7	13	1670.0%	1	R.TGAFALLYAAVQEVEAGNGIPELPQLVR.R
*	TK261102_lung_cytoE18_2_step12.1712.1712.2	2.4038	0.3909	1814.26	1	4120.0%	1	R.HGVPPPGKPVASVNISQK.N
UQ9BTR094.1%51260122.2%3639117.3(Q9BTR0) Hypothetical protein 
*	TK261102_lung_cytoE18_2_step11.4385.4385.1	1.4021	0.1361	883.67	2	5710.0%	51	R.RGILPGLR.-
UICE7_MOUSE94.1%225.3%303340616.3(P97864) Caspase-7 precursor (EC 3.4.22.-) (LICE2 cysteine protease) (Apoptotic protease Mch-3) 
	TK261102_lung_cytoE18_2_step06.1938.1938.1	0.7715	0.0661	730.8	16	4170.0%	1	K.DGVTPIK.D
*	TK261102_lung_cytoE18_2_step06.2185.2185.1	1.5931	0.273	927.57	2	6250.0%	1	K.RNASAGPVR.T
UQ91W4893.9%7117.8%511572306.2(Q91W48) Archain 1 
	TK261102_lung_cytoE18_2_step07.2337.2337.2	2.3746	0.3899	1465.6	1	6250.0%	2	K.GVQLQTHPNVDKK.L
*	TK261102_lung_cytoE18_2_step11.2662.2662.2	1.9828	0.537	1590.64	1	5770.0%	1	K.VHAPPINMESVHMK.I
	TK261102_lung_cytoE18_2_step11.1457.1457.2	1.5004	0.2173	1236.56	4	4580.0%	1	K.VAPAPARPSGPSK.A
UQ91VR493.9%338.9%496551168.0(Q91VR4) Unknown (Protein for IMAGE:3155544) (Fragment) 
*	TK261102_lung_cytoE18_2_step09.4927.4927.2	0.8786	0.0143	2438.41	4	2170.0%	1	R.RPSGAQQLAPGVSAGRPVGPQPRR.Q
*	TK261102_lung_cytoE18_2_step08.1840.1840.2	1.184	0.0386	1347.94	52	3750.0%	1	R.SADLLLPSADTSR.R
*	TK261102_lung_cytoE18_2_step12.2007.2007.1	1.4576	0.4359	831.81	1	6670.0%	1	K.VHLLGHR.K
UQ9D1Q693.9%5720.0%406468535.3(Q9D1Q6) 1110001E24Rik protein (RIKEN cDNA 1110001E24 gene) 
*	TK261102_lung_cytoE18_2_step11.0588.0588.2	1.1135	0.0246	3083.59	6	1730.0%	1	R.VFERVASILHDDCAFLSAFGDLSKPER.Y
*	TK261102_lung_cytoE18_2_step08.2345.2345.1	0.8343	1.0E-4	836.45	47	4170.0%	1	K.NQVVFAR.V
	TK261102_lung_cytoE18_2_step12.2280.2280.1	1.9889	0.2547	988.24	1	6430.0%	2	R.HPLLHIQK.T
*	TK261102_lung_cytoE18_2_step01.4899.4899.3	1.878	0.4157	4585.0	6	1180.0%	1	R.EITFENGEELTEEGLPFLILFHMKDDTESLEIFQNEVAR.Q
UQ96FJ593.7%112.3%351394448.4(Q96FJ5) Similar to RIKEN cDNA 2810403L02 gene (Fragment) 
*	TK261102_lung_cytoE18_2_step03.0496.0496.1	1.5578	0.29	986.7	2	7140.0%	1	R.YMDGHHVK.D
UQ9JJN593.6%359.0%457518458.3(Q9JJN5) Carboxypeptidase N (Carboxypeptidase N small subunit) 
	TK261102_lung_cytoE18_2_step03.0480.0480.1	1.1128	0.1217	687.63	3	7000.0%	2	K.DPATKR.H
	TK261102_lung_cytoE18_2_step06.5349.5349.3	1.2635	0.079	3783.83	65	1100.0%	1	R.LIQDTRIHILPSMNPDGYEVAAAQGPNMSGYLVGR.N
UQ9D2R093.6%5713.5%672752006.7(Q9D2R0) 2210408B16Rik protein (Acetoacetyl-coenzyme a synthetase) (RIKEN cDNA 2210408B16 gene) 
*	TK261102_lung_cytoE18_2_step10.4429.4429.2	1.1489	0.1765	3018.01	46	1250.0%	1	K.SSVLLGSISGGTDIISCFMGQNSSIPVYK.G
*	TK261102_lung_cytoE18_2_step09.3278.3278.3	1.9052	0.1211	2815.57	20	1980.0%	1	R.FRAAVGTACGLALGNYNDLYHWSVR.S
*	TK261102_lung_cytoE18_2_step10.5235.5235.2	1.0627	0.1466	3184.26	6	1350.0%	1	R.FGSSEIYNIVEAFDEVEDSLCVPQYNR.D
*	TK261102_lung_cytoE18_2_step09.3351.3351.1	1.9206	0.2571	1165.83	5	5560.0%	2	R.HVPSLILETR.G
UQ9CY9193.6%489.8%601657005.1(Q9CY91) G1 to phase transition 2 
	TK261102_lung_cytoE18_2_step11.2936.2936.1	2.2036	0.2158	1237.62	1	6000.0%	2	K.HFTILDAPGHK.S
*	TK261102_lung_cytoE18_2_step09.4915.4915.3	1.7612	0.034	4769.27	1	1280.0%	2	-.MDLGSSSDSAPDCWDQVDMEAPGSAPSGDGIAPAAMAAAEAAEAEAQR.K
UQ9UG9493.6%2410.6%132149719.5(Q9UG94) Hypothetical protein 
*	TK261102_lung_cytoE18_2_step06.0735.0735.1	1.3927	0.3379	1550.83	1	3460.0%	2	K.HPELFKALGIAQPK.G
UQ8VED993.5%2220.9%172189565.4(Q8VED9) Hypothetical 19.0 kDa protein 
	TK261102_lung_cytoE18_2_step09.4139.4139.2	2.5823	0.3557	1779.75	1	5770.0%	1	R.VFVDGHQLFDFYHR.I
*	TK261102_lung_cytoE18_2_step11.3245.3245.2	1.2311	0.0777	2417.96	1	3100.0%	1	K.LDDGHLNNSLGSPVQADVYFPR.L
UNUCL_MOUSE93.5%91515.0%706765924.8(P09405) Nucleolin (Protein C23) 
*	TK261102_lung_cytoE18_2_step10.2832.2832.2	1.7022	0.0312	1671.6	9	3930.0%	1	K.GIAYIEFKSEADAEK.N
*	TK261102_lung_cytoE18_2_step12.4437.4437.2	0.836	0.1001	2546.25	8	1820.0%	1	K.QKVEGSEPTTPFNLFIGNLNPNK.S
*	TK261102_lung_cytoE18_2_step07.2284.2284.1	0.9875	0.0099	709.71	230	4170.0%	1	K.VIPTPGK.K
*	TK261102_lung_cytoE18_2_step12.1189.1189.1	1.8833	0.2557	1103.69	1	5560.0%	3	K.VPQNPHGKPK.G
*	TK261102_lung_cytoE18_2_step08.4879.4879.3	1.1959	0.0011	4513.37	17	1120.0%	1	K.EDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPAK.A
*	TK261102_lung_cytoE18_2_step01.3355.3355.1	0.865	0.0194	1268.99	1	3640.0%	1	R.TGKTSTWSGESK.T
UQ923Q293.3%112.7%10561183067.2(Q923Q2) DM544J17.1 (Novel protein similar to rat RhoGap) (Fragment) 
*	TK261102_lung_cytoE18_2_step10.3365.3365.2	2.0309	0.5302	2893.87	1	2220.0%	1	R.SQSGHHSADSTHALEATLVSSSLPQSTR.E
UQ9D97393.3%3314.5%220241956.6(Q9D973) Steroid receptor RNA activator 1 
	TK261102_lung_cytoE18_2_step07.2901.2901.1	0.761	0.0678	1154.54	174	2000.0%	1	K.RVAAPQDGSPR.A
	TK261102_lung_cytoE18_2_step11.4857.4857.2	2.0217	0.5044	2512.66	1	3500.0%	1	R.MALLVQELLHHQWDAADDIHR.S
U143B_MOUSE93.2%91316.7%245279554.8(Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) 
	TK261102_lung_cytoE18_2_step01.2478.2478.1	1.5415	0.1194	909.79	9	5710.0%	2	R.NLLSVAYK.N
	TK261102_lung_cytoE18_2_step01.4280.4280.1	2.2419	0.184	1192.26	2	6110.0%	1	K.DSTLIMQLLR.D
	TK261102_lung_cytoE18_2_step10.1971.1971.1	1.6586	0.0205	1238.62	1	5000.0%	2	K.KEMQPTHPIR.L
	TK261102_lung_cytoE18_2_step04.0586.0586.1	1.5686	0.1783	1108.73	1	6250.0%	1	K.EMQPTHPIR.L
	TK261102_lung_cytoE18_2_step01.0146.0146.1	2.0255	0.1067	904.02	2	7140.0%	1	R.VISSIEQK.T
	TK261102_lung_cytoE18_2_step01.2170.2170.1	1.2734	0.0172	669.78	6	7500.0%	1	K.VFYLK.M
UCYTB_MOUSE93.1%5935.7%98110467.4(Q62426) Cystatin B (Stefin B) 
*	TK261102_lung_cytoE18_2_step12.2899.2899.2	2.126	0.385	2442.76	1	3500.0%	2	R.VFQPLPHENKPLTLSSYQTNK.E
	TK261102_lung_cytoE18_2_step09.1370.1370.1	0.5128	1.0E-4	566.14	13	3750.0%	2	K.AISFK.R
*	TK261102_lung_cytoE18_2_step01.2423.2423.1	0.8076	0.0238	1196.88	1	3750.0%	1	K.ERHDELSYF.-
UQ99K3793.0%227.4%406457706.4(Q99K37) Similar to HNOEL-iso protein 
	TK261102_lung_cytoE18_2_step10.3125.3125.1	1.2143	0.2121	1125.82	10	3890.0%	1	R.DFTLAMAARK.A
*	TK261102_lung_cytoE18_2_step11.3316.3316.2	2.3041	0.3851	1991.97	1	3950.0%	1	R.RPPGGPGGGGELENTLQLIK.F
UCTPT_MOUSE93.0%356.8%367416677.0(P49586) Cholinephosphate cytidylyltransferase A (EC 2.7.7.15) (Phosphorylcholine transferase A) (CTP:phosphocholine cytidylyltransferase A) (CT A) (CCT A) (CCT-alpha) 
	TK261102_lung_cytoE18_2_step08.5269.5269.2	2.1262	0.3729	1805.39	1	4670.0%	2	R.VYADGIFDLFHSGHAR.A
	TK261102_lung_cytoE18_2_step12.2357.2357.3	1.507	0.0159	2856.75	128	1560.0%	1	R.GTPCERPVRVYADGIFDLFHSGHAR.A
UG25P_HUMAN92.8%118.9%191212596.5(P25763) G25K GTP-binding protein, placental isoform (GP) (CDC42 homolog) (P25763) G25K GTP-binding protein, placental isoform (GP) (CDC42 homolog) 
	TK261102_lung_cytoE18_2_step01.4832.4832.2	2.7374	0.2821	1853.88	1	4380.0%	1	K.NVFDEAILAALEPPEPK.K
UQ9CWW192.7%3319.3%379421588.6(Q9CWW1) 2410003B16Rik protein 
	TK261102_lung_cytoE18_2_step11.3509.3509.2	2.4049	0.3785	2716.45	5	1880.0%	1	K.VSGLPTPDLSWQLDGKPIRPDSAHK.M
	TK261102_lung_cytoE18_2_step11.4589.4589.3	1.1267	0.0558	3492.03	151	1000.0%	1	R.VSMHQDNHGYICLLIQGATKEDAGWYTVSAK.N
	TK261102_lung_cytoE18_2_step06.3430.3430.2	1.593	0.1743	2101.52	125	1880.0%	1	R.LDVYTQWHQQPQTTKPK.K
UQ9Y37292.7%4413.2%325350809.7(Q9Y372) CGI-62 protein 
	TK261102_lung_cytoE18_2_step04.0091.0091.1	0.7843	0.1426	1117.0	3	3000.0%	1	K.GLDQALKEGGK.L
	TK261102_lung_cytoE18_2_step10.5168.5168.2	0.9012	0.1313	2455.66	16	2140.0%	1	R.QRAEGTDIPTVKPLKPRPEPPK.K
	TK261102_lung_cytoE18_2_step12.1911.1911.2	2.1798	0.3854	2171.29	1	3680.0%	1	R.AEGTDIPTVKPLKPRPEPPK.K
	TK261102_lung_cytoE18_2_step10.3020.3020.1	1.5754	0.2624	1245.22	3	4440.0%	1	R.KHEEFIATIR.A
UQ9D9Q992.7%3310.6%376418255.9(Q9D9Q9) 2310045H08Rik protein 
*	TK261102_lung_cytoE18_2_step11.0777.0777.2	1.0964	0.1328	1988.4	125	1670.0%	1	R.YYGCGLTVPERLENCR.I
*	TK261102_lung_cytoE18_2_step08.2112.2112.3	1.7242	0.0438	1797.39	19	2500.0%	1	K.GHEKELIFDANFTFK.E
*	TK261102_lung_cytoE18_2_step06.2778.2778.1	1.5806	0.2607	1187.55	1	5620.0%	1	K.TYLEHHMEK.F
UPA1G_MOUSE92.6%72721.6%232258536.9(Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) 
	TK261102_lung_cytoE18_2_step09.1979.1979.1	1.4419	0.1373	919.79	2	7140.0%	5	R.GQHPNPLR.E
	TK261102_lung_cytoE18_2_step06.3034.3034.2	1.9846	0.2168	1435.92	1	6360.0%	1	R.LENGELEHIRPK.I
	TK261102_lung_cytoE18_2_step11.4029.4029.3	2.7151	0.5056	3453.86	1	2240.0%	1	R.AHFLDADPGFVHSDGTISHHDMYDYLHLSR.L
UQ0469292.6%336.0%11361282006.7(Q04692) Enhancer TRAP locus 1 (Enhancer-TRAP-locus 1 protein) (Fragment) 
	TK261102_lung_cytoE18_2_step12.1900.1900.1	1.7521	0.2501	1089.9	2	5620.0%	1	K.MANHPLLHR.Q
*	TK261102_lung_cytoE18_2_step06.4137.4137.3	1.3887	0.0599	4778.8	16	1000.0%	1	K.IEEAPEAAPQPSQARPSSPISLSAEEENAEGEGSRANTPDSDVTEK.T
	TK261102_lung_cytoE18_2_step11.2664.2664.2	1.1645	1.0E-4	1447.01	10	3750.0%	1	K.LISQGTIEESMLK.I
UCNBP_MOUSE92.3%51121.8%170187427.7(P53996) Cellular nucleic acid binding protein (CNBP) 
	TK261102_lung_cytoE18_2_step10.1887.1887.2	2.1782	0.3917	1850.56	1	5360.0%	1	R.EQCCYNCGKPGHLAR.D
	TK261102_lung_cytoE18_2_step09.1918.1918.1	1.0451	0.1183	713.62	38	5000.0%	3	R.SGHWAR.E
	TK261102_lung_cytoE18_2_step12.2432.2432.2	1.2598	0.0098	1913.31	168	2670.0%	1	K.CYRCGETGHVAINCSK.T
UO8817992.2%241.5%550605155.4(O88179) Guanine nucleotide regulatory protein (Fragment) 
	TK261102_lung_cytoE18_2_step11.3221.3221.1	2.2082	0.1624	951.7	8	6430.0%	2	K.HLIVLINK.M
UQ9D7Y092.2%337.5%308331965.8(Q9D7Y0) Bisphosphate 3'-nucleotidase 1 
	TK261102_lung_cytoE18_2_step11.2600.2600.2	1.1223	0.0292	1756.09	23	3330.0%	1	K.WDTCAPEVILHAVGGK.L
	TK261102_lung_cytoE18_2_step08.4776.4776.2	2.1646	0.3922	1882.4	1	6250.0%	1	K.KWDTCAPEVILHAVGGK.L
*	TK261102_lung_cytoE18_2_step01.1863.1863.1	1.0035	0.1241	572.65	4	7000.0%	1	K.EAPAGK.H
UDHAX_HUMAN92.0%228.8%511553666.9(P49419) Antiquitin (EC 1.2.1.-) 
*	TK261102_lung_cytoE18_2_step01.5304.5304.3	1.5342	0.0827	3441.08	28	1330.0%	1	R.EENEGVYNGSWGGRGEVITTYCPANNEPIAR.V
*	TK261102_lung_cytoE18_2_step07.3865.3865.2	2.6813	0.0827	1708.84	1	6920.0%	1	R.LFIHESIHDEVVNR.L
UQ8TDG492.0%7273.5%11011241756.5(Q8TDG4) DNA helicase HEL308 
*	TK261102_lung_cytoE18_2_step12.1616.1616.1	0.8847	0.0733	860.66	24	3750.0%	1	K.KASGQAIGK.K
*	TK261102_lung_cytoE18_2_step09.3898.3898.2	2.211	0.3299	2405.13	5	2140.0%	5	K.SLYIATIEKGHSLVNSLIETGR.I
*	TK261102_lung_cytoE18_2_step11.1808.1808.1	1.1505	0.0056	731.62	59	5000.0%	1	K.QIVSSAK.M
UMAP4_HUMAN91.7%111.1%11521210195.4(P27816) Microtubule-associated protein 4 (MAP 4) 
*	TK261102_lung_cytoE18_2_step07.2049.2049.1	1.8305	0.2448	1348.92	1	5420.0%	1	K.HVPGGGNVQIQNK.K
UAR20_HUMAN91.7%355.4%168196678.4(O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4) (O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4) 
	TK261102_lung_cytoE18_2_step10.1895.1895.1	1.5931	0.2316	1107.66	4	5620.0%	2	R.HNKPEVEVR.S
UQ9CWE091.7%226.9%289317266.1(Q9CWE0) 2410166I05Rik protein (RIKEN cDNA 2410166I05 gene) 
	TK261102_lung_cytoE18_2_step11.0782.0782.1	0.6944	0.076	870.83	58	3570.0%	1	R.NASVPNLR.G
	TK261102_lung_cytoE18_2_step06.3176.3176.1	1.5458	0.2872	1271.75	2	5000.0%	1	K.ASSFADMMGILK.D
UPMM2_MOUSE91.4%225.4%242276576.4(Q9Z2M7) Phosphomannomutase 2 (EC 5.4.2.8) (PMM 2) 
*	TK261102_lung_cytoE18_2_step10.1853.1853.1	1.5932	0.2492	954.52	1	6430.0%	1	R.HLEHAGYK.T
	TK261102_lung_cytoE18_2_step11.1346.1346.1	1.1304	0.1054	769.0	15	6250.0%	1	K.RYCLR.H
UQ9UH8791.3%4102.5%594683616.4(Q9UH87) Transposase-like protein 
	TK261102_lung_cytoE18_2_step10.2156.2156.1	0.6994	0.0294	808.54	226	2500.0%	1	K.GRAPNHR.L
	TK261102_lung_cytoE18_2_step11.1546.1546.1	1.469	0.1541	951.59	8	5000.0%	3	R.EKLSAFVR.K
UCTE1_MOUSE91.3%358.4%419461366.6(O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) 
	TK261102_lung_cytoE18_2_step12.4815.4815.2	0.6501	0.0532	3195.68	56	960.0%	1	R.SDTTFLFLVGQDDHNWKSEFYADEISK.R
	TK261102_lung_cytoE18_2_step10.2807.2807.1	1.5871	0.252	897.63	4	5710.0%	2	R.HFLAPGVR.R
URL29_MOUSE91.1%61211.9%1591745611.8(P47915) 60S ribosomal protein L29 
*	TK261102_lung_cytoE18_2_step07.3372.3372.1	1.3193	0.0337	898.7	22	5000.0%	2	R.LAFIAHPK.L
*	TK261102_lung_cytoE18_2_step11.1925.1925.1	1.7315	0.1233	1194.84	1	5000.0%	2	K.ALVKPQAIKPK.M
UMTAP_MOUSE91.1%116.0%283310627.1(Q9CQ65) 5'-methylthioadenosine phosphorylase (EC 2.4.2.28) (MTA phosphorylase) (MTAPase) 
*	TK261102_lung_cytoE18_2_step07.3077.3077.2	2.2581	0.3786	1983.81	1	4690.0%	1	R.TSLRPQTFYDGSHCSAR.G
UQ91V1291.0%51114.5%338375557.5(Q91V12) Acyl-CoA hydrolase (Hypothetical 37.6 kDa protein) 
	TK261102_lung_cytoE18_2_step07.3337.3337.2	2.4953	0.3594	2080.15	1	4210.0%	3	R.IMRPDDANVAGNVHGGTILK.M
	TK261102_lung_cytoE18_2_step07.4565.4565.1	0.9279	0.1381	1039.68	19	3570.0%	1	R.YEAQKLER.M
	TK261102_lung_cytoE18_2_step06.5020.5020.2	0.6879	0.1296	2377.32	31	1250.0%	1	K.MIEEAGAIISTRHCNSQNGER.C
UQ922F490.9%245.8%447500904.9(Q922F4) Unknown (Protein for MGC:6469) 
	TK261102_lung_cytoE18_2_step09.4921.4921.2	2.2279	0.378	2828.98	1	2800.0%	2	R.SGPFGQLFRPDNFIFGQTGAGNNWAK.G
UCABA_MOUSE90.7%242.8%285308317.9(Q99020) CARG-binding factor-A (CBF-A) 
	TK261102_lung_cytoE18_2_step07.1914.1914.1	1.468	0.0888	862.58	1	6430.0%	2	K.FHTVSGSK.C
UGELS_MOUSE90.4%8187.3%730807465.8(P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) 
	TK261102_lung_cytoE18_2_step07.2724.2724.1	1.5294	0.2013	1275.69	1	5000.0%	3	K.HVVPNEVVVQR.L
*	TK261102_lung_cytoE18_2_step12.3469.3469.2	0.8741	0.0224	2798.85	21	1670.0%	2	K.NWRDPDQTDGPGLGYLSSHIANVER.V
*	TK261102_lung_cytoE18_2_step08.3088.3088.2	1.7356	0.192	942.41	2	7140.0%	1	R.RTPITVVR.Q
	TK261102_lung_cytoE18_2_step04.0428.0428.1	0.9902	0.1052	851.28	9	4380.0%	2	K.KGGVASGFK.H
URL35_HUMAN90.2%338.2%1221442011.0(P42766) 60S ribosomal protein L35 
*	TK261102_lung_cytoE18_2_step12.2191.2191.1	1.7494	0.2375	1258.94	1	6110.0%	1	K.KYKPLDLRPK.K
*	TK261102_lung_cytoE18_2_step10.2776.2776.1	1.2363	0.1312	1131.74	50	4380.0%	1	K.YKPLDLRPK.K
UR10A_MOUSE90.1%116.0%2172491610.0(P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) 
	TK261102_lung_cytoE18_2_step01.3163.3163.1	1.8498	0.2322	1452.14	1	5000.0%	1	K.AVDIPHMDIEALK.K
UQ8VCC989.9%7716.5%807908216.0(Q8VCC9) Similar to spondin 1a 
	TK261102_lung_cytoE18_2_step11.2788.2788.1	1.5914	0.2454	1464.59	1	5770.0%	1	R.ANHWSAIIGGSHSK.N
	TK261102_lung_cytoE18_2_step11.3446.3446.2	1.258	0.0227	2982.26	1	2120.0%	1	K.IRPLTSLDHPQSPFYDPEGGSITQVAR.V
*	TK261102_lung_cytoE18_2_step06.3357.3357.3	1.3624	0.076	2739.69	7	1730.0%	1	R.LSRGPALLALALPLAAALAFSDETLDK.V
*	TK261102_lung_cytoE18_2_step01.4360.4360.3	0.7519	0.0459	3745.42	76	650.0%	1	K.CTVNEECSPSSCLVTEWGEWDDCSATCGMGMK.K
	TK261102_lung_cytoE18_2_step07.2244.2244.1	0.9025	0.0209	613.51	8	7500.0%	1	K.GHMIR.T
	TK261102_lung_cytoE18_2_step11.3128.3128.1	1.0459	0.1299	1029.9	2	3330.0%	1	K.QVAELGSPVK.M
*	TK261102_lung_cytoE18_2_step06.0419.0419.2	1.7139	0.0253	1928.59	2	3820.0%	1	K.MSPADGSMCKAETSQAEK.C
UQ1499789.8%9138.4%17982064067.0(Q14997) Hypothetical protein KIAA0077 (Fragment) 
*	TK261102_lung_cytoE18_2_step01.2931.2931.1	1.8156	0.2262	1582.86	2	4620.0%	2	K.FEHIGIGLLSLLLR.D
*	TK261102_lung_cytoE18_2_step09.3194.3194.2	1.2208	0.045	2157.38	18	2350.0%	1	K.EDHVLFIKLLYELVSIPK.L
*	TK261102_lung_cytoE18_2_step05.4300.4300.3	0.8085	0.0054	3807.27	3	970.0%	2	K.GFKLWFDELIGLWVSVQNLPQWEGQLVNLFAR.L
*	TK261102_lung_cytoE18_2_step11.4965.4965.2	1.8607	0.1396	3069.12	1	2120.0%	1	R.WFPEGPTHMLPLLMRALPGVDPNDFSK.C
*	TK261102_lung_cytoE18_2_step10.2200.2200.3	1.4229	0.161	2228.8	2	2500.0%	1	K.DIRWLVISLLEDEQLEVR.E
*	TK261102_lung_cytoE18_2_step12.2637.2637.3	1.4863	0.2276	3116.65	18	1830.0%	1	R.NFDDAFLPVLKPHLEHLVADSHESTQR.C
*	TK261102_lung_cytoE18_2_step12.2624.2624.2	0.9636	0.0464	1837.15	21	2860.0%	1	K.FVEQLITFLSLEDRK.G
UQ99KR689.8%3510.1%376420304.8(Q99KR6) Hypothetical 42.0 kDa protein (Phafin 1) 
	TK261102_lung_cytoE18_2_step01.4174.4174.2	0.7298	0.0257	2531.95	5	1580.0%	1	R.RCSTCHLLQETAFQRPQLMR.L
*	TK261102_lung_cytoE18_2_step08.4220.4220.2	2.4485	0.3439	1911.56	1	3240.0%	2	R.ASLSDLSSLEEVEGMSVR.Q
UQ91WN789.7%245.8%293327337.2(Q91WN7) Similar to glycine N-methyltransferase 
	TK261102_lung_cytoE18_2_step09.3451.3451.2	2.4603	0.3369	1847.97	1	4060.0%	2	K.AHMVTLDYTVQVPGTGR.D
UQ9D39889.5%6613.9%9451037266.0(Q9D398) 6330415E02Rik protein 
*	TK261102_lung_cytoE18_2_step10.1767.1767.1	1.0892	0.0673	646.42	20	6000.0%	1	R.ARSGVR.S
*	TK261102_lung_cytoE18_2_step12.1619.1619.3	1.327	0.0255	2509.48	414	2120.0%	1	R.ALHCTFTLERHSLASTEFTCK.V
*	TK261102_lung_cytoE18_2_step01.3168.3168.2	0.8163	0.0244	3004.54	214	1200.0%	1	K.CNGEWVSQNDHVTQESLDEATGLRVR.E
*	TK261102_lung_cytoE18_2_step03.0649.0649.2	1.0081	0.0964	3138.69	2	1730.0%	1	K.EVPLDHEVLLQCRPPEGVPVAEVEWLK.N
*	TK261102_lung_cytoE18_2_step01.4246.4246.3	1.1893	0.0442	4320.14	23	1050.0%	1	R.TCTNPAPLNGGAFCEGQAFQKTACTTVCPVDGAWTEWSK.W
*	TK261102_lung_cytoE18_2_step05.0179.0179.1	1.6642	0.2371	1311.9	2	5450.0%	1	R.ECMAPPPQNGGR.D
UQ9D8P989.5%41023.1%117127605.5(Q9D8P9) 1810047K05Rik protein 
	TK261102_lung_cytoE18_2_step03.0139.0139.1	0.5718	0.0897	960.05	17	2500.0%	1	R.KPVLSVSAR.K
	TK261102_lung_cytoE18_2_step10.3821.3821.2	2.3409	0.3635	1839.63	1	4120.0%	3	K.GFTTASSIANLKVSLLSK.E
UDJA1_MOUSE89.5%4620.4%397448687.1(P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) 
	TK261102_lung_cytoE18_2_step08.5311.5311.2	2.1305	0.3808	2722.65	1	2710.0%	2	K.ITFHGEGDQEPGLEPGDIIIVLDQK.D
	TK261102_lung_cytoE18_2_step12.4877.4877.3	1.3212	0.1477	3009.08	8	1420.0%	1	K.GGEQAIKEGGAGGGFGSPMDIFDMFFGGGGR.M
	TK261102_lung_cytoE18_2_step11.3189.3189.2	2.0808	0.2758	2880.78	2	2290.0%	1	R.IHQIGPGMVQQIQSVCMECQGHGER.I
UQ9WTS589.2%885.6%27643064676.7(Q9WTS5) Ten-m2 
*	TK261102_lung_cytoE18_2_step12.1509.1509.1	1.072	0.0037	1595.97	7	3330.0%	1	R.MHYGNRVTDLVHR.E
*	TK261102_lung_cytoE18_2_step01.4034.4034.2	0.8561	0.11	3116.68	4	1300.0%	1	K.YGYTITRQDGTFDLIANGGSALTLHFER.A
*	TK261102_lung_cytoE18_2_step01.3999.3999.1	1.551	0.256	1373.64	3	3180.0%	1	K.NNNPLSNELDLK.N
*	TK261102_lung_cytoE18_2_step11.2482.2482.3	1.7308	0.0613	2727.26	8	1740.0%	1	R.YSYDLNGNLHLLNPGNSARLMPLR.Y
*	TK261102_lung_cytoE18_2_step01.2772.2772.1	1.0202	0.0965	1585.89	2	3440.0%	1	R.TGLPGNDDVATVPSGGK.V
*	TK261102_lung_cytoE18_2_step06.3218.3218.1	0.7765	0.0202	1303.53	6	4000.0%	1	R.CIEHGTCKDGK.C
	TK261102_lung_cytoE18_2_step08.4773.4773.2	0.9411	0.0289	1571.39	24	2310.0%	1	K.MVNLQSGGFSCTIR.Y
	TK261102_lung_cytoE18_2_step11.3854.3854.3	1.3672	0.2274	4174.12	17	1110.0%	1	R.DDDVTVITNLSSVEASYTVVQDQVRNSYQLCNNGTLR.V
UST5A_MOUSE89.2%227.1%793908316.4(P42230) Signal transducer and activator of transcription 5A (Mammary gland factor) 
	TK261102_lung_cytoE18_2_step06.3705.3705.1	1.527	0.2642	1571.91	1	4230.0%	1	K.KAEHQVGEDGFLLK.I
	TK261102_lung_cytoE18_2_step10.4167.4167.3	1.2861	0.0021	4648.19	8	1100.0%	1	R.RAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEK.Q
