true | Use criteria |
26.8313 | Minimum +1 XCorr |
32.49237 | Minimum +2 XCorr |
40.15587 | Minimum +3 XCorr |
0.1 | Minimum DeltCN |
1 | Minimum charge state |
3 | Maximum charge state |
0.0 | Minimum ion proportion |
1000 | Maximum Sp rank |
-1.0 | Minimum Sp score |
Include | Modified peptide inclusion |
Any | Tryptic status requirement |
true | Multiple, ambiguous IDs allowed |
Ignore | Peptide validation handling |
XCorr | Purge duplicate peptides by protein |
false | Include only loci with unique peptide |
false | Remove subset proteins |
Ignore | Locus validation handling |
0 | Minimum modified peptides per locus |
10 | Minimum redundancy for low coverage loci |
2 | Minimum peptides per locus |
Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
Locus | # of identical peptides | # of differing peptides |
U | std_sp|P02754|LACB_BOVIN|ORNL | 20 | 20 | 70.4% | 162 | 18367 | 4.9 | Beta-lactoglobulin precursor (Beta-LG) (Allergen Bos d 5) - Bos taurus (Bovine). clipped MKCLLLALALTCGAQA |
U | std_sp|P02866|CONA_CANEN | 30 | 38 | 67.1% | 237 | 25598 | 5.6 | Concanavalin A precursor (Con A) - Canavalia ensiformis (Jack bean) (Horse bean). clipped MAISKKSSLFLPIFTFITMFLMVVNKVSS VIRNSTTIDFNAAYN EIPDIATVV |
U | std_UniRef100_P02062 | 14 | 14 | 61.6% | 146 | 16008 | 7.0 | Hemoglobin beta chain [Equus caballus] |
U | std_gi|2506462|sp|P02188|MYG_HORSE | 21 | 21 | 61.4% | 153 | 16951 | 7.8 | MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951] |
U | std_sp|P61823|RNP_BOVIN | 8 | 9 | 49.2% | 124 | 13690 | 8.3 | Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1) (RNase A) - Bos taurus (Bovine). clipped MALKSLVLLSLLVLVLLLVRVQPSLG |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.439.439.2 | 37.6152 | 0.262888 | 1594.79 | 1595.73 | 1 | 136.0 | 56.0% | 1 | A.KFERQHMDSSTSAA.S | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.475.475.2 | 36.1793 | 0.194222 | 1467.59 | 1467.56 | 1 | 13.0 | 57.1% | 1 | K.FERQHMDSSTSAA.S | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.463.463.2 | 40.2403 | 0.214541 | 1553.99 | 1554.64 | 1 | 68.0 | 68.2% | 1 | K.FERQHMDSSTSAAS.S | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.725.725.2 | 45.8319 | 0.385882 | 1275.39 | 1275.52 | 1 | 240.0 | 66.7% | 1 | S.NYCNQMMKSR.N | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.803.803.2 | 53.4911 | 0.377676 | 1536.59 | 1536.8 | 1 | 148.0 | 75.0% | 1 | R.NLTKDRCKPVNTF.V | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.762.762.1 | 37.4634 | 0.194678 | 997.5 | 998.081 | 1 | 166.0 | 78.6% | 1 | F.VHESLADVQ.A | 1 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.759.759.2 | 51.5963 | 0.100187 | 997.992 | 998.081 | 1 | 188.0 | 82.4% | 2 | F.VHESLADVQ.A | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1578.1578.1 | 47.318 | 0.43803 | 1530.6 | 1531.66 | 1 | 168.0 | 75.0% | 1 | C.EGNPYVPVHFDASV.- | 1 |
U | std_UniRef100_P00921 | 19 | 21 | 48.6% | 259 | 28983 | 6.9 | Carbonic anhydrase II [Bos taurus] |
U | std_sp|P02768|ALBU_HUMAN | 48 | 48 | 45.1% | 585 | 66472 | 6.0 | Serum albumin precursor - Homo sapiens (Human). clipped MKWVTFISLLFLFSSAYSRGVFRR |
