D simple2

DTASelect v1.9
/home/51n/myMS/article/dbdigger/nathanPSM/nonTryptic/simple2
/home/51n/myMS/db/psmDB/20040623-Scale-8956.fasta
DBDigger 0.5 in SQT format.
-1 34.98134 -2 38.57413 -3 37.59039 --DB -d 0 -p 2
Jump to the summary table.

sequest.params modifications:

true	Use criteria
34.98134	Minimum +1 XCorr
38.57413	Minimum +2 XCorr
37.59039	Minimum +3 XCorr
0.0	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
true	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
false	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

std_gi|2506462|sp|P02188|MYG_HORSE

100.0%

153

16951

7.8

MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1030.1030.1	46.7143	0.453584	1816.76	1817.01	1	144.0	78.3%	1	-.GLSDGEWQQVLNVWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1029.1029.2	75.5249	0.430021	1817.24	1817.01	1	239.0	91.7%	1	-.GLSDGEWQQVLNVWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1190.1190.2	49.0407	0.29322	3404.12	3405.8	1	109.0	61.5%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1186.1186.3	45.1688	0.347956	3406.3	3405.8	1	229.0	63.8%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.730.730.1	44.7754	0.322136	1606.92	1607.81	1	161.0	69.6%	1	K.VEADIAGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.729.729.2	72.0304	0.496203	1608.1	1607.81	1	232.0	88.0%	1	K.VEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.660.660.1	43.4274	0.281948	1271.7	1272.44	1	226.0	81.2%	1	R.LFTGHPETLEK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.662.662.2	50.0784	0.310205	1274.1	1272.44	1	172.0	75.0%	1	R.LFTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.754.754.2	58.2318	0.417935	1938.0	1938.23	1	162.0	80.8%	1	R.LFTGHPETLEKFDKFK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.666.666.2	43.0817	0.324297	1159.98	1159.28	1	148.0	77.8%	1	L.FTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.396.396.2	64.1778	0.415431	1363.88	1362.64	1	236.0	94.4%	1	K.FKHLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.400.400.3	45.2589	0.306737	1364.05	1362.64	1	250.0	61.1%	1	K.FKHLKTEAEMK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.268.268.1	40.8241	0.353216	1086.6	1087.29	1	227.0	92.3%	2	K.HLKTEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.273.273.2	54.277	0.315161	1088.0	1087.29	1	237.0	100.0%	1	K.HLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.494.494.2	58.0275	0.510933	1858.6	1859.15	1	6.0	77.8%	1	K.HLKTEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.421.421.1	46.5011	0.328543	1479.68	1480.68	1	166.0	75.0%	1	K.TEAEMKASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.419.419.2	70.2662	0.494699	1480.76	1480.68	1	186.0	95.2%	1	K.TEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.420.420.3	41.4086	0.215318	1481.77	1480.68	1	234.0	68.3%	1	K.TEAEMKASEDLKK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.929.929.1	53.9155	0.423125	1378.86	1379.69	1	203.0	81.0%	1	K.HGTVVLTALGGILK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.930.930.2	86.2231	0.522397	1379.72	1379.69	1	47.0	100.0%	1	K.HGTVVLTALGGILK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.935.935.3	53.2299	0.2697	1380.16	1379.69	1	63.0	60.9%	1	K.HGTVVLTALGGILK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.854.854.1	56.5563	0.476658	1506.89	1507.86	1	224.0	78.3%	1	K.HGTVVLTALGGILKK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.855.855.2	79.7181	0.532901	1508.36	1507.86	1	118.0	92.0%	1	K.HGTVVLTALGGILKK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.856.856.3	68.4337	0.325885	1508.56	1507.86	1	186.0	79.6%	1	K.HGTVVLTALGGILKK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.319.319.2	63.1093	0.412539	2110.94	2111.41	1	208.0	73.3%	2	K.KKGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.303.303.3	66.3732	0.500018	2112.19	2111.41	1	191.0	60.0%	1	K.KKGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.414.414.3	51.9773	0.326644	1260.28	1259.45	1	61.0	82.4%	1	K.KGHHEAELKPL.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.324.324.1	63.1589	0.475614	1982.0	1983.24	1	44.0	80.8%	1	K.KGHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.323.323.3	65.4288	0.356132	1983.19	1983.24	1	189.0	71.9%	1	K.KGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.343.343.2	57.4269	0.366244	1983.86	1983.24	1	225.0	71.4%	2	K.KGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.348.348.1	62.4866	0.539891	1853.86	1855.06	1	52.0	84.0%	1	K.GHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.373.373.2	49.9343	0.2513	1854.18	1855.06	1	171.0	65.4%	2	K.GHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.349.349.3	42.3913	0.305116	1855.72	1855.06	1	169.0	54.9%	1	K.GHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.356.356.2	54.8855	0.497817	1662.66	1660.87	1	2.0	84.0%	2	H.HEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.310.310.1	36.7013	0.345957	952.44	953.087	1	216.0	78.6%	1	K.PLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1111.1111.2	73.6277	0.509915	2602.1	2603.13	1	208.0	88.9%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1109.1109.3	51.619	0.411001	2603.53	2603.13	1	94.0	72.3%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1097.1097.3	39.0121	0.293247	1886.95	1886.2	1	197.0	53.2%	1	K.YLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1094.1094.2	77.5591	0.525306	1887.3	1886.2	1	222.0	88.5%	2	K.YLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1106.1106.1	64.7517	0.42063	1887.82	1886.2	1	164.0	95.8%	2	K.YLEFISDAIIHVLHSK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1052.1052.2	55.0611	0.445132	3369.6	3370.81	1	200.0	75.0%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1049.1049.3	55.5282	0.457929	3370.69	3370.81	1	216.0	66.7%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1101.1101.2	71.1643	0.496574	1611.24	1609.87	1	214.0	80.8%	1	L.EFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.639.639.1	45.2231	0.43182	1502.58	1503.64	1	173.0	81.0%	1	K.HPGDFGADAQGAMTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.642.642.3	59.2433	0.444367	1505.14	1503.64	1	255.0	60.9%	1	K.HPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.640.640.2	63.2358	0.500369	1505.38	1503.64	1	40.0	80.8%	1	K.HPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.787.787.1	36.2048	0.134624	1360.72	1361.58	1	45.0	72.2%	1	K.ALELFRNDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.937.937.2	47.1659	0.177936	2284.52	2284.62	1	212.0	62.1%	1	K.ALELFRNDIAAKYKELGFQG.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.689.689.2	42.8707	0.206498	942.38	942.059	1	168.0	84.6%	1	K.YKELGFQG.-	2

