WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker Server unavailable.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= B05E11.seq(1>589) (548 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 3 Sequences : less than 3 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 2265 163 |====================================================== 6310 2102 127 |========================================== 3980 1975 162 |====================================================== 2510 1813 152 |================================================== 1580 1661 69 |======================= 1000 1592 69 |======================= 631 1523 56 |================== 398 1467 46 |=============== 251 1421 29 |========= 158 1392 15 |===== 100 1377 14 |==== 63.1 1363 16 |===== 39.8 1347 23 |======= 25.1 1324 14 |==== 15.8 1310 37 |============ >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 1273 <<<<<<<<<<<<<<<<< 10.0 1273 17 |===== 6.31 1256 15 |===== 3.98 1241 15 |===== 2.51 1226 7 |== 1.58 1219 3 |= 1.00 1216 15 |===== 0.63 1201 6 |== 0.40 1195 12 |==== 0.25 1183 8 |== 0.16 1175 11 |=== 0.10 1164 8 |== 0.063 1156 7 |== 0.040 1149 8 |== 0.025 1141 6 |== 0.016 1135 8 |== 0.010 1127 5 |= 0.0063 1122 7 |== 0.0040 1115 6 |== 0.0025 1109 4 |= 0.0016 1105 6 |== Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|585783|sp|P38548|RAN_VICFAGTP-BINDING NUCLEAR PROT... +3 715 5.2e-82 2 gi|585777|sp|P38546|RAN1_LYCESGTP-BINDING NUCLEAR PRO... +3 715 5.2e-82 2 gi|585778|sp|P38547|RAN2_LYCESGTP-BINDING NUCLEAR PRO... +3 715 5.2e-82 2 gi|1172833|sp|P41916|RAN1_ARATHGTP-BINDING NUCLEAR PR... +3 715 5.2e-82 2 gi|1172836|sp|P41919|RANB_TOBACGTP-BINDING NUCLEAR PR... +3 715 5.2e-82 2 gi|2507281|sp|P41917|RAN2_ARATHGTP-BINDING NUCLEAR PR... +3 715 5.2e-82 2 gi|2149051|gb|AAB58478.1|(U73810) small Ras-like GTP-... +3 715 5.2e-82 2 gi|10334503|emb|CAC10213.1|(AJ299064) GTP-binding pro... +3 715 5.2e-82 2 gi|12382026|dbj|BAB21295.1|(AP002844) putative GTP-bi... +3 711 1.4e-81 2 gi|2058280|emb|CAA66049.1|(X97381) atran3 [Arabidopsi... +3 705 5.9e-81 2 gi|1172835|sp|P41918|RANA_TOBACGTP-BINDING NUCLEAR PR... +3 715 7.5e-81 2 gi|5360230|dbj|BAA81911.1|(AB015287) Ran [Oryza sativa] +3 704 4.1e-80 2 gi|2801433|gb|AAB97312.1|(AF017991) salt stress induc... +3 695 6.6e-80 2 gi|1710007|sp|P54765|RANA_LOTJAGTP-BINDING NUCLEAR PR... +3 715 7.6e-75 2 gi|1710008|sp|P54766|RANB_LOTJAGTP-BINDING NUCLEAR PR... +3 715 7.6e-75 2 gi|495731|gb|AAA32852.1|(L16790) small ras-related pr... +3 715 2.6e-72 2 gi|6324759ref|NP_014828.1| GTP binding protein, almos... +3 599 7.8e-65 2 gi|7505085|pir||T23195hypothetical protein K01G5.4 - ... +3 603 1.4e-63 2 gi|6323324ref|NP_013396.1| GTP-binding protein; Gsp1p... +3 599 3.0e-63 2 gi|9758105|dbj|BAB08577.1|(AB010071) salt stress indu... +3 550 1.3e-62 2 gi|585779|sp|P38542|RAN_BRUMAGTP-BINDING NUCLEAR PROT... +3 588 1.6e-62 2 gi|7292609|gb|AAF48008.1|(AE003485) ran gene product ... +3 589 2.1e-62 2 gi|477814|pir||B48463Ras-like GTP-binding protein - n... +3 582 7.0e-62 2 gi|585781|sp|P38544|RAN_ONCVOGTP-BINDING NUCLEAR PROT... +3 582 7.0e-62 2 gi|8698689|gb|AAF78478.1|AF190700_1(AF190700) small G... +3 585 8.9e-62 2 gi|346437|pir||JC1455GTP-binding protein Ran/TC4 - do... +3 591 1.8e-61 2 gi|5453555ref|NP_006316.1| ras-related nuclear protei... +3 583 1.3e-60 2 gi|1172839|sp|P42558|RAN_CHICKGTP-BINDING NUCLEAR PRO... +3 583 1.3e-60 2 gi|4092054|gb|AAC99400.1|(AF054183) GTP binding prote... +3 583 1.3e-60 2 gi|5107682|pdb|1RRP|AChain A, Structure Of The Ran-Gp... +3 583 1.3e-60 2 gi|6729160|dbj|BAA89696.1|(AB030945) ran GTP-binding ... +3 583 1.3e-60 2 gi|6857182|gb|AAF30287.1|(AF220950) GTP-binding nucle... +3 570 2.1e-60 2 gi|2500061|sp|P79735|RAN_BRAREGTP-BINDING NUCLEAR PRO... +3 580 2.6e-60 2 gi|3850118|emb|CAA10039.1|(AJ012477) Ran protein [Sal... +3 580 2.6e-60 2 gi|3894108|emb|CAA10191.1|(AJ012827) Ran protein [Sal... +3 580 2.6e-60 2 gi|5542357|pdb|1QG4|BChain B, Canine Gdp-Ran F72y Mut... +3 580 2.6e-60 2 gi|5542355|pdb|1QG2|AChain A, Canine Gdp-Ran R76e Mutant +3 578 4.3e-60 2 gi|131845|sp|P17080|RAN_HUMANGTP-BINDING NUCLEAR PROT... +3 577 5.5e-60 2 gi|5107637|pdb|1QBK|CChain C, Structure Of The Karyop... +3 577 5.5e-60 2 gi|6729842|pdb|3RAN|BChain B, Canine Gdp-Ran Q69l Mut... +3 576 7.0e-60 2 gi|4583670|emb|CAB40408.1|(AJ010592) GTP-binding nucl... +3 575 3.8e-59 2 gi|6677677ref|NP_033054.1| RAS-like, family 2, locus ... +3 559 8.9e-58 2 gi|585782|sp|P38545|RAN_PLAFAGTP-BINDING NUCLEAR PROT... +3 553 3.0e-57 2 gi|606985|gb|AAA79869.1|(U17086) GTP-binding protein ... +3 545 1.3e-56 2 gi|542430|pir||S40121ras-related nuclear protein - ma... +3 545 2.1e-56 2 gi|464546|sp|P33519|RAN_DICDIGTP-BINDING NUCLEAR PROT... +3 553 2.6e-56 2 gi|134822|sp|P28748|SPI1_SCHPOGTP-BINDING NUCLEAR PRO... +3 572 1.8e-54 1 gi|4336905|gb|AAD18006.1|(AF112244) Ran-related GTP b... +3 558 5.5e-53 1 gi|1172841|sp|P41915|RAN_TETTHGTP-BINDING NUCLEAR PRO... +3 481 6.9e-50 2 gi|1172840|sp|P41914|RAN_TETPYGTP-BINDING NUCLEAR PRO... +3 470 1.3e-48 2
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 1223 database sequences were not reported due to the limiting value of parameter V = 50. >gi|585783|sp|P38548|RAN_VICFA GTP-BINDING NUCLEAR PROTEIN RAN/TC4 >gi|1076544|pir||S46498 GTP-binding protein ran homolog - fava bean >gi|395072|emb|CAA80845.1| (Z24678) guanine nucleotide regulatory protein [Vicia faba] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00006: RASTRANSFORMINGPROTEIN 10..157 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 158..220 Entrez np-binding site: GTP (BY SIMILARITY). 20..27 Entrez np-binding site: GTP (BY SIMILARITY). 68..72 Entrez np-binding site: GTP (BY SIMILARITY). 125..128 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 130..145 PFAM ras: Ras family 15..205 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 14..35 PRINTS 1: RAN family motif I - 2 27..41 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 37..53 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 55..77 PRINTS 2: RAN family motif II - 2 74..92 PRINTS 3: RAN family motif III - 2 94..115 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 116..129 PRINTS 4: RAN family motif IV - 2 130..148 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 149..171 PRINTS 5: RAN family motif V - 2 168..190 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 14..170 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 173..217 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 20..27 PROSITE RAN: GTP-binding nuclear protein ran sig 68..83 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|585777|sp|P38546|RAN1_LYCES GTP-BINDING NUCLEAR PROTEIN RAN1 >gi|453561|gb|AAC37402.1| (L28713) Ran protein/TC4 protein [Lycopersicon esculentum] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL01115A: GTP-binding nuclear protein ra 14..57 BLOCKS BL01115B: GTP-binding nuclear protein ra 94..137 BLOCKS BL01115C: GTP-binding nuclear protein ra 143..173 BLOCKS BL01115D: GTP-binding nuclear protein ra 187..218 DOMO DM00006: RASTRANSFORMINGPROTEIN 10..157 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 158..220 Entrez np-binding site: GTP (BY SIMILARITY). 20..27 Entrez np-binding site: GTP (BY SIMILARITY). 68..72 Entrez np-binding site: GTP (BY SIMILARITY). 