WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= SSH6F07.SEQ(1>529) (499 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 505,245 sequences; 158,518,215 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 3 Sequences : less than 3 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 787 163 |====================================================== 6310 624 116 |====================================== 3980 508 63 |===================== 2510 445 136 |============================================= 1580 309 103 |================================== 1000 206 70 |======================= 631 136 44 |============== 398 92 22 |======= 251 70 15 |===== 158 55 11 |=== 100 44 5 |= 63.1 39 9 |=== 39.8 30 3 |= 25.1 27 3 |= 15.8 24 0 | >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 24 <<<<<<<<<<<<<<<<< 10.0 24 0 | 6.31 24 0 | 3.98 24 0 | 2.51 24 1 |: 1.58 23 1 |: 1.00 22 0 | 0.63 22 0 | 0.40 22 0 | 0.25 22 0 | 0.16 22 0 | 0.10 22 0 | 0.063 22 0 | 0.040 22 0 | 0.025 22 0 | 0.016 22 1 |: 0.010 21 0 | 0.0063 21 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|7432998|pir||T05670pollen-specific protein homolog... +3 231 4.0e-23 2 gi|6573725|gb|AAF17645.1|AC009978_21(AC009978) T23E18... +3 271 6.0e-22 1 gi|7432999|pir||T02910pollen-specific protein homolog... +3 210 3.0e-21 2 gi|1255951|emb|CAA65634.1|(X96932) PS60 [Nicotiana ta... +3 262 5.7e-21 1 gi|2961346|emb|CAA18104.1|(AL022140) pectinesterase l... +3 254 4.3e-20 1 gi|5263337|gb|AAD41439.1|AC007727_28(AC007727) Strong... +3 238 3.9e-19 1 gi|6552745|gb|AAF16544.1|AC013482_18(AC013482) T26F17... +3 238 2.5e-18 1 gi|6552744|gb|AAF16543.1|AC013482_17(AC013482) T26F17... +3 234 6.4e-18 1 gi|4105800|gb|AAD02557.1|(AF049931) PGPS/NH15 [Petuni... +3 141 1.0e-12 2 gi|7432997|pir||T07129pollen-specific protein homolog... +3 181 3.1e-12 1 gi|128592|sp|P29162|NTP3_TOBACPOLLEN-SPECIFIC PROTEIN... +3 147 1.7e-08 1 gi|7432991|pir||T01152pollen-specific protein homolog... +3 140 9.3e-08 1 gi|2464865|emb|CAB16759.1|(Z99707) pectinesterase lik... +3 136 2.5e-07 1 gi|4204257|gb|AAD10638.1|(AC005223) 5493 [Arabidopsis... +3 132 7.0e-07 1 gi|6179398|emb|CAB59910.1|(AJ249211) BNH protein [Ara... +3 131 8.8e-07 1 gi|4204258|gb|AAD10639.1|(AC005223) 14409 [Arabidopsi... +3 131 9.0e-07 1 gi|114268|sp|Q00624|ASO_BRANAL-ASCORBATE OXIDASE HOMO... +3 126 3.1e-06 1 gi|99809|pir||S24950pollen-specific protein Bp10 (clo... +3 126 3.1e-06 1 gi|99808|pir||S24951pollen-specific protein Bp10 (clo... +3 125 4.0e-06 1 gi|99807|pir||S24949pollen-specific protein Bp10 (clo... +3 123 6.5e-06 1 gi|7433001|pir||T07634pollen-specific protein homolog... +3 96 0.0053 2 gi|6721119|gb|AAF26773.1|AC007396_22(AC007396) T4O12.... +3 105 0.011 1 gi|7433000|pir||T05545pollen-specific protein homolog... +3 89 0.72 1 gi|6114698|emb|CAB59415.1|(AJ389993) T cell receptor ... +3 65 0.83 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|7432998 | _________________ gi|6573725 |_____________________ gi|7432999 | ________________ gi|1255951 | ____________________ gi|2961346 | ____________________ gi|5263337 | ___________________ gi|6552745 | ___________________ gi|6552744 | ___________________ gi|4105800 | _______________ gi|7432997 | _______________ gi|128592 |___________________ gi|7432991 | ___________________ gi|2464865 | ___________________ gi|4204257 | __________________ gi|6179398 | _______________ gi|4204258 | _______________ gi|114268 | ________________ gi|99809 | ________________ gi|99808 | ________________ gi|99807 | ________________ gi|7433001 | ___________________ gi|6721119 | ________________ gi|7433000 | ________________ gi|6114698 | _____________________ __________________________________________________ Query sequence: | | | | | 167 0 50 100 150 Locus_ID Frame 2 Hits gi|7432998 |_____ gi|7432999 |_____ gi|4105800 |_____ gi|7433001 |_____ __________________________________________________ Query sequence: | | | | | 167 0 50 100 150
Use the and icons to retrieve links to Entrez:
>gi|7432998|pir||T05670 pollen-specific protein homolog F22I13.190 - Arabidopsis thaliana >gi|4539350|emb|CAB37498.1| (AL035539) putative pectinesterase [Arabidopsis thaliana] >gi|7270826|emb|CAB80507.1| (AL161593) putative pectinesterase [Arabidopsis thaliana] Length = 548 Frame 3 hits (HSPs): _____ Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 548 0 150 300 450 Plus Strand HSPs: Score = 231 (81.3 bits), Expect = 4.0e-23, Sum P(2) = 4.0e-23 Identities = 40/52 (76%), Positives = 47/52 (90%), Frame = +3 Query: 51 MWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTRP 206 MWNLRSE+WARQYLGQQFY+RVY+ + S+RDEY +PKNALLCGRAS +HT P Sbjct: 497 MWNLRSEYWARQYLGQQFYLRVYSPTHSLRDEYLLPKNALLCGRASNKHTTP 548 Score = 75 (26.4 bits), Expect = 4.0e-23, Sum P(2) = 4.0e-23 Identities = 12/15 (80%), Positives = 15/15 (100%), Frame = +2 Query: 5 PKSWTAIYIALDNVG 49 P+SWTA+Y+ALDNVG Sbjct: 482 PESWTAVYVALDNVG 496 >gi|6573725|gb|AAF17645.1|AC009978_21 (AC009978) T23E18.10 [Arabidopsis thaliana] Length = 541 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 541 0 150 300 450 Plus Strand HSPs: Score = 271 (95.4 bits), Expect = 6.0e-22, P = 6.0e-22 Identities = 50/68 (73%), Positives = 55/68 (80%), Frame = +3 Query: 6 PSHGLLYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRA 185 PS ++ L MWNLRSEFWARQYLGQQ Y+RVYT STS+RDEYP+PKNALLCGRA Sbjct: 474 PSSWTAILIALDNVGMWNLRSEFWARQYLGQQLYLRVYTPSTSLRDEYPIPKNALLCGRA 533 Query: 186 SGRHTRPL 209 SGR TRPL Sbjct: 534 SGRSTRPL 541 >gi|7432999|pir||T02910 pollen-specific protein homolog T13J8.200 - Arabidopsis thaliana >gi|4455368|emb|CAB36778.1| (AL035524) pectinesterase like protein [Arabidopsis thaliana] >gi|7269663|emb|CAB79611.1| (AL161572) pectinesterase like protein [Arabidopsis thaliana] Length = 547 Frame 3 hits (HSPs): ______ Frame 2 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | 547 0 150 300 450 Plus Strand HSPs: Score = 210 (73.9 bits), Expect = 3.0e-21, Sum P(2) = 3.0e-21 Identities = 36/49 (73%), Positives = 45/49 (91%), Frame = +3 Query: 51 MWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRH 197 MWNLRS+FWARQYLGQQFY+RV++ + S +DEYP+PKNALLCGRAS ++ Sbjct: 493 MWNLRSQFWARQYLGQQFYLRVHSPNHSPKDEYPLPKNALLCGRASNKN 541 Score = 79 (27.8 bits), Expect = 3.0e-21, Sum P(2) = 3.0e-21 Identities = 13/15 (86%), Positives = 