U | contaminant_sp|P02248|UBIQ_HUMAN | 2 | 2 | 44.7% | 76 | 8565 | 7.2 | Ubiquitin - Homo sapiens (Human), Mus musculus (Mouse), Rattus norvegicus (Rat), Bos taurus (Bovine), Cavia porcellus (Guinea pig), Cricetulus griseus (Chinese hamster), Cricetulus longicaudatus (Long-tailed hamster) (Chinese hamster |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1690.1690.3 | 55.9019 | 0.284441 | 2229.38 | 2229.53 | 1 | 236.0 | 77.8% | 1 | K.TITLEVEPSDTIENVKAKIQ.D | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1262.1262.2 | 49.8502 | 0.30851 | 1652.59 | 1652.76 | 1 | 0.0 | 69.2% | 1 | K.QLEDGRTLSDYNIQ.K | 2 |
U | std_gi|1168350|sp|P00330|ADH1_YEAST | 13 | 14 | 41.2% | 347 | 36692 | 6.7 | ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823] |
U | contaminant_P00442 | 4 | 4 | 39.1% | 151 | 15551 | 6.3 | Superoxide dismutase [Cu-Zn] [Bos taurus] |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1103.1103.2 | 62.1573 | 0.362625 | 1344.59 | 1344.57 | 1 | 63.0 | 70.8% | 1 | K.AVCVLKGDGPVQGT.I | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.800.800.2 | 56.1944 | 0.494072 | 1306.19 | 1306.38 | 1 | 205.0 | 76.2% | 1 | T.GLTEGDHGFHVH.Q | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1498.1498.2 | 50.3161 | 0.346585 | 1992.79 | 1992.14 | 1 | 166.0 | 60.0% | 1 | H.QFGDNTQGCTSAGPHFNPL.S | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.2544.2544.2 | 46.5642 | 0.340908 | 1424.79 | 1424.72 | 1 | 180.0 | 64.0% | 1 | N.GVAIVDIVDPLISL.S | 2 |
U | std_sp|Q29443|TRFE_BOVIN | 34 | 34 | 38.0% | 685 | 75830 | 6.9 | Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) - Bos taurus (Bovine). clipped MRPAVRALLACAVLGLCLA |
U | std_UniRef100_P01958 | 7 | 7 | 35.5% | 141 | 15114 | 8.7 | Hemoglobin alpha chains [Equus caballus] |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1628.1628.2 | 48.0779 | 0.315839 | 1512.19 | 1511.83 | 1 | 150.0 | 69.6% | 1 | E.ALERMFLGFPTTK.T | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1755.1755.2 | 39.3602 | 0.179857 | 1393.39 | 1392.6 | 1 | 144.0 | 61.5% | 1 | L.TLAVGHLDDLPGAL.S | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1512.1512.1 | 31.8825 | 0.18364 | 1177.6 | 1178.33 | 1 | 201.0 | 77.8% | 1 | L.AVGHLDDLPGAL.S | 1 |
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1567.1567.3 | 43.4749 | 0.163432 | 1443.08 | 1442.79 | 1 | 219.0 | 77.8% | 1 | H.KLRVDPVNFKLL.S | 33 | |
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1537.1537.2 | 38.0417 | 0.183365 | 1201.39 | 1201.46 | 1 | 206.0 | 61.1% | 1 | L.RVDPVNFKLL.S | 22 | |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1330.1330.1 | 33.5658 | 0.158396 | 1181.5 | 1182.32 | 1 | 197.0 | 68.8% | 1 | L.AVHLPNDFTPA.V | 1 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1327.1327.2 | 43.4896 | 0.110242 | 1181.99 | 1182.32 | 1 | 164.0 | 73.7% | 1 | L.AVHLPNDFTPA.V | 2 |
