HIV-1 ENV PROTEIN STRUCTURES INDEX

---

Tutorials and Museum Exhibits

(Please CHECK to make sure you have installed the CHIME plug-in into your browser and that it is functioning, before proceding)
A troubleshooting guide is available.

A tutorial on HIV-1 gp120 and Influenza hemaglutinin structure/function from the Online Macromolecular Museum at California Lutheran University.

---

PDB Structure Entries

Use the buttons below each entry in the list to get the PubMed entry, protein structure database (PDB) entry, open a Protein Explorer session with the entry, or get the NCBI entry (allowing Cn3D viewing) of the entry.

1G9M: Nature 1998 Jun 18;393(6686):648-59.

HIV-1 (clone HXB2) gp120 (with variable loops replaced by short linker peptides) bound to neutralizing antibody 17B and CD4 receptor.

1G9N: Nature 1998 Jun 18;393(6686):648-59.

HIV-1 (clone YU-2) gp120 (with vairable loops replaced by short linker peptides) bound to neutralizing antibody 17B and CD4 receptor.

1GC1: Nature 1998 Jun 18;393(6686):648-59.

HIV-1 (clone HXB2 with K403E mutation) gp120 (with vairable loops replaced by short linker peptides) bound to neutralizing antibody 17B and CD4 receptor. K403E is position 232 in this structure.

1QBZ: J Struct Biol 1999 Jun 15;126(2):131-44.

HIV-1 gp41 ectodomain core, trimer of 2 helices each at 1.47 Angstoms.

1AIK: Cell 1997 Apr 18;89(2):263-73.

HIV-1 gp41 ectodomain core.

1ENV: Cell 1997 Apr 18;89(2):263-73.

HIV-1 gp41 ectodomain core.

1SZT: Cell 1997 Apr 18;89(2):263-73.

HIV-1 gp41 ectodomain core.

1I5Y: J Virol 2001 Nov;75(22):11146-56.

HIV-1 gp41 ectodomain core.

1I5X: J Virol 2001 Nov;75(22):11146-56.

HIV-1 gp41 ectodomain coree.

1JQ0: J Biol Chem 2002 Apr 12;277(15):12891-900.

SIV in vitro-derived variant of SIVmac251, denoted CPmac, gp41 ectodomain core.

1JPX: J Biol Chem 2002 Apr 12;277(15):12891-900.

SIVmac251, gp41 ectodomain core.

1ACY: Science. 1994 Apr 1;264(5155):82-5.

Crystal structure of the principal neutralization site (YNKRKRIHIGPGRAFYTTKNIIGC; 301-325 in HXB2 gp160) of HIV-1 (clone MN), bound to antibody.

1F58: Structure Fold Des. 1999 Feb 15;7(2):131-42.

Crystal structure of the principal neutralization site (YNKRKRIHIGPGRXFYTTKNIIGC; 301-325 in HXB2 gp160) of HIV-1 (clone MN with Ala To AIB (ALPHA-AMINOISOBUTYRIC ACID) substitution at position 315), bound to antibody. Position 315 in HXB2 gp160 is 323 in MN.

2F58: Structure Fold Des. 1999 Feb 15;7(2):131-42.

Crystal structure of a cyclic peptide (-HIGPGRAFGGG-; 308-320 in HXB2 gp160) of HIV-1 (clone MN) bound to antibody.

3F58: Structure Fold Des. 1999 Feb 15;7(2):131-42.

Crystal structure of a cyclic peptide (-SIGPGRAFGGG-; 308-320 in HXB2 gp160) of HIV-1 (clone MN with H308S mutation) bound to antibody.

1B03: Biochemistry. 1997 Jul 15;36(28):8619-27. Nat Struct Biol. 1999 Apr;6(4):331-5.

Crystal structure of the principal neutralization site (XKSIRIQRGPGRAFVTIG; 304-321 in HXB2 gp160) of HIV-1 (clone HXB2 with Arg to Ser substitution at position 306), bound to antibody.

1CE4: FEBS Lett 1995 Oct 23;374(1):117-21

Conformational model of HIV-1 (consensus) V3 loop (CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC), 20 NMR structures. Cysteines linked with disulfide bond.