125..128 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 130..145 PFAM ras: Ras family 15..194 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 14..35 PRINTS 1: RAN family motif I - 2 27..41 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 37..53 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 55..77 PRINTS 2: RAN family motif II - 2 74..92 PRINTS 3: RAN family motif III - 2 94..115 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 116..129 PRINTS 4: RAN family motif IV - 2 130..148 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 149..171 PRINTS 5: RAN family motif V - 2 168..190 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 14..170 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 173..217 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 20..27 PROSITE RAN: GTP-binding nuclear protein ran sig 68..83 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|585778|sp|P38547|RAN2_LYCES GTP-BINDING NUCLEAR PROTEIN RAN2 >gi|453563|gb|AAC37403.1| (L28714) Ran protein/TC4 protein [Lycopersicon esculentum] >gi|453565|gb|AAC37404.1| (L28715) Ran protein/TC4 protein [Lycopersicon esculentum] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL01115A: GTP-binding nuclear protein ra 14..57 BLOCKS BL01115B: GTP-binding nuclear protein ra 94..137 BLOCKS BL01115C: GTP-binding nuclear protein ra 143..173 BLOCKS BL01115D: GTP-binding nuclear protein ra 187..218 DOMO DM00006: RASTRANSFORMINGPROTEIN 10..157 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 158..220 Entrez np-binding site: GTP (BY SIMILARITY). 20..27 Entrez np-binding site: GTP (BY SIMILARITY). 68..72 Entrez np-binding site: GTP (BY SIMILARITY). 125..128 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 130..145 PFAM ras: Ras family 15..209 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 14..35 PRINTS 1: RAN family motif I - 2 27..41 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 37..53 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 55..77 PRINTS 2: RAN family motif II - 2 74..92 PRINTS 3: RAN family motif III - 2 94..115 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 116..129 PRINTS 4: RAN family motif IV - 2 130..148 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 149..171 PRINTS 5: RAN family motif V - 2 168..190 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 14..170 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 173..217 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 20..27 PROSITE RAN: GTP-binding nuclear protein ran sig 68..83 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|1172833|sp|P41916|RAN1_ARATH GTP-BINDING NUCLEAR PROTEIN RAN-1 >gi|495729|gb|AAA32851.1| (L16789) small ras-related protein [Arabidopsis thaliana] >gi|2058278|emb|CAA66047.1| (X97379) atran1 [Arabidopsis thaliana] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL01115A: GTP-binding nuclear protein ra 14..57 BLOCKS BL01115B: GTP-binding nuclear protein ra 94..137 BLOCKS BL01115C: GTP-binding nuclear protein ra 143..173 BLOCKS BL01115D: GTP-binding nuclear protein ra 187..218 DOMO DM00006: RASTRANSFORMINGPROTEIN 10..157 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 158..220 Entrez np-binding site: GTP (BY SIMILARITY). 20..27 Entrez np-binding site: GTP (BY SIMILARITY). 68..72 Entrez np-binding site: GTP (BY SIMILARITY). 125..128 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 130..145 PFAM ras: Ras family 15..205 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 14..35 PRINTS 1: RAN family motif I - 2 27..41 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 37..53 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 55..77 PRINTS 2: RAN family motif II - 2 74..92 PRINTS 3: RAN family motif III - 2 94..115 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 116..129 PRINTS 4: RAN family motif IV - 2 130..148 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 149..171 PRINTS 5: RAN family motif V - 2 168..190 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 14..170 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 173..218 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 20..27 PROSITE RAN: GTP-binding nuclear protein ran sig 68..83 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|1172836|sp|P41919|RANB_TOBAC GTP-BINDING NUCLEAR PROTEIN RAN-B1 >gi|496272|gb|AAA34109.1| (L16787) small ras-related protein [Nicotiana tabacum] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL01115A: GTP-binding nuclear protein ra 14..57 BLOCKS BL01115B: GTP-binding nuclear protein ra 94..137 BLOCKS BL01115C: GTP-binding nuclear protein ra 143..173 BLOCKS BL01115D: GTP-binding nuclear protein ra 187..218 DOMO DM00006: RASTRANSFORMINGPROTEIN 10..157 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 158..220 Entrez np-binding site: GTP (BY SIMILARITY). 20..27 Entrez np-binding site: GTP (BY SIMILARITY). 68..72 Entrez np-binding site: GTP (BY SIMILARITY). 125..128 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 130..145 PFAM ras: Ras family 15..212 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 14..35 PRINTS 1: RAN family motif I - 2 27..41 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 37..53 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 55..77 PRINTS 2: RAN family motif II - 2 74..92 PRINTS 3: RAN family motif III - 2 94..115 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 116..129 PRINTS 4: RAN family motif IV - 2 130..148 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 149..171 PRINTS 5: RAN family motif V - 2 168..190 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 14..170 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 173..217 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 20..27 PROSITE RAN: GTP-binding nuclear protein ran sig 68..83 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|2507281|sp|P41917|RAN2_ARATH GTP-BINDING NUCLEAR PROTEIN RAN-2 >gi|1668706|emb|CAA66048.1| (X97380) atran2 [Arabidopsis thaliana] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL01115A: GTP-binding nuclear protein ra 14..57 BLOCKS BL01115B: GTP-binding nuclear protein ra 94..137 BLOCKS BL01115C: GTP-binding nuclear protein ra 143..173 BLOCKS BL01115D: GTP-binding nuclear protein ra 187..218 Entrez np-binding site: GTP (BY SIMILARITY). 20..27 Entrez np-binding site: GTP (BY SIMILARITY). 68..72 Entrez np-binding site: GTP (BY SIMILARITY). 125..128 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 130..145 PFAM ras: Ras family 15..200 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 14..35 PRINTS 1: RAN family motif I - 2 27..41 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 37..53 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 55..77 PRINTS 2: RAN family motif II - 2 74..92 PRINTS 3: RAN family motif III - 2 94..115 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 116..129 PRINTS 4: RAN family motif IV - 2 130..148 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 149..171 PRINTS 5: RAN family motif V - 2 168..190 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 14..170 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 173..217 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 20..27 PROSITE RAN: GTP-binding nuclear protein ran sig 68..83 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|2149051|gb|AAB58478.1| (U73810) small Ras-like GTP-binding protein [Arabidopsis thaliana] >gi|9758116|dbj|BAB08588.1| (AB010071) small Ras-like GTP-binding protein [Arabidopsis thaliana] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|10334503|emb|CAC10213.1| (AJ299064) GTP-binding protein [Cicer arietinum] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.2e-82, Sum P(2) = 5.2e-82 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|12382026|dbj|BAB21295.1| (AP002844) putative GTP-binding protein [Oryza sativa] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 711 (250.3 bits), Expect = 1.4e-81, Sum P(2) = 1.4e-81 Identities = 127/129 (98%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYE+SA Sbjct: 146 NLQYYEVSA 154 Score = 136 (47.9 bits), Expect = 1.4e-81, Sum P(2) = 1.4e-81 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|2058280|emb|CAA66049.1| (X97381) atran3 [Arabidopsis thaliana] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 705 (248.2 bits), Expect = 5.9e-81, Sum P(2) = 5.9e-81 Identities = 128/129 (99%), Positives = 128/129 (99%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGE EKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEPEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 136 (47.9 bits), Expect = 5.9e-81, Sum P(2) = 5.9e-81 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|1172835|sp|P41918|RANA_TOBAC GTP-BINDING NUCLEAR PROTEIN RAN-A1 >gi|496268|gb|AAA73563.1| (L16767) GTP-binding protein [Nicotiana tabacum] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL01115A: GTP-binding nuclear protein ra 14..57 BLOCKS BL01115B: GTP-binding nuclear protein ra 94..137 BLOCKS BL01115C: GTP-binding nuclear protein ra 143..173 BLOCKS BL01115D: GTP-binding nuclear protein ra 187..218 DOMO DM00006: RASTRANSFORMINGPROTEIN 10..157 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 158..220 Entrez np-binding site: GTP (BY SIMILARITY). 