std_gi|122572|sp|P02070|HBB_BOVIN

95.2%

145

15954

7.6

HEMOGLOBIN BETA CHAIN gi|70412|pir||HBBOB hemoglobin beta chain - bovine gi|576143|pdb|1HDA|B Bos taurus gi|576145|pdb|1HDA|D Bos taurus gi|395 (X00376) beta-globin [Bos taurus] gi|162741 (M63453) beta-globin [Bos taurus] [MASS=15954]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.917.917.2	72.386	0.473165	1753.92	1754.06	1	214.0	78.6%	1	-.MLTAEEKAAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.766.766.1	39.0343	0.175834	950.79	951.113	1	91.0	92.3%	1	K.AAVTAFWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.776.776.2	54.199	0.393465	952.76	951.113	1	232.0	93.3%	1	K.AAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.669.669.1	49.7315	0.348863	1328.84	1329.5	1	168.0	90.0%	1	K.VKVDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.670.670.2	77.209	0.411047	1330.0	1329.5	1	236.0	90.9%	1	K.VKVDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.632.632.2	69.1014	0.337661	1102.62	1102.19	1	223.0	90.0%	1	K.VDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.677.677.2	41.0632	0.15168	887.38	887.969	1	226.0	72.2%	1	D.EVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.895.895.2	48.8856	0.29249	1275.96	1275.54	1	231.0	81.2%	1	R.LLVVYPWTQR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1169.1169.3	54.1485	0.409061	3348.55	3347.82	1	214.0	64.5%	1	R.LLVVYPWTQRFFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1170.1170.2	39.2823	0.225006	2761.2	2760.06	1	204.0	62.1%	1	Y.PWTQRFFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.939.939.2	81.8551	0.502889	2090.58	2091.31	1	247.0	80.6%	5	R.FFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.945.945.3	75.4724	0.451281	2091.79	2091.31	1	219.0	74.2%	1	R.FFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.709.709.1	38.3366	0.289956	1097.45	1098.26	1	74.0	87.5%	1	K.VLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.931.931.3	63.5463	0.511298	3194.02	3194.6	1	212.0	67.6%	1	K.HLDDLKGTFAALSELHCDKLHVDPENFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.680.680.1	41.1257	0.271215	1098.65	1099.23	1	171.0	92.3%	1	K.LHVDPENFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1070.1070.2	66.8384	0.412142	1267.9	1266.61	1	234.0	86.4%	1	K.LLGNVLVVVLAR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.852.852.1	49.1575	0.407992	1869.79	1870.12	1	40.0	72.0%	1	R.NFGKEFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.850.850.2	83.0714	0.572634	1870.06	1870.12	1	185.0	92.6%	1	R.NFGKEFTPVLQADFQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1149.1149.3	49.882	0.414424	3330.76	3329.79	1	178.0	64.1%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.829.829.1	44.0746	0.397907	1422.66	1423.61	1	179.0	78.9%	1	K.EFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.832.832.1	48.8338	0.381951	1045.79	1046.21	1	213.0	92.9%	1	T.PVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.685.685.2	75.7945	0.450736	1178.9	1178.38	1	122.0	100.0%	1	K.VVAGVANALAHR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.710.710.2	69.3296	0.483722	1478.84	1478.7	1	120.0	84.0%	1	K.VVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.707.707.3	45.3617	0.337115	1480.09	1478.7	1	189.0	62.2%	1	K.VVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.696.696.2	56.3412	0.286219	980.72	980.116	1	236.0	93.8%	1	V.AGVANALAHR.Y	2