UH2AG_HUMAN88.9%4624.0%1291397610.9(P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) 
	TK261102_lung_cytoE18_2_step01.4399.4399.2	2.1189	0.3776	1934.85	1	4440.0%	1	K.VTIAQGGVLPNIQAVLLPK.K
	TK261102_lung_cytoE18_2_step12.0799.0799.1	0.5758	0.2171	507.26	1	5000.0%	1	-.SGRGK.Q
	TK261102_lung_cytoE18_2_step09.3038.3038.1	1.259	0.0809	850.57	6	5830.0%	2	R.HLQLAIR.N
UARI1_MOUSE88.9%225.1%469555677.2(Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment) 
	TK261102_lung_cytoE18_2_step08.3432.3432.1	1.7867	0.2207	1452.72	1	4550.0%	1	R.VLLQHVHEGYEK.D
	TK261102_lung_cytoE18_2_step09.2429.2429.1	1.3217	0.1259	1506.36	3	3640.0%	1	K.WCPAPDCHHVVK.V
UBAC1_MOUSE88.8%6361.8%739813745.0(P97302) Transcription regulator protein BACH1 (BTB and CNC homolog 1) 
*	TK261102_lung_cytoE18_2_step01.2214.2214.2	2.5741	0.18	1572.97	1	5000.0%	6	K.FLDSTSEQQECAR.K
UENOA_HUMAN88.8%469.9%433470387.4(P06733) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase) 
*	TK261102_lung_cytoE18_2_step11.0533.0533.2	1.2684	0.163	2984.72	2	1880.0%	1	K.SFIKDYPVVSIEDPFDQDDWGAWQK.F
*	TK261102_lung_cytoE18_2_step04.0631.0631.1	1.6986	0.226	1181.99	2	4500.0%	2	K.GVSKAVEHINK.T
	TK261102_lung_cytoE18_2_step09.3157.3157.1	0.9356	0.13	800.86	95	3330.0%	1	K.EGLELLK.T
UQ99LL988.7%111.8%649696006.1(Q99LL9) Hypothetical 69.6 kDa protein (Fragment) 
	TK261102_lung_cytoE18_2_step07.3234.3234.1	1.569	0.2439	1490.47	1	5450.0%	1	R.QGYACPYYHNSK.D
UQ6116688.7%2214.6%268300165.2(Q61166) APC-binding protein EB1 homolog 
*	TK261102_lung_cytoE18_2_step12.1523.1523.2	2.4293	0.3297	1880.31	4	3530.0%	1	K.KPLGSSTAAPQRPIATQR.T
	TK261102_lung_cytoE18_2_step01.3330.3330.2	0.7949	0.0239	2541.58	1	3000.0%	1	K.LRNIELICQENEGENDPVLQR.I
UMBNL_MOUSE88.7%483.2%341369768.6(Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein) 
	TK261102_lung_cytoE18_2_step12.2121.2121.2	1.5814	0.2765	1310.17	1	6500.0%	2	K.YFHPPAHLQAK.I
UG3BP_MOUSE88.5%3311.2%465518295.6(P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) 
*	TK261102_lung_cytoE18_2_step11.1502.1502.2	1.8052	0.3313	2595.55	4	2730.0%	1	K.VPASQPRPESKPDSQIPPQRPQR.D
	TK261102_lung_cytoE18_2_step09.2501.2501.1	0.711	0.1303	840.45	26	3330.0%	1	R.INIPPQR.G
	TK261102_lung_cytoE18_2_step12.3023.3023.2	2.2519	0.3697	2541.58	2	2620.0%	1	R.HPDSHQLFIGNLPHEVDKSELK.D
UQ9DAE488.4%115.6%342389265.5(Q9DAE4) 1700012F10Rik protein 
	TK261102_lung_cytoE18_2_step12.2700.2700.2	2.3508	0.3571	2336.25	1	5000.0%	1	R.HLEHSTIIYEDPQHHPLLR.L
URL13_MOUSE88.3%1410411.4%2102417411.5(P47963) 60S ribosomal protein L13 (A52) 
*	TK261102_lung_cytoE18_2_step12.2531.2531.1	1.9599	0.1512	1324.21	2	5000.0%	1	R.NGMILKPHFHK.D
	TK261102_lung_cytoE18_2_step08.1861.1861.1	1.6215	0.1175	629.61	4	7000.0%	10	R.KPSAPK.K
	TK261102_lung_cytoE18_2_step07.1864.1864.1	1.0459	0.0425	756.24	105	5000.0%	1	R.KPSAPKK.G
	TK261102_lung_cytoE18_2_step06.2096.2096.1	1.2765	0.0552	624.66	5	7000.0%	1	R.VAGIHK.K
UPNAD_MOUSE88.2%117.1%309344646.2(Q64311) Protein N-terminal asparagine amidohydrolase (EC 3.5.1.-) (Protein NH2-terminal asparagine deamidase) (NTN-amidase) (PNAD) (Protein NH2-terminal asparagine amidohydrolase) (PNAA) 
*	TK261102_lung_cytoE18_2_step10.4091.4091.2	2.0597	0.3838	2502.31	1	3100.0%	1	K.QILESLSTSPLAEPPHFVEHIR.S
UQ8VC9388.1%1114.1%128145518.4(Q8VC93) Prion protein interacting protein 
	TK261102_lung_cytoE18_2_step12.2424.2424.2	2.4537	0.3159	1992.08	1	4410.0%	1	K.GLSLQHIGRPHSGIDDCK.N
UCDNC_MOUSE88.1%4423.3%348373324.3(P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2) 
*	TK261102_lung_cytoE18_2_step05.0460.0460.2	1.3192	0.0929	1865.45	161	2810.0%	1	R.TAMERLASSDTFPVIAR.S
	TK261102_lung_cytoE18_2_step12.3432.3432.2	2.4507	0.315	1782.65	1	5000.0%	1	R.LQLGPRPPPVAVAVIPR.S
	TK261102_lung_cytoE18_2_step10.1765.1765.3	1.6661	0.0193	1856.64	27	2670.0%	1	R.SLFGPVDHEELGRELR.M
	TK261102_lung_cytoE18_2_step01.3095.3095.2	1.0689	0.0796	3138.53	12	1500.0%	1	R.GQELKDQPLSGIPGRPAPGTAAANANDFFAK.R
UQ9D8X588.0%115917.5%292335744.8(Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) 
	TK261102_lung_cytoE18_2_step04.2330.2330.2	2.2757	0.0598	2881.84	1	2710.0%	7	K.FNLTEDMYSQDSIDLLANSGLQFQK.H
	TK261102_lung_cytoE18_2_step07.5018.5018.3	1.0558	0.0127	3038.32	26	1400.0%	1	-.MPAALVENSQVICEVWASNLEEEMRK.I
UK6A3_HUMAN88.0%241.2%740837366.9(P51812) Ribosomal protein S6 kinase alpha 3 (EC 2.7.1.-) (S6K-alpha 3) (90 kDa ribosomal protein S6 kinase 3) (p90-RSK 3) (Ribosomal S6 kinase 2) (RSK-2) (pp90RSK2) (Insulin-stimulated protein kinase 1) (ISPK-1) 
*	TK261102_lung_cytoE18_2_step08.2801.2801.1	1.2791	0.2009	1048.77	1	5620.0%	2	K.EIAITHHVK.E
URBB7_MOUSE87.8%359.4%425477905.0(Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7) 
	TK261102_lung_cytoE18_2_step11.4337.4337.2	1.4574	0.1095	2775.11	1	2610.0%	1	K.DYALHWLVLGTHTSDEQNHLVVAR.V
	TK261102_lung_cytoE18_2_step10.1787.1787.2	2.2318	0.3421	1790.95	1	4000.0%	2	K.HPAKPDPSGECNPDLR.L
UQ9Z0H487.8%225.3%508542718.8(Q9Z0H4) Apoptosis-related RNA binding protein (CUG triplet repeat,RNA binding protein 2) 
	TK261102_lung_cytoE18_2_step01.3635.3635.1	1.1138	0.2026	949.83	39	4290.0%	1	K.MFVGQIPR.S
	TK261102_lung_cytoE18_2_step12.3508.3508.3	2.6769	0.38	2284.88	1	3190.0%	1	K.ELKELFEPYGAVYQINVLR.D
UQ1455887.7%116.2%356394807.2(Q14558) Phosphoribosypyrophosphate synthetase-associated protein 39 
*	TK261102_lung_cytoE18_2_step10.2969.2969.2	2.1805	0.3708	2455.66	1	3100.0%	1	R.LIEESSVDEVVVTNTVPHEVQK.L
UFUS_MOUSE87.6%4414.1%518526739.4(P56959) RNA-binding protein FUS (Pigpen protein) 
	TK261102_lung_cytoE18_2_step10.2143.2143.1	0.961	0.0857	676.38	6	6000.0%	1	R.ETGKLK.G
	TK261102_lung_cytoE18_2_step01.1595.1595.1	1.202	0.0248	532.55	1	8750.0%	1	K.FGGPR.D
	TK261102_lung_cytoE18_2_step11.5794.5794.3	1.3797	0.071	4242.48	259	680.0%	1	R.HDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIK.T
	TK261102_lung_cytoE18_2_step11.1478.1478.2	1.9529	0.4276	2254.37	1	4130.0%	1	K.APKPDGPGGGPGGSHMGGNYGDDR.R
UQ9CT0587.4%595.7%654753955.3(Q9CT05) 2610027H02Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step10.3613.3613.2	1.2626	0.0389	2242.23	1	2940.0%	2	R.QEFAQHANAFHQWIQETR.T
	TK261102_lung_cytoE18_2_step01.0043.0043.1	0.9701	0.1001	760.6	26	6000.0%	1	R.ELELQK.E
	TK261102_lung_cytoE18_2_step10.2975.2975.1	1.3879	0.0028	1592.52	2	4580.0%	2	K.KHEAFETDFTVHK.D
UWDR5_HUMAN87.4%114.8%334365898.3(Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) (Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) 
	TK261102_lung_cytoE18_2_step10.2895.2895.2	1.9612	0.4076	1748.17	1	5670.0%	1	K.TLPAHSDPVSAVHFNR.D
UZFP2_MOUSE87.2%3311.0%347398558.8(P08043) Zinc finger protein 2 (Zfp-2) (mKR2 protein) 
	TK261102_lung_cytoE18_2_step10.1800.1800.1	2.1033	0.0462	1074.64	1	8120.0%	1	R.IHTGEKPYK.C
*	TK261102_lung_cytoE18_2_step04.0767.0767.1	0.9294	0.0323	1579.79	10	3330.0%	1	K.AFSQSAYLIEHRR.I
	TK261102_lung_cytoE18_2_step11.4122.4122.2	1.2	0.2126	1886.77	43	2330.0%	1	R.YLGQVTVAQKEIYNEK.S
UZN43_HUMAN87.2%446.1%803934889.2(P17038) Zinc finger protein 43 (Zinc protein HTF6) (Zinc finger protein KOX27) 
	TK261102_lung_cytoE18_2_step10.1800.1800.1	2.1033	0.0462	1074.64	1	8120.0%	1	K.IHTGEQPYK.C
	TK261102_lung_cytoE18_2_step04.4796.4796.1	0.7288	0.0669	727.48	4	5000.0%	1	K.FSNSNR.H
*	TK261102_lung_cytoE18_2_step08.4728.4728.2	1.7581	0.1532	1943.67	3	3670.0%	1	K.ECGKSFCMLPHLAQHK.I
	TK261102_lung_cytoE18_2_step07.4533.4533.2	1.1221	0.0228	2100.14	81	2060.0%	1	K.CEECGKAFTQSSNLTTHK.K
UZF38_MOUSE87.2%222.0%555630427.2(Q07231) Zinc finger protein 38 (Zfp-38) (CtFIN51) (Transcription factor RU49) 
	TK261102_lung_cytoE18_2_step08.2252.2252.1	1.6665	0.0264	1361.45	1	4500.0%	1	R.LHTGEKPYKCK.E
	TK261102_lung_cytoE18_2_step10.1800.1800.1	2.1033	0.0462	1074.64	1	8120.0%	1	R.LHTGEKPYK.C
UCPZ4_MOUSE87.1%111.6%490559037.9(P56656) Cytochrome P450 2C39 (EC 1.14.14.1) (CYPIIC39) 
*	TK261102_lung_cytoE18_2_step07.2874.2874.1	1.5883	0.2307	1008.72	4	6430.0%	1	R.RFTLTTLR.N
UQ9CWR187.1%2210.8%371408565.5(Q9CWR1) 2410008B13Rik protein 
*	TK261102_lung_cytoE18_2_step11.3636.3636.2	2.2789	0.3585	2688.1	1	3700.0%	1	K.GHIFLDGNDVDSAPLVTTHTWHPR.K
*	TK261102_lung_cytoE18_2_step04.0679.0679.2	1.0513	0.0842	1898.63	3	2670.0%	1	R.LSVQENQGLHPERDFK.V
UQ9EQM686.8%3328.4%243264144.7(Q9EQM6) GY1 protein 
	TK261102_lung_cytoE18_2_step06.5217.5217.1	0.8164	0.102	1468.47	1	3330.0%	1	R.LLIDPNCSGHSPR.T
*	TK261102_lung_cytoE18_2_step07.4962.4962.3	0.9556	0.0512	4777.13	12	870.0%	1	K.VLYTGVERSTRPECGQLLSPVSGDVHACPFGGSVGNGVGLGGESADK.K
	TK261102_lung_cytoE18_2_step08.3871.3871.1	1.5305	0.2457	979.72	5	5620.0%	1	R.TARHAPAVR.K
UHS71_MOUSE86.8%5713.7%641699945.6(P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) 
	TK261102_lung_cytoE18_2_step06.4365.4365.3	1.3906	0.0545	2903.2	15	1760.0%	1	R.GVPQIEVTFDIDANGILNVTATDKSTGK.A
	TK261102_lung_cytoE18_2_step11.3296.3296.3	1.0388	0.1043	3212.57	162	890.0%	1	R.TLSSSTQASLEIDSLFEGIDFYTSITRAR.F
	TK261102_lung_cytoE18_2_step06.4370.4370.2	1.9412	0.4049	2775.97	1	2830.0%	1	K.QTQTFTTYSDNQPGVLIQVYEGER.A
	TK261102_lung_cytoE18_2_step01.1438.1438.1	1.5638	0.0959	689.56	5	5830.0%	2	R.LIGDAAK.N
UQ6090286.5%446.0%907993215.0(Q60902) Eps15R protein 
*	TK261102_lung_cytoE18_2_step06.2764.2764.2	1.7959	0.3421	1550.23	1	5830.0%	1	K.LSQLQESHLEAHR.S
*	TK261102_lung_cytoE18_2_step11.0836.0836.3	1.1985	0.0327	2947.28	3	1400.0%	1	K.FHDTSSPLMATQSSAETHWAVRVEEK.A
	TK261102_lung_cytoE18_2_step12.3848.3848.2	1.7427	0.1449	1641.64	14	3210.0%	1	K.TDLDLDGYVSGQEVK.E
UQ9D8M486.3%113.7%2462854410.6(Q9D8M4) 1500016H10Rik protein 
*	TK261102_lung_cytoE18_2_step12.2115.2115.1	1.568	0.2247	1025.91	1	6250.0%	1	K.KLFSGVFVK.V
UO7566386.2%2212.1%272314445.9(O75663) DJ69E11.3 (Yeast YPR037W and WORM C02C2.6 PREDICTED proteins like) 
*	TK261102_lung_cytoE18_2_step11.5258.5258.2	0.6668	0.0306	3184.39	245	740.0%	1	R.ESKISSLMHVPPSLFTEPNEISQYLPIK.E
*	TK261102_lung_cytoE18_2_step06.2289.2289.1	1.4442	0.3486	629.55	1	7500.0%	1	K.THIMK.S
UMK14_MOUSE86.2%4102.8%360412875.9(P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1) 
	TK261102_lung_cytoE18_2_step09.2665.2665.1	1.8264	0.1836	1226.59	1	5560.0%	3	K.YIHSADIIHR.D
UQ9CZ8586.0%51743.9%114127155.0(Q9CZ85) 2810038F24Rik protein 
*	TK261102_lung_cytoE18_2_step06.1199.1199.2	0.9643	0.1113	2794.36	41	1590.0%	1	K.DQDINDNPPEFLHEIYHTNVPER.S
*	TK261102_lung_cytoE18_2_step09.4970.4970.2	1.9745	0.3981	3009.41	1	2120.0%	4	R.AQYTLMAQAVDRDTNKPLGPPSEFIDK.D
UGIPC_MOUSE85.9%4415.3%333361295.9(Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) 
	TK261102_lung_cytoE18_2_step11.1757.1757.1	0.8644	0.0824	743.73	77	4170.0%	1	-.MPLGLGR.R
*	TK261102_lung_cytoE18_2_step09.3553.3553.2	1.3852	0.1795	2229.17	30	2000.0%	1	K.SEEALGLTITDNGAGYAFIKR.I
	TK261102_lung_cytoE18_2_step05.0775.0775.1	1.1056	0.0662	908.7	1	7140.0%	1	R.IEGFTNVK.E
	TK261102_lung_cytoE18_2_step11.2741.2741.2	1.9392	0.4472	1621.92	1	5710.0%	1	R.LVFHTQLAHGSPTGR.I
UQ6221985.7%114.5%444482287.2(Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5) 
*	TK261102_lung_cytoE18_2_step12.1540.1540.2	2.5105	0.2518	2022.38	2	3420.0%	1	R.VQNHLPASGPPQPPAASPTR.E
UPHS_HUMAN85.4%3912.6%103118686.8(P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) 
	TK261102_lung_cytoE18_2_step09.3557.3557.2	2.0311	0.3625	1702.33	1	4580.0%	3	K.LDHHPEWFNVYNK.V
UQ96L7185.3%334.1%12101362636.3(Q96L71) ARAP1 
*	TK261102_lung_cytoE18_2_step09.4979.4979.2	0.7698	0.0583	3081.89	57	1350.0%	1	K.VQLYKNLEEYHLGIGITFIDMSVGNVK.E
*	TK261102_lung_cytoE18_2_step04.4776.4776.1	0.6296	0.0323	682.54	13	5000.0%	1	K.CGQTSK.T
*	TK261102_lung_cytoE18_2_step11.3576.3576.2	2.1517	0.3545	1938.04	1	5000.0%	1	K.HYSVVLPTVSHSGFLYK.T
UCOMT_MOUSE85.1%116.0%265294965.8(O88587) Catechol O-methyltransferase, membrane-bound form (EC 2.1.1.6) (MB-COMT) [Contains: Catechol O-methyltransferase, soluble form (S-COMT)] 
	TK261102_lung_cytoE18_2_step09.4787.4787.2	2.4015	0.3024	2028.2	1	5000.0%	1	K.KYDVDTLDMVFLDHWK.D
USNX2_MOUSE85.0%61014.1%519584715.1(Q9CWK8) Sorting nexin 2 
	TK261102_lung_cytoE18_2_step06.4102.4102.1	1.4761	0.2188	1584.49	2	4620.0%	2	K.YLHVGYIVPPAPEK.S
	TK261102_lung_cytoE18_2_step10.5757.5757.2	1.1868	0.1762	2556.52	94	2170.0%	1	R.QFLESSELPRAVNTQALSGAGILR.M
*	TK261102_lung_cytoE18_2_step11.4109.4109.3	1.2094	0.0788	2488.0	20	1850.0%	1	R.ELILSSEPSPAVTPVTPTTLIAPR.I
	TK261102_lung_cytoE18_2_step06.3574.3574.1	0.9063	0.0613	1304.79	7	4000.0%	2	K.HPTLLQDPDLR.Q
UQ99KN984.9%112.6%531567585.9(Q99KN9) Similar to KIAA0171 gene product (Fragment) 
	TK261102_lung_cytoE18_2_step11.1841.1841.2	1.9392	0.4117	1612.0	1	5770.0%	1	K.HIHITQATETTTTR.H
UO0881784.8%336.1%653704088.8(O08817) CW17 protein 
	TK261102_lung_cytoE18_2_step05.4970.4970.3	1.6401	0.1856	2926.55	16	1800.0%	1	R.HTLITEMVALNPDFKPPADYKPPATR.V
	TK261102_lung_cytoE18_2_step05.0615.0615.2	0.7154	0.1716	1643.15	3	2310.0%	1	K.QGIETPEDQNDLRK.M
UDPY3_MOUSE84.7%3311.2%570619366.5(Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein) 
*	TK261102_lung_cytoE18_2_step07.4744.4744.3	1.6183	0.1375	3220.13	1	1730.0%	1	K.SCCDYALHVDITHWNDSVKQEVQSLSK.E
	TK261102_lung_cytoE18_2_step11.3740.3740.2	2.3147	0.3225	2072.73	1	4710.0%	1	K.MVIPGGIDVHTHFQMPYK.G
	TK261102_lung_cytoE18_2_step06.3524.3524.2	1.4737	0.1236	2031.21	1	3890.0%	1	R.NLHQSGFSLSGTQVDEGVR.S
UQ924M484.3%575.1%10411160374.8(Q924M4) RANBP9 isoform 1 
	TK261102_lung_cytoE18_2_step11.2348.2348.2	1.3879	0.2616	1578.35	1	4170.0%	1	K.NPERWTNIPLLVK.I
	TK261102_lung_cytoE18_2_step08.2623.2623.2	2.2818	0.3278	1381.46	1	5910.0%	2	K.LLQHGINADDKR.L
	TK261102_lung_cytoE18_2_step07.5665.5665.2	0.7663	0.0572	2846.33	76	1110.0%	1	R.IAAQDLLLAVATDFQNESAVALATAATR.H
UACSA_MOUSE84.1%335.0%701789216.6(Q9QXG4) Acetyl-coenzyme A synthetase, cytoplasmic (EC 6.2.1.1) (Acetate--CoA ligase) (Acyl-activating enzyme) (Acetyl-CoA synthetase) (ACS) (AceCS) 
	TK261102_lung_cytoE18_2_step10.1029.1029.1	0.569	5.0E-4	483.05	2	5000.0%	1	K.HLGR.A
	TK261102_lung_cytoE18_2_step11.1560.1560.1	1.3274	0.0096	543.62	8	8330.0%	1	R.RVLR.K
*	TK261102_lung_cytoE18_2_step06.4524.4524.2	2.4766	0.282	2962.15	1	3080.0%	1	K.IAQNDHDLGDTSTVADPSVINHLFSHR.C
UDJB4_MOUSE84.1%2215.7%337377828.6(Q9D832) DnaJ homolog subfamily B member 4 
*	TK261102_lung_cytoE18_2_step09.3035.3035.2	2.4715	0.2789	1431.4	1	5910.0%	1	R.LKQDPPIIHELK.V
	TK261102_lung_cytoE18_2_step07.5282.5282.3	0.8527	0.0345	4261.3	65	940.0%	1	K.GGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGR.R
UQ9CXI583.3%119.5%179203748.1(Q9CXI5) 3230402M22Rik protein 
	TK261102_lung_cytoE18_2_step11.2657.2657.2	2.4763	0.2375	1925.17	1	4380.0%	1	K.IINEVSKPLAHHIPVEK.I
UQ1532783.2%115.0%319362217.2(Q15327) Nuclear protein 
*	TK261102_lung_cytoE18_2_step08.3924.3924.2	2.4745	0.2355	1897.37	3	4000.0%	1	R.SKLENLEDLEIIIQLK.K
U2ACA_HUMAN82.5%335.9%11501302785.2(Q06190) Serine/threonine protein phosphatase 2A, 72/130 kDa regulatory subunit B (PP2A, subunit B, B''-PR72/PR130) (PP2A, subunit B, B72/B130 isoforms) (PP2A, subunit B, PR72/PR130 isoforms) (PP2A, subunit B, R3 isoform) 
*	TK261102_lung_cytoE18_2_step11.5332.5332.2	0.7742	0.1324	3137.41	15	1040.0%	1	R.CMDVDGDGVLSMYELEYFYEEQCER.M
*	TK261102_lung_cytoE18_2_step12.4913.4913.3	1.2271	0.147	3904.05	3	960.0%	1	K.AVQVQSQSLTMNPLENVSSDDLMETLYIEEESDGK.K
*	TK261102_lung_cytoE18_2_step05.2838.2838.1	1.4683	0.2787	1005.66	1	6430.0%	1	K.MCLDILLK.C
UY379_HUMAN82.3%597.8%10591134666.2(O15084) Hypothetical protein KIAA0379 (Fragment) 
*	TK261102_lung_cytoE18_2_step10.3775.3775.2	0.801	0.137	2919.81	1	1110.0%	1	R.TPLHAAAYLGDAEIIELLILSGARVNAK.D
*	TK261102_lung_cytoE18_2_step11.2125.2125.2	1.9228	0.3934	1695.75	1	4670.0%	2	R.TALHHAAFSGHGEMVK.L
*	TK261102_lung_cytoE18_2_step07.4618.4618.3	1.1703	0.0628	4048.5	21	1180.0%	2	K.TEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSK.G
UO6070582.0%112.2%596640288.2(O60705) LIM protein 
*	TK261102_lung_cytoE18_2_step06.3249.3249.2	1.8891	0.426	1702.51	1	5420.0%	1	K.SWHPEEFNCAHCK.N
UQ9Z1R081.6%2442.9%9199545.9(Q9Z1R0) B144 
*	TK261102_lung_cytoE18_2_step07.5230.5230.3	3.0403	0.1485	4286.24	1	1780.0%	2	-.MTMGSGNNCTTNDFLLNGSLGLGGLLLLLVIILFICLCR.F
UPOSC_MOUSE81.6%3316.8%274300498.3(Q9Z2Y8) Proline synthetase co-transcribed bacterial homolog protein 
	TK261102_lung_cytoE18_2_step12.3105.3105.1	1.9965	0.1842	1167.94	1	6880.0%	1	K.WHFIGHLQK.Q
*	TK261102_lung_cytoE18_2_step06.3166.3166.3	1.5613	0.1986	2278.55	19	2250.0%	1	K.LMAVPNLSMLETVDSVKLADK.V
*	TK261102_lung_cytoE18_2_step11.3754.3754.2	1.5279	0.3169	1743.6	1	3330.0%	1	K.HGLLPSETIAVVEHIK.A
UEHD4_MOUSE81.5%5710.4%541614816.8(Q9EQP2) EH-domain containing protein 4 (mPAST2) 
	TK261102_lung_cytoE18_2_step12.1596.1596.1	1.1803	0.024	857.23	1	7500.0%	2	K.FHSLKPK.L
	TK261102_lung_cytoE18_2_step12.2168.2168.3	1.4273	0.2178	2417.25	10	2120.0%	1	R.IILLFDAHKLDISDEFSEAIK.A
*	TK261102_lung_cytoE18_2_step05.5054.5054.2	0.8522	0.0658	1931.93	54	2500.0%	1	R.ELIYRLPEIYVQLQR.E
*	TK261102_lung_cytoE18_2_step01.4676.4676.3	2.9509	0.263	2724.86	1	2610.0%	1	R.LPEIYVQLQREYQISAGDFPEVK.A
UQ9Y4G081.3%111.0%8641000727.2(Q9Y4G0) Hypothetical protein KIAA0381 (Fragment) 
*	TK261102_lung_cytoE18_2_step08.3940.3940.1	1.4778	0.2558	1107.34	1	5000.0%	1	R.FDMVHIDTK.S
UQ9CWU381.3%113.0%367426065.4(Q9CWU3) 2410004D02Rik protein 
	TK261102_lung_cytoE18_2_step07.4730.4730.1	1.4734	0.2531	1411.85	3	4000.0%	1	R.INLWHLEITDR.S
UQ9QYS981.2%2210.3%341376718.5(Q9QYS9) QKI-5 protein 
	TK261102_lung_cytoE18_2_step08.4680.4680.2	1.9119	0.4019	2049.57	1	3750.0%	1	K.EKPKPTPDYLMQLMNDK.K
	TK261102_lung_cytoE18_2_step09.3670.3670.2	1.0535	0.1779	1948.42	4	2650.0%	1	K.RSAELPDAVGPIVQLQEK.L
USI7A_HUMAN81.2%111.5%600685649.9(Q9NSC7) Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (EC 2.4.99.3) (GalNAc alpha-2,6-sialyltransferase I) (ST6GalNAc I) (Sialyltransferase 7A) 
*	TK261102_lung_cytoE18_2_step10.3747.3747.1	1.7936	0.1957	1110.01	1	6250.0%	1	K.RLHDEGIIR.L
UQ9EQ1881.2%359.3%389432565.4(Q9EQ18) SIR2L2 
*	TK261102_lung_cytoE18_2_step04.0666.0666.1	1.3402	0.0674	1176.08	1	5620.0%	2	R.KEYTMGWMK.E
*	TK261102_lung_cytoE18_2_step06.5374.5374.2	1.13	0.0044	3177.71	21	1480.0%	1	R.VAGLEPQDLVEAHGTFYTSHCVNTSCRK.E
URCQ5_HUMAN81.1%116.3%410456798.8(O94762) ATP-dependent DNA helicase Q5 (RecQ protein-like 5) 
	TK261102_lung_cytoE18_2_step07.5230.5230.2	2.4613	0.0503	2857.83	4	2600.0%	1	K.GITIVVSPLIALIQDQVDHLLTLKVR.V
UO9531680.9%5711.5%809908347.2(O95316) Ribosome S6 protein kinase 
	TK261102_lung_cytoE18_2_step08.4045.4045.2	1.9341	0.3679	2282.83	1	2500.0%	2	K.LENILLDSNGHVVLTDFGLSK.E
	TK261102_lung_cytoE18_2_step04.2153.2153.1	0.6832	0.0748	1584.28	198	1540.0%	1	K.DLIQGLLTVDPNKR.L
	TK261102_lung_cytoE18_2_step06.5097.5097.3	1.1536	0.0043	4219.71	38	1050.0%	1	K.MSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVK.A
	TK261102_lung_cytoE18_2_step09.2038.2038.3	1.1026	0.0094	2009.95	6	2080.0%	1	K.VGIENFELLKVLGTGAYGK.V
UQ9NVH980.8%356.9%493572987.1(Q9NVH9) Hypothetical protein FLJ10724 