U | std_sp|P00006|CYC_BOVIN | 5 | 5 | 32.7% | 104 | 11572 | 9.5 | Cytochrome c - Bos taurus (Bovine), Sus scrofa (Pig), and Ovis aries (Sheep). |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1847.1847.3 | 46.1624 | 0.24132 | 2341.58 | 2341.69 | 1 | 177.0 | 62.3% | 1 | W.GEETLMEYLENPKKYIPGTK.M | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.578.578.2 | 36.4045 | 0.211979 | 1275.39 | 1275.49 | 1 | 104.0 | 60.0% | 1 | L.ENPKKYIPGTK.M | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.749.749.2 | 51.6753 | 0.316505 | 1620.59 | 1620.89 | 1 | 25.0 | 77.3% | 1 | A.GIKKKGEREDLIAY.L | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.709.709.2 | 44.2413 | 0.293737 | 1563.59 | 1563.84 | 1 | 24.0 | 68.2% | 1 | G.IKKKGEREDLIAY.L | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.827.827.1 | 42.7419 | 0.345666 | 1321.8 | 1322.5 | 1 | 218.0 | 75.0% | 1 | K.KKGEREDLIAY.L | 1 |
U | std_gi|2190337|sp|P02769|gnl|PID|e321614 | 28 | 28 | 32.1% | 583 | 66463 | 5.9 | (X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323] clipped MKWVTFISLLLLFSSAYSRGVFRR |
U | std_sp|P02789|TRFE_CHICK | 30 | 30 | 31.6% | 686 | 75828 | 7.0 | Ovotransferrin precursor (Conalbumin) (Allergen Gal d 3) (Gal d III) (Serum transferrin) - Gallus gallus (Chicken). clipped MKLILCTVLSLGIAAVCFA |
U | std_UniRef100_P00692 | 7 | 7 | 18.0% | 483 | 54838 | 5.6 | Alpha-amylase precursor [Bacillus amyloliquefaciens] clipped MIQKRKRTVSFRLVLMCTLLFVSLPITKTSA |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1647.1647.2 | 51.0826 | 0.291575 | 1216.79 | 1215.48 | 1 | 176.0 | 84.2% | 1 | T.AVWIPPAYKGL.S | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.688.688.2 | 46.1302 | 0.338997 | 1237.99 | 1238.45 | 1 | 137.0 | 73.7% | 1 | Q.AVRQATGKEMF.T | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1917.1917.2 | 55.3331 | 0.255841 | 1329.39 | 1329.54 | 1 | 206.0 | 80.0% | 1 | S.VFDVPLHFNLQ.A | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.682.682.3 | 41.658 | 0.20513 | 1371.08 | 1370.59 | 1 | 237.0 | 62.5% | 1 | T.VVSRHPEKAVTF.V | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.2637.2637.3 | 40.6638 | 0.228532 | 3996.08 | 3997.5 | 1 | 209.0 | 64.6% | 1 | K.AVTFVENHDTQPGQSLESTVQTWFKPLAYAFILTR.E | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.983.983.2 | 48.7329 | 0.386655 | 1868.79 | 1869.94 | 1 | 192.0 | 66.7% | 1 | F.VENHDTQPGQSLESTVQ.T | 2 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1298.1298.2 | 34.2634 | 0.230608 | 1520.19 | 1519.61 | 1 | 180.0 | 56.5% | 1 | L.TRESGYPQVFYGD.M | 2 |
U | std_sp|P00698|LYC_CHICK | 3 | 3 | 17.1% | 129 | 14313 | 9.0 | Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken). |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.905.905.3 | 40.817 | 0.218617 | 1581.08 | 1579.76 | 1 | 78.0 | 64.3% | 1 | M.KRHGLDNYRGYSL.G | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.574.574.3 | 51.4622 | 0.225845 | 1252.28 | 1251.35 | 1 | 187.0 | 76.5% | 1 | K.RHGLDNYRGY.S | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.778.778.2 | 44.9717 | 0.261213 | 1114.79 | 1115.19 | 1 | 44.0 | 75.0% | 1 | A.KFESNFNTQ.A | 2 |