std_gi|122361|sp|P01966|HBA_BOVIN

91.5%

141

15053

8.4

HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.249.249.1	37.5333	0.100054	703.59	703.814	1	237.0	91.7%	1	-.VLSAADK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.278.278.1	49.0956	0.157813	1101.62	1102.28	1	209.0	93.8%	2	-.VLSAADKGNVK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.281.281.2	49.7811	0.27352	1102.62	1102.28	1	79.0	77.8%	1	-.VLSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.675.675.1	51.1047	0.437739	1529.73	1530.64	1	172.0	81.8%	1	K.VGGHAAEYGAEALER.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.671.671.2	72.8971	0.517688	1531.3	1530.64	1	253.0	87.5%	1	K.VGGHAAEYGAEALER.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.676.676.3	48.3029	0.178092	1531.33	1530.64	1	247.0	63.8%	1	K.VGGHAAEYGAEALER.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.861.861.2	45.3367	0.11636	1073.02	1072.31	1	227.0	85.7%	1	R.MFLSFPTTK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.865.865.1	36.2059	0.173814	1074.59	1072.31	1	180.0	78.6%	1	R.MFLSFPTTK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.782.782.1	60.8681	0.550297	1833.78	1835.03	1	83.0	87.0%	2	K.TYFPHFDLSHGSAQVK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.779.779.2	66.0048	0.516185	1834.72	1835.03	1	23.0	88.5%	1	K.TYFPHFDLSHGSAQVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.780.780.3	49.0287	0.417149	1836.22	1835.03	1	202.0	64.0%	1	K.TYFPHFDLSHGSAQVK.G	3
*2	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.280.280.1	38.7064	0.0268088	675.68	673.831	1	170.0	100.0%	1	K.VAAALTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.879.879.2	86.8138	0.472633	2367.96	2368.61	1	178.0	90.3%	1	K.AVEHLDDLPGALSELSDLHAHK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.880.880.3	79.7881	0.538164	2370.16	2368.61	1	253.0	69.1%	1	K.AVEHLDDLPGALSELSDLHAHK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.869.869.2	92.0881	0.543312	2636.82	2637.96	1	214.0	93.3%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.870.870.3	74.7218	0.518734	2638.36	2637.96	1	124.0	73.8%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.721.721.2	47.7905	0.342659	1088.7	1088.3	1	206.0	92.3%	1	K.LRVDPVNFK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1020.1020.2	62.8788	0.468749	2970.3	2971.43	1	52.0	70.0%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1019.1019.3	72.8086	0.507973	2971.51	2971.43	1	230.0	74.3%	2	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1240.1240.3	69.5215	0.523684	4231.87	4232.91	1	59.0	65.2%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.851.851.2	65.8458	0.30841	1281.66	1280.51	1	203.0	86.4%	1	K.FLANVSTVLTSK.Y	2