*	TK261102_lung_cytoE18_2_step01.3183.3183.1	1.0684	0.0435	1373.99	176	3000.0%	2	K.QMQQQEHDSLK.A
*	TK261102_lung_cytoE18_2_step07.5249.5249.2	2.4293	0.2242	2738.45	1	2730.0%	1	R.EHEEELDQEFELETDTLFGGLKK.D
UH2AZ_HUMAN80.6%3333.9%1271342210.6(P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z) 
	TK261102_lung_cytoE18_2_step11.2704.2704.2	1.8779	0.4016	1371.32	1	5770.0%	1	K.ATIAGGGVIPHIHK.S
	TK261102_lung_cytoE18_2_step05.3570.3570.3	1.1658	0.0496	2895.92	15	1160.0%	1	R.VGATAAVYSAAILEYLTAEVLELAGNASK.D
URL31_HUMAN80.5%61820.0%1251446310.5(P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31 
	TK261102_lung_cytoE18_2_step05.0903.0903.2	1.4582	0.0751	1988.43	3	2810.0%	1	R.SAINEVVTREYTINIHK.R
	TK261102_lung_cytoE18_2_step09.2506.2506.1	1.9245	0.0939	759.74	1	8330.0%	4	R.IHGVGFK.K
	TK261102_lung_cytoE18_2_step12.2000.2000.1	1.4428	0.2877	913.98	19	6430.0%	1	K.RIHGVGFK.K
UO4330480.4%10249.4%756853036.8(O43304) Hypothetical protein KIAA0420 (Fragment) 
*	TK261102_lung_cytoE18_2_step09.4898.4898.2	1.037	0.1695	2471.24	11	2000.0%	1	R.APRVFPVLWTLISPFINENTR.R
*	TK261102_lung_cytoE18_2_step09.3822.3822.2	1.9937	0.0844	1402.37	1	6000.0%	4	R.FLRAHDFHLDK.A
*	TK261102_lung_cytoE18_2_step10.3037.3037.1	0.8224	0.0649	824.59	25	5830.0%	1	R.WTPAPVR.E
*	TK261102_lung_cytoE18_2_step07.3890.3890.1	0.7921	0.1227	868.59	115	2860.0%	1	K.QAPRLGAR.E
*	TK261102_lung_cytoE18_2_step07.2081.2081.2	0.9141	0.0986	2564.84	15	1520.0%	1	R.STLGPALEAVSMDGDKLDADYIER.C
UQ9DBQ480.3%4104.0%720815267.5(Q9DBQ4) 1200016L19Rik protein 
*	TK261102_lung_cytoE18_2_step11.4706.4706.2	1.0255	0.0948	1801.84	2	4000.0%	1	K.KIHTGLQLSAALEYVR.S
	TK261102_lung_cytoE18_2_step10.3864.3864.1	1.7431	0.1139	1543.98	6	3750.0%	3	R.HTGYVIELQNIVR.G
UQ96BG780.3%4418.1%518577359.7(Q96BG7) Similar to hypothetical protein FLJ22582 
*	TK261102_lung_cytoE18_2_step01.1651.1651.3	1.5184	0.0393	1940.83	98	1720.0%	1	R.LDMPPRPLGEFSSPRSR.H
*	TK261102_lung_cytoE18_2_step09.2478.2478.1	1.4854	0.2431	1406.9	4	4640.0%	1	R.SNSFGERPGGGGGAR.R
*	TK261102_lung_cytoE18_2_step06.4700.4700.3	2.0492	0.0992	2736.57	11	2070.0%	1	K.LMSSEQYPPQELFPRGTNPFATVK.L
*	TK261102_lung_cytoE18_2_step08.4485.4485.3	1.2952	0.2075	4087.12	8	1150.0%	1	R.FSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVK.A
UQ8R3P180.2%116.6%196212144.7(Q8R3P1) Similar to hypothetical protein MGC16714 
*	TK261102_lung_cytoE18_2_step10.1997.1997.1	1.9513	0.1503	1426.78	1	5420.0%	1	K.KLEGGQQVGMHSR.G
UHS27_MOUSE80.0%2414.8%209230146.5(P14602) Heat shock 27 kDa protein (HSP 27) (Growth-related 25 kDa protein) (P25) (HSP25) 
*	TK261102_lung_cytoE18_2_step03.0591.0591.2	2.2845	0.3097	3195.72	1	2830.0%	2	R.KYTLPPGVDPTLVSSSLSPEGTLTVEAPLPK.A
UZN30_HUMAN79.8%2222.0%5057719.0(P17039) Zinc finger protein 30 (Zinc finger protein KOX28) (Fragment) 
	TK261102_lung_cytoE18_2_step08.2237.2237.2	1.309	0.0645	1364.08	2	5000.0%	1	R.IHTGKKPYECK.E
UANXA_MOUSE79.8%468.6%324373015.7(Q9QZ10) Annexin A10 
	TK261102_lung_cytoE18_2_step03.3872.3872.1	0.5826	0.0035	572.15	11	3750.0%	1	K.TGEHK.T
	TK261102_lung_cytoE18_2_step04.0992.0992.2	0.8651	0.0305	1773.44	29	2140.0%	1	K.DMLIDILTQRSNAQR.Q
	TK261102_lung_cytoE18_2_step06.2932.2932.1	1.7021	0.1968	976.59	5	5710.0%	2	K.EQLSSHFK.E
UQ9D6M079.7%6819.9%448487785.4(Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene) 
*	TK261102_lung_cytoE18_2_step11.3925.3925.1	0.7836	0.0549	1388.43	11	2080.0%	1	K.SVTGMVDLAQRGR.R
*	TK261102_lung_cytoE18_2_step06.3980.3980.3	2.1908	0.2768	2760.68	16	2020.0%	1	R.SVDALQATFADAHCLGDVAPTALAEGR.G
*	TK261102_lung_cytoE18_2_step10.1935.1935.1	2.0271	0.1231	1155.63	2	5000.0%	2	R.HLAYEHSLGK.L
*	TK261102_lung_cytoE18_2_step01.2244.2244.2	0.7243	0.0024	2275.51	63	1000.0%	1	K.LPFLQQPSDMVVTSAKDTVAK.S
*	TK261102_lung_cytoE18_2_step12.3087.3087.2	1.0372	0.0060	1929.23	32	2350.0%	1	R.SLTLELQNAVDALAGCVR.G
UQ9H00979.6%397.0%215232234.7(Q9H009) Alpha-NAC protein 
*	TK261102_lung_cytoE18_2_step11.2956.2956.1	1.7819	0.029	1574.76	9	3210.0%	3	K.AMSKLGLLQVTGVTR.V
UQ99K5179.5%466.2%630707425.6(Q99K51) Hypothetical 70.7 kDa protein 
	TK261102_lung_cytoE18_2_step09.3978.3978.1	1.6877	0.195	1415.84	2	5450.0%	2	K.AYFHLLNQIAPK.G
	TK261102_lung_cytoE18_2_step09.3778.3778.2	0.9391	0.0189	2588.72	72	1670.0%	1	K.YPALTKPENQDIDWTLLEGETR.E
	TK261102_lung_cytoE18_2_step08.2577.2577.1	0.7919	0.0454	586.77	17	5000.0%	1	K.EGEPR.I
URL6_MOUSE79.5%7919.5%2873261210.8(P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) 
*	TK261102_lung_cytoE18_2_step01.2207.2207.1	0.9173	0.0164	1511.36	16	2500.0%	1	R.SQFSLTNGMYPHK.L
	TK261102_lung_cytoE18_2_step12.1525.1525.1	1.1663	0.0102	1123.77	7	5620.0%	1	K.HLTDAYFKK.K
*	TK261102_lung_cytoE18_2_step01.2720.2720.1	1.5079	0.0638	996.89	2	6880.0%	1	K.AVDLQILPK.I
	TK261102_lung_cytoE18_2_step12.1507.1507.1	1.4755	0.2335	998.92	1	6430.0%	2	K.KPFSQHVR.R
	TK261102_lung_cytoE18_2_step11.3074.3074.1	0.8042	0.1476	1082.46	32	2780.0%	1	R.NPVLVRGIGR.Y
	TK261102_lung_cytoE18_2_step11.1750.1750.1	1.4236	0.1764	782.8	1	5830.0%	1	R.KLLSHGK.K
UNADC_MOUSE79.5%113.7%299315306.7(Q91X91) Nicotinate-nucleotide pyrophosphorylase [carboxylating] (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) (QAPRTase) (QPRTase) 
*	TK261102_lung_cytoE18_2_step12.2603.2603.1	1.9214	0.1573	1201.18	1	5000.0%	1	K.GPAHHLLLGER.V
USVS6_MOUSE79.5%2214.1%99114826.2(Q64356) Seminal vesicle secretory protein VI precursor (Seminal vesicle protein 6) (SVSP99) (SVS VI) 
*	TK261102_lung_cytoE18_2_step06.3762.3762.1	1.0305	0.1913	1454.08	1	4170.0%	1	K.RNMVNGEDGEDSK.R
*	TK261102_lung_cytoE18_2_step07.2594.2594.1	1.4731	0.234	1449.97	1	4170.0%	1	R.NMVNGEDGEDSKR.A
UQ9EPZ279.5%448.8%831926317.4(Q9EPZ2) ELAC2 
*	TK261102_lung_cytoE18_2_step10.3409.3409.2	2.3325	0.2766	2462.56	1	4000.0%	1	R.FGPDTQHLILNENCPSVHNLR.S
*	TK261102_lung_cytoE18_2_step11.3086.3086.3	1.3328	0.0586	2832.3	266	1670.0%	1	R.LSPKQSSDSGSAENGQCPPEDSSAGANR.K
	TK261102_lung_cytoE18_2_step06.2648.2648.1	1.2485	0.1021	762.54	7	7500.0%	1	K.IFSGPLK.G
	TK261102_lung_cytoE18_2_step12.1320.1320.3	1.8116	0.1689	1927.83	1	3440.0%	1	K.VCFGDFPTVPKLIPPLK.A
URSU1_MOUSE79.4%5516.6%277315508.9(Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1) 
	TK261102_lung_cytoE18_2_step10.1691.1691.1	1.9992	0.1454	1276.66	1	6500.0%	1	R.HMQANPEPPKK.N
	TK261102_lung_cytoE18_2_step12.2060.2060.2	1.2936	0.0325	1150.65	24	5000.0%	1	R.HMQANPEPPK.K
	TK261102_lung_cytoE18_2_step07.1778.1778.1	0.857	0.1067	627.53	9	5000.0%	1	R.KPLAAK.N
	TK261102_lung_cytoE18_2_step01.2440.2440.3	1.4906	0.0193	2362.03	10	2120.0%	1	R.ALYLSDNDFEILPPDIGKLTK.L
	TK261102_lung_cytoE18_2_step10.2624.2624.1	1.1886	0.0964	954.82	3	6430.0%	1	K.HLNLGMNR.L
UEF1D_MOUSE79.4%61015.7%281312935.0(P57776) Elongation factor 1-delta (EF-1-delta) 
*	TK261102_lung_cytoE18_2_step01.1915.1915.2	1.8094	0.3862	2196.87	1	2610.0%	1	K.SLAGSSGPGASSGPGGDHSELIVR.I
*	TK261102_lung_cytoE18_2_step07.2144.2144.1	1.6495	0.0909	756.83	4	7500.0%	2	K.KPTLVAK.S
	TK261102_lung_cytoE18_2_step07.2112.2112.2	2.273	0.1574	1426.53	1	5420.0%	1	R.ATAPQTQHVSPMR.Q
UFRZB_MOUSE79.3%241.9%323360118.3(P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3) 
	TK261102_lung_cytoE18_2_step09.2307.2307.1	1.3043	0.2065	625.56	1	6000.0%	2	R.HLGLGK.T
UALD1_MOUSE79.2%8642.5%315358577.3(P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7) 
	TK261102_lung_cytoE18_2_step08.2764.2764.1	1.6112	0.1173	884.74	17	5710.0%	8	R.LLNKPGLK.H
URS10_MOUSE79.1%244.2%1651891610.2(P09900) 40S ribosomal protein S10 
	TK261102_lung_cytoE18_2_step09.1826.1826.1	1.5374	0.2123	854.54	1	6670.0%	2	K.KDVHMPK.H
UFXP1_MOUSE79.0%336.8%705788336.7(P58462) Forkhead box protein P1 (Forkhead-related transcription factor 1) 
*	TK261102_lung_cytoE18_2_step01.4662.4662.2	0.82	0.0028	2221.53	13	2000.0%	1	K.SSLIMNPHASTNGQLSVHTPK.R
	TK261102_lung_cytoE18_2_step03.4304.4304.3	1.1784	0.0317	1623.98	106	1500.0%	1	K.AAPQPLNLVSSVTLSK.S
	TK261102_lung_cytoE18_2_step06.2548.2548.1	1.876	0.1854	1307.48	2	5500.0%	1	K.HLNSEHALDDR.S
UQ9DC1578.8%227.3%603659517.5(Q9DC15) 1200007E24Rik protein 
*	TK261102_lung_cytoE18_2_step12.2637.2637.2	2.06	0.3287	2078.11	1	4120.0%	1	R.RPGHALPDQQALQVVYER.C
*	TK261102_lung_cytoE18_2_step11.0814.0814.2	0.7736	0.0622	3051.33	68	1200.0%	1	K.EALYALTVLEICMNHCGEKFHSEVAK.F
UO5486578.7%449.4%620705985.3(O54865) Soluble guanylate cyclase beta-1 subunit 
*	TK261102_lung_cytoE18_2_step06.4512.4512.2	1.8846	0.3629	2082.63	1	4060.0%	1	R.CLMSPENSDPLFHLEHR.G
*	TK261102_lung_cytoE18_2_step09.5615.5615.2	0.8772	0.0946	2682.74	60	1360.0%	1	R.CLMSPENSDPLFHLEHRGPVSMK.G
	TK261102_lung_cytoE18_2_step06.4253.4253.3	1.2085	0.029	2117.54	10	1940.0%	1	K.KTDTLLYSVLPPSVANELR.H
	TK261102_lung_cytoE18_2_step11.1565.1565.3	1.2813	0.0587	1871.62	1	3170.0%	1	K.YMTVSGLPEPCIHHAR.S
UQ8VHQ078.6%3316.4%385437876.4(Q8VHQ0) SPI3L2 
*	TK261102_lung_cytoE18_2_step12.3389.3389.2	2.1285	0.3259	1258.55	1	6500.0%	1	K.QGLFLSNVIHK.S
*	TK261102_lung_cytoE18_2_step12.4367.4367.3	0.965	0.0638	3647.02	22	710.0%	1	K.NVFLSPISISSALVMVLLGAKGTTAIQITQALSLGK.C
*	TK261102_lung_cytoE18_2_step09.3010.3010.2	0.7114	0.0417	1840.1	21	2000.0%	1	K.DVLCKLGMTDAFEEGR.A
UPSD4_MOUSE78.6%10503.7%376407044.8(O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) 
	TK261102_lung_cytoE18_2_step09.2518.2518.1	1.0122	0.1077	751.63	11	5830.0%	5	R.VAHLALK.H
	TK261102_lung_cytoE18_2_step09.1812.1812.1	1.5851	0.1039	822.6	1	7500.0%	5	K.LHTVQPK.G
URL8_HUMAN78.1%61210.5%2572802511.0(P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8 
	TK261102_lung_cytoE18_2_step05.1226.1226.1	0.3382	0.0286	641.57	9	2000.0%	1	K.GAARLR.A
	TK261102_lung_cytoE18_2_step06.2352.2352.1	1.6011	0.1963	816.57	2	7140.0%	1	R.VKLPSGSK.K
	TK261102_lung_cytoE18_2_step07.1982.1982.1	1.2617	0.0646	617.62	3	7500.0%	3	R.HGYIK.G
	TK261102_lung_cytoE18_2_step08.2856.2856.1	1.4542	0.1666	822.01	1	7140.0%	1	R.KGAGSVFR.A
UQ9CS6478.0%247.9%1651837210.5(Q9CS64) 5730508B09Rik protein (Fragment) 
*	TK261102_lung_cytoE18_2_step09.4046.4046.1	1.8691	0.1624	1431.25	1	4580.0%	2	R.RWDVLGQEAAAGR.R
UIDHC_MOUSE78.0%81219.1%414466606.9(O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) 
	TK261102_lung_cytoE18_2_step04.0432.0432.2	1.8142	0.2901	1011.92	1	7860.0%	1	R.HAYGDQYR.A
*	TK261102_lung_cytoE18_2_step06.2404.2404.1	1.3927	0.1094	808.62	9	5830.0%	1	K.KYNVGVK.C
*	TK261102_lung_cytoE18_2_step01.3072.3072.1	1.1533	0.0037	1298.25	1	5560.0%	1	K.DIFQEIYDKK.Y
*	TK261102_lung_cytoE18_2_step11.3973.3973.2	1.2061	0.1396	1452.73	1	3750.0%	2	R.LVTGWVKPIIIGR.H
*	TK261102_lung_cytoE18_2_step04.2490.2490.2	2.3091	0.2784	2374.49	1	4740.0%	1	K.LILPYVELDLHSYDLGIENR.D
	TK261102_lung_cytoE18_2_step07.3405.3405.2	1.1357	0.0429	2371.03	41	2000.0%	2	R.LIDDMVAQAMKSEGGFIWACK.N
URS29_HUMAN77.9%2229.1%55654610.1(P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 
	TK261102_lung_cytoE18_2_step10.2259.2259.1	1.1272	0.0078	595.54	1	8750.0%	1	R.HGLIR.K
	TK261102_lung_cytoE18_2_step11.2314.2314.1	1.5966	0.1937	1408.66	2	4500.0%	1	-.GHQQLYWSHPR.K
UDJB1_MOUSE77.9%339.4%340381678.6(Q9QYJ3) DnaJ homolog subfamily B member 1 (Heat shock 40 kDa protein 1) (Heat shock protein 40) (HSP40) 
	TK261102_lung_cytoE18_2_step06.2706.2706.1	0.7058	0.0017	1251.39	21	2000.0%	1	K.RDGSDVIYPAR.I
	TK261102_lung_cytoE18_2_step06.3442.3442.1	1.458	0.2416	1136.51	2	4500.0%	1	R.KVPGEGLPLPK.T
	TK261102_lung_cytoE18_2_step01.2996.2996.1	0.7337	0.0839	1201.58	2	2780.0%	1	K.DYYQTLGLAR.G
UZYX_MOUSE77.7%7914.9%564607906.9(Q62523) Zyxin 
	TK261102_lung_cytoE18_2_step08.2597.2597.1	1.2733	0.1257	678.79	12	5000.0%	1	K.NFHMK.C
*	TK261102_lung_cytoE18_2_step12.1223.1223.2	1.5627	0.2348	1740.22	1	4640.0%	2	K.QHPQPPPAQNQNQVR.S
	TK261102_lung_cytoE18_2_step08.3096.3096.2	1.2981	0.1835	1054.04	1	5560.0%	1	K.FAPVVAPKPK.V
*	TK261102_lung_cytoE18_2_step01.1778.1778.1	1.4043	0.2572	1163.48	2	5000.0%	1	R.GPLSQAPTPAPK.F
*	TK261102_lung_cytoE18_2_step09.4443.4443.3	1.424	0.0331	4614.75	22	1040.0%	1	K.TPSSSQPPPQPQRKPQVQLHVQPQAKPHVQPQPVSSANTQPR.G
*	TK261102_lung_cytoE18_2_step01.4047.4047.3	1.3045	0.0181	4369.96	3	1190.0%	1	R.KPQVQLHVQPQAKPHVQPQPVSSANTQPRGPLSQAPTPAPK.F
UQ91XF077.7%4413.0%261301148.2(Q91XF0) Similar to pyridoxine 5'-phosphate oxidase (Expressed sequence AI415282) 
*	TK261102_lung_cytoE18_2_step03.0191.0191.3	1.1176	0.0568	1488.64	2	2920.0%	1	-.MTCGLLSVTVTFR.R
	TK261102_lung_cytoE18_2_step08.1951.1951.1	1.0021	0.0392	614.6	3	7500.0%	1	K.KLPEK.E
	TK261102_lung_cytoE18_2_step09.1868.1868.1	0.7745	0.0363	618.32	46	6250.0%	1	R.MLLLK.G
*	TK261102_lung_cytoE18_2_step06.2805.2805.2	1.8073	0.4178	1379.23	1	6500.0%	1	K.EAENYFHSRPK.S
U143S_MOUSE77.6%113.2%248277134.8(O70456) 14-3-3 protein sigma (Stratifin) 
	TK261102_lung_cytoE18_2_step01.0146.0146.1	2.0255	0.1067	904.02	2	7140.0%	1	R.VLSSIEQK.S
UY232_HUMAN77.4%222.8%12781416644.8(Q92628) Hypothetical protein KIAA0232 (Fragment) 
*	TK261102_lung_cytoE18_2_step09.2882.2882.3	1.8708	0.0662	3327.75	1	1900.0%	1	R.QDTSDLTSEAVEELSESVHGLCISNNNLHK.T
*	TK261102_lung_cytoE18_2_step12.1929.1929.1	1.6989	0.1858	784.63	1	7000.0%	1	R.KDTEYK.E
UILF3_MOUSE77.1%464.9%911980429.2(Q9Z1X4) Interleukin enhancer-binding factor 3 
	TK261102_lung_cytoE18_2_step12.5177.5177.2	1.0366	0.1313	2984.23	30	1200.0%	1	K.HSSVYPTQEELEAVQNMVSHTERALK.A
	TK261102_lung_cytoE18_2_step08.2563.2563.1	1.8178	0.168	667.05	5	7000.0%	2	K.LHVAVK.V
	TK261102_lung_cytoE18_2_step01.2308.2308.1	1.1521	0.0825	1321.83	37	3330.0%	1	K.VAKAYAALAALEK.L
UQ99KP676.8%5527.2%504552396.6(Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV) 
*	TK261102_lung_cytoE18_2_step10.3876.3876.2	1.9537	0.3365	2616.88	1	2830.0%	1	K.KVTSVVFHPSQELVFSASPDATIR.I
	TK261102_lung_cytoE18_2_step11.2808.2808.3	1.5293	0.0035	2716.8	57	1850.0%	1	K.YIAENGTDPINNQPLSEEQLIDIK.V
	TK261102_lung_cytoE18_2_step05.5018.5018.3	1.3934	0.1216	2903.44	164	1390.0%	1	R.QVASHVGLHSASIPGILALDLCPSDTNK.I
	TK261102_lung_cytoE18_2_step06.0411.0411.2	0.9803	0.1339	2804.24	22	1670.0%	1	K.QWTEILHFTEHSGLTTGVAFGHHAK.F
	TK261102_lung_cytoE18_2_step11.5873.5873.3	1.5241	0.0357	3901.04	26	1140.0%	1	R.AHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGR.V
UPMG2_HUMAN76.8%73715.5%252286358.9(P15259) Phosphoglycerate mutase 2 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme M) (PGAM-M) (BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase) 
*	TK261102_lung_cytoE18_2_step06.0807.0807.2	1.4132	0.1224	3030.25	1	2310.0%	6	K.HLEGMSDQAIMELNLPTGIPIVYELNK.E
*	TK261102_lung_cytoE18_2_step11.1649.1649.2	1.2949	0.0643	1373.32	4	4550.0%	1	R.SFDIPPPPMDEK.H
USTN1_MOUSE76.5%51712.2%148171436.0(P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) 
	TK261102_lung_cytoE18_2_step08.2413.2413.1	1.5597	0.0556	1042.44	2	5620.0%	4	R.KSHEAEVLK.Q
	TK261102_lung_cytoE18_2_step05.3512.3512.1	0.8782	0.056	1141.4	3	4380.0%	1	R.EHEKEVLQK.A
UTCPH_MOUSE76.5%91326.3%544596527.8(P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) 
	TK261102_lung_cytoE18_2_step08.4117.4117.3	1.2799	0.0545	3218.81	5	1730.0%	1	K.DNAEIRVHTVEDYQAIVDAEWNILYDK.L
	TK261102_lung_cytoE18_2_step07.3916.3916.1	1.5662	0.1948	1156.74	1	5560.0%	2	R.SLHDAIMIVR.R
	TK261102_lung_cytoE18_2_step10.2887.2887.1	0.986	0.076	1390.84	8	2310.0%	1	R.GKATISNDGATILK.L
*	TK261102_lung_cytoE18_2_step03.0423.0423.3	1.4837	0.0657	3891.65	10	1210.0%	1	R.TMMACGGSIQTSVNALVPDVLGHCQVFEETQIGGER.Y
	TK261102_lung_cytoE18_2_step01.2043.2043.1	1.2615	0.0917	1062.83	1	6110.0%	1	K.LLDVVHPAAK.T
	TK261102_lung_cytoE18_2_step12.3091.3091.3	1.2778	0.0366	2994.44	194	1160.0%	1	K.TLVDIAKSQDAEVGDGTTSVTLLAAEFLK.Q
	TK261102_lung_cytoE18_2_step10.3576.3576.2	1.6432	0.2384	2019.79	1	3120.0%	2	K.QVKPYVEEGLHPQIIIR.A
UUBIM_HUMAN76.3%1125.7%7477604.3(P35544) Ubiquitin-like protein FUBI 
	TK261102_lung_cytoE18_2_step10.2152.2152.2	2.3765	0.0668	2128.43	1	3610.0%	1	R.AQELHTFEVTGQETVAQIK.A
UQ99MZ976.0%444.8%11731301046.3(Q99MZ9) Structural protein FBF1 
*	TK261102_lung_cytoE18_2_step09.2365.2365.1	1.1448	0.0507	1489.87	5	3080.0%	1	K.QSSPPASSPIHPRK.G
*	TK261102_lung_cytoE18_2_step11.3373.3373.2	1.0241	0.0883	1857.19	7	2810.0%	1	R.AMHADSQREGTIISLTK.E
*	TK261102_lung_cytoE18_2_step03.0408.0408.2	0.8131	0.1006	1735.74	64	2500.0%	1	R.FLGEGGPDPKGESLGFK.Q
*	TK261102_lung_cytoE18_2_step07.2593.2593.1	1.7691	0.1757	884.73	3	6430.0%	1	R.EERAGPPK.D
UMYO6_HUMAN75.9%484.0%12621460478.5(Q9UM54) Myosin VI 
	TK261102_lung_cytoE18_2_step05.1002.1002.2	1.1	0.1456	1985.64	27	2060.0%	2	K.SLGTRPPHVFAIADKAFR.D
	TK261102_lung_cytoE18_2_step10.3885.3885.3	1.2832	0.1842	3860.86	3	1480.0%	2	R.HFAGAVCYETTQFVEKNNDALHMSLESLICESR.D
UO7515575.8%447.4%11111218235.8(O75155) Hypothetical protein KIAA0667 (Fragment) 
*	TK261102_lung_cytoE18_2_step12.2493.2493.3	1.5815	0.0534	3106.47	16	1630.0%	1	R.ALWPLHRPRMLDPEPYVGEMSAVTLAR.L
*	TK261102_lung_cytoE18_2_step07.3944.3944.3	1.6669	0.0858	2825.58	3	1520.0%	1	R.LGAHLDRLVPLVEDFCNLDDDELR.E
*	TK261102_lung_cytoE18_2_step12.0098.0098.3	1.2144	0.0296	2279.81	76	1900.0%	1	K.LISLLTAPVYEQAVDGGPGLHK.Q
*	TK261102_lung_cytoE18_2_step11.1780.1780.1	1.7427	0.1811	1083.7	1	6250.0%	1	R.MLTFIMVAR.L
UO8890375.6%5513.6%641707876.3(O88903) SH3 domain-containing adapter protein 
*	TK261102_lung_cytoE18_2_step09.3025.3025.2	1.4364	0.0694	2450.93	4	2170.0%	1	K.SSLSTPSSASKVNTAAFLTPLELK.A
*	TK261102_lung_cytoE18_2_step09.2787.2787.3	0.9152	0.0114	2178.25	2	1500.0%	1	R.ISTYGLPAGGIQPHPQTKAIK.K
*	TK261102_lung_cytoE18_2_step01.1460.1460.1	1.3301	0.0474	700.56	35	6000.0%	1	K.TLKLPK.E
*	TK261102_lung_cytoE18_2_step05.4558.4558.2	0.7297	0.1081	2020.61	284	1180.0%	1	R.EGELSLISKETGEAGWWK.G
*	TK261102_lung_cytoE18_2_step12.1844.1844.2	1.806	0.3751	1917.13	1	4710.0%	1	K.SLLEQKPSKPAAPQVPPK.K
UQ8VEL975.6%117.7%272300838.6(Q8VEL9) Similar to GTP-binding protein REM2 
*	TK261102_lung_cytoE18_2_step12.1224.1224.2	2.0553	0.3258	2069.25	1	3250.0%	1	R.GHAGGQRPEPSSPDGPAPPTR.R
UQ9D7S775.4%2419.7%122144679.4(Q9D7S7) 3110001N18Rik protein 
*	TK261102_lung_cytoE18_2_step09.4987.4987.2	1.5483	0.3996	2836.64	2	2170.0%	2	R.FHLDLTHPVEDGIFDSGNFEQFLR.E
UQ9CSM474.9%2222.4%851021110.6(Q9CSM4) 60S ribosomal protein L27 (Fragment) 
	TK261102_lung_cytoE18_2_step07.1869.1869.1	1.4699	0.2253	805.57	1	7140.0%	1	-.KVTAAMGK.K
	TK261102_lung_cytoE18_2_step06.3350.3350.1	1.7654	0.0785	1407.67	1	5000.0%	1	K.VYNYNHLMPTR.Y
UPGMU_MOUSE74.8%3310.5%561613866.8(Q9D0F9) Phosphoglucomutase (EC 5.4.2.2) (Glucose phosphomutase) (PGM) 
	TK261102_lung_cytoE18_2_step06.3326.3326.3	1.6049	0.162	2104.67	19	2240.0%	1	R.LSGTGSAGATIRLYIDSYEK.D
*	TK261102_lung_cytoE18_2_step11.1456.1456.3	1.4899	0.1495	1938.18	35	2500.0%	1	K.TIEEYAICPDLKVDLR.V
	TK261102_lung_cytoE18_2_step05.0918.0918.2	2.0183	0.325	2208.62	3	2500.0%	1	K.AIGGIILTASHNPGGPNGDFGIK.F
UQ99JW974.6%2211.0%300341319.0(Q99JW9) Similar to alpha-coatomer protein (Fragment) 
	TK261102_lung_cytoE18_2_step11.2717.2717.3	1.4198	0.0976	2129.89	7	2650.0%	1	K.CPLSGACYSPEFKGQICR.V