20..27 Entrez np-binding site: GTP (BY SIMILARITY). 68..72 Entrez np-binding site: GTP (BY SIMILARITY). 125..128 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 130..145 PFAM ras: Ras family 15..210 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 14..35 PRINTS 1: RAN family motif I - 2 27..41 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 37..53 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 55..77 PRINTS 2: RAN family motif II - 2 74..92 PRINTS 3: RAN family motif III - 2 94..115 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 116..129 PRINTS 4: RAN family motif IV - 2 130..148 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 149..171 PRINTS 5: RAN family motif V - 2 168..190 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 14..170 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 173..217 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 20..27 PROSITE RAN: GTP-binding nuclear protein ran sig 68..83 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 7.5e-81, Sum P(2) = 7.5e-81 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 125 (44.0 bits), Expect = 7.5e-81, Sum P(2) = 7.5e-81 Identities = 24/26 (92%), Positives = 24/26 (92%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALP QQ VDYPSFKLVIVGDGGTGK Sbjct: 1 MALPGQQAVDYPSFKLVIVGDGGTGK 26 >gi|5360230|dbj|BAA81911.1| (AB015287) Ran [Oryza sativa] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 704 (247.8 bits), Expect = 4.1e-80, Sum P(2) = 4.1e-80 Identities = 127/129 (98%), Positives = 128/129 (99%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 86 GQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 145 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 146 NLQYYEISA 154 Score = 129 (45.4 bits), Expect = 4.1e-80, Sum P(2) = 4.1e-80 Identities = 25/26 (96%), Positives = 25/26 (96%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQ TVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQGTVDYPSFKLVIVGDGGTGK 26 >gi|2801433|gb|AAB97312.1| (AF017991) salt stress inducible small GTP binding protein Ran1 homolog [Arabidopsis thaliana] >gi|3559764|gb|AAC34900.1| (U75601) unknown [Arabidopsis thaliana] Length = 221 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 695 (244.7 bits), Expect = 6.6e-80, Sum P(2) = 6.6e-80 Identities = 125/129 (96%), Positives = 127/129 (98%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHP DFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 26 KTTFVKRHLTGEFEKKYEPTIGVEVHPPDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTY+NVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRK+ Sbjct: 86 GQCAIIMFDVTARLTYRNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKE 145 Query: 507 NLQYYEISA 533 LQYYEISA Sbjct: 146 ELQYYEISA 154 Score = 136 (47.9 bits), Expect = 6.6e-80, Sum P(2) = 6.6e-80 Identities = 26/26 (100%), Positives = 26/26 (100%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQTVDYPSFKLVIVGDGGTGK Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGK 26 >gi|1710007|sp|P54765|RANA_LOTJA GTP-BINDING NUCLEAR PROTEIN RAN1A >gi|1370203|emb|CAA98187.1| (Z73959) RAN1A [Lotus japonicus] Length = 209 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 209 0 50 100 150 200 __________________ Annotated Domains: Entrez np-binding site: GTP (BY SIMILARITY). 8..15 Entrez np-binding site: GTP (BY SIMILARITY). 56..60 Entrez np-binding site: GTP (BY SIMILARITY). 113..116 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 118..133 PFAM ras: Ras family 3..198 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 8..15 PROSITE RAN: GTP-binding nuclear protein ran sig 56..71 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 7.6e-75, Sum P(2) = 7.6e-75 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 14 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 73 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 74 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 133 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 134 NLQYYEISA 142 Score = 68 (23.9 bits), Expect = 7.6e-75, Sum P(2) = 7.6e-75 Identities = 13/14 (92%), Positives = 14/14 (100%), Frame = +1 Query: 109 SFKLVIVGDGGTGK 150 +FKLVIVGDGGTGK Sbjct: 1 NFKLVIVGDGGTGK 14 >gi|1710008|sp|P54766|RANB_LOTJA GTP-BINDING NUCLEAR PROTEIN RAN1B >gi|1370205|emb|CAA98188.1| (Z73960) RAN1B [Lotus japonicus] Length = 209 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 209 0 50 100 150 200 __________________ Annotated Domains: Entrez np-binding site: GTP (BY SIMILARITY). 8..15 Entrez np-binding site: GTP (BY SIMILARITY). 56..60 Entrez np-binding site: GTP (BY SIMILARITY). 113..116 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 118..133 PFAM ras: Ras family 3..198 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 8..15 PROSITE RAN: GTP-binding nuclear protein ran sig 56..71 __________________ Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 7.6e-75, Sum P(2) = 7.6e-75 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 14 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 73 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 74 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 133 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 134 NLQYYEISA 142 Score = 68 (23.9 bits), Expect = 7.6e-75, Sum P(2) = 7.6e-75 Identities = 13/14 (92%), Positives = 14/14 (100%), Frame = +1 Query: 109 SFKLVIVGDGGTGK 150 +FKLVIVGDGGTGK Sbjct: 1 NFKLVIVGDGGTGK 14 >gi|495731|gb|AAA32852.1| (L16790) small ras-related protein [Arabidopsis thaliana] Length = 203 Frame 3 hits (HSPs): _________________________________ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | || 203 0 50 100 150 200 Plus Strand HSPs: Score = 715 (251.7 bits), Expect = 2.6e-72, Sum P(2) = 2.6e-72 Identities = 129/129 (100%), Positives = 129/129 (100%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH Sbjct: 8 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 67 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK Sbjct: 68 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 127 Query: 507 NLQYYEISA 533 NLQYYEISA Sbjct: 128 NLQYYEISA 136 Score = 44 (15.5 bits), Expect = 2.6e-72, Sum P(2) = 2.6e-72 Identities = 8/8 (100%), Positives = 8/8 (100%), Frame = +1 Query: 127 VGDGGTGK 150 VGDGGTGK Sbjct: 1 VGDGGTGK 8 >gi|6324759 ref|NP_014828.1| GTP binding protein, almost identical to Gsp1p; Gsp2p [Saccharomyces cerevisiae] >gi|417091|sp|P32836|GSP2_YEAST GTP-BINDING NUCLEAR PROTEIN GSP2/CNR2 >gi|486808|pir||S35505 GTP-binding protein GSP2 - yeast (Saccharomyces cerevisiae) >gi|171623|gb|AAA34654.1| (L08691) GTP-binding protein [Saccharomyces cerevisiae] >gi|311754|emb|CAA50748.1| (X71946) CNR1 [Saccharomyces cerevisiae] >gi|1420445|emb|CAA99394.1| (Z75093) ORF YOR185c [Saccharomyces cerevisiae] Length = 220 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 220 0 50 100 150 200 Plus Strand HSPs: Score = 599 (210.9 bits), Expect = 7.8e-65, Sum P(2) = 7.8e-65 Identities = 109/129 (84%), Positives = 118/129 (91%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY TIGVEVHPL F+TN G+I+F WDTAGQEKFGGLRDGYYI+ Sbjct: 26 KTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYIN 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKK Sbjct: 86 AQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKK 145 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 146 NLQYYDISA 154 Score = 89 (31.3 bits), Expect = 7.8e-65, Sum P(2) = 7.8e-65 Identities = 16/26 (61%), Positives = 20/26 (76%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 M+ P Q + P+FKLV+VGDGGTGK Sbjct: 1 MSAPAQNNAEVPTFKLVLVGDGGTGK 26 >gi|7505085|pir||T23195 hypothetical protein K01G5.4 - Caenorhabditis elegans >gi|3924787|emb|CAB07240.1| (Z92803) predicted using Genefinder~contains similarity to Pfam domain: PF00071 (Ras family), Score=208.4, E-value=3.6e-59, N=1~cDNA EST EMBL:T00705 comes from this gene; cDNA EST CEESX11R comes from this gene~cDNA EST CEESX58F comes from this gene; cD> Length = 215 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 215 0 50 100 150 200 Plus Strand HSPs: Score = 603 (212.3 bits), Expect = 1.4e-63, Sum P(2) = 1.4e-63 Identities = 111/129 (86%), Positives = 118/129 (91%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G+IRF WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQ 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTAR+TYKNVP WHRDL RVCENIPIVLCGNKVDVK+R+VKAK +TFHRKK Sbjct: 82 GQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCGNKVDVKDRKVKAKTITFHRKK 141 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 142 NLQYYDISA 150 Score = 73 (25.7 bits), Expect = 1.4e-63, Sum P(2) = 1.4e-63 Identities = 13/15 (86%), Positives = 15/15 (100%), Frame = +1 Query: 106 PSFKLVIVGDGGTGK 150 P+FKLV+VGDGGTGK Sbjct: 8 PTFKLVLVGDGGTGK 22 >gi|6323324 ref|NP_013396.1| GTP-binding protein; Gsp1p [Saccharomyces cerevisiae] >gi|417090|sp|P32835|GSP1_YEAST GTP-BINDING NUCLEAR PROTEIN GSP1/CNR1 >gi|486807|pir||S35504 GTP-binding protein GSP1 - yeast (Saccharomyces cerevisiae) >gi|171621|gb|AAA34653.1| (L08690) GTP-binding protein [Saccharomyces cerevisiae] >gi|311752|emb|CAA50747.1| (X71945) CNR2 [Saccharomyces cerevisiae] >gi|596049|gb|AAB67339.1| (U17243) GTP-binding nuclear protein. Highly similar to GSP2_YEAST. Belongs to the Ran family of Ras proteins [Saccharomyces cerevisiae] Length = 219 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 219 0 50 100 150 200 Plus Strand HSPs: Score = 599 (210.9 bits), Expect = 3.0e-63, Sum P(2) = 3.0e-63 Identities = 109/129 (84%), Positives = 118/129 (91%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY TIGVEVHPL F+TN G+I+F WDTAGQEKFGGLRDGYYI+ Sbjct: 25 KTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYIN 84 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKK Sbjct: 85 AQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKK 144 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 145 NLQYYDISA 153 Score = 74 (26.0 bits), Expect = 3.0e-63, Sum P(2) = 3.0e-63 Identities = 13/17 (76%), Positives = 16/17 (94%), Frame = +1 Query: 100 DYPSFKLVIVGDGGTGK 150 + P+FKLV+VGDGGTGK Sbjct: 9 EVPTFKLVLVGDGGTGK 25 >gi|9758105|dbj|BAB08577.1| (AB010071) salt stress inducible small GTP binding protein Ran1-like protein [Arabidopsis thaliana] Length = 222 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 222 0 50 100 150 200 Plus Strand HSPs: Score = 550 (193.6 bits), Expect = 1.3e-62, Sum P(2) = 1.3e-62 Identities = 98/129 (75%), Positives = 113/129 (87%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTF+KRHLTGEFE EPT+GV+++PLDFFTN GKIRF CWDTAGQEK+ GL+D YYIH Sbjct: 26 KTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFTNRGKIRFECWDTAGQEKYSGLKDAYYIH 85 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTAR TY N+ W+RDL RVC+NIPIVLCGNKVDV +RQ+K K V++HRKK Sbjct: 86 GQCAIIMFDVTARHTYMNIDRWYRDLRRVCKNIPIVLCGNKVDVPSRQIKPKHVSYHRKK 145 Query: 507 NLQYYEISA 533 LQYYE+SA Sbjct: 146 CLQYYEMSA 154 Score = 117 (41.2 bits), Expect = 1.3e-62, Sum P(2) = 1.3e-62 Identities = 22/26 (84%), Positives = 24/26 (92%), Frame = +1 Query: 73 MALPNQQTVDYPSFKLVIVGDGGTGK 150 MALPNQQ VD P+FKL+IVGDGGTGK Sbjct: 1 MALPNQQNVDLPTFKLLIVGDGGTGK 26 >gi|585779|sp|P38542|RAN_BRUMA GTP-BINDING NUCLEAR PROTEIN RAN/TC4 >gi|477262|pir||A48463 Ras-like GTP-binding protein - nematode (Brugia malayi) Length = 215 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 215 0 50 100 150 200 __________________ Annotated Domains: Entrez np-binding site: GTP (BY SIMILARITY). 16..23 Entrez np-binding site: GTP (BY SIMILARITY). 64..68 Entrez np-binding site: GTP (BY SIMILARITY). 121..124 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 126..141 PFAM ras: Ras family 11..188 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 10..31 PRINTS 1: RAN family motif I - 2 23..37 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 33..49 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 51..73 PRINTS 2: RAN family motif II - 2 70..88 PRINTS 3: RAN family motif III - 2 90..111 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 112..125 PRINTS 4: RAN family motif IV - 2 126..144 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 145..167 PRINTS 5: RAN family motif V - 2 164..186 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 10..167 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 169..214 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 16..23 PROSITE RAN: GTP-binding nuclear protein ran sig 64..79 __________________ Plus Strand HSPs: Score = 588 (207.0 bits), Expect = 1.6e-62, Sum P(2) = 1.6e-62 Identities = 108/129 (83%), Positives = 116/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTG+FEKKY T+GVEVHPL F TN G+IRF WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGDFEKKYVATLGVEVHPLIFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQ 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCA MFDVTAR+TYKNVP WHRDL RVCENIPIVLCGNKVDVK+R+VKAK +TFHRKK Sbjct: 82 GQCAFNMFDVTARVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRKVKAKTITFHRKK 141 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 142 NLQYYDISA 150 Score = 78 (27.5 bits), Expect = 1.6e-62, Sum P(2) = 1.6e-62 Identities = 14/17 (82%), Positives = 16/17 (94%), Frame = +1 Query: 100 DYPSFKLVIVGDGGTGK 150 D P+FKLV+VGDGGTGK Sbjct: 6 DIPTFKLVLVGDGGTGK 22 >gi|7292609|gb|AAF48008.1| (AE003485) ran gene product [Drosophila melanogaster] >gi|7331134|gb|AAF60289.1|AF233584_1 (AF233584) Ran10A [Drosophila melanogaster] Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 589 (207.3 bits), Expect = 2.1e-62, Sum P(2) = 2.1e-62 Identities = 106/129 (82%), Positives = 116/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRH+TGEFEKKY T+GVEVHPL F TN G IRF WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCA+IMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 GQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 76 (26.8 bits), Expect = 2.1e-62, Sum P(2) = 2.1e-62 Identities = 14/21 (66%), Positives = 17/21 (80%), Frame = +1 Query: 88 QQTVDYPSFKLVIVGDGGTGK 150 Q+ D P+FK V+VGDGGTGK Sbjct: 3 QEGQDIPTFKCVLVGDGGTGK 23 >gi|477814|pir||B48463 Ras-like GTP-binding protein - nematode (Onchocerca volvulus) Length = 215 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 215 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00006: RASTRANSFORMINGPROTEIN 6..153 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 154..215 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 16..23 PROSITE RAN: GTP-binding nuclear protein ran sig 64..79 __________________ Plus Strand HSPs: Score = 582 (204.9 bits), Expect = 7.0e-62, Sum P(2) = 7.0e-62 Identities = 108/129 (83%), Positives = 116/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTG+ EKKY T+GVEVHPL F TN G+IRF WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGDPEKKYVATLGVEVHPLIFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQ 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTAR+TYKNVP WHRDL RVCENIPIVLCGN VDVK+R+VKAK +TFHRKK Sbjct: 82 GQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCGNFVDVKDRKVKAKTITFHRKK 141 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 142 NLQYYDISA 150 Score = 78 (27.5 bits), Expect = 7.0e-62, Sum P(2) = 7.0e-62 Identities = 14/17 (82%), Positives = 16/17 (94%), Frame = +1 Query: 100 DYPSFKLVIVGDGGTGK 150 D P+FKLV+VGDGGTGK Sbjct: 6 DIPTFKLVLVGDGGTGK 22 >gi|585781|sp|P38544|RAN_ONCVO GTP-BINDING NUCLEAR PROTEIN RAN/TC4 Length = 215 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 215 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00006: RASTRANSFORMINGPROTEIN 6..154 Entrez np-binding site: GTP (BY SIMILARITY). 