1GGI: Proteins 1992 Dec;14(4):499-508

Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, IgG2 Fab Fragment (50.1) in complex with its V3 loop peptide antigen (CKRIHIGPGRAFYTTC).

1GGB: Proteins 1992 Dec;14(4):499-508

Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, IgG2 Fab Fragment (50.1).

1GGC: Proteins 1992 Dec;14(4):499-508

Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, IgG2 Fab Fragment (50.1).

1QNZ: Proteins 1992 Dec;14(4):499-508.

NMR minimized average structure of a neutralizing antibody 0.5B, complexed with a HIV-1 (clone LAI, same as HXB2 except for R306S mutation) V3 peptide (RKSIRIQRGPGRAFVTIG).

1HHG: Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3429-33. J Mol Biol. 1985 Nov 5;186(1):205-10. J Mol Biol. 1991 May 20;219(2):277-319. Nature. 1987 Oct 8-14;329(6139):512-8. Cell. 1992 Sep 18;70(6):1035-48. Nature. 1987 Oct 8-14;329(6139):506-12.

Human class I histocompatibility antigen (Hla-A 0201) in complex with a 9 amino acid HIV-1 gp120 env peptide (TLTSCNTSV; residues 192-200 in HXB2).

1MEQ: Eur J Biochem 2002 Oct;269(19):4860-7.

NMR minimized average structure of HIV gp120 C5 domain (VKIEPLGVAPTKTKRRVVQREKR), (residues 489-511 in gp160 of clone HXB2).

1NIZ: Structure (Camb). 2003 Feb;11(2):225-36.

HIV-1 (Mn Isolate) V3 Peptide Bound to A Human Neutralizing Antibody 447-52D, NMR minimized average structure of V3 only, not Antibody.

1NJ0: Structure (Camb). 2003 Feb;11(2):225-36.

HIV-1 (Mn Isolate) V3 Peptide Bound to A Human Neutralizing Antibody 447-52D, NMR 29 structures of V3 only, not Antibody.

1DFB: Proc Natl Acad Sci U S A. 1992 Aug 1;89(15):7154-8. and J Mol Biol. 1990 Dec 5;216(3):511-2.

HIV-1 gp41 complexed with human monoclonal antibody Fab 3D6 fragment.

2SIV: Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9134-9. and Cell. 1997 Apr 18;89(2):263-73.

SIV-SMM gp41 core structure.

1JEK: Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9134-9. and Cell. 1997 Apr 18;89(2):263-73.

Visna Virus Envelope Transmembrane Region core structure.

---

Envelope-related Structures

1MG1: Proc Natl Acad Sci U S A. 1999 Apr 13;96(8):4319-24. Protein Sci. 1998 Jul;7(7):1612-9.

HTLV-I Env gp21 ectodomain.

2EBO: Proc Natl Acad Sci U S A. 1999 Mar 16;96(6):2662-7. Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9134-9. and Cell. 1997 Apr 18;89(2):263-73.

Visna Virus Envelope Transmembrane Region core structure.

---

Publications on Envelope Structures

The Glycosylation of Env
Zhu X, Borchers C, Bienstock RJ, Tomer KB.
Mass spectrometric characterization of the glycosylation pattern of HIV-gp120 expressed in CHO cells.
Biochemistry 2000 Sep 19;39(37):11194-204.
PMID: 10985765

The gp41 core domain and its role in virus/cell fusion
Yang ZN, Mueser TC, Kaufman J, Stahl SJ, Wingfield PT, Hyde CC.
The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
J Struct Biol 1999 Jun 15;126(2):131-44.
PMID: 10388624

Antibody neutralization and escape by HIV-1
Wei X, Decker JM, Wang S, Hui H, Kappes JC, Wu X, Salazar-Gonzalez JF, Salazar MG, Kilby JM, Saag MS, Komarova NL, Nowak MA, Hahn BH, Kwong PD, Shaw GM.
Antibody neutralization and escape by HIV-1.
Nature. 2003 Mar 20;422(6929):307-12.
PMID: 12646921

---