	TK261102_lung_cytoE18_2_step06.0651.0651.2	1.8378	0.3568	1714.86	1	5000.0%	1	R.LLHDQVGVIQFGPYK.Q
UQ8WUC774.6%1115.4%1041054011.6(Q8WUC7) Hypothetical protein (Fragment) 
*	TK261102_lung_cytoE18_2_step01.0286.0286.1	1.4356	0.2841	1597.91	1	3670.0%	1	R.RPGGAAMLAESPSVPR.L
UQ1456874.4%249.0%312356744.6(Q14568) Heat shock protein 86 (Fragment) 
*	TK261102_lung_cytoE18_2_step01.4539.4539.3	2.777	0.2688	2945.2	1	2220.0%	2	K.QDQTLTIVDTGIGMTKADLINNLGTIAK.S
UQ9D9A274.0%113.0%235257535.5(Q9D9A2) 1700121J11Rik protein 
	TK261102_lung_cytoE18_2_step09.2503.2503.1	1.5224	0.2143	913.52	4	7500.0%	1	K.KYISQFK.N
UDPO2_MOUSE74.0%224.0%600662675.4(P33611) DNA polymerase alpha 70 kDa subunit (DNA polymerase subunit B) 
	TK261102_lung_cytoE18_2_step10.1110.1110.1	0.7232	0.0277	528.9	2	6670.0%	1	R.RQPK.A
*	TK261102_lung_cytoE18_2_step08.4653.4653.2	1.935	0.3292	2384.3	1	3950.0%	1	R.DVHHEPVYPQPPFTFSELSR.E
UAK10_MOUSE74.0%2211.5%503558755.7(O88845) A kinase anchor protein 10, mitochondrial (Protein kinase A anchoring protein 10) (PRKA10) (Dual specificity A-Kinase anchoring protein 2) (D-AKAP-2) (Fragment) 
*	TK261102_lung_cytoE18_2_step10.5419.5419.3	1.0965	0.0168	4601.44	23	1030.0%	1	R.NDIIAKICGEDGQVDPNCFVLDTAVVFSAMEQEHFSEFLR.S
*	TK261102_lung_cytoE18_2_step08.3305.3305.2	2.3472	0.1398	2032.12	1	3530.0%	1	R.TQNPQNHLLLSQEGHSAR.S
UQ9CYN573.7%114.1%341393797.2(Q9CYN5) 5730405I09Rik protein 
*	TK261102_lung_cytoE18_2_step12.2417.2417.1	1.4441	0.239	1594.13	1	3850.0%	1	K.SLFINHHPPGQTSR.K
UTPM3_MOUSE73.7%113.9%284328634.7(P21107) Tropomyosin alpha 3 chain (Tropomyosin 3) (Tropomyosin gamma) 
	TK261102_lung_cytoE18_2_step07.3785.3785.1	1.6463	0.1793	1285.85	3	4500.0%	1	R.KLVIIEGDLER.T
UVP26_MOUSE73.7%226.4%327381146.5No description
	TK261102_lung_cytoE18_2_step11.1585.1585.1	1.4502	0.243	1008.81	1	6430.0%	1	K.RLEHQGIR.I
	TK261102_lung_cytoE18_2_step07.5346.5346.1	1.3248	0.262	1553.82	15	3330.0%	1	R.IEFVGQIELFNDK.S
UQ9CXS473.6%393.2%252274829.7(Q9CXS4) 3110013H01Rik protein 
*	TK261102_lung_cytoE18_2_step11.1620.1620.1	1.776	0.1671	1125.56	2	6430.0%	3	R.ERWETFQK.R
UGNDS_MOUSE73.3%448.6%852941725.8(Q03385) Ral guanine nucleotide dissociation stimulator (RalGEF) (RalGDS) 
*	TK261102_lung_cytoE18_2_step11.5122.5122.2	1.1156	0.2712	3116.36	50	1400.0%	1	K.AMDKHNLDEDEPEDYELVQIISEDHK.L
*	TK261102_lung_cytoE18_2_step11.2045.2045.2	2.137	0.3002	1582.63	3	4620.0%	1	K.EGTSKFATLEMNPR.R
	TK261102_lung_cytoE18_2_step06.3074.3074.1	1.0486	0.0821	763.54	29	6000.0%	1	R.LINFEK.R
*	TK261102_lung_cytoE18_2_step06.5966.5966.2	0.8804	0.1327	2915.97	10	1350.0%	1	K.ETGVIQGTVPYLGTFLTDLVMLDTAMK.D
URL44_HUMAN73.2%3510.5%1051231010.6(P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a) 
	TK261102_lung_cytoE18_2_step09.2527.2527.1	1.6642	0.1743	1190.83	4	5560.0%	1	R.CKHFELGGDK.K
	TK261102_lung_cytoE18_2_step06.2973.2973.1	1.3014	0.022	1031.64	1	6250.0%	2	K.HFELGGDKK.R
UQ9D41873.1%241.5%393458108.9(Q9D418) 4930560E09Rik protein 
	TK261102_lung_cytoE18_2_step01.1510.1510.1	2.0013	0.0945	716.7	5	7000.0%	2	K.NLDNIK.N
UQ9BYZ673.1%111.4%727825806.7(Q9BYZ6) DBC2 
	TK261102_lung_cytoE18_2_step10.2399.2399.1	1.7274	0.1664	1351.74	1	5000.0%	1	R.HLQFWKSHLR.N
UQ91W5073.1%573.6%798887916.4(Q91W50) Hypothetical 88.8 kDa protein 
	TK261102_lung_cytoE18_2_step07.1809.1809.1	0.8331	0.0612	861.43	164	4170.0%	1	R.NIMLLKK.K
*	TK261102_lung_cytoE18_2_step08.2603.2603.2	1.1382	0.1088	1248.2	3	5000.0%	1	K.IKPEIHPEER.M
	TK261102_lung_cytoE18_2_step05.3788.3788.1	0.8176	0.0905	1353.19	29	2730.0%	1	K.SKVTLLEGDHVR.F
UO5503372.5%4418.9%380428797.0(O55033) SH2/SH3 adaptor protein (Similar to non-catalytic region of tyrosine kinase adaptor protein 2) 
*	TK261102_lung_cytoE18_2_step07.3854.3854.1	1.4044	0.3268	1536.0	1	4090.0%	1	R.FHSMDELVEHYK.K
*	TK261102_lung_cytoE18_2_step12.3048.3048.3	0.8118	0.0863	3731.96	65	680.0%	1	R.GSFNGQIGWFPSNYVLEEADEAAAEAPSFLSLRR.G
	TK261102_lung_cytoE18_2_step08.3108.3108.2	1.1074	0.1014	1344.3	380	3640.0%	1	K.KAPIFTSEHGEK.L
	TK261102_lung_cytoE18_2_step08.4317.4317.1	1.3523	0.121	1486.9	2	3460.0%	1	R.DSESSPSDFSVSLK.A
UDHQU_MOUSE72.5%228.8%273308288.7(Q64669) NAD(P)H dehydrogenase [quinone] 1 (EC 1.6.99.2) (Quinone reductase 1) (QR1) (DT-diaphorase) (DTD) (Azoreductase) (Phylloquinone reductase) (Menadione reductase) 
	TK261102_lung_cytoE18_2_step12.3191.3191.3	2.9906	0.1845	2746.42	3	2280.0%	1	K.KLEAADLVIFQFPLQWFGVPAILK.G
UMTX1_MOUSE72.2%4613.2%317356246.2(P47802) Metaxin 1 
*	TK261102_lung_cytoE18_2_step01.2886.2886.2	2.1523	0.2958	1807.04	3	3850.0%	1	R.QYMERLQLLCGEHK.S
*	TK261102_lung_cytoE18_2_step11.4482.4482.2	0.9552	0.3276	2598.54	1	2270.0%	1	R.DGDEVPLPRQTPAAPETEEEPYR.R
	TK261102_lung_cytoE18_2_step08.1598.1598.1	0.3091	0.1866	502.5	2	2500.0%	2	K.LPSGK.L
UVAB2_MOUSE72.1%5714.3%511565515.8(P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) 
	TK261102_lung_cytoE18_2_step08.4748.4748.2	1.4442	0.1454	2178.93	1	3950.0%	2	K.IPIFSAAGLPHNEIAAQICR.Q
	TK261102_lung_cytoE18_2_step01.1402.1402.1	0.819	0.0018	693.49	61	4000.0%	1	K.DVQAMK.A
	TK261102_lung_cytoE18_2_step01.1426.1426.1	1.0602	0.0545	631.59	4	8000.0%	1	R.EVSAAR.E
	TK261102_lung_cytoE18_2_step10.4895.4895.3	1.1319	0.0596	4553.3	14	1060.0%	1	R.VEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDR.Q
UTTHY_MOUSE72.1%1115.6%147157766.2(P07309) Transthyretin precursor (Prealbumin) 
*	TK261102_lung_cytoE18_2_step09.4839.4839.2	2.1234	0.2976	2517.76	1	2950.0%	1	K.TLGISPFHEFADVVFTANDSGHR.H
URL23_HUMAN72.0%92711.4%1401486510.5(P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) 
	TK261102_lung_cytoE18_2_step11.1152.1152.1	1.3665	0.0719	827.67	2	6670.0%	3	K.KGKPELR.K
	TK261102_lung_cytoE18_2_step12.1731.1731.2	2.1185	0.2902	1019.81	1	7500.0%	1	K.KVHPAVVIR.Q
	TK261102_lung_cytoE18_2_step11.1905.1905.1	1.2464	0.0784	890.82	11	5000.0%	4	K.VHPAVVIR.Q
UQ8VDW871.9%113.1%2292541610.9(Q8VDW8) Hypothetical 25.4 kDa protein 
*	TK261102_lung_cytoE18_2_step01.0142.0142.1	2.0047	0.0134	905.63	3	8330.0%	1	K.EEQLEKK.E
UCIA1_HUMAN71.6%3511.5%339378405.0(O76071) WD-repeat containing protein Ciao 1 
*	TK261102_lung_cytoE18_2_step11.4344.4344.2	0.8728	0.0079	1980.77	28	2650.0%	1	K.EPGLLASCSDDGEVAFWK.Y
*	TK261102_lung_cytoE18_2_step07.5318.5318.2	2.0507	0.3126	2411.24	1	4250.0%	2	R.CWFLAWNPAGTLLASCGGDRR.I
UQ9WU7871.5%335.6%869961516.7(Q9WU78) ALG-2 interacting protein AIP1 
*	TK261102_lung_cytoE18_2_step01.2544.2544.2	1.1508	0.0253	1808.69	28	2810.0%	1	R.KATLVKPTPVNVPVSQK.F
	TK261102_lung_cytoE18_2_step09.2606.2606.2	2.0328	0.3121	1679.0	1	4330.0%	1	K.ATLVKPTPVNVPVSQK.F
	TK261102_lung_cytoE18_2_step12.4872.4872.3	1.1934	0.1406	3495.48	1	1530.0%	1	R.EPTVDISPDTVGTLSLIMLAQAQEVFFLKATR.D
UO9568671.4%115.7%317364457.5(O95686) Serine-threonine specific protein phosphatase (EC 3.1.3.16) (Similar to protein phosphatase 1, regulatory (Inhibitor) subunit 3C) 
	TK261102_lung_cytoE18_2_step06.3712.3712.2	2.3041	0.1792	2300.29	1	4120.0%	1	R.SHFQKNFVCLENCSLQER.T
UFAK2_HUMAN71.3%111.3%10091158756.2(Q14289) Protein tyrosine kinase 2 beta (EC 2.7.1.112) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Cell adhesion kinase beta) (CAK beta) (Calcium-dependent tyrosine kinase) (CADTK) (Related adhesion focal tyrosine kinase) 
*	TK261102_lung_cytoE18_2_step01.4164.4164.1	1.5877	0.1735	1589.63	4	4580.0%	1	R.EEAQQLWEAEKVK.M
UTGR2_MOUSE71.3%4613.3%592671226.3(Q62312) TGF-beta receptor type II precursor (EC 2.7.1.37) (TGFR-2) (TGF-beta type II receptor) 
*	TK261102_lung_cytoE18_2_step01.5158.5158.2	1.4598	0.0167	2914.8	1	2170.0%	2	K.QNTSEQFETVAVKIFPYEEYSSWK.T
*	TK261102_lung_cytoE18_2_step11.5184.5184.2	0.5654	0.0128	2387.97	99	530.0%	1	R.YMAPEVLESRMNLENVESFK.Q
*	TK261102_lung_cytoE18_2_step10.5600.5600.3	1.26	0.0242	4261.94	10	1320.0%	1	R.DRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEAR.L
URCQ1_MOUSE71.2%3310.3%648725528.3(Q9Z129) ATP-dependent DNA helicase Q1 
*	TK261102_lung_cytoE18_2_step06.2494.2494.1	1.5956	0.1709	1441.5	3	4170.0%	1	K.QAEGLNEKLTPLK.L
*	TK261102_lung_cytoE18_2_step06.5918.5918.3	0.9032	0.0286	4234.85	61	610.0%	1	K.VHTQWSANELQVVVATVAFGMGIDKPDVRFVIHHSMSK.S
*	TK261102_lung_cytoE18_2_step06.5008.5008.2	0.7557	0.034	1916.37	34	1670.0%	1	K.FRPLQLETINVTMARK.D
UPA1B_MOUSE71.1%3313.5%229254926.2(Q61206) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) 
	TK261102_lung_cytoE18_2_step06.2576.2576.1	1.2798	0.0643	958.53	62	5830.0%	1	R.WMSQHNR.F
	TK261102_lung_cytoE18_2_step01.4343.4343.2	1.7676	0.3966	2046.19	1	4720.0%	1	R.ELFSPLHALNFGIGGDTTR.H
	TK261102_lung_cytoE18_2_step03.0437.0437.3	1.4863	0.1702	2735.2	4	1960.0%	1	R.ELFSPLHALNFGIGGDTTRHVLWR.L
UQ6470671.0%9158.0%20192218264.9(Q64706) Tenascin C precursor 
*	TK261102_lung_cytoE18_2_step11.4254.4254.1	1.003	0.089	1544.89	6	2690.0%	1	K.VATSYRVSIYGVAR.G
*	TK261102_lung_cytoE18_2_step06.4578.4578.3	1.5258	0.1498	2874.86	35	1540.0%	1	R.TPMLSTDVSTAREPEIGNLNVSDVTPK.S
*	TK261102_lung_cytoE18_2_step11.3750.3750.2	1.2161	0.2029	2614.92	10	1880.0%	1	R.TAHISGLPPSTDFIVYLSGIAPSIR.T
*	TK261102_lung_cytoE18_2_step09.5370.5370.3	1.5981	0.1249	4611.78	1	1380.0%	1	K.LIQTIFTTIGLLYPFPRDCSQAMLNGDTTSGLYTIYINGDK.T
*	TK261102_lung_cytoE18_2_step07.5064.5064.2	2.163	0.1894	2752.92	1	2290.0%	3	K.HFVVQVQEANNVEAAQNLTVPSSLR.A
*	TK261102_lung_cytoE18_2_step08.4723.4723.2	0.864	0.0486	2550.51	51	1500.0%	1	R.CVNGQCVCDEGYTGEDCSQRR.C
*	TK261102_lung_cytoE18_2_step06.4648.4648.3	1.0439	0.1578	3545.54	36	860.0%	1	K.HFVVQVQEANNVEAAQNLTVPSSLRAVDIPGLK.A
UQ8VC8770.9%114.4%344395286.9(Q8VC87) RIKEN cDNA 2810411K16 gene 
*	TK261102_lung_cytoE18_2_step06.4022.4022.2	1.8463	0.329	1780.73	4	3930.0%	1	K.IHSGEKAYECNECGK.A
UQ9BTA970.8%392.5%604656919.3(Q9BTA9) Hypothetical protein 
	TK261102_lung_cytoE18_2_step01.3418.3418.2	1.5723	0.0058	1612.55	5	3930.0%	3	K.LPTPTSSVPAQKTER.K
UO4315470.7%777.5%19562145965.9(O43154) Hypothetical protein KIAA0404 (Fragment) 
*	TK261102_lung_cytoE18_2_step12.0106.0106.3	1.1565	0.1653	2314.67	23	1670.0%	1	K.RTMYETEEMVIPGDPEEMR.T
*	TK261102_lung_cytoE18_2_step07.5040.5040.2	1.5959	0.0141	1884.38	6	3330.0%	1	R.VVLREVSLVWHLYGGR.D
*	TK261102_lung_cytoE18_2_step04.2453.2453.3	1.4289	0.0206	4068.69	8	1350.0%	1	R.SELSSGPGPPVPTHLELTCSDLHGIYEDGGKPPVPCLR.V
*	TK261102_lung_cytoE18_2_step07.4086.4086.2	0.7428	0.0728	2513.88	16	1430.0%	1	R.HGLLGVDKVLGYALNEWLQDIR.K
*	TK261102_lung_cytoE18_2_step01.3272.3272.1	1.5204	0.2015	1598.99	3	3850.0%	1	R.DPWAGQAVRAEQLR.L
*	TK261102_lung_cytoE18_2_step01.3372.3372.1	0.9725	0.03	1458.88	45	2730.0%	1	R.CSGPNRPQNSWR.T
*	TK261102_lung_cytoE18_2_step12.5343.5343.2	1.0393	0.0096	3095.08	21	1800.0%	1	R.CSLEVILPSVHIFLPSKEVYESIYNR.I
UQ9NYF070.2%112.5%555595579.6(Q9NYF0) Heptacellular carcinoma novel gene-3 protein 
*	TK261102_lung_cytoE18_2_step11.2445.2445.1	1.7811	0.1421	1494.75	1	4620.0%	1	K.ESPSRGPAPPQENK.V
UVATE_MOUSE69.8%227.9%228265889.2(P50518) Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) (V-ATPase 31 kDa subunit) (P31) 
	TK261102_lung_cytoE18_2_step04.0162.0162.1	0.9862	0.0146	674.39	25	6250.0%	1	K.EKQIR.Q
	TK261102_lung_cytoE18_2_step06.0382.0382.1	1.8977	0.1119	1578.78	1	5000.0%	1	K.HMMAFIEQEANEK.A
UO8854569.7%229.9%324358805.7(O88545) COP9 complex subunit 6 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6) (ARABIDOPSIS) (Similar TO COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6) 
	TK261102_lung_cytoE18_2_step12.2239.2239.1	1.2379	0.1599	1184.04	1	5000.0%	1	K.EEQFKQVFK.E
	TK261102_lung_cytoE18_2_step07.4893.4893.2	1.8089	0.3305	2598.38	1	2950.0%	1	K.ELEFLGWYTTGGPPDPSDIHVHK.Q
UK1CW_MOUSE69.6%339.5%422480276.2(Q99PS0) Keratin, type I cytoskeletal 23 (Cytokeratin 23) (K23) (CK 23) 
*	TK261102_lung_cytoE18_2_step04.0736.0736.2	1.7239	0.0579	1534.95	1	4550.0%	1	R.KDYSQYEENISR.L
*	TK261102_lung_cytoE18_2_step12.2375.2375.3	1.6201	0.2515	3023.41	5	1850.0%	1	R.EQSAAMAQEVASPAPVQGNQSDIHELRR.T
UPIR_MOUSE69.6%117.9%290320667.1(Q9D711) Pirin 
*	TK261102_lung_cytoE18_2_step06.3317.3317.2	2.2736	0.2203	2497.9	2	3410.0%	1	K.IEPHHTAVLGEGDAVQLENKDPK.R
UO1463869.5%225.6%8751000966.6(O14638) Phosphodiesterase I/nucleotide pyrophosphatase beta (EC 3.1.4.1) (Phosphodiesterase I beta) 
	TK261102_lung_cytoE18_2_step09.3221.3221.3	1.4063	0.1537	3044.91	10	1730.0%	1	R.MPMWSSYTVPQLGDTSPLPPTVPDCLR.A
	TK261102_lung_cytoE18_2_step12.4364.4364.2	1.7844	0.3375	2570.34	1	2860.0%	1	K.CSFYLADKNITHGFLYPPASNR.T
UQ8VI5669.4%779.5%19052120365.4(Q8VI56) LDLR dan 
*	TK261102_lung_cytoE18_2_step12.0513.0513.3	1.8364	0.176	4338.31	6	1150.0%	1	K.TDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPER.R
*	TK261102_lung_cytoE18_2_step11.4117.4117.3	1.414	0.1844	4730.49	28	1030.0%	1	R.CDGEDDCADNSDEENCENTGSPQCASDQFLCWNGRCIGQR.K
*	TK261102_lung_cytoE18_2_step10.4379.4379.3	1.3074	0.0429	4760.48	17	1010.0%	1	R.SWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIR.S
	TK261102_lung_cytoE18_2_step01.2190.2190.1	1.9851	0.043	768.21	10	7000.0%	1	K.FLLFAR.R
	TK261102_lung_cytoE18_2_step07.4433.4433.3	1.6026	0.0997	1898.8	7	2170.0%	1	R.NLYWTDTGRNTIEASR.L
	TK261102_lung_cytoE18_2_step05.0917.0917.2	1.4957	0.0989	2278.22	60	2110.0%	1	R.RISFDTEDLSDDVIPLADVR.S
	TK261102_lung_cytoE18_2_step06.1222.1222.2	0.8021	0.1222	2431.46	2	1750.0%	1	K.VLINTDLGWPNGLTLDYDTRR.I
USEP4_MOUSE69.4%223.8%478549365.9(P28661) Septin 4 (Peanut-like protein 2) (Brain protein H5) 
	TK261102_lung_cytoE18_2_step07.3577.3577.1	1.9937	0.323	1371.92	6	5500.0%	1	K.IREEIEHFGIK.I
	TK261102_lung_cytoE18_2_step04.4878.4878.1	0.9428	0.0956	873.73	20	5000.0%	1	R.THMQDLK.D
UPFD5_MOUSE69.3%1112.3%154173566.3(Q9WU28) Prefoldin subunit 5 (C-myc binding protein Mm-1) (Myc modulator 1) (EIG-1) 
	TK261102_lung_cytoE18_2_step09.4042.4042.2	1.9929	0.3121	2186.85	1	4440.0%	1	K.LHDVEHVLIDVGTGYYVEK.T
UTRA1_MOUSE68.7%2213.9%409454655.8(P39428) TNF receptor associated factor 1 (TRAF1) 
*	TK261102_lung_cytoE18_2_step04.2362.2362.3	0.9101	0.0085	4687.46	13	750.0%	1	-.MASSSAPDENEFQFGCPPAPCQDPSEPRVLCCTACLSENLR.D
*	TK261102_lung_cytoE18_2_step06.0080.0080.1	1.605	0.1578	1576.72	1	4000.0%	1	K.SSPGSNLGSAPMALER.N
UQ9UG4768.7%244.0%323373869.5(Q9UG47) Hypothetical protein 
*	TK261102_lung_cytoE18_2_step10.2841.2841.1	1.9767	0.0517	1579.86	1	5000.0%	2	K.KDEFMSFAGTWMK.L
UHUNK_MOUSE68.6%574.1%714796039.1(O88866) Hormonally upregulated neu tumor-associated kinase (EC 2.7.1.-) (Serine/threonine protein kinase MAK-V) 
	TK261102_lung_cytoE18_2_step07.1712.1712.1	0.7695	0.1946	592.95	1	6250.0%	2	K.KYGPK.I
	TK261102_lung_cytoE18_2_step06.2965.2965.2	1.0985	0.0844	1574.24	20	3330.0%	1	R.ACHILAIYFLLNK.K
*	TK261102_lung_cytoE18_2_step11.1598.1598.2	1.2586	0.054	1167.3	13	4440.0%	1	R.HQSLQPSSER.S
*	TK261102_lung_cytoE18_2_step07.3481.3481.1	1.453	0.2276	1324.6	3	5000.0%	1	K.RHQSLQPSSER.S
UQ9NS8268.5%112.7%523567988.2(Q9NS82) Asc-type amino acid transporter 1 (ASC1 protein) 
	TK261102_lung_cytoE18_2_step12.3172.3172.1	1.4424	0.2256	1573.89	1	4230.0%	1	R.EGHLPSLLAMIHVR.H
UABCR_HUMAN68.5%14287.4%22732559416.3(P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein) 
*	TK261102_lung_cytoE18_2_step01.5098.5098.1	0.3006	0.0	616.47	9	1250.0%	1	R.GIRIR.D
*	TK261102_lung_cytoE18_2_step08.2233.2233.1	1.0439	0.0318	958.61	7	5000.0%	2	K.RFQHTIR.S
*	TK261102_lung_cytoE18_2_step10.3193.3193.2	0.9258	0.1319	1521.12	7	3330.0%	1	K.GAFRCMGTIQHLK.S
*	TK261102_lung_cytoE18_2_step07.4244.4244.3	1.7331	0.0824	4568.37	35	990.0%	1	R.DIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLK.G
*	TK261102_lung_cytoE18_2_step10.1665.1665.1	0.9465	0.068	1118.43	5	3890.0%	1	R.DIETSLDAVR.Q
*	TK261102_lung_cytoE18_2_step11.3581.3581.2	0.6054	0.0188	2792.26	70	870.0%	1	R.LYCSGTPLFLKNCFGTGLYLTLVR.K
*	TK261102_lung_cytoE18_2_step05.4281.4281.3	1.0419	1.0E-4	4752.06	1	1190.0%	1	K.NIGLSDSVVYLLINSQVRPEQFAHGVPDLALKDIACSEALLER.F
*	TK261102_lung_cytoE18_2_step09.5029.5029.1	1.4314	0.1416	1279.0	2	3500.0%	4	K.DIACSEALLER.F
*	TK261102_lung_cytoE18_2_step06.2908.2908.1	1.0953	0.07	1591.73	22	2310.0%	1	R.DTLGNPTVKDFLNR.Q
*	TK261102_lung_cytoE18_2_step11.5077.5077.2	1.6264	0.2446	2254.52	8	2270.0%	1	K.TTTLSILTGLLPPTSGTVLVGGR.D
UQ9JLB868.3%224.9%510558118.0(Q9JLB8) Cell adhesion molecule nectin-3 beta 
	TK261102_lung_cytoE18_2_step06.3482.3482.1	1.4004	0.1029	1009.58	5	5000.0%	1	K.KRPSYLDK.V
	TK261102_lung_cytoE18_2_step12.2792.2792.2	1.9399	0.3115	1989.14	1	3750.0%	1	K.VIDLPPTHKPPPVYEER.I
UQ9D0N068.1%228.7%414450008.8(Q9D0N0) 2610001M19Rik protein 
*	TK261102_lung_cytoE18_2_step08.2628.2628.1	1.7178	0.1516	1216.55	2	5000.0%	1	K.AIEQLAKDGNR.F
*	TK261102_lung_cytoE18_2_step07.3769.3769.3	1.3954	0.0514	2582.59	22	1880.0%	1	K.QKNLLSPANAVLVVSGGVASNLYIR.K
UPSB5_MOUSE68.0%245.7%209229678.5(O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6) 
	TK261102_lung_cytoE18_2_step08.3917.3917.1	1.5932	0.1589	1285.81	1	5450.0%	2	K.FLHGVIVAADSR.A
UFBL1_MOUSE68.0%339.6%705780575.2(Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) 
*	TK261102_lung_cytoE18_2_step11.3730.3730.2	1.7684	0.3436	1907.09	1	3750.0%	1	R.DPVHTVSHTVISLPTFR.E
*	TK261102_lung_cytoE18_2_step06.5306.5306.3	1.2003	0.0029	4409.9	40	1030.0%	1	R.LVPLPLLLLSSLSLLAARANADISMEACCTDPNQMANQHR.D
*	TK261102_lung_cytoE18_2_step09.3546.3546.1	0.6612	0.0048	1477.44	38	2000.0%	1	R.CLSFECPENYR.R
UQ91Z8367.9%7115.5%19352228775.8(Q91Z83) Beta myosin heavy chain 
	TK261102_lung_cytoE18_2_step06.5620.5620.2	1.1522	0.2071	2925.92	2	1670.0%	2	K.MDADLSQLQTEVEEAVQECRNAEEK.A
*	TK261102_lung_cytoE18_2_step12.3396.3396.3	1.5573	0.1852	2976.91	2	1900.0%	1	K.GKQEAHFSLVHYAGTVDYNILGWLQK.N
	TK261102_lung_cytoE18_2_step06.4112.4112.2	0.9989	0.0226	1900.76	340	2140.0%	1	K.AERDYHIFYQILSNK.K
	TK261102_lung_cytoE18_2_step10.5141.5141.3	1.3138	0.1364	4770.39	4	1030.0%	2	K.KEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPK.A
	TK261102_lung_cytoE18_2_step12.2687.2687.2	2.1023	0.2772	2354.25	1	3950.0%	1	K.MDADLSQLQTEVEEAVQECR.N
UQ9QYY067.8%336.9%695767935.7(Q9QYY0) GRB2-associated binding protein 1 
*	TK261102_lung_cytoE18_2_step11.4165.4165.2	2.2766	0.1631	2518.7	1	3570.0%	1	K.VKPAPLDIKPLSEWEELQAPVR.S
	TK261102_lung_cytoE18_2_step05.4145.4145.1	0.7642	0.089	1195.26	323	2000.0%	1	R.SNTISTVDLNK.L
	TK261102_lung_cytoE18_2_step07.2509.2509.2	2.1284	0.1417	1703.93	1	4290.0%	1	R.RPVPVADCEPPPVDR.N
UQ9UH4867.8%2213.6%332388659.2(Q9UH48) Gastric cancer-related protein GCYS-20 
*	TK261102_lung_cytoE18_2_step10.4101.4101.2	2.2754	0.1482	2211.5	1	4120.0%	1	K.IVDWMDNFKLVGLLNNYR.Y
*	TK261102_lung_cytoE18_2_step07.3774.3774.3	1.6892	0.1059	3268.7	2	1920.0%	1	R.SVSFCNPIFSDWFSLGYSTFKITYLER.D
UQ921Q567.7%229.0%558608155.6(Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1 
*	TK261102_lung_cytoE18_2_step12.3065.3065.3	1.7864	0.0111	3482.62	35	1370.0%	1	K.ITAADRTEGSLEGCLDCLLQALAQNNAETSEK.I
	TK261102_lung_cytoE18_2_step05.4396.4396.2	2.0655	0.2997	1918.04	1	4710.0%	1	R.HVEDGNVTVQHAALSALR.N