std_sp|P00698|LYC_CHICK

80.6%

129

14313

9.0

Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.604.604.1	39.1991	0.207809	836.57	837.051	1	218.0	84.6%	1	R.CELAAAMK.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.540.540.2	56.0614	0.311374	993.8	993.238	1	221.0	86.7%	1	R.CELAAAMKR.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.299.299.2	51.7071	0.258164	875.44	874.932	1	215.0	100.0%	1	R.HGLDNYR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.836.836.2	44.8078	0.355637	2125.38	2125.38	1	2.0	66.7%	1	R.HGLDNYRGYSLGNWVCAAK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.650.650.2	60.8061	0.486616	1429.56	1429.49	1	250.0	86.4%	1	K.FESNFNTQATNR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.805.805.2	78.3018	0.489475	1754.84	1754.85	1	244.0	92.0%	1	R.NTDGSTDYGILQINSR.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1079.1079.2	104.259	0.641291	2337.8	2338.73	1	171.0	90.6%	7	R.NLCNIPCSALLSSDITASVNCAK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.999.999.2	69.5467	0.524336	2465.9	2466.91	1	152.0	78.1%	2	R.NLCNIPCSALLSSDITASVNCAKK.I	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.847.847.2	91.0454	0.564886	1806.76	1805.07	1	187.0	92.3%	1	K.KIVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.910.910.2	60.6847	0.255378	1677.92	1676.9	1	186.0	70.4%	1	K.IVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.767.767.2	58.8126	0.240185	1046.7	1046.17	1	172.0	93.3%	1	K.GTDVQAWIR.G	2