15/15 (100%), Frame = +2 Query: 5 PKSWTAIYIALDNVG 49 PKSWTA+Y+ALDNVG Sbjct: 478 PKSWTAVYVALDNVG 492 >gi|1255951|emb|CAA65634.1| (X96932) PS60 [Nicotiana tabacum] Length = 540 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 540 0 150 300 450 Plus Strand HSPs: Score = 262 (92.2 bits), Expect = 5.7e-21, P = 5.7e-21 Identities = 47/63 (74%), Positives = 54/63 (85%), Frame = +3 Query: 21 LYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHT 200 +YI L MWNLR+EFWARQYLGQQ YMRVYTTSTS+RDEYP+P+NA LCG+ +GRHT Sbjct: 479 IYIA-LDNVGMWNLRTEFWARQYLGQQLYMRVYTTSTSLRDEYPIPRNARLCGKVAGRHT 537 Query: 201 RPL 209 RPL Sbjct: 538 RPL 540 >gi|2961346|emb|CAA18104.1| (AL022140) pectinesterase like protein [Arabidopsis thaliana] >gi|7269046|emb|CAB79156.1| (AL161556) pectinesterase like protein [Arabidopsis thaliana] Length = 541 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 541 0 150 300 450 Plus Strand HSPs: Score = 254 (89.4 bits), Expect = 4.3e-20, P = 4.3e-20 Identities = 47/62 (75%), Positives = 52/62 (83%), Frame = +3 Query: 21 LYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHT 200 +YI L MWN+RSE WARQYLGQQFY+RVYT+STS RDEYP PKNAL+CGRA GRHT Sbjct: 480 IYIA-LDNVGMWNIRSENWARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRAKGRHT 538 Query: 201 RP 206 RP Sbjct: 539 RP 540 >gi|5263337|gb|AAD41439.1|AC007727_28 (AC007727) Strong similarity to gb|X96932 ascorbate oxidase-related protein PS60 from Nicotiana tabacum and is a member of the PF|00394 Multicopper oxidase family. This gene is cut off. [Arabidopsis thaliana] Length = 359 Frame 3 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 359 0 150 300 Plus Strand HSPs: Score = 238 (83.8 bits), Expect = 3.9e-19, P = 3.9e-19 Identities = 44/60 (73%), Positives = 49/60 (81%), Frame = +3 Query: 21 LYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHT 200 +Y+ L MWNLRSE W RQYLGQQFYMRVYT STS+RDEY +PKNALLCGRA+G HT Sbjct: 288 IYV-SLDNVGMWNLRSELWERQYLGQQFYMRVYTPSTSLRDEYLIPKNALLCGRATGHHT 346 >gi|6552745|gb|AAF16544.1|AC013482_18 (AC013482) T26F17.6 [Arabidopsis thaliana] Length = 551 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 551 0 150 300 450 Plus Strand HSPs: Score = 238 (83.8 bits), Expect = 2.5e-18, P = 2.5e-18 Identities = 44/60 (73%), Positives = 49/60 (81%), Frame = +3 Query: 21 LYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHT 200 +Y+ L MWNLRSE W RQYLGQQFYMRVYT STS+RDEY +PKNALLCGRA+G HT Sbjct: 480 IYV-SLDNVGMWNLRSELWERQYLGQQFYMRVYTPSTSLRDEYLIPKNALLCGRATGHHT 538 >gi|6552744|gb|AAF16543.1|AC013482_17 (AC013482) T26F17.7 [Arabidopsis thaliana] Length = 538 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 538 0 150 300 450 Plus Strand HSPs: Score = 234 (82.4 bits), Expect = 6.4e-18, P = 6.4e-18 Identities = 44/59 (74%), Positives = 48/59 (81%), Frame = +3 Query: 21 LYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRH 197 +YI L MWN+RSE W RQYLGQQFYMRVYTTSTS+RDEY +PKNALLCGRAS H Sbjct: 480 IYIA-LDNVGMWNMRSEIWERQYLGQQFYMRVYTTSTSLRDEYLIPKNALLCGRASSSH 537 >gi|4105800|gb|AAD02557.1| (AF049931) PGPS/NH15 [Petunia x hybrida] Length = 167 Frame 3 hits (HSPs): _______________ Frame 2 