WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker Server unavailable.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= B05H02.seq(1>593) (553 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 3 Sequences : less than 3 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 903 176 |========================================================== 6310 727 122 |======================================== 3980 605 178 |=========================================================== 2510 427 132 |============================================ 1580 295 108 |==================================== 1000 187 46 |=============== 631 141 43 |============== 398 98 30 |========== 251 68 20 |====== 158 48 13 |==== 100 35 12 |==== 63.1 23 7 |== 39.8 16 7 |== 25.1 9 2 |: 15.8 7 1 |: >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 6 <<<<<<<<<<<<<<<<< 10.0 6 1 |: 6.31 5 0 | 3.98 5 0 | 2.51 5 0 | 1.58 5 0 | 1.00 5 0 | 0.63 5 1 |: 0.40 4 0 | 0.25 4 0 | 0.16 4 0 | 0.10 4 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|9294516|dbj|BAB02778.1|(AB023036) contains similar... +1 356 1.4e-31 1 gi|9294513|dbj|BAB02775.1|(AB023036) contains similar... +1 335 2.4e-29 1 gi|6319267ref|NP_009350.1| Yal049cp [Saccharomyces ce... +1 114 0.00048 1 gi|8928122|sp|Q9ZT66|E134_MAIZEENDO-1,3;1,4-BETA-D-GL... +1 98 0.076 1 gi|11498723ref|NP_069952.1| hypothetical protein [Arc... +1 71 0.44 1 gi|11359146|pir||T50286hypothetical protein SPAC977.1... +1 80 0.9995 1
Use the and icons to retrieve links to Entrez:
>gi|9294516|dbj|BAB02778.1| (AB023036) contains similarity to endo-1,3-1,4-beta-D-glucanase~gene_id:MDB19.8 [Arabidopsis thaliana] Length = 239 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 239 0 50 100 150 200 Plus Strand HSPs: Score = 356 (125.3 bits), Expect = 1.4e-31, P = 1.4e-31 Identities = 66/103 (64%), Positives = 83/103 (80%), Frame = +1 Query: 4 AKSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVSPPELVKQFEQVLAAKSGVAS 183 +K LIQ AVLLHPSFV++DDIKG PIAILGAE+DQ+SPP L+KQFE++L++K V S Sbjct: 137 SKEELIQAAVLLHPSFVNVDDIKGGKAPIAILGAEIDQMSPPALLKQFEEILSSKPEVNS 196 Query: 184 FVKIFPKVSHGWAVRYNTEDAETVKVAEEAHQDLLDWLAKHHK 312 +VKI PKVSHGW VRYN ++ E VK AEEAH+++LDW + K Sbjct: 197 YVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYIK 239 >gi|9294513|dbj|BAB02775.1| (AB023036) contains similarity to endo-1,3-1,4-beta-D-glucanase~gene_id:MDB19.5 [Arabidopsis thaliana] Length = 232 Frame 1 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | | 232 0 50 100 150 200 Plus Strand HSPs: Score = 335 (117.9 bits), Expect = 2.4e-29, P = 2.4e-29 Identities = 62/103 (60%), Positives = 79/103 (76%), Frame = +1 Query: 4 AKSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVSPPELVKQFEQVLAAKSGVAS 183 AK +L+ VLLHP+ V++DDIK V++PIA+LGAE+DQVSPPELV+QFE +LA+K V S Sbjct: 130 AKEKLVDATVLLHPARVTVDDIKEVNLPIAVLGAEIDQVSPPELVRQFEDILASKPQVKS 189 Query: 184 FVKIFPKVSHGWAVRYNTEDAETVKVAEEAHQDLLDWLAKHHK 312 FVKIFP+ HGW VRYN D V+ A EAH+D+L WL + K Sbjct: 190 FVKIFPRCKHGWTVRYNENDPSEVEAAMEAHKDMLAWLIDYLK 232 >gi|6319267 ref|NP_009350.1| Yal049cp [Saccharomyces cerevisiae] >gi|731285|sp|P39721|YAE9_YEAST HYPOTHETICAL 27.1 KD PROTEIN IN ACS1-GCV3 INTERGENIC REGION >gi|1077483|pir||S51970 hypothetical protein YAL049c - yeast (Saccharomyces cerevisiae) >gi|595535|gb|AAC04982.1| (U12980) Yal049cp [Saccharomyces cerevisiae] Length = 246 Frame 1 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | | | 246 0 50 100 150 200 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 