std_gi|2190337|gnl|PID|e321614

72.7%

607

69324

6.2

(X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.223.223.1	38.2432	0.378766	1193.62	1194.29	1	152.0	87.5%	2	R.DTHKSEIAHR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.205.205.2	56.8498	0.417294	1194.28	1194.29	1	153.0	88.2%	5	R.DTHKSEIAHR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.635.635.1	46.0359	0.327379	1249.64	1250.4	1	226.0	86.7%	1	R.FKDLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.636.636.2	65.8764	0.321026	1250.54	1250.4	1	216.0	100.0%	1	R.FKDLGEEHFK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1145.1145.3	50.1991	0.46497	4812.7	4813.53	1	156.0	62.5%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1129.1129.2	72.5643	0.476199	2436.22	2436.84	1	201.0	81.5%	1	K.GLVLIAFSQYLQQCPFDEHVK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1181.1181.3	47.5733	0.320266	3581.65	3582.16	1	229.0	66.7%	1	K.GLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.814.814.2	57.1295	0.251017	1164.62	1164.34	1	187.0	88.9%	1	K.LVNELTEFAK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.270.270.1	48.5165	0.460551	1349.59	1350.47	1	216.0	84.2%	1	K.TCVADESHAGCEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.831.831.1	55.2263	0.539615	1362.68	1363.58	1	244.0	88.9%	1	K.SLHTLFGDELCK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.835.835.2	60.5233	0.441771	1363.88	1363.58	1	46.0	81.8%	1	K.SLHTLFGDELCK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.450.450.1	36.0616	0.0920666	886.43	886.934	1	186.0	83.3%	1	K.DDSPDLPK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1076.1076.3	45.2614	0.393162	4343.95	4344.98	1	90.0	63.6%	1	R.RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.367.367.2	44.7435	0.128992	848.06	848.033	1	30.0	100.0%	1	R.LSQKFPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.634.634.1	43.683	0.233484	922.68	923.054	1	224.0	100.0%	1	K.AEFVEVTK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.637.637.2	53.8103	0.310957	923.6	923.054	1	211.0	100.0%	1	K.AEFVEVTK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.584.584.1	35.0314	0.151989	789.68	789.948	1	207.0	81.8%	1	K.LVTDLTK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.714.714.2	50.0527	0.365971	2441.8	2442.76	1	87.0	64.5%	1	K.VHKECCHGDLLECADDRADLAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.622.622.1	37.2267	0.471995	1386.61	1387.51	1	169.0	72.2%	1	K.YICDNQDTISSK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.626.626.2	71.1827	0.527092	1387.74	1387.51	1	143.0	95.0%	1	K.YICDNQDTISSK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.620.620.1	41.2669	0.297649	1418.62	1419.75	1	104.0	77.8%	1	K.LKECCDKPLLEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.621.621.2	58.8423	0.383307	1419.8	1419.75	1	244.0	85.0%	1	K.LKECCDKPLLEK.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.630.630.3	41.9713	0.202771	1420.33	1419.75	1	181.0	59.0%	1	K.LKECCDKPLLEK.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.353.353.1	41.4493	0.202448	1015.53	1016.16	1	228.0	85.7%	1	K.SHCIAEVEK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.911.911.3	76.4799	0.583879	3398.86	3399.82	1	240.0	73.8%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.889.889.3	42.3091	0.329671	4133.08	4133.6	1	228.0	60.7%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAK.D	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1026.1026.1	38.1141	0.200045	1567.74	1568.73	1	136.0	73.7%	1	K.DAFLGSFLYEYSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.744.744.2	59.9955	0.48308	1441.2	1440.69	1	164.0	86.4%	1	R.RHPEYAVSVLLR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.752.752.3	48.3442	0.223763	1441.69	1440.69	1	233.0	65.8%	1	R.RHPEYAVSVLLR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.906.906.3	38.2211	0.28594	3421.96	3422.88	1	208.0	56.4%	1	R.LAKEYEATLEECCAKDDPHACYSTVFDKLK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.724.724.1	42.0054	0.305117	1305.72	1306.51	1	205.0	81.2%	1	K.HLVDEPQNLIK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.725.725.2	61.2466	0.480725	1308.14	1306.51	1	190.0	88.9%	1	K.HLVDEPQNLIK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.811.811.2	76.7163	0.443299	2299.84	2299.57	1	225.0	89.3%	1	K.HLVDEPQNLIKQNCDQFEK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1044.1044.3	52.2706	0.462404	3760.54	3761.25	1	174.0	65.0%	1	K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.959.959.2	48.8654	0.406077	2473.0	2473.77	1	37.0	64.3%	1	K.QNCDQFEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.881.881.1	36.2	0.289913	1479.68	1480.71	1	136.0	70.0%	1	K.LGEYGFQNALIVR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.882.882.2	69.8211	0.522435	1481.72	1480.71	1	234.0	82.6%	1	K.LGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.749.749.1	36.4322	0.342982	1639.92	1640.92	1	16.0	69.6%	1	R.KVPQVSTPTLVEVSR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.745.745.2	66.2781	0.52747	1640.64	1640.92	1	106.0	87.5%	1	R.KVPQVSTPTLVEVSR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.751.751.3	45.7976	0.275194	1641.16	1640.92	1	252.0	65.3%	1	R.KVPQVSTPTLVEVSR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1050.1050.2	76.0292	0.486868	1668.92	1668.97	1	246.0	95.7%	1	R.MPCTEDYLSLILNR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.445.445.2	47.5733	0.180082	842.54	842.05	1	244.0	100.0%	1	R.LCVLHEK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.657.657.2	59.555	0.436529	1484.22	1483.77	1	252.0	86.4%	1	R.LCVLHEKTPVSEK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.799.799.2	50.6921	0.348183	1825.74	1825.09	1	153.0	64.3%	1	R.RPCFSALTPDETYVPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.941.941.2	95.6942	0.631359	2441.8	2442.75	1	201.0	86.2%	1	K.AFDEKLFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.920.920.2	67.5318	0.500838	2811.82	2812.22	1	201.0	78.6%	1	K.AFDEKLFTFHADICTLPDTEKQIK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.912.912.1	64.7564	0.469459	1850.74	1852.12	1	138.0	91.7%	1	K.LFTFHADICTLPDTEK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.909.909.2	84.3468	0.55087	1852.1	1852.12	1	250.0	96.3%	1	K.LFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.770.770.1	38.9355	0.182717	1142.76	1143.41	1	169.0	81.2%	1	K.KQTALVELLK.H	1
*2	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.238.238.1	35.1644	0.135635	818.59	818.903	1	156.0	90.9%	1	K.ATEEQLK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1134.1134.2	73.6449	0.562302	2199.94	2200.52	1	178.0	82.1%	1	K.ATEEQLKTVMENFVAFVDK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1142.1142.3	56.7911	0.44442	2201.83	2200.52	1	247.0	63.8%	1	K.ATEEQLKTVMENFVAFVDK.C	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1220.1220.3	57.1223	0.545489	3938.41	3939.5	1	107.0	65.1%	1	K.ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1175.1175.2	54.7826	0.306661	3138.04	3139.62	1	217.0	65.5%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1174.1174.3	52.7543	0.372975	3138.76	3139.62	1	224.0	66.2%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1177.1177.3	67.1972	0.471975	2939.5	2939.38	1	237.0	73.3%	1	V.MENFVAFVDKCCAADDKEACFAVEGPK.L	3