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 167 0 50 100 150 Plus Strand HSPs: Score = 141 (49.6 bits), Expect = 1.0e-12, Sum P(2) = 1.0e-12 Identities = 26/47 (55%), Positives = 31/47 (65%), Frame = +3 Query: 51 MWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASG 191 MWNLRS+ W + YLGQQ Y V + S S+RDEY +P N LCG G Sbjct: 112 MWNLRSDMWEKFYLGQQLYFSVLSPSGSLRDEYNLPDNHPLCGIVKG 158 Score = 49 (17.2 bits), Expect = 1.0e-12, Sum P(2) = 1.0e-12 Identities = 8/15 (53%), Positives = 9/15 (60%), Frame = +2 Query: 5 PKSWTAIYIALDNVG 49 P SW A+ LDN G Sbjct: 97 PNSWAAVMTTLDNAG 111 >gi|7432997|pir||T07129 pollen-specific protein homolog - tomato (fragment) >gi|1944575|emb|CAB08077.1| (Z94058) pectinesterase [Lycopersicon esculentum] Length = 504 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 504 0 150 300 450 Plus Strand HSPs: Score = 181 (63.7 bits), Expect = 3.1e-12, P = 3.1e-12 Identities = 35/48 (72%), Positives = 40/48 (83%), Frame = +3 Query: 21 LYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYT--TSTSIRDEYPVPK 161 +YI L MWNLR+EFWARQYLGQQ YMRVYT TSTS+RDEYP+P+ Sbjct: 457 IYIA-LDNVGMWNLRTEFWARQYLGQQLYMRVYTDSTSTSLRDEYPIPR 504 >gi|128592|sp|P29162|NTP3_TOBAC POLLEN-SPECIFIC PROTEIN NTP303 PRECURSOR >gi|82190|pir||S22495 pollen-specific protein precursor - common tobacco >gi|19902|emb|CAA43454.1| (X61146) pollen specific protein [Nicotiana tabacum] Length = 554 Frame 3 hits (HSPs): _______ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 554 0 150 300 450 __________________ Annotated Domains: DOMO DM00953: LACCASE 6..71 DOMO DM00645: MULTICOPPEROXIDASES 73..240 DOMO DM00873: MULTICOPPEROXIDASES 242..502 DOMO DM07265: 504..553 Entrez Domain: PLASTOCYANIN-LIKE 1. 22..143 Entrez Domain: PLASTOCYANIN-LIKE 2. 196..296 Entrez Domain: PLASTOCYANIN-LIKE 3. 411..521 Entrez glycosylation site: POTENTIAL. 31 Entrez glycosylation site: POTENTIAL. 59 Entrez glycosylation site: POTENTIAL. 108 Entrez glycosylation site: POTENTIAL. 332 Entrez glycosylation site: POTENTIAL. 352 Entrez glycosylation site: POTENTIAL. 423 PFAM Cu-oxidase: Multicopper oxidase 6..145 PRODOM PD126286: NTP3_TOBAC 1..28 PRODOM PD000573: LAC1(10) LAC2(7) NIR(6) 30..283 PRODOM PD007707: 286..543 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 189..196 __________________ Plus Strand HSPs: Score = 147 (51.7 bits), Expect = 1.7e-08, P = 1.7e-08 Identities = 28/62 (45%), Positives = 35/62 (56%), Frame = +3 Query: 6 PSHGLLYILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRA 185 P+ +L MWNLRSE W + YLG+Q Y V + S S+RDEY +P N LCG Sbjct: 484 PNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIV 543 Query: 186 SG 191 G Sbjct: 544 KG 545 >gi|7432991|pir||T01152 pollen-specific protein homolog F26B6.28 - Arabidopsis thaliana >gi|3152618|gb|AAC17097.1| (AC004482) putative pectinesterase [Arabidopsis thaliana] Length = 541 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 541 0 150 300 450 Plus Strand HSPs: Score = 140 (49.3 bits), Expect = 9.3e-08, P = 9.3e-08 Identities = 26/59 (44%), Positives = 37/59 (62%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTR 203 ++ L MWNLRS+ W+R+YLGQ+ Y+RV+ S+ E P N L CG+A +H R Sbjct: 