16..23 Entrez np-binding site: GTP (BY SIMILARITY). 64..68 Entrez np-binding site: GTP (BY SIMILARITY). 121..124 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 126..141 PFAM ras: Ras family 11..188 PRINTS 1: RAN family motif I - 2 23..37 PRINTS 2: RAN family motif II - 2 70..88 PRINTS 3: RAN family motif III - 2 90..111 PRINTS 4: RAN family motif IV - 2 126..144 PRINTS 5: RAN family motif V - 2 164..186 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 10..167 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 169..214 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 16..23 PROSITE RAN: GTP-binding nuclear protein ran sig 64..79 __________________ Plus Strand HSPs: Score = 582 (204.9 bits), Expect = 7.0e-62, Sum P(2) = 7.0e-62 Identities = 108/129 (83%), Positives = 116/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTG+ EKKY T+GVEVHPL F TN G+IRF WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGDPEKKYVATLGVEVHPLIFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQ 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVTAR+TYKNVP WHRDL RVCENIPIVLCGN VDVK+R+VKAK +TFHRKK Sbjct: 82 GQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCGNFVDVKDRKVKAKTITFHRKK 141 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 142 NLQYYDISA 150 Score = 78 (27.5 bits), Expect = 7.0e-62, Sum P(2) = 7.0e-62 Identities = 14/17 (82%), Positives = 16/17 (94%), Frame = +1 Query: 100 DYPSFKLVIVGDGGTGK 150 D P+FKLV+VGDGGTGK Sbjct: 6 DIPTFKLVLVGDGGTGK 22 >gi|8698689|gb|AAF78478.1|AF190700_1 (AF190700) small G-protein Gsp1p [Candida albicans] Length = 214 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 214 0 50 100 150 200 Plus Strand HSPs: Score = 585 (205.9 bits), Expect = 8.9e-62, Sum P(2) = 8.9e-62 Identities = 106/129 (82%), Positives = 117/129 (90%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEV+PL F TN G+++F WDTAGQEKFGGLRDGYYI+ Sbjct: 20 KTTFVKRHLTGEFEKKYIATLGVEVNPLGFHTNFGELKFDVWDTAGQEKFGGLRDGYYIN 79 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQC IIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK R+VKAK +TFHRKK Sbjct: 80 GQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKK 139 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 140 NLQYYDISA 148 Score = 74 (26.0 bits), Expect = 8.9e-62, Sum P(2) = 8.9e-62 Identities = 13/17 (76%), Positives = 16/17 (94%), Frame = +1 Query: 100 DYPSFKLVIVGDGGTGK 150 + P+FKLV+VGDGGTGK Sbjct: 4 EVPTFKLVLVGDGGTGK 20 >gi|346437|pir||JC1455 GTP-binding protein Ran/TC4 - dog >gi|6730007|pdb|1BYU|B Chain B, Canine Gdp-Ran >gi|6730006|pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: ___ _____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 __________________ Annotated Domains: PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 17..24 PROSITE RAN: GTP-binding nuclear protein ran sig 65..80 __________________ Plus Strand HSPs: Score = 591 (208.0 bits), Expect = 1.8e-61, Sum P(2) = 1.8e-61 Identities = 107/129 (82%), Positives = 116/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY PT+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 1.8e-61, Sum P(2) = 1.8e-61 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|5453555 ref|NP_006316.1| ras-related nuclear protein [Homo sapiens] >gi|6678365 ref|NP_033417.1| RAN, member RAS oncogene family [Mus sp.] >gi|12737304 ref|XP_012170.1| similar to RAN, member RAS oncogene family (H. sapiens) [Homo sapiens] >gi|131844|sp|P28746|RAN_MOUSE GTP-BINDING NUCLEAR PROTEIN RAN (TC4) >gi|2118457|pir||I57020 GTP-binding protein Ran - mouse >gi|2144602|pir||TVHUC3 GTP-binding protein Ran/TC4 - human >gi|3212264|pdb|1A2K|E Chain E, Gdpran-Ntf2 Complex >gi|3212263|pdb|1A2K|D Chain D, Gdpran-Ntf2 Complex >gi|3212262|pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex >gi|5542273|pdb|1IBR|A Chain A, Complex Of Ran With Importin Beta >gi|5542275|pdb|1IBR|C Chain C, Complex Of Ran With Importin Beta >gi|924|emb|CAA77980.1| (Z11922) Ran [Canis familiaris] >gi|190879|gb|AAA36546.1| (M31469) ras-like protein [Homo sapiens] >gi|263630|gb|AAB24940.1| Ran/TC4 gene product nuclear GTP-binding protein [human, Peptide, 216 aa] >gi|727167|gb|AAA64247.1| (L32751) Ran [Mus musculus] >gi|1911761|gb|AAB50841.1| (S83456) GTP-binding protein [mice, C3H/HeJ spleens, LDS responder, Peptide, 216 aa] [Mus sp.] >gi|2967848|gb|AAC05840.1| (AF052578) androgen receptor associated protein 24 [Homo sapiens] >gi|5566235|gb|AAD45343.1|AF159256_1 (AF159256) Lps/Ran GTPase [Mus musculus] >gi|11228976|gb|AAG33229.1|AF306457_1 (AF306457) GTPase [Rattus norvegicus] >gi|12654085|gb|AAH00852.1|AAH00852 (BC000852) RAN, member RAS oncogene family [Homo sapiens] Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 583 (205.2 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 106/129 (82%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|1172839|sp|P42558|RAN_CHICK GTP-BINDING NUCLEAR PROTEIN RAN (TC4) >gi|283915|pir||S24031 GTP-binding protein, ras-like - chicken >gi|63765|emb|CAA47355.1| (X66906) ras-like protein [Gallus gallus] >gi|228911|prf||1814339A ras-like protein [Gallus gallus] Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 __________________ Annotated Domains: Entrez np-binding site: GTP (BY SIMILARITY). 17..24 Entrez np-binding site: GTP (BY SIMILARITY). 65..69 Entrez np-binding site: GTP (BY SIMILARITY). 122..125 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 127..142 PFAM ras: Ras family 12..189 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 11..32 PRINTS 1: RAN family motif I - 2 24..38 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 34..50 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 52..74 PRINTS 2: RAN family motif II - 2 71..89 PRINTS 3: RAN family motif III - 2 91..112 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 113..126 PRINTS 4: RAN family motif IV - 2 127..145 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 146..168 PRINTS 5: RAN family motif V - 2 165..187 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 11..167 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 170..215 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 17..24 PROSITE RAN: GTP-binding nuclear protein ran sig 65..80 __________________ Plus Strand HSPs: Score = 583 (205.2 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 106/129 (82%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|4092054|gb|AAC99400.1| (AF054183) GTP binding protein [Homo sapiens] Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 583 (205.2 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 106/129 (82%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|5107682|pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex >gi|5107684|pdb|1RRP|C Chain C, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 Frame 3 hits (HSPs): _________________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 204 0 50 100 150 200 Plus Strand HSPs: Score = 583 (205.2 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 106/129 (82%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 16 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 75 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 76 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 135 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 136 NLQYYDISA 144 Score = 65 (22.9 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 4 FKLVLVGDGGTGK 16 >gi|6729160|dbj|BAA89696.1| (AB030945) ran GTP-binding protein [Xenopus laevis] Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 583 (205.2 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 106/129 (82%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 1.3e-60, Sum P(2) = 1.3e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|6857182|gb|AAF30287.1| (AF220950) GTP-binding nuclear protein RAN [Drosophila melanogaster] Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 570 (200.7 bits), Expect = 2.1e-60, Sum P(2) = 2.1e-60 Identities = 103/129 (79%), Positives = 113/129 (87%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRH+TGEFEKKY T+GVEVHPL F TN G IRF WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCA+IM D +R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 GQCAVIMVDGNSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 76 (26.8 bits), Expect = 2.1e-60, Sum P(2) = 2.1e-60 Identities = 14/21 (66%), Positives = 17/21 (80%), Frame = +1 Query: 88 QQTVDYPSFKLVIVGDGGTGK 150 Q+ D P+FK V+VGDGGTGK Sbjct: 3 QEGQDIPTFKCVLVGDGGTGK 23 >gi|2500061|sp|P79735|RAN_BRARE GTP-BINDING NUCLEAR PROTEIN RAN >gi|1747495|gb|AAB97093.1| (U61395) Ran [Danio rerio] Length = 215 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ___ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 215 0 50 100 150 200 __________________ Annotated Domains: Entrez np-binding site: GTP (BY SIMILARITY). 16..23 Entrez np-binding site: GTP (BY SIMILARITY). 64..68 Entrez np-binding site: GTP (BY SIMILARITY). 121..124 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 126..141 PFAM ras: Ras family 11..188 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 10..31 PRINTS 1: RAN family motif I - 2 23..37 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 33..49 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 51..73 PRINTS 2: RAN family motif II - 2 70..88 PRINTS 3: RAN family motif III - 2 90..111 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 112..125 PRINTS 4: RAN family motif IV - 2 126..144 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 145..167 PRINTS 5: RAN family motif V - 2 164..186 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 10..166 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 169..214 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 16..23 PROSITE RAN: GTP-binding nuclear protein ran sig 64..79 __________________ Plus Strand HSPs: Score = 580 (204.2 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 105/129 (81%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I++ WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQ 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 82 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 141 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 142 NLQYYDISA 150 Score = 65 (22.9 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 10 FKLVLVGDGGTGK 22 >gi|3850118|emb|CAA10039.1| (AJ012477) Ran protein [Salmo salar] >gi|3850120|emb|CAA10040.1| (AJ012478) Ran protein [Salmo salar] Length = 215 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 215 0 50 100 150 200 Plus Strand HSPs: Score = 580 (204.2 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 105/129 (81%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I++ WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQ 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 82 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 141 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 142 NLQYYDISA 150 Score = 65 (22.9 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 10 FKLVLVGDGGTGK 22 >gi|3894108|emb|CAA10191.1| (AJ012827) Ran protein [Salmo salar] Length = 156 Frame 3 hits (HSPs): __________________________________________ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 156 0 50 100 150 Plus Strand HSPs: Score = 580 (204.2 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 105/129 (81%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I++ WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKYNVWDTAGQEKFGGLRDGYYIQ 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 82 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 141 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 142 NLQYYDISA 150 Score = 65 (22.9 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 10 FKLVLVGDGGTGK 22 >gi|5542357|pdb|1QG4|B Chain B, Canine Gdp-Ran F72y Mutant >gi|5542356|pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 580 (204.2 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 105/129 (81%), Positives = 115/129 (89%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEK+GGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKYGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 2.6e-60, Sum P(2) = 2.6e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|5542355|pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 578 (203.5 bits), Expect = 4.3e-60, Sum P(2) = 4.3e-60 Identities = 105/129 (81%), Positives = 114/129 (88%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGL DGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLEDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 4.3e-60, Sum P(2) = 4.3e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|131845|sp|P17080|RAN_HUMAN GTP-BINDING NUCLEAR PROTEIN RAN (TC4) Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 __________________ Annotated Domains: Entrez np-binding site: GTP (BY SIMILARITY). 17..24 Entrez np-binding site: GTP (BY SIMILARITY). 65..69 Entrez np-binding site: GTP (BY SIMILARITY). 122..125 Entrez Domain: IBB DOMAIN. 127..142 PFAM ras: Ras family 12..189 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 11..32 PRINTS 1: RAN family motif I - 2 24..38 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 34..50 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 52..74 PRINTS 2: RAN family motif II - 2 71..89 PRINTS 3: RAN family motif III - 2 91..112 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 113..126 PRINTS 4: RAN family motif IV - 2 127..145 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 146..168 PRINTS 5: RAN family motif V - 2 165..187 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 11..167 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 170..215 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 17..24 PROSITE RAN: GTP-binding nuclear protein ran sig 65..80 __________________ Plus Strand HSPs: Score = 577 (203.1 bits), Expect = 5.5e-60, Sum P(2) = 5.5e-60 Identities = 105/129 (81%), Positives = 114/129 (88%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+ +VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDSKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 5.5e-60, Sum P(2) = 5.5e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|5107637|pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-Ran Gppnhp Nuclear Transport Complex Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 577 (203.1 bits), Expect = 5.5e-60, Sum P(2) = 5.5e-60 Identities = 105/129 (81%), Positives = 114/129 (88%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAII FDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIXFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 5.5e-60, Sum P(2) = 5.5e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|6729842|pdb|3RAN|B Chain