5 proteins |
S | COG5583 | Uncharacterized small protein | Help | |
---|---|---|---|---|---|
1 from | query genome Clostridium acetobutylicum (Clostridiales | Clostridia) | ||||
CAC0932 |
56 letters (r) 0 0 191 = ||| 1 CAC0932 (56) = -7 -1 84 = | 3 BH1485 (48) = -11 22 68 = | 4 BH3126 (67) = -3 7 61 = 5 PA0284 (60) =
BLASTP 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= CAC0932 (56 letters) Database: myva 192,987 sequences; 59,019,183 total letters Score E Sequences producing significant alignments: (bits) Value CAC0932 78 4e-15 BH1485 37 0.009 BH3126 31 0.69 PA0284 28 4.5 # >CAC0932 # Length = 56 # # Score = 78.2 bits (191), Expect = 4e-15 # Identities = 56/56 (100%), Positives = 56/56 (100%) # # Query: 1 MNDLDYKINKSKTIKGERYEEKISKLLKEIKYGSITLIIQDGVVIQIEASQKIRLR 56 # MNDLDYKINKSKTIKGERYEEKISKLLKEIKYGSITLIIQDGVVIQIEASQKIRLR # Sbjct: 1 MNDLDYKINKSKTIKGERYEEKISKLLKEIKYGSITLIIQDGVVIQIEASQKIRLR 56 # # # >BH1485 # Length = 48 # # Score = 37.0 bits (84), Expect = 0.009 # Identities = 18/35 (51%), Positives = 30/35 (85%) # # Query: 21 EKISKLLKEIKYGSITLIIQDGVVIQIEASQKIRL 55 # +K+ LL+ +KYGS+T+++Q+G VIQIE ++K+RL # Sbjct: 14 DKVKDLLEGLKYGSVTIVVQNGKVIQIEKNEKVRL 48 # # # >BH3126 # Length = 67 # # Score = 30.8 bits (68), Expect = 0.69 # Identities = 13/34 (38%), Positives = 27/34 (79%) # # Query: 21 EKISKLLKEIKYGSITLIIQDGVVIQIEASQKIR 54 # E+I K +++IKYGS+ + I + ++QI+A++++R # Sbjct: 10 EEIKKAIEKIKYGSVLITIHEDQIMQIDATERVR 43 # # # >PA0284 # Length = 60 # # Score = 28.1 bits (61), Expect = 4.5 # Identities = 11/35 (31%), Positives = 24/35 (68%) # # Query: 22 KISKLLKEIKYGSITLIIQDGVVIQIEASQKIRLR 56 # +I L+ +++G++ + + +G V+QIE +K RL+ # Sbjct: 19 EIQSALRGLRFGAVEITVHNGQVVQIERKEKFRLQ 53 # # Database: myva Posted date: Sep 16, 2002 2:25 PM Number of letters in database: 59,019,183 Number of sequences in database: 192,987 Lambda K H 0.315 0.137 0.346 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,359,889 Number of Sequences: 192987 Number of extensions: 141943 Number of successful extensions: 598 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 587 Number of HSP's gapped (non-prelim): 12 length of query: 56 length of database: 59,019,183 effective HSP length: 32 effective length of query: 24 effective length of database: 52,843,599 effective search space: 1268246376 effective search space used: 1268246376 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 58 (26.9 bits) S2: 58 (26.9 bits)