UBIRF_MOUSE67.6%223.7%14031598245.7(Q9JIB6) Baculoviral IAP repeat-containing protein 1f (Neuronal apoptosis inhibitory protein 6) 
*	TK261102_lung_cytoE18_2_step06.5286.5286.3	1.1977	0.0583	3042.08	4	1900.0%	1	K.KSSEEIAQYIQDYEGFVHVTGEHFVK.S
	TK261102_lung_cytoE18_2_step08.5035.5035.3	2.6746	0.2787	2984.21	3	1800.0%	1	-.MAEHGESSEDRISEIDYEFLAELSAR.F
UQ8VCL267.6%1114.5%255289448.3(Q8VCL2) RIKEN cDNA 2900072D10 gene 
*	TK261102_lung_cytoE18_2_step07.5309.5309.3	2.67	0.2547	4285.9	1	1670.0%	1	R.VYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGR.S
UQ8VGF467.6%5719.9%307347859.0(Q8VGF4) Olfactory receptor MOR230-3 
*	TK261102_lung_cytoE18_2_step11.4845.4845.3	2.67	0.2534	3105.18	3	2210.0%	1	K.QKMVFIIFLVFYLGTVVGNTLIIMTIK.F
*	TK261102_lung_cytoE18_2_step06.1166.1166.3	0.9215	0.0557	3883.31	1	1440.0%	1	R.YPVIMSRQVCVILIILAWIGSFIHSTAQIVLALR.L
*	TK261102_lung_cytoE18_2_step12.5752.5752.2	1.4058	0.189	2847.54	23	1880.0%	2	K.MVFIIFLVFYLGTVVGNTLIIMTIK.F
UQ9Y35367.4%5517.8%422468528.2(Q9Y353) Soluble liver antigen/liver pancreas antigen 
	TK261102_lung_cytoE18_2_step03.3750.3750.1	0.9161	0.1018	616.48	7	7000.0%	1	K.QVSGAR.V
	TK261102_lung_cytoE18_2_step06.5385.5385.3	1.3085	0.0688	3445.01	61	1330.0%	1	K.LAGVHTVANCFVVPMATGMSLTLCFLTLRHK.R
	TK261102_lung_cytoE18_2_step12.2979.2979.1	1.8453	0.1132	1392.53	5	4550.0%	1	K.TEDVDIEEMALK.L
	TK261102_lung_cytoE18_2_step07.5158.5158.2	0.9268	0.0434	3030.28	1	1800.0%	1	K.VQELGPDCILCIHSTTSCFAPRVPDR.L
UEP15_MOUSE67.1%6618.8%897984714.6(P42567) Epidermal growth factor receptor substrate 15 (Protein Eps15) (AF-1P protein) 
*	TK261102_lung_cytoE18_2_step01.2594.2594.3	1.396	0.0175	4408.89	3	1160.0%	1	K.HNDPFAPGGTVVAAASDSATDPFASVFGNESFGDGFADFSTLSK.V
*	TK261102_lung_cytoE18_2_step03.0059.0059.3	1.2707	0.0024	1616.26	14	2500.0%	1	K.IWDLADTDGKGVLSK.Q
*	TK261102_lung_cytoE18_2_step01.4842.4842.3	1.2187	0.0449	4559.8	2	1100.0%	1	K.GSDPFASDCFFKQTSTDPFTTSSTDPFSASSNSSNTSVETWK.H
*	TK261102_lung_cytoE18_2_step12.1365.1365.2	1.888	0.3126	1463.08	1	5380.0%	1	K.VGTPTRPCPPPPGK.R
*	TK261102_lung_cytoE18_2_step07.3716.3716.3	0.7949	0.0426	3163.83	22	980.0%	1	K.NITGSSPVADFSAIKELDTLNNEIVDLQR.E
*	TK261102_lung_cytoE18_2_step01.2506.2506.2	0.8699	2.0E-4	2980.63	42	1250.0%	1	K.QQVQELLGELDEQKAQLEEQLQEVR.K
URN5A_MOUSE67.1%355.6%735832756.5(Q05921) 2-5A-dependent ribonuclease (EC 3.1.26.-) (2-5A-dependent RNase) (Ribonuclease L) (RNase L) (Ribonuclease 4) 
*	TK261102_lung_cytoE18_2_step01.3308.3308.3	1.7199	0.1705	2963.38	6	1700.0%	1	K.GEIPFETLKTQNDEVLLTMSPDEETK.D
*	TK261102_lung_cytoE18_2_step01.4836.4836.2	2.2441	0.2122	1942.98	1	4290.0%	2	R.YFQETFPDLVIYIYK.K
UEGF_MOUSE66.7%466.0%12171331446.5(P01132) Pro-epidermal growth factor precursor (EGF) [Contains: Epidermal growth factor] 
	TK261102_lung_cytoE18_2_step08.1844.1844.1	0.9732	0.0384	468.5	2	6670.0%	1	R.AHLK.G
*	TK261102_lung_cytoE18_2_step06.5973.5973.3	0.9758	0.0061	4731.47	12	830.0%	1	R.QKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEK.L
*	TK261102_lung_cytoE18_2_step08.5453.5453.3	2.5285	0.134	2853.84	6	2200.0%	2	R.IDPDGTNHQQLVVDAGISADMDIHYK.K
URYR3_HUMAN66.5%10105.1%48705519395.7(Q15413) Ryanodine receptor 3 (Brain-type ryanodine receptor) (RyR3) (RYR-3) (Brain ryanodine receptor-calcium release channel) 
*	TK261102_lung_cytoE18_2_step09.0087.0087.3	1.5127	0.1051	4717.46	3	990.0%	1	K.YIPPDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHR.T
*	TK261102_lung_cytoE18_2_step06.3189.3189.3	1.2063	0.0094	2633.47	135	1300.0%	1	K.LPSLNKDGSVSEPDMAANFCPDHK.A
*	TK261102_lung_cytoE18_2_step12.2392.2392.1	1.028	0.0751	1435.91	51	2730.0%	1	R.GEKVLQNDEFTR.D
*	TK261102_lung_cytoE18_2_step07.3917.3917.3	1.2852	0.1422	4044.44	142	1110.0%	1	R.QRPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTK.T
*	TK261102_lung_cytoE18_2_step10.4016.4016.2	0.889	0.0258	2129.75	14	2650.0%	1	R.LPTFVNVPKDHPHIEVMR.I
*	TK261102_lung_cytoE18_2_step12.3356.3356.3	2.8051	0.2479	3057.25	1	2210.0%	1	K.CLLDPAESVLNYFEPYLGRIEIMGGAK.K
*	TK261102_lung_cytoE18_2_step06.1148.1148.2	1.0315	0.0378	3040.89	15	1540.0%	1	R.QNQKAMFEHLSYLLENSSVGLASPSMR.G
*	TK261102_lung_cytoE18_2_step12.4543.4543.2	1.1737	0.1391	2525.66	1	2730.0%	1	K.YVDSAQEFIAHLEAIVSSGKTEK.S
*	TK261102_lung_cytoE18_2_step08.3629.3629.3	1.5178	0.0701	3090.99	62	1560.0%	1	K.VEEEEEEETEKQPDPLHQIILYFSR.N
*	TK261102_lung_cytoE18_2_step12.1928.1928.1	0.9042	0.0303	1134.68	198	3120.0%	1	K.QKTLYQQAR.L
URPB2_HUMAN66.4%6126.2%11741338966.9(P30876) DNA-directed RNA polymerase II 140 kDa polypeptide (EC 2.7.7.6) (RNA polymerase II subunit 2) (RPB2) 
*	TK261102_lung_cytoE18_2_step12.2964.2964.3	1.2705	0.1196	2246.04	23	1390.0%	1	R.MDTLAHVLYYPQKPLVTTR.S
*	TK261102_lung_cytoE18_2_step06.4224.4224.2	1.1753	0.211	1878.94	3	3670.0%	1	K.EMLPHVGVSDFCETKK.A
*	TK261102_lung_cytoE18_2_step12.3111.3111.2	0.9674	0.0108	1905.89	4	3670.0%	1	R.QMDIIVSEVSMIRDIR.E
*	TK261102_lung_cytoE18_2_step06.0692.0692.2	2.2699	0.048	2227.39	6	2620.0%	3	K.LDDDGLIAPGVRVSGDDVIIGK.T
UQ9BTJ166.3%86419.0%8494789.1(Q9BTJ1) Ribosomal protein S27 
*	TK261102_lung_cytoE18_2_step07.3658.3658.2	0.9647	0.1015	1881.87	29	2670.0%	8	-.MPLARDLLHPSLEEEK.K
UTRFE_HUMAN66.3%225.4%698770507.1(P02787) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) (PRO1400) 
*	TK261102_lung_cytoE18_2_step10.1495.1495.3	1.211	0.0559	1688.54	16	2680.0%	1	K.DCHLAQVPSHTVVAR.S
*	TK261102_lung_cytoE18_2_step11.5756.5756.2	1.8397	0.3106	2443.78	1	2500.0%	1	-.MRLAVGALLVCAVLGLCLAVPDK.T
UTYB4_MOUSE66.1%1417054.0%5056795.0(P20065) Thymosin beta-4 (T beta 4) 
	TK261102_lung_cytoE18_2_step02.3876.3876.1	0.7288	0.0338	658.54	38	3000.0%	13	K.NPLPSK.E
*	TK261102_lung_cytoE18_2_step11.4644.4644.2	1.2412	0.0534	2409.05	84	1750.0%	1	-.MLLPATMSDKPDMAEIEKFDK.S
UQ8R2Q766.0%337.7%869990467.5(Q8R2Q7) Similar to hypothetical protein FLJ20318 
	TK261102_lung_cytoE18_2_step10.1793.1793.1	0.9059	0.065	666.39	23	6250.0%	1	K.YSKIR.S
*	TK261102_lung_cytoE18_2_step12.3383.3383.2	2.0161	0.2995	2241.18	1	3610.0%	1	K.DHLIAPNDNDFGKYSFLFK.D
*	TK261102_lung_cytoE18_2_step11.4597.4597.3	1.8875	0.0843	4564.14	1	1310.0%	1	R.DLCTSTAREGTPLNNSNSSLLLMNGPGNLLASENFLGITSQPR.N
UQ9EQ0066.0%247.8%230259425.1(Q9EQ00) cAMP-dependent protein kinase regulatory subunit 
*	TK261102_lung_cytoE18_2_step08.4599.4599.2	2.252	0.1688	1943.41	1	3820.0%	2	K.FLALGCSSLGRTLNTAMK.N
UQ9EQN865.9%2210.2%324378974.9(Q9EQN8) Mitosin (Fragment) 
*	TK261102_lung_cytoE18_2_step01.3870.3870.1	1.9205	0.0325	1171.45	2	6250.0%	1	K.QCHILEQLK.E
*	TK261102_lung_cytoE18_2_step07.5388.5388.3	1.3869	0.1558	2852.23	1	2280.0%	1	K.TEIQTMDQNLQDLELELTNTRSEK.E
UQ9DAN165.3%5711.3%604694865.7(Q9DAN1) 1700007B13Rik protein 
*	TK261102_lung_cytoE18_2_step06.5248.5248.1	1.4681	0.1916	1419.83	1	4090.0%	2	R.FHVILDSVLVFK.K
*	TK261102_lung_cytoE18_2_step09.1651.1651.1	0.9864	0.0874	693.53	5	6000.0%	1	K.IEDTSK.Q
*	TK261102_lung_cytoE18_2_step12.4237.4237.3	0.9361	0.1017	3903.13	65	860.0%	1	K.QQLTGFVIELNPENKDLIYELNILNHMLLFISK.S
*	TK261102_lung_cytoE18_2_step05.5112.5112.2	0.7254	0.0124	2031.23	154	1560.0%	1	K.ETELQQEFDITHAPELK.L
UCU80_MOUSE64.7%2212.1%429494296.5(Q8VHI3) Protein C21orf80 homolog 
*	TK261102_lung_cytoE18_2_step06.4056.4056.3	1.3828	0.0121	4624.13	1	1350.0%	1	K.NIPVIEYEQFIAESGGPFIDQVYVLQGYAEGWKEGTWEEK.V
*	TK261102_lung_cytoE18_2_step06.3012.3012.1	1.8935	0.2783	1381.65	6	4550.0%	1	R.AENLLHDHYGGR.E
UTDR1_HUMAN64.4%82014.4%777867635.2(Q9BXT4) Tudor domain containing protein 1 
*	TK261102_lung_cytoE18_2_step06.4093.4093.2	0.9333	0.017	2840.59	17	1520.0%	1	K.GMPENQEKLCMLTAELLEYCNAPK.S
*	TK261102_lung_cytoE18_2_step01.5547.5547.3	0.9956	0.0784	4318.95	139	760.0%	1	K.YTSDDFWYRAVVLGTSDTDVEVLYADYGNIETLPLCR.V
*	TK261102_lung_cytoE18_2_step05.3688.3688.1	1.0259	0.0513	1009.28	1	6250.0%	4	K.EILPNGHVK.V
*	TK261102_lung_cytoE18_2_step11.0840.0840.3	0.9173	0.1331	3872.22	35	830.0%	1	K.YCDQLPPRSDFYPAIGDICCAQFSEDDQWYR.A
*	TK261102_lung_cytoE18_2_step05.4356.4356.1	0.8233	0.1667	1189.31	19	2500.0%	1	R.KLAELQASLSK.Y
UQ9DCY264.3%2210.3%233259318.2(Q9DCY2) 2310045J23Rik protein 
	TK261102_lung_cytoE18_2_step10.4115.4115.2	1.9299	0.2965	1860.32	2	3570.0%	1	R.VVYRPEHISFEELLK.V
	TK261102_lung_cytoE18_2_step07.3413.3413.1	0.6124	0.044	1126.54	6	3120.0%	1	K.EEYQKVLSK.H
UIF4E_MOUSE64.2%392.8%217250536.1(P20415) Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa subunit) 
	TK261102_lung_cytoE18_2_step10.1576.1576.1	1.1018	0.0401	766.48	36	4000.0%	3	K.HPLQNR.W
UO9551464.2%4168.7%150172888.7(O95514) DJ1042K10.2 (Putative partial isoform 2) (Fragment) 
*	TK261102_lung_cytoE18_2_step07.3800.3800.1	1.5281	0.1575	1574.04	1	5000.0%	4	R.RWGSHVCAQEEGR.G
UAMYP_MOUSE64.1%2210.0%508574177.5(P00688) Alpha-amylase, pancreatic precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) 
*	TK261102_lung_cytoE18_2_step09.4387.4387.3	1.6163	0.0266	2882.03	2	1880.0%	1	K.NWGEGWGLVPSDRALVFVDNHDNQR.G
	TK261102_lung_cytoE18_2_step09.4647.4647.2	1.9268	0.2976	3011.49	5	2200.0%	1	R.NVVNGQPFSNWWDNNSNQVAFSRGNR.G
UQ9JL6164.1%228.2%658697079.5(Q9JL61) Regulator factor X 5 
	TK261102_lung_cytoE18_2_step07.5466.5466.2	2.2258	0.1119	2520.43	2	3000.0%	1	K.YCESLACCRPLSTANFGKIIR.E
*	TK261102_lung_cytoE18_2_step07.4016.4016.3	1.5835	0.0314	3788.94	5	1410.0%	1	K.LYLYLQLPSGPSVGEKSSEPSLLSNEEYMYAYR.W
UQ8R0G964.1%466.5%11551286875.2(Q8R0G9) Similar to nucleoporin 133kD 
*	TK261102_lung_cytoE18_2_step09.5015.5015.2	0.8596	0.0574	2617.33	2	2170.0%	2	K.MCRFLTAVQGGSFILSSVGSQLVR.L
*	TK261102_lung_cytoE18_2_step12.2957.2957.2	1.7552	0.356	1931.52	2	2940.0%	1	K.IHQHVLPQGQGMLSGIGR.R
*	TK261102_lung_cytoE18_2_step12.3407.3407.3	1.3877	0.0331	3503.8	26	1410.0%	1	R.ENVSLLAEDLEESLTSSVGGRGSESMVFETTTK.N
UQ8WUS364.0%1148.5%6671157.4(Q8WUS3) Similar to hypothetical protein FLJ21463 
*	TK261102_lung_cytoE18_2_step10.4431.4431.3	2.5611	0.3507	3613.19	1	1690.0%	1	R.SSNPPTSASQVAETTGTHHHTWLIFCDFGRDR.V
UQ9HCC863.9%111.9%539617298.4(Q9HCC8) Osteoblast differentiation promoting factor 
*	TK261102_lung_cytoE18_2_step08.2708.2708.1	1.4446	0.2152	1151.59	2	6110.0%	1	R.QIYGRQGGNR.T
UQ9NXC763.9%1115.0%226248488.4(Q9NXC7) Hypothetical protein FLJ20320 
*	TK261102_lung_cytoE18_2_step09.2815.2815.3	2.5553	0.3445	3654.88	1	2050.0%	1	R.ALLSVESGSKPFTRQEVIGFVIGSISSVLYLLSR.L
UNEK1_HUMAN63.6%121223.6%12581428285.9(Q96PY6) Serine/threonine-protein kinase NEK1 (EC 2.7.1.37) (NimA-related protein kinase 1) (NY-REN-55 antigen) 
*	TK261102_lung_cytoE18_2_step11.3280.3280.3	2.533	0.3864	2276.32	1	2750.0%	11	K.NSLLIGLSTGLFDANNPKMLR.T
*	TK261102_lung_cytoE18_2_step09.4602.4602.2	1.041	0.0699	2938.71	34	1520.0%	1	R.GQYEHYHAIFDQMQQQRAEDNEAK.W
UQ8R0N963.4%112.5%485531088.7(Q8R0N9) Hypothetical 53.1 kDa protein (Fragment) 
*	TK261102_lung_cytoE18_2_step12.2069.2069.2	2.2164	0.0794	1353.31	7	4550.0%	1	R.SGVLDRELPLPR.L
UROA1_MOUSE63.3%121447.6%319340659.2(P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) 
	TK261102_lung_cytoE18_2_step11.1653.1653.3	1.2295	0.0536	2511.42	36	2050.0%	1	R.GFGFVTYATVEEVDAAMNARPHK.V
	TK261102_lung_cytoE18_2_step05.0191.0191.2	0.9555	0.0499	1303.33	7	3000.0%	1	K.SESPKEPEQLR.K
	TK261102_lung_cytoE18_2_step08.4516.4516.2	1.2829	0.1077	1969.11	3	3000.0%	1	R.SHFEQWGTLTDCVVMR.D
	TK261102_lung_cytoE18_2_step06.2542.2542.2	1.8923	0.1114	1440.12	1	5830.0%	2	R.EDSQRPGAHLTVK.K
	TK261102_lung_cytoE18_2_step12.2093.2093.3	1.3724	0.0376	4407.99	8	970.0%	1	R.GGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMK.G
	TK261102_lung_cytoE18_2_step01.4314.4314.2	0.9161	0.223	1879.22	6	2000.0%	1	K.IFVGGIKEDTEEHHLR.D
	TK261102_lung_cytoE18_2_step06.2253.2253.2	1.5577	0.2548	1489.54	5	5000.0%	1	K.YHTVNGHNCEVR.K
	TK261102_lung_cytoE18_2_step06.1188.1188.2	0.8729	0.111	2756.2	86	1460.0%	1	R.SRGFGFVTYATVEEVDAAMNARPHK.V
	TK261102_lung_cytoE18_2_step01.1214.1214.2	1.0614	0.0702	1315.98	130	3080.0%	1	R.GGNFSGRGGFGGSR.G
UQ99ML963.2%222.2%9891078967.1(Q99ML9) Arkadia 
	TK261102_lung_cytoE18_2_step08.2241.2241.1	1.2158	0.0251	900.41	2	7500.0%	1	R.MMQHPTR.A
	TK261102_lung_cytoE18_2_step06.3836.3836.1	1.5008	0.1722	1573.85	4	3570.0%	1	R.LGNVNRGASQGTIER.C
UQ9D0Q863.2%247.1%168193278.8(Q9D0Q8) 2600005K24Rik protein 
	TK261102_lung_cytoE18_2_step08.3056.3056.1	1.5028	0.172	1377.8	1	4090.0%	2	K.RIEPADAHVLQK.N
UQ9UDR163.0%1111.7%137151846.7(Q9UDR1) T-cell receptor gamma chain, TRGV9 
	TK261102_lung_cytoE18_2_step09.2653.2653.2	1.8425	0.2986	1771.95	1	4330.0%	1	R.IPETSTSTLTIHNVEK.Q
UQ9CYP962.9%3543.6%117133965.6(Q9CYP9) 3930402F23Rik protein 
*	TK261102_lung_cytoE18_2_step06.3136.3136.1	1.5893	0.1117	1139.53	3	5000.0%	2	R.GEPAEPSPEPK.E
*	TK261102_lung_cytoE18_2_step11.4709.4709.3	1.0611	0.0234	4279.16	42	1150.0%	1	K.SCDENEGTPQNTPKADEGHPSEDPPQQAGETLQASGENVR.E
USYEP_HUMAN62.8%999.9%14401630267.7(P07814) Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)] 
*	TK261102_lung_cytoE18_2_step01.3116.3116.2	0.9037	0.048	2555.02	1	2950.0%	1	K.TELAEPIAIRPTSETVMYPAYAK.W
*	TK261102_lung_cytoE18_2_step07.5105.5105.2	1.7871	0.3064	2018.03	1	2860.0%	1	K.DPSKNQGGGLSSSGAGEGQGPK.K
*	TK261102_lung_cytoE18_2_step11.1188.1188.1	0.668	0.0241	541.76	6	3750.0%	1	K.GVPIR.L
*	TK261102_lung_cytoE18_2_step01.3482.3482.3	1.0359	0.0863	4659.77	1	880.0%	1	K.LSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLK.G
*	TK261102_lung_cytoE18_2_step07.3524.3524.1	1.2781	0.0988	973.82	1	5830.0%	1	K.FNHWELK.G
*	TK261102_lung_cytoE18_2_step06.3101.3101.1	1.1646	0.0243	1193.77	72	3890.0%	1	K.QLLSLKAEYK.E
*	TK261102_lung_cytoE18_2_step01.3064.3064.1	0.8733	0.0014	1424.04	31	3330.0%	1	K.VEATKNETSAPFK.E
*	TK261102_lung_cytoE18_2_step11.2096.2096.2	1.0378	0.1822	1796.19	9	3210.0%	1	K.HEELMLGDPCLKDLK.K
*	TK261102_lung_cytoE18_2_step07.2245.2245.1	0.8877	0.0028	1192.47	5	3500.0%	1	K.GVPIRLEVGPR.D
UNR52_MOUSE62.8%226.4%560640208.2(P45448) Orphan nuclear receptor NR5A2 (Liver receptor homolog) (LRH-1) 
*	TK261102_lung_cytoE18_2_step11.4220.4220.3	1.1315	0.1107	3343.03	5	1550.0%	1	R.SPFVTSPISMTMPPHSSLHGYQPYGHFPSR.A
*	TK261102_lung_cytoE18_2_step11.0752.0752.1	1.3991	0.2629	639.42	1	7000.0%	1	R.QVAHGK.E
UQ9UPY362.7%101010.9%19242188115.7(Q9UPY3) Helicase-MOI 
*	TK261102_lung_cytoE18_2_step12.3669.3669.2	0.7284	0.0605	2644.7	94	1090.0%	1	K.QDPELAYISSNFITGHGIGKNQPR.N
*	TK261102_lung_cytoE18_2_step01.1089.1089.1	0.356	0.0475	807.01	11	1670.0%	1	R.SLPADFR.Y
*	TK261102_lung_cytoE18_2_step01.5668.5668.2	0.8686	0.0407	2777.23	56	1090.0%	1	K.YEEELDLHDEEETSVPGRPGSTKR.R
*	TK261102_lung_cytoE18_2_step01.2580.2580.1	1.1363	0.2051	1514.88	13	3750.0%	1	K.DEMTKDCMLANGK.L
*	TK261102_lung_cytoE18_2_step01.2723.2723.3	0.9388	0.0256	2336.0	8	1360.0%	1	K.STSDGSPVMAVMPGTTDTIQVLK.G
*	TK261102_lung_cytoE18_2_step10.1891.1891.1	1.5577	0.1569	695.73	2	7500.0%	1	R.QCYPK.A
*	TK261102_lung_cytoE18_2_step10.4273.4273.3	1.0696	0.0038	3720.85	5	1140.0%	1	K.YQVELLEAALDHNTIVCLNTGSGKTFIASTTLLK.S
*	TK261102_lung_cytoE18_2_step07.4828.4828.3	1.2277	0.0292	4347.67	10	1080.0%	1	K.AMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEK.F
*	TK261102_lung_cytoE18_2_step12.2617.2617.2	0.7787	0.1585	1552.66	167	1920.0%	1	R.APISNYIMLADTDK.I
*	TK261102_lung_cytoE18_2_step10.3931.3931.3	1.5921	0.134	3235.75	1	1760.0%	1	K.YNLDLTNLNQPLLDVDHTSSRLNLLTPR.H
USSRP_HUMAN62.7%3310.4%709810756.9(Q08945) Structure-specific recognition protein 1 (SSRP1) (Recombination signal sequence recognition protein) (T160) (Chromatin-specific transcription elongation factor 80 KDA subunit) (FACT 80 KDA subunit) 
*	TK261102_lung_cytoE18_2_step12.5160.5160.2	0.8527	0.0013	3151.16	6	1730.0%	1	R.GLKEGMNPSYDEYADSDEDQHDAYLER.M
*	TK261102_lung_cytoE18_2_step01.2350.2350.3	1.5275	0.1237	2730.17	87	1700.0%	1	R.RSEDSEEEELASTPPSSEDSASGSDE.-
*	TK261102_lung_cytoE18_2_step07.4485.4485.2	1.8749	0.2883	2477.13	1	2750.0%	1	K.NEVTLEFHQNDDAEVSLMEVR.F
UDYLL_HUMAN62.6%117.9%89105356.9(Q9Y3P0) Putative dynein light chain protein DJ8B22.1 
*	TK261102_lung_cytoE18_2_step01.1771.1771.1	1.3546	0.3614	767.68	1	6670.0%	1	K.DIAAHLK.K
UDYL1_HUMAN62.6%117.9%89103667.4(Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) 
	TK261102_lung_cytoE18_2_step01.1771.1771.1	1.3546	0.3614	767.68	1	6670.0%	1	K.DIAAHIK.K
UQ96JQ262.5%240.7%10021116514.9(Q96JQ2) Calmin 
	TK261102_lung_cytoE18_2_step05.3760.3760.1	1.4902	0.1775	867.75	1	5830.0%	2	K.KPEVHEK.A
UQ9CXP562.4%6362.6%189206269.8(Q9CXP5) 3110043A19Rik protein 
	TK261102_lung_cytoE18_2_step08.0219.0219.1	1.4627	0.0193	599.52	4	6250.0%	6	R.LHLSK.S
UQ9JLT462.4%9399.5%528570598.5(Q9JLT4) Thioredoxin reductase 2, mitochondrial precursor (EC 1.6.4.5) 
*	TK261102_lung_cytoE18_2_step09.2182.2182.1	0.6993	0.0135	754.7	29	5000.0%	1	K.LHISKR.S
*	TK261102_lung_cytoE18_2_step08.4212.4212.3	1.2871	0.1288	3733.5	8	1210.0%	1	K.IIVDAQEATSVPHIYAIGDVAEGRPELTPTAIKAGK.L
*	TK261102_lung_cytoE18_2_step08.0219.0219.1	1.4627	0.0193	599.52	4	6250.0%	6	K.LHISK.R
*	TK261102_lung_cytoE18_2_step05.2726.2726.1	0.954	0.1382	788.52	19	4290.0%	1	K.AGISTNPK.N
UCYA8_MOUSE62.4%124212.2%12491401556.9(P97490) Adenylate cyclase, type VIII (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Ca(2+)/calmodulin activated adenylyl cyclase) 
	TK261102_lung_cytoE18_2_step06.3886.3886.2	1.7553	0.2374	2257.7	1	3000.0%	1	R.RLPGQYSLAAVVLGLVQSLNR.Q
	TK261102_lung_cytoE18_2_step05.0621.0621.1	0.336	0.0272	443.2	4	3330.0%	1	R.VQAK.E
	TK261102_lung_cytoE18_2_step10.3443.3443.3	1.6836	0.1046	3408.96	64	1250.0%	1	K.QQCEDKWGHLCALADFSLALTESIQEINK.H
	TK261102_lung_cytoE18_2_step12.4205.4205.2	0.6341	0.0353	1534.23	7	2270.0%	1	R.HITEQRFIHGHR.G
	TK261102_lung_cytoE18_2_step08.0219.0219.1	1.4627	0.0193	599.52	4	6250.0%	6	R.IHISK.A
*	TK261102_lung_cytoE18_2_step08.5305.5305.3	1.4986	0.1691	4419.15	4	1220.0%	1	K.LAVLLIMIAIYALLTETIYAGLFLSYDNLNHSGEDFLGTK.E
*	TK261102_lung_cytoE18_2_step06.1103.1103.3	1.3979	0.2011	4667.11	1	1380.0%	1	K.SIPLKNLTFNSSAVFTDICSYPEYFVFTGVLAMVTCAVFVR.L
ULDVR_MOUSE62.4%111.1%873963734.8(P98156) Very low-density lipoprotein receptor precursor (VLDL receptor) 
	TK261102_lung_cytoE18_2_step01.2714.2714.1	1.4054	0.2489	1233.9	1	5560.0%	1	K.EPSLIFTNRR.D
USYN_HUMAN62.4%5114.2%548629436.3(O43776) Asparaginyl-tRNA synthetase, cytoplasmic (EC 6.1.1.22) (Asparagine--tRNA ligase) (AsnRS) 
*	TK261102_lung_cytoE18_2_step10.3307.3307.1	1.4008	0.258	900.67	2	5830.0%	1	K.VFGWVHR.L
*	TK261102_lung_cytoE18_2_step08.2756.2756.1	1.3718	0.0162	602.69	2	7500.0%	3	K.KITIK.N
*	TK261102_lung_cytoE18_2_step11.1576.1576.1	1.3229	0.0608	1118.53	5	5000.0%	1	K.TGLKALMTVGK.E
UUBP8_HUMAN62.4%333.8%11181275238.5(P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15) (Ubiquitin thiolesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) 
*	TK261102_lung_cytoE18_2_step10.3479.3479.2	0.8811	0.0216	2975.11	7	1670.0%	1	R.NEPLVLEGGYENWLLCYPQYTTNAK.V
*	TK261102_lung_cytoE18_2_step12.2253.2253.1	1.0313	0.0236	894.77	23	4290.0%	1	K.TQKSNGEK.N
*	TK261102_lung_cytoE18_2_step06.2288.2288.1	1.4218	0.2259	958.65	3	6250.0%	1	K.GQPESGILR.T