0.00048, P = 0.00048 Identities = 35/92 (38%), Positives = 52/92 (56%), Frame = +1 Query: 16 LIQTAVLLHPSFVSLDDIKGVDI--PIAILGAEVDQVSPPELVKQFEQVLAAKSGVASF- 186 L A + HPSFVS+++I+ +D PI I AE D + P L E+ L K A++ Sbjct: 146 LANAAAIAHPSFVSIEEIEAIDSKKPILISAAEEDHIFPANLRHLTEEKL--KDNHATYQ 203 Query: 187 VKIFPKVSHGWAVRYNTEDAETVKVAEEAHQDLLD 291 + +F V+HG+A R + VK A+E + LLD Sbjct: 204 LDLFSGVAHGFAARGDIS-IPAVKYAKE--KVLLD 235 >gi|8928122|sp|Q9ZT66|E134_MAIZE ENDO-1,3;1,4-BETA-D-GLUCANASE PRECURSOR >gi|3822036|gb|AAC69757.1| (AF072326) endo-1,3-1,4-beta-D-glucanase [Zea mays] Length = 303 Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | | || 303 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.079, P = 0.076 Identities = 23/57 (40%), Positives = 33/57 (57%), Frame = +1 Query: 7 KSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVSPPELVKQFEQVLAAKSGV 177 K+ ++ L HP V+ DD+K V PI ILGA+ D +PP+ V +F VL + V Sbjct: 163 KTSDVKAVCLSHPYSVTADDMKEVKWPIEILGAQNDTTTPPKEVYRFVHVLRERHEV 219 >gi|11498723 ref|NP_069952.1| hypothetical protein [Archaeoglobus fulgidus] >gi|7483554|pir||B69390 hypothetical protein AF1123 - Archaeoglobus fulgidus >gi|2649469|gb|AAB90124.1| (AE001026) A. fulgidus predicted coding region AF1123 [Archaeoglobus fulgidus] Length = 71 Frame 1 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 0.58, P = 0.44 Identities = 12/34 (35%), Positives = 22/34 (64%), Frame = +1 Query: 67 IKGVDIPIAILGAEVDQVSPPELVKQFEQVLAAK 168 +K + +P+ +L AE D ++PPE V F + + +K Sbjct: 1 MKNIKMPVLVLAAEKDHITPPESVTAFFEKIPSK 34 >gi|11359146|pir||T50286 hypothetical protein SPAC977.15 [imported] - fission yeast (Schizosaccharomyces pombe) >gi|6742164|emb|CAB69637.1| (AL137130) hypothetical protein [Schizosaccharomyces pombe] Length = 247 Frame 1 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | | 247 0 50 100 150 200 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 7.6, P = 1.0 Identities = 28/94 (29%), Positives = 44/94 (46%), Frame = +1 Query: 7 KSRLIQTAVLLHPSFVSLDDIKGVDIPIAILGAEVDQVSPPELVKQFEQVLAAKSGVA-S 183 K R ++ HPS + D K V P+ L ++ D+ PE V +++ + S Sbjct: 149 KERFLRIGCA-HPSLLDPVDAKHVHCPVCFLCSK-DE--DPEEVDAWKKSFENSPYFSES 204 Query: 184 FVKIFPKVSHGW-AVRYNTEDAETVKVAEEAHQDLL 288 + + F K+ HGW A R N D E K + +Q L Sbjct: 205 YFETFGKMHHGWMAARANLSDPENRKYFDLGYQIFL 240 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.99 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.364 0.163 0.667 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.371 0.168 0.655 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.345 0.152 0.508 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.351 0.155 0.534 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.349 0.155 0.551 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.334 0.137 0.435 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 183 182 10. 76 3 12 22 0.12 34 31 0.12 37 +2 0 184 183 10. 76 3 12 22 0.12 34 31 0.12 37 +1 0 184 183 10. 76 3 12 22 0.12 34 31 0.12 37 -1 0 184 183 10. 76 3 12 22 0.12 34 31 0.12 37 -2 0 184 183 10. 76 3 12 22 0.12 34 31 0.12 37 -3 0 183 183 10. 76 3 12 22 0.12 34 31 0.12 37 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 6 No. of states in DFA: 597 (59 KB) Total size of DFA: 220 KB (256 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 178.66u 1.02s 179.68t Elapsed: 00:00:31 Total cpu time: 178.69u 1.04s 179.73t Elapsed: 00:00:31 Start: Sat Feb 2 04:58:08 2002 End: Sat Feb 2 04:58:39 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000