483 LVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNNEKSLYTESEPPVNVLFCGKA--KHPR 539 >gi|2464865|emb|CAB16759.1| (Z99707) pectinesterase like protein [Arabidopsis thaliana] >gi|7270665|emb|CAB80382.1| (AL161590) pectinesterase like protein [Arabidopsis thaliana] Length = 541 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 541 0 150 300 450 Plus Strand HSPs: Score = 136 (47.9 bits), Expect = 2.5e-07, P = 2.5e-07 Identities = 27/61 (44%), Positives = 37/61 (60%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTRP 206 ++ L MWNLRS+ W+R+YLGQ+ Y+RV+ S+ E P N L CG+A RP Sbjct: 485 LVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEAEPPLNVLYCGKAK----RP 540 Query: 207 L 209 L Sbjct: 541 L 541 >gi|4204257|gb|AAD10638.1| (AC005223) 5493 [Arabidopsis thaliana] Length = 555 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 555 0 150 300 450 Plus Strand HSPs: Score = 132 (46.5 bits), Expect = 7.0e-07, P = 7.0e-07 Identities = 25/56 (44%), Positives = 34/56 (60%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGR 194 +L MWN+RSE R+YLGQQ Y V + S+RDEY +P+ +L CG G+ Sbjct: 491 LLTFDNCGMWNIRSENAERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGK 546 >gi|6179398|emb|CAB59910.1| (AJ249211) BNH protein [Arabidopsis thaliana] Length = 549 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 549 0 150 300 450 Plus Strand HSPs: Score = 131 (46.1 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 24/47 (51%), Positives = 31/47 (65%), Frame = +3 Query: 51 MWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASG 191 MWN+RSE R+YLG+Q Y+ V + S+RDEY +P N LCG G Sbjct: 495 MWNIRSENLERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKG 541 >gi|4204258|gb|AAD10639.1| (AC005223) 14409 [Arabidopsis thaliana] Length = 558 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 558 0 150 300 450 Plus Strand HSPs: Score = 131 (46.1 bits), Expect = 9.0e-07, P = 9.0e-07 Identities = 24/47 (51%), Positives = 31/47 (65%), Frame = +3 Query: 51 MWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASG 191 MWN+RSE R+YLG+Q Y+ V + S+RDEY +P N LCG G Sbjct: 504 MWNIRSENLERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKG 550 >gi|114268|sp|Q00624|ASO_BRANA L-ASCORBATE OXIDASE HOMOLOG PRECURSOR (ASCORBASE) >gi|541907|pir||S23763 pollen-specific protein Bp10 - rape >gi|17789|emb|CAA45554.1| (X64257) protein homologous to ascorbate oxidase [Brassica napus] Length = 555 Frame 3 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 555 0 150 300 450 __________________ Annotated Domains: DOMO DM00953: LACCASE 3..73 DOMO DM00645: MULTICOPPEROXIDASES 75..242 DOMO DM00873: MULTICOPPEROXIDASES 244..501 DOMO DM07265: 503..554 Entrez metal-binding site: COPPER (TYPE 2) (PRO 444 Entrez glycosylation site: POTENTIAL. 33 Entrez glycosylation site: POTENTIAL. 61 Entrez glycosylation site: POTENTIAL. 110 Entrez glycosylation site: POTENTIAL. 330 Entrez glycosylation site: POTENTIAL. 350 Entrez glycosylation site: POTENTIAL. 