UQ9CWS062.2%228.1%285313816.0(Q9CWS0) 2410006N07Rik protein 
	TK261102_lung_cytoE18_2_step12.1675.1675.1	1.1419	0.0454	831.87	206	3330.0%	1	K.GHVLLHR.T
*	TK261102_lung_cytoE18_2_step08.4141.4141.2	1.8031	0.2909	1856.13	1	4330.0%	1	K.LKDHLLIPVSNSEMEK.V
UQ9D4I662.1%247.2%152165708.4(Q9D4I6) 4931432M23Rik protein 
*	TK261102_lung_cytoE18_2_step07.3750.3750.1	1.664	0.1301	1314.55	5	5000.0%	2	R.HPESHHRGQVK.G
USKD1_MOUSE61.9%4416.2%444493897.5(P46467) SKD1 protein (Vacuolar sorting protein 4b) 
*	TK261102_lung_cytoE18_2_step11.1050.1050.1	1.4813	0.1804	824.81	1	6670.0%	1	K.KPQKPVK.E
	TK261102_lung_cytoE18_2_step11.3368.3368.1	1.3166	0.2739	946.8	1	6430.0%	1	K.FPHLFTGK.R
	TK261102_lung_cytoE18_2_step11.5012.5012.3	1.6264	0.0014	2842.04	26	1920.0%	1	K.SYLAKAVATEANNSTFFSISSSDLVSK.W
	TK261102_lung_cytoE18_2_step01.2807.2807.3	1.9493	0.1899	3515.26	25	1470.0%	1	K.AGNYEEALQLYQHAVQYFLHVVKYEAQGDK.A
UQ9DBN661.9%2210.3%544614747.0(Q9DBN6) 1300001I01Rik protein 
	TK261102_lung_cytoE18_2_step11.4470.4470.2	1.7409	0.3284	2084.36	1	3530.0%	1	R.HKPAFTEEDVLNIFPVVK.H
	TK261102_lung_cytoE18_2_step07.5216.5216.3	1.8791	0.1804	4362.01	1	1620.0%	1	R.ARYLMLLVFGEDHPEMALLDNNIGLVLHGVMEYDLSLR.F
UAF4_HUMAN61.9%221.1%12101314219.2(P51825) AF-4 protein (Proto-oncogene AF4) (FEL protein) 
*	TK261102_lung_cytoE18_2_step08.2379.2379.1	0.8847	0.0012	715.75	85	4000.0%	1	K.KHSSEK.R
*	TK261102_lung_cytoE18_2_step11.1050.1050.1	1.4813	0.1804	824.81	1	6670.0%	1	K.QPKKPVK.A
UEDD_HUMAN61.9%663.0%27993093525.8(O95071) Ubiquitin--protein ligase EDD (EC 6.3.2.-) (Hyperplastic discs protein homolog) (hHYD) (Progestin induced protein) 
*	TK261102_lung_cytoE18_2_step10.1061.1061.1	0.9362	0.0171	782.55	16	4170.0%	1	R.QGMMSAR.G
*	TK261102_lung_cytoE18_2_step06.4629.4629.2	0.9793	0.0159	3116.54	13	1410.0%	1	R.RSGTISTSAAAAAAALEASNASSYLTSASSLAR.A
*	TK261102_lung_cytoE18_2_step08.3084.3084.3	1.531	0.2536	2879.91	299	1350.0%	1	R.NVAIFTAGQESPIILRDGNGTIYPMAK.D
*	TK261102_lung_cytoE18_2_step10.0128.0128.3	1.0198	0.0199	2961.29	15	1210.0%	1	R.SGTISTSAAAAAAALEASNASSYLTSASSLAR.A
*	TK261102_lung_cytoE18_2_step08.2999.2999.1	0.9626	0.047	953.65	153	2860.0%	1	R.VLLLPLER.D
*	TK261102_lung_cytoE18_2_step12.2740.2740.1	1.4725	0.1787	891.76	1	5000.0%	1	R.SSGLRAGSR.R
UQ922U361.9%4416.5%717805438.9(Q922U3) Unknown (Protein for IMAGE:3589116) (Fragment) 
*	TK261102_lung_cytoE18_2_step07.3884.3884.3	1.683	0.0108	2675.75	36	1850.0%	1	R.QILIDEAGMATEPETLIPLVCFSK.T
*	TK261102_lung_cytoE18_2_step01.4570.4570.3	2.6155	0.2691	2737.05	2	2200.0%	1	K.TASPLVISIALGLPIPEIHWPISGPR.R
*	TK261102_lung_cytoE18_2_step06.5480.5480.2	1.1037	0.0448	2920.75	20	1600.0%	1	K.TEMKPLRVYGEQAEATEFPLPGVSNR.S
*	TK261102_lung_cytoE18_2_step06.0820.0820.3	1.5216	0.0554	4478.87	2	1400.0%	1	R.SNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDVLGGLLLR.R
UQ9NXE861.8%111.2%4254964810.2(Q9NXE8) Hypothetical protein FLJ20291 
*	TK261102_lung_cytoE18_2_step07.1984.1984.1	1.7283	0.1131	599.56	3	7500.0%	1	K.LHNSK.V
UA2A2_MOUSE61.6%111.2%9381041016.9(P17427) Adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) 
*	TK261102_lung_cytoE18_2_step08.2437.2437.1	1.5069	0.1696	1271.55	2	5000.0%	1	K.AKHPMDTEITK.A
UQ9JLI861.6%334.7%9621096195.2(Q9JLI8) Tumor-rejection antigen SART3 
*	TK261102_lung_cytoE18_2_step09.1894.1894.1	1.5075	0.1649	1081.58	1	6250.0%	1	R.KVPEKPEVR.T
*	TK261102_lung_cytoE18_2_step05.0319.0319.1	1.2111	0.0961	1223.0	2	5000.0%	1	R.EHVYELFER.A
	TK261102_lung_cytoE18_2_step12.5403.5403.2	0.9996	0.0572	3043.82	9	1730.0%	1	K.DYICPNIWLEYGQYSVGGIGQKGGLEK.V
UQ9DD2161.6%227.6%303344927.3(Q9DD21) 0610006A11Rik protein 
	TK261102_lung_cytoE18_2_step01.2975.2975.2	1.1462	0.0305	1986.51	223	2330.0%	1	K.EDQYMKMTVQLETQNK.S
	TK261102_lung_cytoE18_2_step11.2656.2656.1	1.5136	0.1622	881.62	1	7500.0%	1	R.HISIHFK.S
U3BP1_HUMAN61.5%112.3%622667655.9(Q9Y3L3) SH3-domain binding protein 1 (3BP-1) 
*	TK261102_lung_cytoE18_2_step12.2688.2688.1	1.8191	0.0625	1532.78	4	3850.0%	1	R.RSLSSLDTALAELR.E
UQ922J361.4%6144.3%13911558135.2(Q922J3) Similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) 
	TK261102_lung_cytoE18_2_step10.2424.2424.1	1.0885	0.0332	800.65	28	6000.0%	3	R.KHEEEK.K
	TK261102_lung_cytoE18_2_step07.3245.3245.1	1.6669	0.0227	1481.74	4	4550.0%	2	K.TKHEEILQNLQK.M
*	TK261102_lung_cytoE18_2_step07.5642.5642.3	0.8856	0.0263	4608.09	29	670.0%	1	R.LESSKPPGDVDMSLSLLQEISALQEKLEAIHTDHQGEMTSLK.E
UQ9D79061.4%224.3%345393068.6(Q9D790) 2310021M12Rik protein (RIKEN cDNA 2310021M12 gene) 
*	TK261102_lung_cytoE18_2_step06.2509.2509.1	1.6816	0.1252	1121.48	1	5000.0%	1	K.YSQKPGLLGR.I
*	TK261102_lung_cytoE18_2_step08.2005.2005.1	0.9976	0.0104	654.44	3	7500.0%	1	R.KLHQK.T
URIR1_MOUSE61.4%222.0%792902196.9(P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain) 
	TK261102_lung_cytoE18_2_step08.2504.2504.1	1.1667	0.1995	627.69	3	6250.0%	1	-.MHVIK.R
	TK261102_lung_cytoE18_2_step11.2117.2117.2	1.9284	0.2781	1368.86	1	5500.0%	1	K.VAERPQHMLMR.V
UJAK3_MOUSE61.3%335.5%12991443158.2(Q62137) Tyrosine-protein kinase JAK3 (EC 2.7.1.112) (Janus kinase 3) (JAK-3) 
	TK261102_lung_cytoE18_2_step08.3748.3748.2	0.7965	0.0901	2161.58	8	1940.0%	1	R.LSFSFGDYLAEDLCVRAAK.A
	TK261102_lung_cytoE18_2_step10.3284.3284.2	2.1956	0.3159	2474.65	8	2500.0%	1	R.IPWVAPECLQEAQTLCLEADK.W
*	TK261102_lung_cytoE18_2_step11.4533.4533.2	1.5652	0.1021	3156.39	1	1830.0%	1	R.ADCTTGQGGGVNLKVGPGMELPQGLTWGVTR.R
UNOA1_HUMAN61.1%114.1%510520568.9(P51513) Onconeural ventral antigen-1 (NOVA-1) (Paraneoplastic Ri antigen) (Ventral neuron-specific protein 1) 
*	TK261102_lung_cytoE18_2_step11.2750.2750.2	1.694	0.3846	2271.99	1	2750.0%	1	R.VCLIQGTVEALNAVHGFIAEK.I
UY918_HUMAN61.1%4411.7%9661082977.1(O94991) Hypothetical protein KIAA0918 (Fragment) 
*	TK261102_lung_cytoE18_2_step07.3882.3882.3	1.0908	0.0102	2818.39	34	1480.0%	1	R.LSPELFYGLQSLQYLFLQYNLIR.E
*	TK261102_lung_cytoE18_2_step10.3631.3631.3	1.197	0.0257	3147.83	30	1070.0%	1	R.SIKSELLCPDYSDVVVSTPTPSSIQVPAR.T
*	TK261102_lung_cytoE18_2_step09.4079.4079.3	1.7105	0.039	4363.26	28	1060.0%	1	K.KNQSDHTSTNNSDVSSFNMQYSVYGGGGGTGGHPHAHVHHR.G
*	TK261102_lung_cytoE18_2_step08.3692.3692.2	1.8779	0.2842	2218.59	1	3160.0%	1	R.QPSKDLGYSNYGPSIAYQTK.S
UPWP2_HUMAN61.1%242.9%9191024516.2(Q15269) Periodic tryptophan protein 2 homolog 
	TK261102_lung_cytoE18_2_step07.4913.4913.2	1.5803	0.2172	2744.6	1	2120.0%	2	R.SLDPLGSEEEAEASEDDSLHLLGGGGR.D
UJIP1_HUMAN61.1%241.1%711775245.0(Q9UQF2) C-jun-amino-terminal kinase interacting protein 1 (JNK-interacting protein 1) (JIP-1) (JNK MAP kinase scaffold protein 1) (Islet-brain-1) (IB-1) (Mitogen-activated protein kinase 8-interacting protein 1) 
*	TK261102_lung_cytoE18_2_step12.1571.1571.1	1.431	0.2203	781.62	4	5000.0%	2	R.RPGAGPPK.A
UQ921M361.0%448.4%12171355505.3(Q921M3) Similar to splicing factor 3b, subunit 3, 130kD 
	TK261102_lung_cytoE18_2_step08.4203.4203.3	1.8738	0.0627	3717.65	48	1330.0%	1	R.NENQLIIFADDTYPRWVTTASLLDYDTVAGADK.F
	TK261102_lung_cytoE18_2_step11.3541.3541.2	1.7744	0.2907	3001.38	2	2200.0%	1	R.KFVIHPESNNLIIIETDHNAYTEATK.A
	TK261102_lung_cytoE18_2_step12.5625.5625.2	0.9323	0.0123	2034.08	24	2350.0%	1	K.AEVIMNYHVGETVLSLQK.T
	TK261102_lung_cytoE18_2_step06.4501.4501.3	1.7126	0.1212	2750.46	12	1880.0%	1	R.HGLEVSEMAVSELPGNPNAVWTVRR.H
UREST_HUMAN60.8%666.2%14271609895.4(P30622) Restin (Cytoplasmic linker protein-170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament associated protein) 
*	TK261102_lung_cytoE18_2_step08.3055.3055.2	2.186	0.0264	1386.55	1	5910.0%	1	K.HLEIEKNAESSK.A
*	TK261102_lung_cytoE18_2_step06.0495.0495.3	1.8692	0.1223	2123.14	5	2120.0%	1	K.ILKPGSTALKTPTAVVAPVEK.T
*	TK261102_lung_cytoE18_2_step07.3626.3626.2	0.8658	0.1014	2023.96	79	2060.0%	1	K.ANENASFLQKSIEDMTVK.A
*	TK261102_lung_cytoE18_2_step06.2353.2353.1	1.4604	0.1273	1424.51	1	3750.0%	1	K.FAEASEEAVSVQR.S
*	TK261102_lung_cytoE18_2_step12.3060.3060.2	1.0544	0.014	1942.9	6	2940.0%	1	R.QLSSSSGNTDTQADEDER.A
*	TK261102_lung_cytoE18_2_step07.2894.2894.1	1.157	0.0991	771.5	7	7000.0%	1	R.EETHQK.E
UCYRB_HUMAN60.8%82012.2%897973365.5(P32927) Cytokine receptor common beta chain precursor (CDw131 antigen) 
*	TK261102_lung_cytoE18_2_step08.3669.3669.3	1.3476	0.1124	2166.24	124	1970.0%	1	K.TETLQNAHSMALPALEPSTR.Y
*	TK261102_lung_cytoE18_2_step08.4589.4589.2	2.1074	0.2432	2373.83	2	2600.0%	3	R.RPSQGAAGSPSLESGGGPAPPALGPR.V
*	TK261102_lung_cytoE18_2_step09.4111.4111.2	1.1048	0.0364	2892.79	2	2000.0%	3	K.NLDQAFQVKKPPGQAVPQVPVIQLFK.A
*	TK261102_lung_cytoE18_2_step01.5699.5699.3	1.1796	0.0686	4358.27	5	1320.0%	1	K.WSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVR.K
UPTNB_MOUSE60.8%227.4%585668167.0(P35235) Protein-tyrosine phosphatase, non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase SYP) 
	TK261102_lung_cytoE18_2_step09.4641.4641.2	1.7369	0.3177	2669.85	2	2170.0%	1	R.TWPDHGVPSDPGGVLDFLEEVHHK.Q
*	TK261102_lung_cytoE18_2_step05.1159.1159.2	0.8942	0.049	2216.9	8	2220.0%	1	K.GHEYTNIKYSGELGYTETR.V
UPK3G_MOUSE60.8%557.4%15061715796.9(O70167) Phosphatidylinositol 3-kinase C2 domain-containing gamma polypeptide (EC 2.7.1.137) (Phosphoinositide 3-Kinase-C2-gamma) (PtdIns-3-kinase C2 gamma) (PI3K-C2gamma) 
*	TK261102_lung_cytoE18_2_step05.4382.4382.1	1.0737	0.1552	1337.39	16	3500.0%	1	K.SVIQLHLQKNR.D
*	TK261102_lung_cytoE18_2_step09.4091.4091.2	1.7507	0.3179	3144.02	1	1920.0%	1	R.GIEDLKYVHNNLRPQDTDLEATSHFTK.K
*	TK261102_lung_cytoE18_2_step03.0477.0477.3	1.6002	0.043	3319.63	15	1390.0%	1	K.SCRPLPVTKSFSLLVNWNEIINFPLEIK.S
*	TK261102_lung_cytoE18_2_step12.1659.1659.1	0.4603	3.0E-4	1199.86	131	1110.0%	1	K.EIGSLEEFFK.D
*	TK261102_lung_cytoE18_2_step11.5977.5977.3	1.2503	0.2468	4047.75	4	1400.0%	1	R.QDMLALQIIQVMDNAWLQEGLDMQMITYGCLSTGR.A
UA1T2_MOUSE60.4%354.4%413459145.5(P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT) 
	TK261102_lung_cytoE18_2_step11.2846.2846.1	1.6087	0.1296	975.9	4	7140.0%	2	R.LVQIHIPR.L
	TK261102_lung_cytoE18_2_step06.2661.2661.1	1.4152	0.1627	1241.68	1	5560.0%	1	K.MQHLEQTLNK.E
UKERA_MOUSE60.4%249.4%351404046.2(O35367) Keratocan precursor (KTN) (Keratan sulfate proteoglycan keratocan) 
	TK261102_lung_cytoE18_2_step07.4734.4734.3	2.0553	0.1561	3789.71	22	1410.0%	2	R.NMPPRLPANTMQLFLDNNSIEGIPENYFNVIPK.V
UCD86_HUMAN60.2%2210.6%329376966.9(P42081) T lymphocyte activation antigen CD86 precursor (Activation B7-2 antigen) (CTLA-4 counter-receptor B7.2) (B70) (FUN-1) (BU63) 
*	TK261102_lung_cytoE18_2_step11.5504.5504.2	0.7651	0.0674	2927.52	41	960.0%	1	-.MDPQCTMGLSNILFVMAFLLSGAAPLK.I
*	TK261102_lung_cytoE18_2_step08.2403.2403.1	1.4387	0.1968	969.68	1	5710.0%	1	K.CGTNTMER.E
UQ9D3V860.2%336.9%625725819.0(Q9D3V8) 4933432B09Rik protein 
*	TK261102_lung_cytoE18_2_step06.4938.4938.2	0.6612	0.0657	2466.5	59	1430.0%	1	K.GFYSPFSFQNSMDVDNNSLGLK.S
*	TK261102_lung_cytoE18_2_step09.3137.3137.1	1.5037	0.1578	956.59	1	7140.0%	1	R.NYASLLFK.M
*	TK261102_lung_cytoE18_2_step05.4358.4358.1	0.8671	0.0275	1515.52	44	2080.0%	1	K.QDMLFQLSPSSME.-
UAPB1_HUMAN60.1%110.6%837929244.9(Q02410) Amyloid beta A4 precursor protein-binding family A member 1 (Neuron-specific X11 protein) (Neuronal Munc18-1-interacting protein 1) (Mint-1) (Adapter protein X11alpha) 
*	TK261102_lung_cytoE18_2_step08.2140.2140.1	1.4298	0.2092	656.56	1	7500.0%	1	R.RPDLR.Y
USDC2_MOUSE59.9%115.4%202221314.6(P43407) Syndecan-2 precursor (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (SYND2) 
	TK261102_lung_cytoE18_2_step11.1988.1988.1	1.4631	0.1782	1269.65	3	5500.0%	1	K.KDEGSYDLGER.K
UQ9HC5659.9%6610.7%12031322515.5(Q9HC56) Protocadherin-9 
*	TK261102_lung_cytoE18_2_step08.2144.2144.1	1.3233	0.0389	930.4	108	6250.0%	1	K.VEDGGTPQK.S
*	TK261102_lung_cytoE18_2_step10.0006.0006.3	2.1154	0.3338	3859.53	1	1910.0%	1	R.ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEK.D
*	TK261102_lung_cytoE18_2_step07.5166.5166.3	1.4378	0.1364	2943.3	2	1700.0%	1	K.LVPLSAIPGSVVAEVFAVDVDTGMNAELK.Y
*	TK261102_lung_cytoE18_2_step03.0644.0644.3	1.2376	0.0358	4371.47	1	1380.0%	1	R.LVVNISDLGYPKSLHTLVLVFLYVNDTAGNASYIYDLIR.R
*	TK261102_lung_cytoE18_2_step09.3439.3439.2	1.1721	0.0161	1873.19	154	2190.0%	1	K.VSSSTGEIFTTSNRIDR.E
*	TK261102_lung_cytoE18_2_step01.3014.3014.1	1.5246	0.1564	1319.2	1	4090.0%	1	R.LVVNISDLGYPK.S
UQ9CXT259.8%3533.0%188210528.5(Q9CXT2) 3110007P09Rik protein 
	TK261102_lung_cytoE18_2_step08.5189.5189.3	1.7389	0.0614	4305.81	4	1150.0%	1	K.SNGAPNGFYAEIDWERYNSPELDEEGYSIRPEEPGSTK.G
*	TK261102_lung_cytoE18_2_step09.2819.2819.2	1.9569	0.2725	2398.41	2	2610.0%	2	K.NAATVDELKASIGNIALSPSPVVK.K
UPSDB_HUMAN59.8%3311.1%422474646.5(O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) 
*	TK261102_lung_cytoE18_2_step05.0326.0326.1	1.4088	0.2225	1527.84	1	4580.0%	1	R.YQEALHLGSQLLR.E
*	TK261102_lung_cytoE18_2_step06.5089.5089.3	1.1602	0.0211	2521.09	45	1670.0%	1	K.TYEAALETIQNMSKVVDSLYNK.A
*	TK261102_lung_cytoE18_2_step11.2396.2396.1	1.2114	0.0703	1440.95	9	3640.0%	1	K.AITSLKYMLLCK.I
UQ9NR4859.5%350.7%29693327689.4(Q9NR48) ASH1 
*	TK261102_lung_cytoE18_2_step05.4236.4236.1	1.1073	0.0292	1111.48	9	3640.0%	2	K.AGVGSVAGIIHK.D
*	TK261102_lung_cytoE18_2_step09.2786.2786.1	0.9626	0.1121	950.47	4	4290.0%	1	K.TTHIDIPR.I
UQ9R0B759.5%244.4%294326988.9(Q9R0B7) Double-stranded RNA-binding zinc finger protein JAZ 
*	TK261102_lung_cytoE18_2_step06.0547.0547.1	1.2974	0.2231	1254.42	6	4170.0%	2	R.LADPAVSDLPAGK.G
UQ9ULU559.4%446.5%17601992086.5(Q9ULU5) Hypothetical protein KIAA1124 (Fragment) 
*	TK261102_lung_cytoE18_2_step06.4921.4921.3	1.5753	0.0484	2923.76	3	1730.0%	1	R.QPPSRNKPYISWPSSGGSEPSVTVPLR.S
*	TK261102_lung_cytoE18_2_step06.3544.3544.2	0.6011	0.1414	1655.96	31	1430.0%	1	R.SQLPLEGLEQPACDT.-
*	TK261102_lung_cytoE18_2_step12.5203.5203.3	1.5797	0.3817	4343.02	38	900.0%	1	R.FYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIR.L
*	TK261102_lung_cytoE18_2_step06.4966.4966.3	2.7765	0.2231	4070.63	4	1500.0%	1	R.ARAQELMWPAAPVACSCSPTHVTVYSEYGVDVFDVR.T
UJMJ_MOUSE59.4%6102.5%12341374459.4(Q62315) Jumonji protein 
	TK261102_lung_cytoE18_2_step10.1167.1167.1	0.6828	0.0414	553.69	20	6670.0%	2	K.KHLR.S
	TK261102_lung_cytoE18_2_step10.3313.3313.2	1.4557	0.0393	1720.08	10	4000.0%	1	R.KFAQSQPNSPSTTPVK.I
*	TK261102_lung_cytoE18_2_step08.3548.3548.1	1.4551	0.0543	839.83	5	5830.0%	2	R.EKEPAHK.H
	TK261102_lung_cytoE18_2_step10.1110.1110.1	0.7232	0.0277	528.9	2	6670.0%	1	K.RKPK.T
UIRR_HUMAN59.2%333.2%12971437206.5(P14616) Insulin receptor-related protein precursor (EC 2.7.1.112) (IRR) (IR-related receptor) 
*	TK261102_lung_cytoE18_2_step07.3937.3937.2	0.9337	0.0824	1772.19	5	2500.0%	1	K.FGGVHLALLPPGNYSAR.V
*	TK261102_lung_cytoE18_2_step10.3949.3949.2	0.6243	0.0271	2540.46	165	1000.0%	1	R.LRPSFTHILDSIQEELRPSFR.L
*	TK261102_lung_cytoE18_2_step07.3257.3257.2	1.9016	0.2703	2130.61	1	3680.0%	1	R.YAKFGGVHLALLPPGNYSAR.V
UCAO2_HUMAN59.2%224.7%681768277.6(Q99424) Acyl-coenzyme A oxidase 2, peroxisomal (EC 1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox) (Trihydroxycoprostanoyl-CoA oxidase) (THCCox) (THCA-CoA oxidase) 
*	TK261102_lung_cytoE18_2_step01.3078.3078.3	1.9074	0.1252	2355.65	15	2500.0%	1	R.VELLSGEILPILQKACVIAMR.Y
*	TK261102_lung_cytoE18_2_step10.3753.3753.1	1.7799	0.0904	1349.79	2	4500.0%	1	R.TAYLDLLRLIR.K
UMTR3_HUMAN58.8%114.9%205236616.7(Q13615) Myotubularin-related protein 3 (Fragment) 
	TK261102_lung_cytoE18_2_step10.3048.3048.1	1.4806	0.163	1247.64	5	4440.0%	1	K.WLHHLSVLLK.S
UQ8TD5758.6%9113.4%41164707746.4(Q8TD57) Axonemal heavy chain dynein type 3 
	TK261102_lung_cytoE18_2_step06.1422.1422.1	0.7325	3.0E-4	570.27	3	3750.0%	1	K.TSAYK.V
*	TK261102_lung_cytoE18_2_step08.4372.4372.3	1.4637	0.1286	2994.97	2	1880.0%	2	K.YRDTDTNILCAIDDIQMLLDDHVIK.T
	TK261102_lung_cytoE18_2_step09.5013.5013.2	1.1622	0.2144	3070.68	15	1730.0%	1	K.GPPVVFWISGFYFTQSFLTGVSQNYAR.K
*	TK261102_lung_cytoE18_2_step11.3889.3889.2	1.6427	0.1269	2188.46	4	2650.0%	1	K.QQGVEYMRLGENIIEYSR.D
	TK261102_lung_cytoE18_2_step06.2941.2941.1	0.949	0.0227	1011.54	21	4290.0%	1	K.HLKEIEDK.I
*	TK261102_lung_cytoE18_2_step08.3491.3491.3	1.8527	0.148	2827.96	62	1700.0%	1	K.IRAWQIAGLPVDSFSIDNGIIVSNSR.R
*	TK261102_lung_cytoE18_2_step12.3863.3863.2	1.783	0.2745	1885.83	1	3750.0%	1	K.ISFSLAMSPIGDAFRNR.L
*	TK261102_lung_cytoE18_2_step06.5504.5504.1	1.0054	0.0085	1369.05	95	2730.0%	1	K.LAFKTSIFSPMK.K
UO0882858.6%558.3%13481547985.3(O08828) Axonemal dynein heavy chain (Fragment) 
*	TK261102_lung_cytoE18_2_step10.3340.3340.2	1.7745	0.2819	2502.28	1	2620.0%	1	R.CLEMNLQDHIESISKVAEMAGK.E
	TK261102_lung_cytoE18_2_step11.2064.2064.2	1.2901	0.0256	1249.99	12	5000.0%	1	K.KLCLSSGEIIK.L
	TK261102_lung_cytoE18_2_step11.5044.5044.3	1.3551	0.1047	2884.18	1	1770.0%	1	K.ALAIQTVVFNCSDQLDFMAMGKFFK.G
	TK261102_lung_cytoE18_2_step09.4707.4707.3	1.4699	0.05	3030.86	2	2020.0%	1	R.AVNAEFIYGYEYLGNSGRLVITPLTDR.C
*	TK261102_lung_cytoE18_2_step07.5053.5053.2	1.0578	0.0582	3169.99	2	1730.0%	1	R.WSESWMNDPLSAIDAEQLEKNVIESFK.T
UA10A_MOUSE58.6%685.1%15081686996.7(O54827) Potential phospholipid-transporting ATPase VA (EC 3.6.3.1) 
*	TK261102_lung_cytoE18_2_step12.3281.3281.2	0.8932	0.0526	2696.81	8	1400.0%	1	R.NTEAVAGIVIYAGHETKALLNNSGPR.Y
	TK261102_lung_cytoE18_2_step08.1953.1953.1	1.5445	0.1417	599.6	1	7500.0%	2	K.KPLNK.F
	TK261102_lung_cytoE18_2_step04.0599.0599.1	0.7065	0.0282	1049.87	210	2860.0%	1	K.TIEDFLRR.F
*	TK261102_lung_cytoE18_2_step09.1666.1666.1	0.8782	0.0207	593.56	18	6250.0%	1	K.FSDPK.E
*	TK261102_lung_cytoE18_2_step06.4508.4508.3	0.9901	0.0486	3587.13	18	780.0%	1	R.DCASQASQFTQQLTCSPEASGEPSAVDTNMPLR.E
UQ9254958.6%81010.3%12871436246.0(Q92549) Hypothetical protein KIAA0261 (Fragment) 
*	TK261102_lung_cytoE18_2_step08.3281.3281.3	1.1281	0.1297	2620.32	79	1500.0%	1	K.EVGAGSANGVEMVQGPVQTPALTIHR.R
*	TK261102_lung_cytoE18_2_step09.4066.4066.3	1.1267	0.2388	2787.49	2	1200.0%	1	K.TLDDSQHHQNLSLCTAALMYILSR.D
*	TK261102_lung_cytoE18_2_step08.1953.1953.1	1.5445	0.1417	599.6	1	7500.0%	2	K.KPINK.Q
*	TK261102_lung_cytoE18_2_step04.0422.0422.2	1.2463	0.1078	1079.38	2	5560.0%	1	R.ARVPRPPAGR.R
	TK261102_lung_cytoE18_2_step09.3243.3243.3	1.0988	0.0853	4415.48	30	880.0%	1	K.ALQHCEELIQQYNRAEDSICLADSKPLPHQNVTNHVGK.A
*	TK261102_lung_cytoE18_2_step08.3320.3320.1	0.9946	0.2038	806.6	167	4170.0%	1	K.RTTLSTK.W
*	TK261102_lung_cytoE18_2_step08.3797.3797.3	1.2407	0.0395	2585.69	127	1550.0%	1	R.SEDCILSLDSDPLLEMKDDDFK.N
UQ9GZM958.6%241.1%440493249.9(Q9GZM9) Hypothetical protein FLJ13421 (Nucleolar protein ANKT) (Clone HQ0310 PRO0310p1) 
*	TK261102_lung_cytoE18_2_step08.1953.1953.1	1.5445	0.1417	599.6	1	7500.0%	2	K.QPINK.G
UCAD2_HUMAN58.5%3312.1%906998514.8(P19022) Neural-cadherin precursor (N-cadherin) (Cadherin-2) 
*	TK261102_lung_cytoE18_2_step11.4772.4772.2	1.8559	0.274	3109.67	1	2070.0%	1	R.IAGALRTLLPLLLALLQASVEASGEIALCK.T
*	TK261102_lung_cytoE18_2_step04.2192.2192.3	1.243	0.0285	4607.84	32	910.0%	1	R.FAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAK.G