B, Canine Gdp-Ran Q69l Mutant >gi|4139786|pdb|3RAN|C Chain C, Canine Gdp-Ran Q69l Mutant >gi|4139787|pdb|3RAN|D Chain D, Canine Gdp-Ran Q69l Mutant >gi|4139784|pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 576 (202.8 bits), Expect = 7.0e-60, Sum P(2) = 7.0e-60 Identities = 105/129 (81%), Positives = 114/129 (88%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G I+F WDTAG EKFGGLRDGYYI Sbjct: 23 KTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K+R+VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 65 (22.9 bits), Expect = 7.0e-60, Sum P(2) = 7.0e-60 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 11 FKLVLVGDGGTGK 23 >gi|4583670|emb|CAB40408.1| (AJ010592) GTP-binding nuclear protein RAN [Guillardia theta] Length = 213 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 213 0 50 100 150 200 Plus Strand HSPs: Score = 575 (202.4 bits), Expect = 3.8e-59, Sum P(2) = 3.8e-59 Identities = 105/129 (81%), Positives = 117/129 (90%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL FF++ G+I F WDTAGQEKFGGLRDGYYI Sbjct: 20 KTTFVKRHLTGEFEKKYIATLGVEVHPLKFFSSSGEIIFNIWDTAGQEKFGGLRDGYYIQ 79 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQ AIIMFDVT+RLTYKNVP WHRDL RVC+NIPIVL GNKVD+++R+VKAKQ+TFHRKK Sbjct: 80 GQAAIIMFDVTSRLTYKNVPNWHRDLTRVCDNIPIVLVGNKVDIRDRKVKAKQITFHRKK 139 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 140 NLQYYDISA 148 Score = 59 (20.8 bits), Expect = 3.8e-59, Sum P(2) = 3.8e-59 Identities = 10/13 (76%), Positives = 12/13 (92%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKL++VGDGG GK Sbjct: 8 FKLILVGDGGVGK 20 >gi|6677677 ref|NP_033054.1| RAS-like, family 2, locus 9 [Mus musculus] >gi|2500060|sp|Q61820|RANT_MOUSE GTP-BINDING NUCLEAR PROTEIN RAN, TESTIS-SPECIFIC ISOFORM >gi|2118458|pir||I76676 gene Ran protein - mouse >gi|727169|gb|AAA64248.1| (L32752) Ran [Mus musculus] Length = 216 Frame 3 hits (HSPs): ______________________________ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 559 (196.8 bits), Expect = 8.9e-58, Sum P(2) = 8.9e-58 Identities = 102/129 (79%), Positives = 114/129 (88%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTF+KRHLTGEFEK+Y T+GVEVH L F TN G I+F WDTAGQEKFGGLRDGYYI Sbjct: 23 KTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQ 82 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 QCAIIMFDVT+R+TYKNVP+WH+DL RVCENIPIVLCGNKVDVK+ +VKAK + FHRKK Sbjct: 83 AQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDVKDMKVKAKPILFHRKK 142 Query: 507 NLQYYEISA 533 NLQYY+ISA Sbjct: 143 NLQYYDISA 151 Score = 62 (21.8 bits), Expect = 8.9e-58, Sum P(2) = 8.9e-58 Identities = 11/13 (84%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FK+V+VGDGGTGK Sbjct: 11 FKVVLVGDGGTGK 23 >gi|585782|sp|P38545|RAN_PLAFA GTP-BINDING NUCLEAR PROTEIN RAN/TC4 >gi|627065|pir||JC2246 ras related nuclear GTP binding protein Ran/TC4 homolog - Plasmodium falciparum >gi|1078787|pir||JC2374 ras-related nuclear GTP binding protein Ran/TC4 homolog - malaria parasite (Plasmodium falciparum) >gi|476130|gb|AAA19587.1| (U06051) homologue to human Ran/TC4 nuclear GTP-binding protein, PIR Accession Number A44393 [Plasmodium falciparum] Length = 214 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 214 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00006: RASTRANSFORMINGPROTEIN 6..154 Entrez np-binding site: GTP (BY SIMILARITY). 16..23 Entrez np-binding site: GTP (BY SIMILARITY). 64..68 Entrez np-binding site: GTP (BY SIMILARITY). 121..124 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 126..141 PFAM ras: Ras family 11..199 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 10..31 PRINTS 1: RAN family motif I - 2 23..37 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 33..49 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 51..73 PRINTS 2: RAN family motif II - 2 70..88 PRINTS 3: RAN family motif III - 2 90..111 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 112..125 PRINTS 4: RAN family motif IV - 2 126..144 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 145..167 PRINTS 5: RAN family motif V - 2 164..186 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 10..166 PRODOM PD050009: RAN_PLAFA 168..213 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 16..23 PROSITE RAN: GTP-binding nuclear protein ran sig 64..79 __________________ Plus Strand HSPs: Score = 553 (194.7 bits), Expect = 3.0e-57, Sum P(2) = 3.0e-57 Identities = 99/129 (76%), Positives = 114/129 (88%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY PT+GVEVHPL F TN GK +F WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGEFEKKYIPTLGVEVHPLKFQTNFGKTQFNVWDTAGQEKFGGLRDGYYIK 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 CAIIMFDV++R+TYKNVP W+RD+ RVCE IP+VL GNKVDVK+RQVK++Q+ FHRK+ Sbjct: 82 SDCAIIMFDVSSRITYKNVPNWYRDITRVCETIPMVLVGNKVDVKDRQVKSRQIQFHRKR 141 Query: 507 NLQYYEISA 533 NLQYY++SA Sbjct: 142 NLQYYDLSA 150 Score = 63 (22.2 bits), Expect = 3.0e-57, Sum P(2) = 3.0e-57 Identities = 10/15 (66%), Positives = 13/15 (86%), Frame = +1 Query: 106 PSFKLVIVGDGGTGK 150 P +KL++VGDGG GK Sbjct: 8 PQYKLILVGDGGVGK 22 >gi|606985|gb|AAA79869.1| (U17086) GTP-binding protein rtb2 [Trypanosoma brucei] Length = 205 Frame 3 hits (HSPs): ________________________________ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 205 0 50 100 150 200 Plus Strand HSPs: Score = 545 (191.8 bits), Expect = 1.3e-56, Sum P(2) = 1.3e-56 Identities = 101/129 (78%), Positives = 110/129 (85%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEK+Y T+GV+VHPL F TN GKI F CWDTAGQEKFGGLRDGYYI Sbjct: 13 KTTFVKRHLTGEFEKRYVATVGVDVHPLTFHTNRGKICFNCWDTAGQEKFGGLRDGYYIE 72 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 GQCAIIMFDVT+R TYKNVP WHRD+ VC+NIPIVL GNKVD RQVKAK +TFH+K Sbjct: 73 GQCAIIMFDVTSRNTYKNVPNWHRDITGVCDNIPIVLVGNKVDCAERQVKAKMITFHQK- 131 Query: 507 NLQYYEISA 533 LQYY+ISA Sbjct: 132 GLQYYDISA 140 Score = 65 (22.9 bits), Expect = 1.3e-56, Sum P(2) = 1.3e-56 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +1 Query: 112 FKLVIVGDGGTGK 150 FKLV+VGDGGTGK Sbjct: 1 FKLVLVGDGGTGK 13 >gi|542430|pir||S40121 ras-related nuclear protein - malaria parasite (Plasmodium falciparum) >gi|436408|emb|CAA52140.1| (X73954) ras-related nuclear protein [Plasmodium falciparum] Length = 214 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: ___________________________________ __________________________________________________ Database sequence: | | | | | | 214 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00006: RASTRANSFORMINGPROTEIN 6..154 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 16..23 PROSITE RAN: GTP-binding nuclear protein ran sig 64..79 __________________ Plus Strand HSPs: Score = 545 (191.8 bits), Expect = 2.1e-56, Sum P(2) = 2.1e-56 Identities = 98/129 (75%), Positives = 113/129 (87%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFVKRHLTGEFEKKY T+GVEVHPL F TN GK +F WDTAGQEKFGGLRDGYYI Sbjct: 22 KTTFVKRHLTGEFEKKYIATLGVEVHPLKFQTNFGKTQFNVWDTAGQEKFGGLRDGYYIK 81 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 CAIIMFDV++R+TYKNVP W+RD+ RVCE IP+VL GNKVDVK+RQVK++Q+ FHRK+ Sbjct: 82 SDCAIIMFDVSSRITYKNVPNWYRDITRVCETIPMVLVGNKVDVKDRQVKSRQIQFHRKR 141 Query: 507 NLQYYEISA 533 NLQYY++SA Sbjct: 142 NLQYYDLSA 150 Score = 63 (22.2 bits), Expect = 2.1e-56, Sum P(2) = 2.1e-56 Identities = 10/15 (66%), Positives = 13/15 (86%), Frame = +1 Query: 106 PSFKLVIVGDGGTGK 150 P +KL++VGDGG GK Sbjct: 8 PQYKLILVGDGGVGK 22 >gi|464546|sp|P33519|RAN_DICDI GTP-BINDING NUCLEAR PROTEIN RAN/TC4 >gi|422288|pir||S35619 GTP-binding protein - slime mold (Dictyostelium discoideum) >gi|167894|gb|AAA33255.1| (L09720) GTP-binding protein [Dictyostelium discoideum] >gi|299824|gb|AAB26358.1| TC4 related GTP binding protein [Dictyostelium discoideum, Peptide, 212 aa] Length = 212 Frame 3 hits (HSPs): _______________________________ Frame 1 hits (HSPs): ____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 212 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00006: RASTRANSFORMINGPROTEIN 3..150 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 151..211 Entrez np-binding site: GTP (BY SIMILARITY). 