std_tr|Q865Y7

64.2%

260

29114

6.9

Carbonic anhydrase II (EC 4.2.1.1) - Bos taurus (Bovine).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.654.654.2	71.6736	0.575215	2141.66	2142.3	1	163.0	85.7%	1	K.HNGPEHWHKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.434.434.2	50.3688	0.437624	1284.8	1284.42	1	224.0	80.0%	1	W.HKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.512.512.2	47.125	0.26251	1005.06	1003.1	1	49.0	100.0%	2	R.QSPVDIDTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.521.521.1	44.4316	0.225266	874.65	874.967	1	222.0	84.6%	1	Q.SPVDIDTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.517.517.1	44.316	0.210422	787.66	787.889	1	231.0	90.9%	1	S.PVDIDTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.961.961.2	65.7762	0.45047	2199.94	2199.56	1	132.0	75.0%	1	K.AVVQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.964.964.3	49.3874	0.327655	2201.83	2199.56	1	254.0	65.0%	1	K.AVVQDPALKPLALVYGEATSR.R	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.971.971.2	57.0366	0.435407	2029.46	2029.34	1	134.0	65.6%	1	V.VQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.967.967.1	55.3902	0.502031	1276.66	1277.46	1	71.0	94.4%	1	K.PLALVYGEATSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.600.600.2	51.9421	0.326194	1067.7	1067.19	1	205.0	73.7%	1	L.ALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.756.756.1	52.7923	0.371121	1581.81	1582.8	1	120.0	93.3%	1	K.YAAELHLVHWNTK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1066.1066.2	70.204	0.53045	2255.12	2254.55	1	157.0	77.1%	1	K.YGDFGTAAQQPDGLAVVGVFLK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.339.339.2	59.8789	0.367096	1014.9	1013.14	1	217.0	88.9%	1	K.VGDANPALQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.775.775.1	40.5571	0.285551	973.64	974.143	1	172.0	85.7%	1	K.VLDALDSIK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1392.1392.3	38.1471	0.305001	4532.89	4533.29	1	70.0	48.8%	1	L.PNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1390.1390.2	38.5765	0.164986	3381.26	3381.01	1	196.0	44.4%	1	Y.PGSLTTPPLLESVTWIVLKEPISVSSQQMLK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.815.815.2	61.6824	0.499607	1800.62	1801.2	1	163.0	84.0%	1	W.IVLKEPISVSSQQMLK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.820.820.3	62.6515	0.451362	1803.55	1801.2	1	219.0	74.0%	1	W.IVLKEPISVSSQQMLK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.734.734.1	40.768	0.275511	1346.7	1347.58	1	178.0	68.4%	1	K.EPISVSSQQMLK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1064.1064.2	56.881	0.373683	2854.08	2854.3	1	93.0	70.4%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1065.1065.3	39.0519	0.222889	2855.32	2854.3	1	185.0	45.7%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	3