*	TK261102_lung_cytoE18_2_step10.4507.4507.3	1.6514	0.0532	4040.29	5	1280.0%	1	R.YSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIAR.F
UENTK_HUMAN58.1%227.0%10191129245.1(P98073) Enteropeptidase precursor (EC 3.4.21.9) (Enterokinase) 
*	TK261102_lung_cytoE18_2_step12.5589.5589.3	0.7428	0.0031	4598.1	19	620.0%	1	K.NIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPGPVK.D
*	TK261102_lung_cytoE18_2_step12.1595.1595.3	2.5664	0.3203	3371.95	1	2240.0%	1	K.EELIQGLEANKSSQLVTFHIDLNSVDILDK.L
UPIA1_MOUSE58.1%3314.9%651716087.3(O88907) Protein inhibitor of activated STAT protein 1 (DEAD/H box binding protein 1) 
*	TK261102_lung_cytoE18_2_step01.5447.5447.3	1.5709	0.1214	4375.92	15	1070.0%	1	R.FFPYTSSQMFLDQLSAGGSTSLPATNGSSSGSNSSLVSSNSLR.E
	TK261102_lung_cytoE18_2_step11.4856.4856.2	2.1084	0.2362	3006.24	2	2600.0%	1	K.LQKLPFYDLLDELIKPTSLASDNSQR.F
	TK261102_lung_cytoE18_2_step12.4336.4336.2	1.005	0.0918	3178.64	11	1480.0%	1	R.FRETCFAFALTPQQVQQISSSMDISGTK.C
U22A3_MOUSE58.0%3511.2%250287818.8(P70122) Protein 22A3 
*	TK261102_lung_cytoE18_2_step07.2202.2202.1	1.5191	0.1567	1200.71	1	6670.0%	2	K.DIHYSVKPNK.S
	TK261102_lung_cytoE18_2_step07.4116.4116.3	0.9724	0.0156	2117.23	102	2060.0%	1	R.HTQLEQMFRDIATIVADK.C
UGBB1_HUMAN57.5%112.1%340373776.0(P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) 
	TK261102_lung_cytoE18_2_step11.2017.2017.1	1.3614	0.2953	805.57	1	7500.0%	1	K.VHAIPLR.S
UNEO1_MOUSE57.3%223.4%14931631596.5(P97798) Neogenin precursor 
	TK261102_lung_cytoE18_2_step10.2435.2435.1	1.5728	0.1355	886.7	4	5830.0%	1	R.GTEYNFR.V
*	TK261102_lung_cytoE18_2_step05.1222.1222.3	1.7224	0.1726	4755.84	1	1280.0%	1	R.VETQPEVQLPGPAPNIRAYATSPTSITVTWETPLSGNGEIQNYK.L
UQ96QC257.3%6183.9%20902267305.5(Q96QC2) Hypothetical protein KIAA0170 
	TK261102_lung_cytoE18_2_step07.3181.3181.3	1.1731	0.0039	3763.63	85	710.0%	1	R.SSVKTPETVVPTAPELQPSTSTDQPVTPEPTSQATR.G
	TK261102_lung_cytoE18_2_step07.4572.4572.2	0.8132	0.0073	2622.79	41	1300.0%	1	R.QDGSQEAPEAPLSSELEPFHPKPK.I
	TK261102_lung_cytoE18_2_step10.4619.4619.2	1.7629	0.2396	2276.59	1	3250.0%	4	K.HLAPPPLLSPLLPSIKPTVRK.T
UQ91Z1657.2%337.6%801867809.2(Q91Z16) Hypothetical 86.8 kDa protein (Fragment) 
	TK261102_lung_cytoE18_2_step10.3952.3952.2	0.9184	0.1018	2099.24	1	2780.0%	1	R.NHMDITTPPLPPVAPEVLR.V
	TK261102_lung_cytoE18_2_step10.2332.2332.2	1.7172	0.2903	1947.44	1	3330.0%	1	R.GPFPLQVVSVGGPARGRPR.G
	TK261102_lung_cytoE18_2_step11.0542.0542.2	1.2599	0.1319	2726.79	3	2050.0%	1	K.NLTEQNSYSNIPHEGKHTPLYER.S
UQ6162757.0%5174.6%10091122446.7(Q61627) Glutamate receptor delta-1 subunit precursor 
*	TK261102_lung_cytoE18_2_step07.4820.4820.2	2.0378	0.2569	2624.85	1	2950.0%	4	K.DDRVFQLAVSDLSLNDDILQSEK.I
*	TK261102_lung_cytoE18_2_step05.0458.0458.3	1.6523	0.0821	2823.95	6	1820.0%	1	K.FVMFYDSEYDIRGFQSFLDQASR.L
UQ9BSP157.0%225.8%381422539.3(Q9BSP1) Hypothetical protein (Fragment) 
*	TK261102_lung_cytoE18_2_step08.2851.2851.1	1.5527	0.1316	1372.81	5	5000.0%	1	K.LLTNFLPLKGQK.R
*	TK261102_lung_cytoE18_2_step09.1663.1663.1	1.0516	0.1568	950.41	30	3330.0%	1	R.FVAGVGANSK.I
UMCM6_MOUSE57.0%5512.1%821928675.5(P97311) DNA replication licensing factor MCM6 (Mis5 homolog) 
*	TK261102_lung_cytoE18_2_step10.3648.3648.3	1.0694	0.1093	3977.98	6	1250.0%	1	R.VETPDVNLDQEEEIQMETDEGQGGVNGHADSPAPVNR.F
	TK261102_lung_cytoE18_2_step08.4889.4889.2	1.2005	0.0838	2472.94	1	2750.0%	1	K.NLYHNLCTSLFPTIHGNDEVK.R
*	TK261102_lung_cytoE18_2_step12.2788.2788.2	1.3547	0.2061	2013.08	22	2220.0%	1	R.SLEVILRAEAVESAQAGDR.C
	TK261102_lung_cytoE18_2_step11.4056.4056.2	1.6964	0.3219	1951.6	1	4690.0%	1	R.LTHYDHVLIELTQAGLK.G
	TK261102_lung_cytoE18_2_step01.0052.0052.1	0.9774	0.0789	529.58	33	5000.0%	1	R.GSIPR.S
UQ8TB6856.8%392.2%274309308.6(Q8TB68) Similar to hypothetical protein MGC10772 
*	TK261102_lung_cytoE18_2_step07.2084.2084.1	1.4499	0.0999	706.47	9	6000.0%	3	R.RDSAEK.Q
UQ9Y38256.7%396.6%335383395.5(Q9Y382) CGI-73 protein 
*	TK261102_lung_cytoE18_2_step08.4088.4088.2	1.4085	0.0811	2286.24	1	3100.0%	3	K.VGTVVTPDNDIYIAGGQVPLEK.H
UATM_MOUSE56.6%17278.6%30663494876.9(Q62388) Serine-protein kinase ATM (EC 2.7.1.37) (Ataxia telangiectasia mutated homolog) (A-T, mutated homolog) 
	TK261102_lung_cytoE18_2_step06.3884.3884.2	0.993	0.0988	2506.8	5	1900.0%	1	K.SILYNLYDLLVNEISHIGSRGK.Y
*	TK261102_lung_cytoE18_2_step10.4628.4628.3	2.2875	0.1167	3010.46	7	2080.0%	1	K.IKQYNSAICGISEWHLEEAQVFWAK.K
*	TK261102_lung_cytoE18_2_step01.4247.4247.2	0.747	0.0194	3119.15	4	1350.0%	1	K.SVLLMMIAVVLHCSPVCEKQALFALCK.S
*	TK261102_lung_cytoE18_2_step07.4480.4480.2	0.8167	0.0783	2349.1	119	1580.0%	1	K.SQSDFDLVPWLQITTRLISK.Y
*	TK261102_lung_cytoE18_2_step12.2607.2607.3	1.2846	0.0216	2141.18	17	2370.0%	1	K.RSPTFEEGSQGTTISSLSEK.S
*	TK261102_lung_cytoE18_2_step12.2451.2451.2	0.8637	0.0396	2909.21	10	1670.0%	2	R.MALVKCLQTLLEADPYSEWAILNVK.G
*	TK261102_lung_cytoE18_2_step06.2842.2842.1	1.1858	0.1718	1337.84	64	3000.0%	1	R.TMLAVVDYLRR.Q
*	TK261102_lung_cytoE18_2_step07.3881.3881.3	2.8427	0.1311	2339.05	3	2880.0%	3	R.ISLDHPHHTLFIILALANANK.D
	TK261102_lung_cytoE18_2_step01.1266.1266.1	1.0383	0.0595	660.66	26	6000.0%	1	K.NILATK.I
	TK261102_lung_cytoE18_2_step09.1564.1564.1	0.5333	0.0566	517.64	14	5000.0%	1	K.KSQR.T
*	TK261102_lung_cytoE18_2_step06.4437.4437.3	1.1887	0.1247	3946.25	20	1320.0%	1	R.EFWKLFTGSACKPSSPSVCCLTLALSICVVPDAIK.M
*	TK261102_lung_cytoE18_2_step05.3548.3548.1	1.0775	0.1242	1205.66	225	3890.0%	2	R.VCHTAVTQCK.D
*	TK261102_lung_cytoE18_2_step12.1264.1264.3	1.0975	0.0375	4475.46	29	1050.0%	1	K.DALESHLHVIVGTLIPLVDYQEVQEQVLDLLKYLVIDNK.D
UQ6172656.4%113.2%495549036.4(Q61726) Keratin, type II cytoskeletal (Fragment) 
*	TK261102_lung_cytoE18_2_step11.3433.3433.1	1.3759	0.2447	1590.68	2	3330.0%	1	R.GLSGGFGSQSVCGAFR.S
UCM35_HUMAN56.1%114.0%224248309.3(Q08708) CMRF35 antigen precursor (CMRF-35) 
*	TK261102_lung_cytoE18_2_step10.1731.1731.1	1.4251	0.1946	1101.76	2	5620.0%	1	R.QNWPKGENQ.-
UO1505056.1%445.3%13471568867.6(O15050) Hypothetical protein KIAA0342 (Fragment) 
*	TK261102_lung_cytoE18_2_step11.0712.0712.3	1.3114	0.0602	1581.08	3	2920.0%	1	K.TYLECKEPTLSLK.C
*	TK261102_lung_cytoE18_2_step09.3586.3586.3	1.2493	0.0839	4347.36	11	1210.0%	1	R.ESTDLWLSAMQAFLLSSNYPEEFEKLLHQEEDNYNR.E
*	TK261102_lung_cytoE18_2_step01.3359.3359.2	1.2303	0.0050	1931.89	102	2500.0%	1	R.QQVAYQKYSEFFHEK.V
*	TK261102_lung_cytoE18_2_step10.3095.3095.1	1.4249	0.1946	956.67	2	6430.0%	1	K.YLSANKMK.E
UQ9WVQ056.0%666.6%10221194006.6(Q9WVQ0) Sperm tail associated protein 
*	TK261102_lung_cytoE18_2_step07.1885.1885.1	1.3724	0.2395	1319.63	1	5000.0%	1	K.DSLEEAREQLK.V
*	TK261102_lung_cytoE18_2_step05.2783.2783.1	1.1818	0.0595	978.45	21	4290.0%	1	R.EQVKYIAK.L
	TK261102_lung_cytoE18_2_step01.1735.1735.1	1.2303	0.0127	887.67	3	5830.0%	1	R.QLQQLKK.K
*	TK261102_lung_cytoE18_2_step11.5677.5677.1	0.7905	0.132	1480.0	38	2270.0%	1	K.ILSLERSLNLYR.D
*	TK261102_lung_cytoE18_2_step05.1297.1297.2	1.1353	0.2167	1816.52	8	3210.0%	1	K.QAQTLVFTDNQMDFR.V
*	TK261102_lung_cytoE18_2_step09.3121.3121.2	1.044	0.1081	1664.06	5	3460.0%	1	R.KAQLEDEIAAYEER.M
ULMA4_MOUSE55.9%446.6%18162018186.2(P97927) Laminin alpha-4 chain precursor 
*	TK261102_lung_cytoE18_2_step08.3600.3600.3	1.5225	0.0062	2475.4	36	1670.0%	1	K.IPFTDIYIGGAPQEVLQSRTLR.A
*	TK261102_lung_cytoE18_2_step11.2985.2985.3	1.2526	0.0114	3076.23	121	1340.0%	1	K.GEFAGDDSLLDLTPEDTVFYVGGVPANFK.L
*	TK261102_lung_cytoE18_2_step10.4751.4751.2	1.6508	0.3838	2863.71	2	1960.0%	1	K.CDCSGNSDPNLIFEDCDEITGQCR.N
*	TK261102_lung_cytoE18_2_step01.4803.4803.3	1.2652	0.0889	4792.0	1	1100.0%	1	-.MGWSTAWCSVLALWLLWCAVCSNAASGDGNAFPFDIEGSAVVGR.Q
UQ96J6755.7%117.4%188206867.5(Q96J67) Branching-enzyme interacting dual-specificity protein phosphatase BEDP 
*	TK261102_lung_cytoE18_2_step06.3170.3170.1	1.607	0.1015	1476.69	2	4620.0%	1	-.MAETSLPELGGEDK.A
UQ9CUU355.5%5119.0%557639527.2(Q9CUU3) 3830402K23Rik protein (Fragment) 
*	TK261102_lung_cytoE18_2_step12.2125.2125.2	1.9051	0.2588	1575.37	1	5770.0%	1	R.IFLNLVNGILGDKR.R
*	TK261102_lung_cytoE18_2_step08.4321.4321.3	1.0896	0.0297	4112.04	5	1070.0%	1	K.ILSNQEMLTLMSNMGERILDVGDYELQVGIVEALCR.M
UNER3_HUMAN55.4%8509.6%428482527.2(Q9UQ49) Sialidase 3 (EC 3.2.1.18) (Membrane sialidase) (Ganglioside sialidase) (N-acetyl-alpha-neuraminidase 3) 
*	TK261102_lung_cytoE18_2_step03.0400.0400.2	0.8496	0.0429	2058.14	46	1390.0%	1	R.AEALSTDHGEGFQRLALSR.Q
*	TK261102_lung_cytoE18_2_step01.5526.5526.2	1.767	0.1734	2519.8	2	2380.0%	7	R.LEEEAGTPSESWLLYSHPTSRK.Q
UQ9JJF355.4%339.3%603675878.5(Q9JJF3) Brain cDNA, clone MNCb-7109, similar to AF000198, weak similarity to HSP90 (Caenorhabditis elegans) 
	TK261102_lung_cytoE18_2_step12.4413.4413.2	0.9226	0.1449	1825.97	32	1330.0%	1	R.AKDFIHDSLPPVLTDR.E
*	TK261102_lung_cytoE18_2_step10.4480.4480.3	0.8089	0.0152	4068.8	1	880.0%	1	R.ALSVHGLPVRWEAGEPVNVGAQLTTETQVHMLQDGVAR.L
*	TK261102_lung_cytoE18_2_step06.5426.5426.1	1.5562	0.1245	1335.06	3	4550.0%	1	R.ERALSVHGLPVR.W
UQ9NVM655.3%393.3%304346878.5(Q9NVM6) Hypothetical protein FLJ10634 
*	TK261102_lung_cytoE18_2_step11.3454.3454.1	1.2955	0.0084	1109.99	28	4440.0%	3	K.GGYSKDVLLR.L
UZN29_HUMAN55.0%3925.0%5663689.4(P17037) Zinc finger protein 29 (Zinc finger protein KOX26) (Fragment) 
*	TK261102_lung_cytoE18_2_step06.4314.4314.1	0.8994	0.0246	1548.57	7	2310.0%	3	K.ECGEAFSQSSTLTK.H
UO7525755.0%352.5%13841518176.8(O75257) R31180_1 
	TK261102_lung_cytoE18_2_step03.0341.0341.1	1.5502	0.1227	910.65	1	7140.0%	2	R.ILGLEVHK.Q
	TK261102_lung_cytoE18_2_step01.4510.4510.3	1.8309	0.0436	2851.59	8	2300.0%	1	R.ELPVNTLDELIDQLGGPQRVAEMTGR.K
UEHD1_MOUSE55.0%465.8%534606036.8(Q9WVK4) EH-domain containing protein 1 (mPAST1) 
	TK261102_lung_cytoE18_2_step06.2717.2717.1	1.486	0.1505	831.67	1	6670.0%	2	K.FQALKPK.L
*	TK261102_lung_cytoE18_2_step10.5075.5075.2	0.8387	0.1206	2214.92	30	1580.0%	1	K.LEGHELPADLPPHLIPPSKR.R
	TK261102_lung_cytoE18_2_step11.1628.1628.1	0.7463	0.0272	575.65	1	6670.0%	1	R.RPFR.K
UALK_HUMAN55.0%335.6%16201764177.1(Q9UM73) ALK tyrosine kinase receptor precursor (EC 2.7.1.112) (Anaplastic lymphoma kinase) (CD246 antigen) 
	TK261102_lung_cytoE18_2_step11.4469.4469.2	1.2333	0.0557	3027.11	3	1790.0%	1	R.GPAVEGGHVNMAFSQSNPPSELHKVHGSR.N
*	TK261102_lung_cytoE18_2_step06.5901.5901.3	1.2396	0.0022	4276.09	7	1280.0%	1	K.TDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGK.S
	TK261102_lung_cytoE18_2_step10.3685.3685.2	1.7548	0.2785	2422.37	1	3420.0%	1	K.HQELQAMQMELQSPEYKLSK.L
UO0050855.0%574.2%15871696215.3(O00508) Latent TGF-beta binding protein-4 
*	TK261102_lung_cytoE18_2_step12.1732.1732.3	1.825	0.0995	1417.49	1	3860.0%	1	R.TCPSGHHLHRGR.C
*	TK261102_lung_cytoE18_2_step01.4182.4182.2	1.7047	0.2746	1987.88	3	2810.0%	2	R.CENSPGSFRCVCGPGFR.A
*	TK261102_lung_cytoE18_2_step09.3519.3519.2	1.265	0.158	2062.05	4	2650.0%	1	R.SSCISQHVISEAKGPCFR.V
*	TK261102_lung_cytoE18_2_step10.3481.3481.2	1.1015	0.0074	1953.38	29	2780.0%	1	R.RLGGAAASESLAVSEAFCR.V
UDCT2_MOUSE54.9%4422.1%402441175.3(Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) 
	TK261102_lung_cytoE18_2_step06.4170.4170.3	1.1417	0.0392	4640.31	17	950.0%	1	R.CDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEAR.L
	TK261102_lung_cytoE18_2_step06.3041.3041.1	1.7969	0.2644	1287.69	8	4440.0%	1	K.VHQLYETIQR.W
	TK261102_lung_cytoE18_2_step07.1691.1691.1	0.9508	0.0173	644.56	56	4000.0%	1	K.QLAALK.Q
	TK261102_lung_cytoE18_2_step12.3961.3961.2	0.7673	0.0993	3044.34	70	1210.0%	1	K.GSSGGKATAGAPPDSSLVTYELHSRPEQDK.F
UCXB4_MOUSE54.8%1110.2%266303898.8(Q02738) Gap junction beta-4 protein (Connexin 30.3) (Cx30.3) 
*	TK261102_lung_cytoE18_2_step11.4681.4681.2	2.157	0.1535	3067.23	3	1920.0%	1	K.VFTYFMVVTAAICILLNLSEVVYLVGK.R
UQ9BSA954.8%4108.3%504556157.7(Q9BSA9) Similar to RIKEN cDNA 3010001K23 gene 
*	TK261102_lung_cytoE18_2_step04.2297.2297.3	1.0648	0.1181	2849.29	1	1920.0%	1	R.GLARPEHPPPAPTGQDDPQSQLLPAPC.-
*	TK261102_lung_cytoE18_2_step05.0338.0338.2	1.0061	0.0022	1435.96	7	3570.0%	3	R.FSGSLVAALSATGPR.F
UQ6241254.7%332.2%11901377748.7(Q62412) Nebulin (Fragment) 
*	TK261102_lung_cytoE18_2_step11.2066.2066.1	1.0113	0.0336	907.55	30	5000.0%	1	R.RQGYDLR.V
*	TK261102_lung_cytoE18_2_step11.4926.4926.1	1.4787	0.0051	1433.8	73	3180.0%	1	K.KAYELQSDSVYK.A
	TK261102_lung_cytoE18_2_step01.1948.1948.1	1.4818	0.1525	931.94	1	7500.0%	1	K.YKEAYEK.Q
URS17_MOUSE54.6%247.5%134153939.8(P06584) 40S ribosomal protein S17 
	TK261102_lung_cytoE18_2_step10.2023.2023.2	1.4718	0.1811	1204.01	1	6670.0%	2	R.LGNDFHTNKR.V
URS26_HUMAN54.5%4166.1%1151301511.0(P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26 
	TK261102_lung_cytoE18_2_step08.0207.0207.1	1.165	0.0064	806.75	3	5830.0%	4	R.GHVQPIR.C
UQ9H2T254.2%229.0%621697839.8(Q9H2T2) Nuclear receptor coactivator CIA (Fragment) 
*	TK261102_lung_cytoE18_2_step07.2641.2641.3	2.4436	0.3694	4225.95	1	1400.0%	1	K.ILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQR.S
*	TK261102_lung_cytoE18_2_step09.3242.3242.1	0.9229	0.0597	1583.83	267	1920.0%	1	R.RNMNTAPSRPSPTR.R
UIF4G_HUMAN54.2%335.6%13951533615.2(Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) 
*	TK261102_lung_cytoE18_2_step04.2352.2352.3	1.349	0.0199	4288.17	6	1250.0%	1	R.AVTSVGAVLQALPSAVDFPLWMMVADTVPISKGSRPIDTSR.L
	TK261102_lung_cytoE18_2_step06.3426.3426.2	1.7936	0.2633	1973.57	1	3890.0%	1	K.ITKPGSIDSNNQLFAPGGR.L
*	TK261102_lung_cytoE18_2_step08.2928.2928.2	0.9152	0.072	1856.2	189	2350.0%	1	R.LERVNGEGTVGTGLIVSR.T
UQ96PE054.1%222.8%12051284056.6(Q96PE0) Tumor endothelial marker 6 
*	TK261102_lung_cytoE18_2_step08.3176.3176.2	1.626	0.3792	1657.68	1	4000.0%	1	R.HVVPAQVHVNGDAALK.D
*	TK261102_lung_cytoE18_2_step01.4704.4704.2	0.9574	0.0832	1910.42	18	2060.0%	1	K.LSLGQYDNDAGGQLPFSK.C
UQ99PS454.0%792.3%35513885188.5(Q99PS4) Msx-2 interacting nuclear target protein 
	TK261102_lung_cytoE18_2_step04.0618.0618.1	1.138	0.0848	869.87	53	5000.0%	1	R.EEPAEHR.A
	TK261102_lung_cytoE18_2_step08.2021.2021.3	1.3582	0.0424	2334.87	18	1970.0%	1	K.VNGVPQYAFLQYCDIASVCK.A
	TK261102_lung_cytoE18_2_step10.4317.4317.2	0.8689	0.0727	2348.41	10	1430.0%	1	R.VNTSEGVVLLSYSGQKTEGPQR.I
	TK261102_lung_cytoE18_2_step09.3525.3525.1	1.4508	0.1575	1189.83	1	4500.0%	1	R.QSDVPPGEDSR.D
	TK261102_lung_cytoE18_2_step06.2473.2473.1	1.1851	0.2302	722.87	1	5830.0%	1	R.GTGAFDR.T
	TK261102_lung_cytoE18_2_step09.3273.3273.2	1.0496	0.1053	1837.79	1	3670.0%	2	K.QDPSRFDVSFPNSVIK.R
UQ8VI2454.0%339.8%733825596.9(Q8VI24) KIAA1034-like DNA binding protein 
	TK261102_lung_cytoE18_2_step05.0220.0220.2	2.152	0.0986	1971.41	5	3120.0%	1	K.TNEQSPHSQIHHSTPIR.N
	TK261102_lung_cytoE18_2_step03.3918.3918.3	1.0673	0.0406	2006.46	149	1250.0%	1	R.MQHVVQLPPEPVQVLHR.Q
	TK261102_lung_cytoE18_2_step09.4210.4210.3	0.8308	0.0039	4174.99	167	880.0%	1	R.TKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPK.H
UMM02_MOUSE53.9%223.3%662741025.5(P33434) 72 kDa type IV collagenase precursor (EC 3.4.24.24) (72 kDa gelatinase) (Matrix metalloproteinase-2) (MMP-2) (Gelatinase A) 
	TK261102_lung_cytoE18_2_step06.0060.0060.2	2.155	0.2879	1588.25	9	4230.0%	1	R.IHDGEADIMINFGR.W
	TK261102_lung_cytoE18_2_step05.3885.3885.1	1.0843	0.0769	922.62	1	5000.0%	1	K.KMDPGFPK.L
UQ9CUE553.9%5511.1%756860315.5(Q9CUE5) 4931427F14Rik protein (Fragment) 
*	TK261102_lung_cytoE18_2_step11.4680.4680.2	2.158	0.026	3052.63	1	2310.0%	1	K.IWEPSLIAAHLNQNDWKASIAFVVGNR.V
*	TK261102_lung_cytoE18_2_step11.3228.3228.3	2.0672	0.1573	2426.32	6	2370.0%	1	K.YLEPILNNEKLEIHLFDVAR.L
*	TK261102_lung_cytoE18_2_step08.4553.4553.1	0.8452	0.0324	1212.75	14	2220.0%	1	K.LEIHLFDVAR.L
*	TK261102_lung_cytoE18_2_step11.4692.4692.2	1.2236	0.021	1996.11	13	2940.0%	1	K.ALPKGPLLLNYHDAHAHK.K
*	TK261102_lung_cytoE18_2_step09.1852.1852.3	1.5216	0.0186	2308.87	7	2360.0%	1	K.LPLWEFLQFPLPPPWNSTK.R
UQ9Y2H653.7%337.4%11511268787.1(Q9Y2H6) Hypothetical protein KIAA0970 (Fragment) 
	TK261102_lung_cytoE18_2_step11.3497.3497.1	1.7899	0.2065	1399.79	7	4580.0%	1	K.YVVEMAEGSNGNK.W
	TK261102_lung_cytoE18_2_step06.0244.0244.3	1.4464	0.0703	4256.96	20	1090.0%	1	R.TVVLTWSPPSSLINGETDESSVPELYGYEVLISSTGKDGK.Y
	TK261102_lung_cytoE18_2_step11.2752.2752.3	1.0047	0.1133	3687.35	23	890.0%	1	R.LNESTSYKFCIQACNEAGEGPLSQEYIFTTPK.S
UQ9BVA253.7%229.3%280311926.2(Q9BVA2) Similar to four and a half LIM domains 3 
*	TK261102_lung_cytoE18_2_step07.4688.4688.2	1.2755	0.0213	3012.9	6	1880.0%	1	K.LEYGGQTWHEHCFLCSGCEQPLGSR.S
*	TK261102_lung_cytoE18_2_step11.3152.3152.2	1.6148	0.3772	3137.73	1	2400.0%	1	R.KLEYGGQTWHEHCFLCSGCEQPLGSR.S
UQ8R1X853.5%7276.9%695789815.9(Q8R1X8) Hypothetical 79.0 kDa protein 
	TK261102_lung_cytoE18_2_step01.2728.2728.1	1.2497	0.1073	1575.17	37	2690.0%	5	R.QSLSQALNQNAELR.S
	TK261102_lung_cytoE18_2_step12.1389.1389.2	1.0683	0.0074	1572.86	15	4230.0%	1	K.WHEGLYCGVAPSAK.C
*	TK261102_lung_cytoE18_2_step01.2176.2176.3	1.4063	0.1642	2290.27	9	1970.0%	1	R.FRPDQRFLEEGNLEAAAAEK.Q
UQ9BRR853.5%241.5%9311033457.1(Q9BRR8) Similar to RIKEN cDNA 1300003A17 gene 
	TK261102_lung_cytoE18_2_step07.3536.3536.1	1.4251	0.1754	1582.66	4	4230.0%	2	K.EDSISEFLSLARSK.A
UQ8R5M053.3%3510.4%297321085.7(Q8R5M0) PDZ-domain protein Gipc3 
	TK261102_lung_cytoE18_2_step09.3553.3553.2	1.3852	0.1795	2229.17	30	2000.0%	1	K.TEDALGLTITDNGAGYAFIKR.I
*	TK261102_lung_cytoE18_2_step08.2899.2899.1	1.1159	0.0643	1025.74	12	5000.0%	2	R.EPGATEPPAR.A
U9KD_HUMAN53.3%1130.5%8285946.2(P13994) 9 kDa protein 
*	TK261102_lung_cytoE18_2_step09.4201.4201.2	2.1303	0.0717	2368.11	2	3330.0%	1	K.SHPGGGGERPGLAGQGEPDHPAGAR.D
UROG_MOUSE53.3%336.4%3884223410.0(O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G) 
	TK261102_lung_cytoE18_2_step12.1287.1287.2	1.781	0.2621	873.95	1	7140.0%	1	R.RGPPPPPR.S
	TK261102_lung_cytoE18_2_step05.3505.3505.1	0.9363	0.2274	1268.47	4	3180.0%	1	R.DSYSSSSRGAPR.G
	TK261102_lung_cytoE18_2_step10.1053.1053.1	0.5153	0.0912	568.01	6	5000.0%	1	R.GYGDR.D
USM6A_MOUSE53.3%447.8%888990767.8(O35464) Semaphorin 6A precursor (Semaphorin VIA) (Sema VIA) (Semaphorin Q) (Sema Q) 
	TK261102_lung_cytoE18_2_step09.1340.1340.1	0.3158	0.0614	542.0	4	2500.0%	1	K.VPLGR.C
	TK261102_lung_cytoE18_2_step09.2674.2674.1	0.877	0.0219	1208.32	7	3890.0%	1	K.SRQADVDTCR.M
*	TK261102_lung_cytoE18_2_step11.4276.4276.2	2.1294	0.0455	2549.13	3	2500.0%	1	R.IGSSGFLNGSLFLEEMNVYNPEK.C
	TK261102_lung_cytoE18_2_step10.3491.3491.3	1.4949	0.0040	3292.98	5	1420.0%	1	R.GGMLDWNDLLEAPGSTDPLGAVSSHNHQDKK.G
UNAL1_HUMAN53.3%7156.3%14731658656.8(Q9C000) NACHT-, LRR- and PYD-containing protein 2 (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) (Caspase recruitment domain protein 7) 
*	TK261102_lung_cytoE18_2_step09.3993.3993.3	1.7662	0.1805	4192.48	7	1470.0%	2	K.MGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEK.G
*	TK261102_lung_cytoE18_2_step07.0648.0648.1	0.4295	0.0019	776.2	7	1000.0%	1	K.FSRHVK.K
*	TK261102_lung_cytoE18_2_step10.4307.4307.2	2.1418	0.0498	2283.45	2	3420.0%	3	R.IAVPSPLDAPQLLHFVDQYR.E