U | std_gi|113380|sp|P00331|ADH2_YEAST | 7 | 9 | 16.7% | 347 | 36601 | 6.7 | ALCOHOL DEHYDROGENASE II gi|65897|pir||DEBYA2 alcohol dehydrogenase (EC 1.1.1.1) II - yeast (Saccharomyces cerevisiae) gi|171021 (J01314) alcohol dehydrogenase II [Saccharomyces cerevisiae] gi|600021 (V01293) alcohol dehydrogenase II [Saccharomyces cerevisiae] gi|798945 (Z49212) Adh2p [Saccharomyces cerevisiae] [MASS=36732] |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1247.1247.2 | 58.2893 | 0.420798 | 1389.59 | 1389.53 | 1 | 100.0 | 82.6% | 1 | K.YSGVCHTDLHAW.H | 22 | |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1902.1902.3 | 51.9036 | 0.343668 | 2523.98 | 2524.95 | 1 | 192.0 | 63.6% | 2 | W.HGDWPLPTKLPLVGGHEGAGVVVGM.G | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1887.1887.2 | 59.0327 | 0.416996 | 2523.99 | 2524.95 | 1 | 72.0 | 66.7% | 1 | W.HGDWPLPTKLPLVGGHEGAGVVVGM.G | 2 |
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1355.1355.2 | 47.6756 | 0.264169 | 1205.19 | 1205.4 | 1 | 32.0 | 66.7% | 1 | K.LPLVGGHEGAGVV.V | 22 | |
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.757.757.1 | 39.2246 | 0.212451 | 964.6 | 965.138 | 1 | 233.0 | 85.7% | 1 | W.KIGDYAGIK.W | 11 | |
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.752.752.2 | 57.0436 | 0.311464 | 965.392 | 965.138 | 1 | 202.0 | 88.2% | 2 | W.KIGDYAGIK.W | 22 | |
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1485.1485.3 | 48.7108 | 0.137329 | 1210.88 | 1210.55 | 1 | 226.0 | 81.1% | 1 | R.GLVKSPIKVVGL.S | 33 |
U | std_sp|P00327|ADHE_HORSE | 2 | 2 | 11.8% | 374 | 39804 | 8.0 | Alcohol dehydrogenase E chain (EC 1.1.1.1) - Equus caballus (Horse). |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1859.1859.3 | 44.4254 | 0.291146 | 2240.48 | 2237.6 | 1 | 211.0 | 58.6% | 1 | A.GIVESIGEGVTTVRPGDKVIPL.F | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.2393.2393.3 | 50.1861 | 0.181335 | 2494.88 | 2495.92 | 1 | 142.0 | 62.1% | 1 | F.ALDPLITHVLPFEKINEGFDLL.R | 3 |
U | std_sp|P00639|DRN1_BOVIN | 2 | 2 | 9.6% | 260 | 29066 | 5.3 | Deoxyribonuclease I precursor (EC 3.1.21.1) (DNase I) - Bos taurus (Bovine). clipped MRGTRLMGLLLALAGLLQLGLS |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.573.573.3 | 44.9351 | 0.210145 | 1310.78 | 1310.5 | 1 | 251.0 | 63.4% | 1 | Q.EVRDSHLVAVGK.L | 3 |
* | ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1007.1007.2 | 44.917 | 0.11893 | 1325.39 | 1324.43 | 1 | 197.0 | 66.7% | 1 | A.LHSAPSDAVAEIN.S | 2 |
U | std_sp|P01267|THYG_BOVIN | 24 | 25 | 9.3% | 2750 | 301219 | 5.7 | Thyroglobulin precursor - Bos taurus (Bovine). clipped MALALWVFGLLDLICLASA |
U | std_gi|122361|sp|P01966|HBA_BOVIN | 2 | 2 | 8.5% | 141 | 15053 | 8.4 | HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053] |
Filename | XCorr | DeltCN | ObsM+H+ | CalcM+H+ | SpR | SpScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1567.1567.3 | 43.4749 | 0.163432 | 1443.08 | 1442.79 | 1 | 219.0 | 77.8% | 1 | H.KLRVDPVNFKLL.S | 33 | |
ExtPSM_ProtK_1d_SW_5ug_Inj_072304_01_PPM.1537.1537.2 | 38.0417 | 0.183365 | 1201.39 | 1201.46 | 1 | 206.0 | 61.1% | 1 | L.RVDPVNFKLL.S | 22 |
Proteins | Peptide IDs | Copies | |
Unfiltered | 3273 | 2618 | 4326 |
Redundant | 22 | 330 | 345 |
Nonredundant | 22 | 322 | 336 |