std_gi|1168350|sp|P00330|ADH1_YEAST

58.3%

348

36823

6.7

ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.619.619.1	40.9672	0.349811	1136.59	1137.28	1	208.0	85.7%	1	K.GVIFYESHGK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.624.624.2	48.1017	0.328021	1137.64	1137.28	1	196.0	100.0%	1	K.GVIFYESHGK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.761.761.2	55.0284	0.254726	1014.24	1014.21	1	252.0	82.4%	1	K.ANELLINVK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.762.762.1	38.4118	0.0475336	1016.48	1014.21	1	136.0	92.9%	2	K.ANELLINVK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.824.824.2	91.5702	0.579266	2021.08	2020.36	1	253.0	82.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.827.827.3	46.1301	0.225835	2022.67	2020.36	1	109.0	52.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.614.614.2	44.8667	0.235875	838.04	836.964	1	205.0	84.6%	1	K.IGDYAGIK.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.986.986.2	59.9826	0.309433	3013.38	3014.52	1	125.0	67.6%	1	K.ALKSANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1034.1034.2	94.293	0.549203	2701.16	2702.11	1	174.0	85.7%	11	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.804.804.2	70.2778	0.449122	1619.38	1619.82	1	104.0	77.8%	1	R.VLGIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.807.807.3	37.6125	0.223585	1622.32	1619.82	1	187.0	44.7%	1	R.VLGIDGGEGKEELFR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.812.812.2	62.7271	0.512495	1407.94	1407.52	1	43.0	85.0%	1	L.GIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.949.949.1	49.1976	0.42209	1312.64	1313.49	1	216.0	83.3%	2	R.SIGGEVFIDFTK.E	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1059.1059.2	74.4819	0.505282	2366.32	2366.76	1	145.0	86.2%	2	R.SIGGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1072.1072.3	42.2639	0.26399	2369.47	2366.76	1	143.0	54.0%	1	R.SIGGEVFIDFTKEKDIVGAVLK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1067.1067.2	69.7111	0.419143	2166.16	2166.52	1	58.0	80.0%	1	I.GGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.722.722.2	47.354	0.107134	1073.02	1072.29	1	120.0	83.3%	1	K.EKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.784.784.1	35.7955	0.202537	814.69	815.001	1	210.0	78.6%	1	K.DIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.786.786.2	39.6792	0.127727	815.62	815.001	1	204.0	84.6%	1	K.DIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.846.846.2	92.5054	0.575535	2312.98	2313.49	1	213.0	85.7%	3	K.ATDGGAHGVINVSVSEAAIEASTR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.839.839.3	38.3988	0.201209	2313.61	2313.49	1	211.0	48.5%	1	K.ATDGGAHGVINVSVSEAAIEASTR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.739.739.2	50.3211	0.31042	1388.18	1387.64	1	236.0	72.0%	1	R.ANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.740.740.1	42.2832	0.231905	1389.64	1387.64	1	206.0	72.7%	2	R.ANGTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.789.789.1	35.2107	0.331799	1251.72	1252.41	1	66.0	72.2%	1	K.SISIVGSYVGNR.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.771.771.2	66.7166	0.38059	1252.66	1252.41	1	231.0	95.0%	1	K.SISIVGSYVGNR.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.845.845.2	41.4116	0.186247	969.64	969.085	1	156.0	92.3%	1	R.EALDFFAR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.580.580.1	38.0641	0.240711	841.81	842.07	1	235.0	84.6%	1	R.GLVKSPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.919.919.2	67.4166	0.504611	2271.2	2271.75	1	248.0	71.9%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.915.915.3	57.4076	0.447208	2272.75	2271.75	1	236.0	62.5%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.904.904.1	53.5894	0.454101	1872.91	1874.23	1	162.0	84.0%	1	K.SPIKVVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.905.905.3	43.7661	0.231424	1874.71	1874.23	1	160.0	56.9%	1	K.SPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.901.901.2	95.6016	0.606102	1875.28	1874.23	1	249.0	96.2%	1	K.SPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.874.874.1	46.2227	0.364845	1447.8	1448.7	1	189.0	73.7%	1	K.VVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.875.875.2	61.3315	0.32601	1448.96	1448.7	1	207.0	90.0%	1	K.VVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.876.876.1	39.6259	0.269527	1249.64	1250.43	1	186.0	64.7%	1	V.GLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.313.313.1	39.3421	0.154944	811.59	811.91	1	236.0	91.7%	2	R.YVVDTSK.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.295.295.2	44.5286	0.231086	812.68	811.91	1	161.0	100.0%	1	R.YVVDTSK.-	2

	Proteins	Peptide IDs	Copies
Unfiltered	2455	2260	3709
Redundant	7	220	264
Nonredundant	7	220	264

/home/51n/myMS/article/dbdigger/nathanPSM/nonTryptic/simple2