	TK261102_lung_cytoE18_2_step06.3193.3193.3	1.3345	0.0113	3595.49	53	1370.0%	1	K.EEGMLLEKPARVELHHIVLENPSFSPLGVLLK.M
UQ9CQR853.3%116.2%227256885.4(Q9CQR8) 1600016E11Rik protein 
*	TK261102_lung_cytoE18_2_step06.5138.5138.2	2.1427	0.1789	1701.84	8	4230.0%	1	K.MVISISRAWYHPLK.Q
UQ6448753.3%222.3%18942121936.6(Q64487) Protein-tyrosine phosphatase, receptor-type, D precursor (EC 3.1.3.48) (Protein-tyrosine phosphatase delta) (R-PTP-delta) 
*	TK261102_lung_cytoE18_2_step10.3951.3951.2	2.121	0.2202	2225.99	6	2940.0%	1	R.MIWEQEATVVMMTKLEER.S
*	TK261102_lung_cytoE18_2_step09.0010.0010.2	0.8558	0.0754	3030.58	26	1600.0%	1	K.WTEYRITVTAHTDVGPWPESLSVLIR.T
UQ9UIE653.3%339.7%455519998.7(Q9UIE6) Hypothetical protein 
*	TK261102_lung_cytoE18_2_step06.2201.2201.1	0.9362	0.0050	725.52	23	4170.0%	1	R.KHPGTGK.A
*	TK261102_lung_cytoE18_2_step07.3218.3218.2	0.9343	0.202	2180.57	16	2110.0%	1	K.LASWTSMALAASGIYFYSNK.Y
*	TK261102_lung_cytoE18_2_step11.1642.1642.2	1.8243	0.257	2268.13	1	3750.0%	1	R.LNYCHLWQSLIWTDMKR.V
UNECD_HUMAN53.2%9813.4%321360868.8(Q99608) Necdin 
*	TK261102_lung_cytoE18_2_step05.0206.0206.1	1.3596	0.1561	1411.36	38	3500.0%	9	K.KMIIWFPDMVK.D
UQ9CTV253.2%112.3%564627118.1(Q9CTV2) 4933434L15Rik protein (Fragment) 
	TK261102_lung_cytoE18_2_step12.3245.3245.1	1.498	0.1313	1421.73	3	4170.0%	1	R.AGLAVVLRHIIQK.S
UGPDA_MOUSE53.1%2210.9%348374427.2(P13707) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic (EC 1.1.1.8) (GPD-C) (GPDH-C) 
*	TK261102_lung_cytoE18_2_step06.4914.4914.2	0.8433	0.2479	3130.02	30	1070.0%	1	K.LFCSGTVSSATFLESCGVADLITTCYGGR.N
*	TK261102_lung_cytoE18_2_step08.3380.3380.1	1.5436	0.1077	1104.58	1	6250.0%	1	R.ELHSILQHK.G
UO9483753.1%443.8%14491631127.6(O94837) Hypothetical protein KIAA0732 (Fragment) 
*	TK261102_lung_cytoE18_2_step01.2499.2499.3	0.914	0.0156	2221.11	100	1320.0%	1	R.LLSGFVPLLAAPQDPCYVEK.T
	TK261102_lung_cytoE18_2_step08.1972.1972.1	0.9691	0.0209	672.62	51	5000.0%	1	K.KLALAR.K
	TK261102_lung_cytoE18_2_step01.4318.4318.2	0.8025	0.0119	1981.74	156	1470.0%	1	K.YILVVPLIVINELDGLAK.G
*	TK261102_lung_cytoE18_2_step01.1791.1791.1	1.5442	0.1156	1312.68	5	4500.0%	1	K.DPNVENPEQIR.N
UNFC1_MOUSE53.0%5510.3%717778337.7(O88942) Nuclear factor of activated T-cells, cytoplasmic 1 (NFAT transcription complex cytosolic component) (NF-ATc1) (NF-ATc) 
	TK261102_lung_cytoE18_2_step06.0355.0355.3	1.2529	0.0399	2222.63	5	2360.0%	1	K.VIFVEKAPDGHHVWEMEAK.T
	TK261102_lung_cytoE18_2_step06.5822.5822.2	1.6149	0.3385	1901.38	1	3750.0%	1	K.RSPSTATLHLPSLEAYR.D
	TK261102_lung_cytoE18_2_step03.0107.0107.2	0.7276	0.0088	1260.41	206	2000.0%	1	R.GSRPTSPCNKR.K
	TK261102_lung_cytoE18_2_step12.4452.4452.3	1.9206	0.0413	3109.69	1	2400.0%	1	R.SQYQRFTYLPANGNSVFLTLSSESELR.G
UQ9HCF453.0%444.6%14151602725.9(Q9HCF4) Hypothetical protein KIAA1618 (Fragment) 
*	TK261102_lung_cytoE18_2_step05.3733.3733.2	1.3131	0.1094	1543.56	2	4620.0%	1	R.TEDAAQELLLPESK.G
	TK261102_lung_cytoE18_2_step06.5500.5500.1	0.9254	0.1061	1562.16	223	2690.0%	1	R.MIRLLSLVDSAGQR.D
*	TK261102_lung_cytoE18_2_step09.3482.3482.1	1.5405	0.1017	1349.6	2	5000.0%	1	R.DSHIFQLFWR.E
*	TK261102_lung_cytoE18_2_step07.3500.3500.3	1.8279	0.065	3123.27	19	1540.0%	1	K.ESLGLNGDFSVLNTLLNFTDNFDDFRR.E
UQ9D48653.0%3313.9%685766256.3(Q9D486) 4933407C03Rik protein 
	TK261102_lung_cytoE18_2_step01.4274.4274.2	2.0526	0.2344	2045.94	3	3440.0%	1	R.FAEDPRQEVHSCLLSVR.A
	TK261102_lung_cytoE18_2_step09.5439.5439.3	1.1035	0.0060	4535.86	66	990.0%	1	K.LLSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCK.H
*	TK261102_lung_cytoE18_2_step08.4525.4525.3	1.8181	0.1735	4329.52	13	1120.0%	1	-.MKTFGPGDEHPEPSGYMENSVSYSAIEDVQPLSWENAPK.Y
UHP28_HUMAN52.9%243.3%181206308.9(Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) 
*	TK261102_lung_cytoE18_2_step07.2148.2148.1	1.4307	0.1512	656.74	1	8000.0%	2	K.MHLAGK.T
UQ9CQT152.8%3314.9%369394115.9(Q9CQT1) 2410018C20Rik protein (RIKEN cDNA 2410018C20 gene) 
	TK261102_lung_cytoE18_2_step10.2604.2604.1	1.2407	0.1782	1029.6	56	4000.0%	1	R.GVSAVVVGADR.V
*	TK261102_lung_cytoE18_2_step11.3224.3224.2	1.5989	0.4229	2510.37	1	2950.0%	1	K.HHGVPFYVAAPSSSCDLHLETGK.E
*	TK261102_lung_cytoE18_2_step11.4176.4176.2	0.7879	0.1237	2258.66	122	1000.0%	1	R.DLGQVAAQEAEREGATEETVR.E
UQ91Y1652.8%241.0%9421022485.1(Q91Y16) Protocadherin alpha 3 
*	TK261102_lung_cytoE18_2_step01.1718.1718.1	1.4236	0.0408	1016.65	4	5620.0%	2	R.VLDETDAPR.Q
USTA6_MOUSE52.8%445.6%837937266.4(P52633) Signal transducer and transcription activator 6 
	TK261102_lung_cytoE18_2_step09.3523.3523.1	0.8804	0.0541	1243.71	3	3120.0%	1	R.CLRSYWSDR.L
	TK261102_lung_cytoE18_2_step12.1741.1741.3	1.6267	0.0716	1535.59	39	2500.0%	1	R.SHYKPEQMGKDGR.G
	TK261102_lung_cytoE18_2_step10.1860.1860.1	1.4693	0.1464	1204.64	1	6670.0%	1	R.SHYKPEQMGK.D
*	TK261102_lung_cytoE18_2_step08.5236.5236.3	1.5398	0.1884	2778.48	27	1670.0%	1	R.FLLGLQFLGTSTKPPMVRADMVTEK.Q
UQ9Z24352.7%61413.6%457506485.2(Q9Z243) NNX3 
	TK261102_lung_cytoE18_2_step05.0047.0047.1	1.4708	0.0646	1138.8	7	5000.0%	2	K.QAVGLVEHRK.E
*	TK261102_lung_cytoE18_2_step10.4191.4191.2	0.8776	0.0446	3111.43	11	1550.0%	1	R.GLLRSTSSEEAVATEAGGSSLDELQENHPK.K
*	TK261102_lung_cytoE18_2_step12.3617.3617.2	1.801	0.2554	2446.14	3	2380.0%	3	R.QEELLGELESKPDTVIANGEDR.V
UKCRM_MOUSE52.7%3310.8%381430457.1(P07310) Creatine kinase, M chain (EC 2.7.3.2) (M-CK) 
*	TK261102_lung_cytoE18_2_step12.4307.4307.2	1.5613	0.0177	2930.72	1	2400.0%	1	K.AGHPFMWNEHLGYVLTCPSNLGTGLR.G
	TK261102_lung_cytoE18_2_step10.1537.1537.1	1.419	0.1861	1002.42	1	6250.0%	1	R.HGGYKPTDK.H
	TK261102_lung_cytoE18_2_step09.0222.0222.1	0.6643	0.2882	594.66	1	3000.0%	1	R.GGVHVK.L
UQ6092052.6%8649.7%134156739.3(Q60920) Zfp78p (Fragment) 
	TK261102_lung_cytoE18_2_step01.2346.2346.1	1.3569	0.1233	1573.5	83	2920.0%	8	K.AFIRSSQLLIHER.I
UO1546352.6%333.7%12611421066.7(O15463) PTPL1-associated RhoGAP 
*	TK261102_lung_cytoE18_2_step11.0629.0629.2	0.8776	0.0445	997.68	395	3570.0%	1	K.REILAQLR.T
*	TK261102_lung_cytoE18_2_step09.2345.2345.1	1.5279	0.1026	1193.56	1	5000.0%	1	R.SSDSYPLAPVR.A
*	TK261102_lung_cytoE18_2_step06.2341.2341.3	1.4441	0.0268	2955.42	51	1570.0%	1	K.GVTTSLQISGDHSINATQPSKPYAEPVR.S
UHAO1_HUMAN52.4%2211.4%370409248.1(Q9UJM8) Hydroxyacid oxidase 1 (EC 1.1.3.15) (HAOX1) (Glycolate oxidase) (GOX) 
*	TK261102_lung_cytoE18_2_step01.5536.5536.1	1.3272	0.4152	1522.79	1	3080.0%	1	R.VSMPICVGATAMQR.M
*	TK261102_lung_cytoE18_2_step12.3479.3479.2	1.2953	0.1473	3069.26	17	1480.0%	1	K.AVFVGRPIVWGLAFQGEKGVQDVLEILK.E
UQ9ESC852.4%445.9%11601266399.4(Q9ESC8) Putative transcription factor ALF-4 
	TK261102_lung_cytoE18_2_step11.0598.0598.3	1.8014	0.1583	3861.95	5	1640.0%	1	K.IHQMAASYVQVTSNFLYATEIWDQAEQLSKEQK.E
*	TK261102_lung_cytoE18_2_step06.3498.3498.2	1.6232	0.3282	1868.13	1	3240.0%	1	K.EGREQGTASNYTDPGGTK.E
	TK261102_lung_cytoE18_2_step08.2699.2699.1	0.8713	0.0176	1030.38	5	4290.0%	1	K.RLTVLCLR.C
	TK261102_lung_cytoE18_2_step11.1370.1370.1	0.939	0.1119	1061.98	208	2780.0%	1	K.TIQKGSESGR.G
UQ9D46252.4%112.0%541608379.5(Q9D462) 4933411K20Rik protein 
*	TK261102_lung_cytoE18_2_step06.4364.4364.1	1.669	0.091	1314.86	2	6000.0%	1	K.FGVQNDHLKEK.I
UQ8R32052.3%224.3%11611328774.9(Q8R320) Similar to N-arginine dibasic convertase 1 
*	TK261102_lung_cytoE18_2_step10.3772.3772.2	1.6304	0.3224	2238.77	1	3330.0%	1	R.EMPVQFQVVELPSGHHLCK.V
*	TK261102_lung_cytoE18_2_step09.4133.4133.3	1.86	0.0863	3602.17	1	1670.0%	1	K.LPLLFQLIIDYLTEFSSTPAVFTMITEQLKK.T
URM09_MOUSE52.3%114.3%2562946010.1(Q99N94) 60S ribosomal protein L9, mitochondrial precursor (L9mt) (Fragment) 
	TK261102_lung_cytoE18_2_step08.3633.3633.1	1.4126	0.1939	1329.72	4	4000.0%	1	R.TLWWAGAAWLR.Q
UQ6128552.3%4104.5%741834839.1(Q61285) ALDR protein (ATP-binding cassette, sub-family D (ALD), member 2) 
	TK261102_lung_cytoE18_2_step07.5225.5225.2	1.9162	0.2524	1901.95	1	3420.0%	3	R.GASPIGPTLLAGLVVYATAK.V
*	TK261102_lung_cytoE18_2_step05.0248.0248.1	0.883	0.1266	1520.48	144	2080.0%	1	K.ALAYQMNLILSKR.L
UCCAD_HUMAN52.2%444.3%21612451636.8(Q01668) Voltage-dependent L-type calcium channel alpha-1D subunit (Calcium channel, L type, alpha-1 polypeptide, isoform 2) 
*	TK261102_lung_cytoE18_2_step12.4036.4036.2	1.5874	0.4204	2629.36	1	3180.0%	1	K.RPSIGNLEHVSENGHHSSHKHDR.E
*	TK261102_lung_cytoE18_2_step07.2466.2466.3	1.2139	0.0131	2681.7	1	2080.0%	1	R.TALPLHLMQQQIMAVAGLDSSKAQK.Y
*	TK261102_lung_cytoE18_2_step09.3583.3583.3	1.5677	0.0505	1915.58	4	2640.0%	1	R.GTRLPLSGEGPTSQPNSSK.Q
*	TK261102_lung_cytoE18_2_step01.4159.4159.3	1.6994	0.1268	2826.04	1	2080.0%	1	K.GYLDWITQAEDIDPENEEEGGEEGK.R
UQ925F252.2%116.1%394418109.3(Q925F2) Endothelial cell-selective adhesion molecule 
*	TK261102_lung_cytoE18_2_step12.2335.2335.2	1.588	0.4272	2410.88	1	3260.0%	1	K.AAPPRPGTFTPTPSVSSQALSSPR.L
UFCG2_MOUSE52.0%2212.7%330366956.7(P08101) Low affinity immunoglobulin gamma FC region receptor II precursor (FC-gamma RII) (FCRII) (IGG FC receptor II beta) (FC gamma receptor IIB) (FCgammaRIIB) 
*	TK261102_lung_cytoE18_2_step11.3018.3018.2	0.9477	0.0546	1496.46	76	3640.0%	1	-.MESNWTVHVFSR.T
*	TK261102_lung_cytoE18_2_step09.4285.4285.2	1.7674	0.2597	3023.92	4	1900.0%	1	R.SLPVLTIVAAVTGIAVAAIVIILVSLVYLK.K
UQ8QZX552.0%1110.7%122138818.7(Q8QZX5) Similar to U7 snRNP-specific Sm-like protein LSM10 (Hypothetical 13.9 kDa protein) 
*	TK261102_lung_cytoE18_2_step12.2865.2865.2	1.6456	0.3116	1521.77	2	4170.0%	1	R.GRIDNVDAFMNIR.L
UQ9CY2652.0%242.3%298333665.5(Q9CY26) 2700085E05Rik protein 
	TK261102_lung_cytoE18_2_step10.3620.3620.1	1.3331	0.3815	861.7	1	5830.0%	2	R.ALHFVFK.V
UFGD1_MOUSE51.7%222.4%9601064786.6(P52734) Putative Rho/Rac guanine nucleotide exchange factor (Rho/Rac GEF) (Faciogenital dysplasia protein homolog) 
	TK261102_lung_cytoE18_2_step12.3253.3253.2	1.3594	0.0139	1931.84	3	3670.0%	1	K.HEQTLETFKLLNSTNR.D
	TK261102_lung_cytoE18_2_step06.0435.0435.1	1.6429	0.0914	1023.89	1	7500.0%	1	K.RMEEWDR.Y
UQ9NY7451.6%447.5%840944327.2(Q9NY74) ETAA16 protein 
*	TK261102_lung_cytoE18_2_step09.3574.3574.2	1.5288	0.0038	1891.8	27	2670.0%	1	K.QIYTTDSDEISHIVNR.I
*	TK261102_lung_cytoE18_2_step12.2095.2095.3	0.8413	0.0164	3397.2	159	740.0%	1	K.ACHQLDNTWEADDVDDDLLYQACDDIER.L
*	TK261102_lung_cytoE18_2_step04.0484.0484.1	0.8512	0.0751	870.4	10	5000.0%	1	R.QEALVRR.M
*	TK261102_lung_cytoE18_2_step01.1995.1995.1	1.7511	0.0151	1165.58	4	5000.0%	1	R.ASSVNAAPTSFL.-
UNSGX_HUMAN51.6%1115.2%79885111.6(Q9UH64) Susceptibility protein NSG-x 
*	TK261102_lung_cytoE18_2_step05.0284.0284.1	1.3503	0.2394	1402.86	2	4550.0%	1	R.ACNNPTVAENRR.V
UNU62_MOUSE51.5%224.2%526532555.3(Q63850) Nuclear pore glycoprotein p62 (62 kDa nucleoporin) 
*	TK261102_lung_cytoE18_2_step11.1764.1764.2	2.024	0.2319	2426.61	1	2750.0%	1	K.ILNAHMDSLQWVDQSSALLQR.R
*	TK261102_lung_cytoE18_2_step12.1627.1627.2	0.9535	0.0561	2580.71	16	1430.0%	1	K.ILNAHMDSLQWVDQSSALLQRR.V
UO8841251.4%5116.1%524583937.8(O88412) Zinc finger protein 105 
*	TK261102_lung_cytoE18_2_step11.2401.2401.1	0.3813	0.0	942.48	5	1430.0%	1	K.NLELLIPK.K
*	TK261102_lung_cytoE18_2_step10.4095.4095.1	1.1219	0.1045	1560.9	16	2920.0%	1	K.AFSQLSCLIVHQR.I
*	TK261102_lung_cytoE18_2_step06.4108.4108.1	1.5207	0.1043	1297.43	1	5500.0%	3	-.MTTELKETMGR.A
UQ9BTP151.2%5172.4%863974816.1(Q9BTP1) Hypothetical protein (Fragment) 
*	TK261102_lung_cytoE18_2_step10.2584.2584.1	1.1256	0.0196	691.72	4	5000.0%	4	R.QREEK.S
*	TK261102_lung_cytoE18_2_step01.4160.4160.2	1.5655	0.3603	1933.44	4	3330.0%	1	R.QQILSLGMDLQLEWMK.L
UQ91ZU851.0%442.6%26113016916.5(Q91ZU8) Bullous pemphigoid antigen 1-e 
	TK261102_lung_cytoE18_2_step12.2425.2425.3	1.4007	0.1764	2838.28	13	1880.0%	1	R.SELSVVIQSLSQIYSMSSTYIEKLK.T
	TK261102_lung_cytoE18_2_step02.0015.0015.2	0.9393	0.0448	2575.31	29	1430.0%	1	R.TEWGSDLPSVESHLENHKNVHR.A
*	TK261102_lung_cytoE18_2_step06.2797.2797.1	1.6159	0.0964	1377.66	1	4550.0%	1	R.KDSSLSDLEQQK.R
*	TK261102_lung_cytoE18_2_step07.3421.3421.1	1.178	0.0959	1165.02	6	3890.0%	1	R.QRATMVENSK.L
UA1A1_HUMAN51.0%222.4%10231128965.5(P05023) Sodium/potassium-transporting ATPase alpha-1 chain precursor (EC 3.6.3.9) (Sodium pump 1) (Na+/K+ ATPase 1) 
*	TK261102_lung_cytoE18_2_step11.2756.2756.3	1.075	0.0339	1643.26	12	2920.0%	1	K.CIELCCGSVKEMR.E
*	TK261102_lung_cytoE18_2_step01.2390.2390.1	1.6136	0.0972	1295.74	2	4550.0%	1	K.YEPAAVSEQGDK.K
UDD20_MOUSE51.0%449.6%825917196.8(Q9JJY4) Probable ATP-dependent RNA helicase DDX20 (DEAD-box protein 20) (DEAD-box protein DP 103) (Component of gems 3) (Gemin3) (Regulator of steroidogenic factor-1) (ROSF-1) 
*	TK261102_lung_cytoE18_2_step12.4671.4671.2	0.6538	0.0883	2891.97	41	1200.0%	1	K.VPFNQALVFSNLHSRAQHLADILSSK.G
	TK261102_lung_cytoE18_2_step07.5606.5606.2	1.093	0.0856	2919.28	1	2270.0%	1	R.AYYRAWQEYYAAASHSYYWNAQR.H
	TK261102_lung_cytoE18_2_step10.2940.2940.3	1.0112	0.0056	2378.9	150	1750.0%	1	K.MEGLECHVFIGGTPLSQDKTR.L
	TK261102_lung_cytoE18_2_step01.1840.1840.1	1.7407	0.0367	1065.9	3	5000.0%	1	R.LFILDEADK.L
UVMT2_HUMAN51.0%116.4%514557136.0(Q05940) Synaptic vesicle amine transporter (Monoamine transporter) (Vesicular amine transporter 2) (VAT2) 
*	TK261102_lung_cytoE18_2_step03.0488.0488.3	2.5322	0.3061	3775.26	1	1950.0%	1	R.KLILFIVFLALLLDNMLLTVVVPIIPSYLYSIK.H
UQ91ZG950.9%223.6%14011590907.6(Q91ZG9) DM61H21.1 (Novel protein) (Fragment) 
	TK261102_lung_cytoE18_2_step01.5502.5502.2	1.8014	0.244	2733.98	3	2290.0%	1	K.AMSAVLCCGPVFDNVGLSPDGYLYK.W
	TK261102_lung_cytoE18_2_step06.3992.3992.3	1.9902	0.2063	2817.87	1	2500.0%	1	R.LQLLRIFELLADAGVISDSTNGALER.D
UQ9D9J350.9%112.7%376422165.4(Q9D9J3) 1700061J02Rik protein 
*	TK261102_lung_cytoE18_2_step09.3245.3245.1	1.3963	0.1956	1255.69	5	3890.0%	1	K.QMWVTAEDFK.E
UQ9JI1850.8%13136.6%45995136385.4(Q9JI18) Low density lipoprotein receptor related protein LRP1B/LRP-DIT 
*	TK261102_lung_cytoE18_2_step09.4055.4055.3	1.5072	0.0987	3023.56	6	1770.0%	1	K.DCEDGLDELHCDSSCSWNQFACSVK.K
*	TK261102_lung_cytoE18_2_step06.4070.4070.2	0.8379	0.0143	2808.36	96	1520.0%	1	R.GPCSHLCLINHNRSAACACPHLMK.L
*	TK261102_lung_cytoE18_2_step01.3663.3663.3	1.3728	0.0354	4419.65	33	1040.0%	1	K.DQDECSIYGICSQTCKNTYGSYACSCVEGYIMQSDNR.S
*	TK261102_lung_cytoE18_2_step07.5657.5657.3	1.1808	0.1053	4668.65	7	940.0%	1	R.FQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLAGQFK.C
*	TK261102_lung_cytoE18_2_step12.1917.1917.3	1.6482	0.2405	2721.14	6	1960.0%	1	K.ICNGINDCGDNSDEEHCSGKLSLK.S
*	TK261102_lung_cytoE18_2_step06.2793.2793.1	0.955	0.0751	781.51	36	5830.0%	1	R.KVVYSGK.E
*	TK261102_lung_cytoE18_2_step12.0084.0084.2	1.0622	0.0126	1794.94	261	2330.0%	1	R.IDLHKGDYSLLVPGLR.N
*	TK261102_lung_cytoE18_2_step10.4837.4837.2	1.5638	0.4879	3181.56	2	1730.0%	1	R.CLVNTLWQCDGDFDCPDSSDEAPINPR.C
*	TK261102_lung_cytoE18_2_step01.4110.4110.2	1.1495	0.1737	2837.7	24	1520.0%	1	K.SIHLSDETNLNSPVRPYENPNYFK.N
*	TK261102_lung_cytoE18_2_step09.4658.4658.1	0.6383	0.0296	1554.18	118	1360.0%	1	K.WHCDTDDDCGDR.S
*	TK261102_lung_cytoE18_2_step11.1533.1533.1	1.3635	0.01	1196.61	16	4380.0%	1	K.EDQFQCKNK.A
*	TK261102_lung_cytoE18_2_step11.4624.4624.3	1.2988	0.0456	3960.63	11	1210.0%	1	R.IYWADFELSIIGSVLYDGSSPVVSVSSKQGLLHPHR.I
	TK261102_lung_cytoE18_2_step06.2742.2742.3	1.5979	9.0E-4	2636.34	42	2020.0%	1	R.AIALDPRYGILFWTDWDANFPR.I
UACDV_HUMAN50.7%336.0%655703908.8(P49748) Acyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor (EC 1.3.99.-) (VLCAD) 
*	TK261102_lung_cytoE18_2_step06.5430.5430.1	1.276	0.0063	1450.67	2	4230.0%	1	R.LTALLGQPRPGPAR.R
*	TK261102_lung_cytoE18_2_step11.2826.2826.3	1.2549	0.0675	2810.15	8	1670.0%	1	K.IFGSEAAWKVTDECIQIMGGMGFMK.E
UA2MG_MOUSE50.7%11274.0%14951658276.7(Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) 
*	TK261102_lung_cytoE18_2_step12.1061.1061.1	1.0219	0.0618	650.75	2	7500.0%	1	K.IHKPR.F
*	TK261102_lung_cytoE18_2_step09.2153.2153.1	1.4946	0.1033	882.56	1	6430.0%	4	K.NLKPAPIK.V
*	TK261102_lung_cytoE18_2_step10.4517.4517.2	0.8728	0.0038	2602.89	4	1960.0%	1	K.HSLGDNDAHSIFQSVGINIFTNSK.I
*	TK261102_lung_cytoE18_2_step08.3159.3159.1	1.5747	0.119	1118.76	10	5000.0%	2	K.KIEHSFEVK.E
*	TK261102_lung_cytoE18_2_step06.0350.0350.1	1.4844	0.0394	1108.98	2	5560.0%	1	K.LTEVPALVHK.D
	TK261102_lung_cytoE18_2_step10.1355.1355.1	0.9561	0.0228	553.79	3	8330.0%	2	R.KYSR.Y
UGRG_MOUSE50.7%2219.8%197220006.4(Q06195) GRG protein (ESP1 protein) (Amino enhancer of split) (AES-1/AES-2) 
	TK261102_lung_cytoE18_2_step06.4716.4716.2	1.3646	0.0447	2940.24	6	2050.0%	1	K.SEMQRHYVMYYEMSYGLNIEMHK.Q
	TK261102_lung_cytoE18_2_step08.4431.4431.2	1.6044	0.311	1961.74	1	4670.0%	1	R.IKDEFQLLQAQYHSLK.L
UPTPX_HUMAN50.7%111.9%10151112815.8(Q92932) Protein-tyrosine phosphatase X precursor (EC 3.1.3.48) (R-PTP-X) (Islet cell autoantigen related protein) (ICAAR) (IAR) (Phogrin) 
	TK261102_lung_cytoE18_2_step01.3612.3612.2	1.569	0.3244	1930.77	1	3060.0%	1	K.WPSPLGDSEDPSSTGDGAR.I
UQ91ZD050.4%339.8%518602738.2(Q91ZD0) 3-beta-hydroxysterol delta-24 reductase 
	TK261102_lung_cytoE18_2_step10.3992.3992.2	1.2708	0.0769	2186.98	4	2500.0%	1	-.MEPAVSLAVCALLFLLWVR.V
	TK261102_lung_cytoE18_2_step09.4153.4153.3	2.5506	0.2572	3792.55	2	1720.0%	1	R.SVHGFQMLYADCYMNREEFWEMFDGSLYHK.L
*	TK261102_lung_cytoE18_2_step10.3220.3220.2	1.3681	0.2104	2417.08	45	2000.0%	1	-.MEPAVSLAVCALLFLLWVRVK.G
UMYHA_HUMAN50.3%665.0%19762289375.5(P35580) Myosin heavy chain, nonmuscle type B (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) 
*	TK261102_lung_cytoE18_2_step07.2632.2632.1	1.3776	0.2125	1308.61	1	5000.0%	1	R.KDHNIPGELER.Q
*	TK261102_lung_cytoE18_2_step11.2566.2566.2	1.6421	0.2034	1350.69	1	5000.0%	1	K.VEGELEEMERK.H
	TK261102_lung_cytoE18_2_step05.3714.3714.3	1.6819	0.2078	2361.04	32	2370.0%	1	K.DERTFHIFYQLLSGAGEHLK.S
*	TK261102_lung_cytoE18_2_step10.4279.4279.2	1.2881	0.0693	2091.61	31	2110.0%	1	R.IVGLDQVTGMTETAFGSAYK.T
*	TK261102_lung_cytoE18_2_step11.3720.3720.2	1.2526	0.1247	2806.82	1	2170.0%	1	R.LQQELDDLTVDLDHQRQVASNLEK.K
*	TK261102_lung_cytoE18_2_step07.1929.1929.1	0.6779	0.1261	1411.34	6	2270.0%	1	R.DEIFAQSKESEK.K
UQ9BW1150.3%3327.2%206234779.2(Q9BW11) Similar to Max dimerization protein 3 
	TK261102_lung_cytoE18_2_step08.2111.2111.3	1.7782	0.2921	2272.64	52	1880.0%	1	K.RPPQAPGAQDSGRSVHNELEK.R
	TK261102_lung_cytoE18_2_step01.2808.2808.2	0.7147	0.0132	2273.76	11	1320.0%	1	-.MEPLASNIQVLLQAAEFLER.R
	TK261102_lung_cytoE18_2_step09.2842.2842.2	1.9782	0.2345	1812.55	1	4290.0%	1	R.EREAEHGYASLCPHR.S
UIF2B_HUMAN50.3%113.9%333383885.8(P20042) Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 beta subunit) (eIF-2-beta) 
*	TK261102_lung_cytoE18_2_step11.2440.2440.1	1.6057	0.0993	1492.76	4	4170.0%	1	K.KIFDIDEAEEGVK.D
UO6033150.2%224.7%687752835.6(O60331) Hypothetical protein KIAA0589 (Fragment) 
*	TK261102_lung_cytoE18_2_step11.4964.4964.1	1.3943	0.185	1335.92	2	4170.0%	1	-.AAVAARVPLGRPR.R
*	TK261102_lung_cytoE18_2_step08.3557.3557.2	1.0299	0.0591	1852.18	120	2500.0%	1	K.AAPTEVLSMTAQPGPGHGK.K
ProteinsPeptide IDsCopies
Unfiltered195724029441198
Filtered1008645939191