422 PFAM Cu-oxidase: Multicopper oxidase 10..147 PRODOM PD000573: LAC1(10) LAC2(7) NIR(6) 32..285 PRODOM PD007707: 288..542 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 191..198 __________________ Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.1e-06, P = 3.1e-06 Identities = 24/51 (47%), Positives = 32/51 (62%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCG 179 +L MWN+RSE R+YLGQQ Y V + S+RDEY +P+ +L CG Sbjct: 490 LLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCG 540 >gi|99809|pir||S24950 pollen-specific protein Bp10 (clone Bp 1002) - rape >gi|17795|emb|CAA47177.1| (X66608) Bplo [Brassica napus] Length = 555 Frame 3 hits (HSPs): _____ Annotated Domains: _ __________________________________________________ Database sequence: | | | | | 555 0 150 300 450 __________________ Annotated Domains: PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 191..198 __________________ Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.1e-06, P = 3.1e-06 Identities = 24/51 (47%), Positives = 32/51 (62%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCG 179 +L MWN+RSE R+YLGQQ Y V + S+RDEY +P+ +L CG Sbjct: 490 LLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCG 540 >gi|99808|pir||S24951 pollen-specific protein Bp10 (clone Bp 1003) - rape >gi|17797|emb|CAA47178.1| (X66609) Bplo [Brassica napus] Length = 555 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 555 0 150 300 450 Plus Strand HSPs: Score = 125 (44.0 bits), Expect = 4.0e-06, P = 4.0e-06 Identities = 23/51 (45%), Positives = 32/51 (62%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCG 179 +L MWN+RSE R+YLGQQ Y + + S+RDEY +P+ +L CG Sbjct: 490 LLTFDNCGMWNIRSENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCG 540 >gi|99807|pir||S24949 pollen-specific protein Bp10 (clone Bp 1001) - rape >gi|17782|emb|CAA47176.1| (X66607) Bplo [Brassica napus] Length = 554 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 554 0 150 300 450 Plus Strand HSPs: Score = 123 (43.3 bits), Expect = 6.5e-06, P = 6.5e-06 Identities = 23/51 (45%), Positives = 32/51 (62%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCG 179 +L MWN+ SE R+YLGQQ Y+ V + S+RDEY +P+ +L CG Sbjct: 489 LLTFDNCGMWNIASENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCG 539 >gi|7433001|pir||T07634 pollen-specific protein homolog T1P17.10 - Arabidopsis thaliana >gi|4725941|emb|CAB41712.1| (AL049730) putative pollen-specific protein [Arabidopsis thaliana] >gi|7267944|emb|CAB78285.1| (AL161534) putative pollen-specific protein [Arabidopsis thaliana] Length = 587 Frame 3 hits (HSPs): ______ Frame 2 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | 587 0 150 300 450 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.0053, Sum P(2) = 0.0053 Identities = 23/62 (37%), Positives = 32/62 (51%), Frame = +3 Query: 54 WNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTRPL*ASKQAPS 233 WNLR+E YLGQ+ Y+RV + + E+ P N L CG S + +P S A Sbjct: 507 WNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVLYCGALS-KLQKPQKVSSSASK 565 Query: 234 SM 239 S+ Sbjct: 566 SI 567 Score = 50 (17.6 bits), Expect = 0.0053, Sum P(2) = 0.0053 Identities = 9/15 (60%), Positives = 12/15 (80%), Frame = +2 Query: 5 PKSWTAIYIALDNVG 49 P +W+AI I+LDN G Sbjct: 491 PGAWSAILISLDNPG 505 >gi|6721119|gb|AAF26773.1|AC007396_22 (AC007396) T4O12.2 [Arabidopsis thaliana] Length = 545 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 545 0 150 300 450 Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.011, P = 0.011 Identities = 23/58 (39%), Positives = 34/58 (58%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVY-----TTST-SIRDEYPVPKNALLCGR 182 ++ + MWN+RS+ + YLGQ+ YMRV ST +RDE P+P N + CG+ Sbjct: 486 LIAMDNQGMWNVRSQKAEQWYLGQELYMRVKGEGEEDPSTIPVRDENPIPGNVIRCGK 543 >gi|7433000|pir||T05545 pollen-specific protein homolog F24A6.80 - Arabidopsis thaliana >gi|4454012|emb|CAA23065.1| (AL035396) Pollen-specific protein precursor like [Arabidopsis thaliana] >gi|7269375|emb|CAB81335.1| (AL161563) Pollen-specific protein precursor like [Arabidopsis thaliana] Length = 561 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 561 0 150 300 450 Plus Strand HSPs: Score = 89 (31.3 bits), Expect = 1.3, P = 0.72 Identities = 18/51 (35%), Positives = 26/51 (50%), Frame = +3 Query: 27 ILRLTTWXMWNLRSEFWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCG 179 ++ L +WN+R E R YLG++ YMR+ + E P N L CG Sbjct: 501 LISLDNVGVWNIRVENLDRWYLGEETYMRITNPEEDGKTEMDPPDNVLYCG 551 >gi|6114698|emb|CAB59415.1| (AJ389993) T cell receptor beta chain variable region [Homo sapiens] Length = 84 Frame 3 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | | | 84 0 20 40 60 80 Plus Strand HSPs: Score = 65 (22.9 bits), Expect = 1.8, P = 0.83 Identities = 16/66 (24%), Positives = 30/66 (45%), Frame = +3 Query: 72 FWARQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTRPL*ASKQAPSSMKTKA 251 +W R+ +G++ ++ S +DE +P N L R G ++ K P+ ++ Sbjct: 10 YWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYS----TLKVQPAELEDSG 65 Query: 252 VNLSAS 269 V AS Sbjct: 66 VYFCAS 71 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.97 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.347 0.151 0.509 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.350 0.152 0.538 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.349 0.158 0.554 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.360 0.160 0.575 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.348 0.151 0.478 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.362 0.161 0.579 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 165 164 10. 74 3 12 22 0.10 34 30 0.10 37 +2 0 166 165 10. 74 3 12 22 0.10 34 30 0.10 37 +1 0 166 164 10. 74 3 12 22 0.10 34 30 0.10 37 -1 0 166 164 10. 74 3 12 22 0.10 34 30 0.10 37 -2 0 166 164 10. 74 3 12 22 0.10 34 30 0.10 37 -3 0 165 164 10. 74 3 12 22 0.10 34 30 0.10 37 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 8:50 PM CDT May 27, 2000 Format: BLAST # of letters in database: 158,518,215 # of sequences in database: 505,245 # of database sequences satisfying E: 24 No. of states in DFA: 594 (59 KB) Total size of DFA: 188 KB (192 KB) Time to generate neighborhood: 0.02u 0.00s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 4 Search cpu time: 210.71u 1.43s 212.14t Elapsed: 00:01:05 Total cpu time: 210.77u 1.46s 212.23t Elapsed: 00:01:05 Start: Wed Feb 14 23:11:13 2001 End: Wed Feb 14 23:12:18 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000