13..20 Entrez np-binding site: GTP (BY SIMILARITY). 61..65 Entrez np-binding site: GTP (BY SIMILARITY). 118..121 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 123..138 PFAM ras: Ras family 8..180 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 7..28 PRINTS 1: RAN family motif I - 2 20..34 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 30..46 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 48..70 PRINTS 2: RAN family motif II - 2 67..85 PRINTS 3: RAN family motif III - 2 87..108 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 109..122 PRINTS 4: RAN family motif IV - 2 123..141 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 142..164 PRINTS 5: RAN family motif V - 2 161..183 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 8..164 PRODOM PD194058: RAN_DICDI 166..211 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 13..20 PROSITE RAN: GTP-binding nuclear protein ran sig 61..76 __________________ Plus Strand HSPs: Score = 553 (194.7 bits), Expect = 2.6e-56, Sum P(2) = 2.6e-56 Identities = 98/129 (75%), Positives = 111/129 (86%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFV+RHLTGEFE +Y PT+GV VHPL F+TN GKI F WDTAGQEKFGGLRDGYYI Sbjct: 19 KTTFVQRHLTGEFEPRYIPTLGVSVHPLIFYTNFGKIHFNVWDTAGQEKFGGLRDGYYIQ 78 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 G CAIIMFDVT+R++YKNVP WH DL RVCENIPIVLCGNKVDVK+R+VK Q+ FHR+ Sbjct: 79 GNCAIIMFDVTSRISYKNVPNWHSDLTRVCENIPIVLCGNKVDVKDRKVKPSQIVFHRRY 138 Query: 507 NLQYYEISA 533 NL YY++SA Sbjct: 139 NLSYYDVSA 147 Score = 54 (19.0 bits), Expect = 2.6e-56, Sum P(2) = 2.6e-56 Identities = 10/12 (83%), Positives = 11/12 (91%), Frame = +1 Query: 115 KLVIVGDGGTGK 150 KLV+VGDGG GK Sbjct: 8 KLVLVGDGGVGK 19 >gi|134822|sp|P28748|SPI1_SCHPO GTP-BINDING NUCLEAR PROTEIN SPI1 >gi|101078|pir||A40039 gtp-binding nuclear protein spi1 - fission yeast (Schizosaccharomyces pombe) >gi|299321|gb|AAB25844.1| GTPase=spi1 gene product [Schizosaccharomyces pombe, Peptide, 216 aa] >gi|4490658|emb|CAB38683.1| (AL035675) gtp-binding nuclear protein spi1. [Schizosaccharomyces pombe] Length = 216 Frame 3 hits (HSPs): ___________________________________ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL01115A: GTP-binding nuclear protein ra 10..53 BLOCKS BL01115B: GTP-binding nuclear protein ra 90..133 BLOCKS BL01115C: GTP-binding nuclear protein ra 139..169 BLOCKS BL01115D: GTP-binding nuclear protein ra 183..214 Entrez np-binding site: GTP (BY SIMILARITY). 16..23 Entrez np-binding site: GTP (BY SIMILARITY). 64..68 Entrez np-binding site: GTP (BY SIMILARITY). 121..124 PFAM ras: Ras family 11..206 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 10..31 PRINTS 1: RAN family motif I - 2 23..37 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 33..49 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 51..73 PRINTS 2: RAN family motif II - 2 70..88 PRINTS 3: RAN family motif III - 2 90..111 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 112..125 PRINTS 4: RAN family motif IV - 2 126..144 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 145..167 PRINTS 5: RAN family motif V - 2 164..186 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 10..166 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 169..215 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 16..23 PROSITE RAN: GTP-binding nuclear protein ran sig 64..79 __________________ Plus Strand HSPs: Score = 572 (201.4 bits), Expect = 1.8e-54, P = 1.8e-54 Identities = 112/151 (74%), Positives = 121/151 (80%), Frame = +3 Query: 81 AQPANRGLP*FQTRYRRRWWHRKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIR 260 AQP N +P F+ KTTFVKRHLTGEFEKKY T+GVEVHPL F TN G+I Sbjct: 2 AQPQN--VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLHFHTNFGEIC 59 Query: 261 FYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLC 440 F WDTAGQEK GGLRDGYYI GQC IIMFDVT+R+TYKNVP W RDL RVCENIPIVLC Sbjct: 60 FNVWDTAGQEKLGGLRDGYYIQGQCGIIMFDVTSRITYKNVPHWWRDLVRVCENIPIVLC 119 Query: 441 GNKVDVKNRQVKAKQVTFHRKKNLQYYEISA 533 GNKVDVK R+VKAK +TFHRKKNLQYY+ISA Sbjct: 120 GNKVDVKERKVKAKAITFHRKKNLQYYDISA 150 >gi|4336905|gb|AAD18006.1| (AF112244) Ran-related GTP binding protein [Zea mays] Length = 170 Frame 3 hits (HSPs): _______________________________ __________________________________________________ Database sequence: | | | | | 170 0 50 100 150 Plus Strand HSPs: Score = 558 (196.4 bits), Expect = 5.5e-53, P = 5.5e-53 Identities = 100/102 (98%), Positives = 101/102 (99%), Frame = +3 Query: 228 LDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC 407 LDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVT+RLTYKNVPTWHRDLC Sbjct: 2 LDFSTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLC 61 Query: 408 RVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISA 533 RVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISA Sbjct: 62 RVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISA 103 >gi|1172841|sp|P41915|RAN_TETTH GTP-BINDING NUCLEAR PROTEIN RAN/TC4 >gi|559386|dbj|BAA04600.1| (D17748) Ran/TC4 [Tetrahymena thermophila] Length = 225 Frame 3 hits (HSPs): _____________________________ Frame 1 hits (HSPs): ______ Annotated Domains: _______________________________________________ __________________________________________________ Database sequence: | | | | | | 225 0 50 100 150 200 __________________ Annotated Domains: Entrez np-binding site: GTP (BY SIMILARITY). 18..25 Entrez np-binding site: GTP (BY SIMILARITY). 66..70 Entrez np-binding site: GTP (BY SIMILARITY). 123..126 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 128..143 PFAM ras: Ras family 13..202 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 12..33 PRINTS 1: RAN family motif I - 2 25..39 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 35..51 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 53..75 PRINTS 2: RAN family motif II - 2 72..90 PRINTS 3: RAN family motif III - 2 92..113 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 114..127 PRINTS 4: RAN family motif IV - 2 128..146 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 147..169 PRINTS 5: RAN family motif V - 2 166..188 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 12..168 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 171..221 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 18..25 PROSITE RAN: GTP-binding nuclear protein ran sig 66..81 __________________ Plus Strand HSPs: Score = 481 (169.3 bits), Expect = 6.9e-50, Sum P(2) = 6.9e-50 Identities = 87/129 (67%), Positives = 105/129 (81%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFV RH TGEFEK+Y T GV V + +T G IRF WDTAGQEK GGLR+GYYI Sbjct: 24 KTTFVTRHQTGEFEKRYIATQGVNVSNMVLYTTKGPIRFNIWDTAGQEKLGGLREGYYIG 83 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 AI+MFDVT+R+TYKN+P WH+DL R+CENIPIVL GNKVD K+R+VKA+Q+TFHRK+ Sbjct: 84 ANAAIMMFDVTSRITYKNIPKWHKDLTRICENIPIVLVGNKVDSKDRKVKARQITFHRKR 143 Query: 507 NLQYYEISA 533 +LQYY++SA Sbjct: 144 SLQYYDVSA 152 Score = 65 (22.9 bits), Expect = 6.9e-50, Sum P(2) = 6.9e-50 Identities = 14/22 (63%), Positives = 16/22 (72%), Frame = +1 Query: 85 NQQTVDYPSFKLVIVGDGGTGK 150 N+Q V FKLV+VGDGG GK Sbjct: 4 NKQNV-VAEFKLVLVGDGGVGK 24 >gi|1172840|sp|P41914|RAN_TETPY GTP-BINDING NUCLEAR PROTEIN RAN/TC4 >gi|559385|dbj|BAA04849.1| (D21825) Ran/TC4 [Tetrahymena pyriformis] Length = 223 Frame 3 hits (HSPs): _____________________________ Frame 1 hits (HSPs): ______ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 223 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00006: RASTRANSFORMINGPROTEIN 8..155 DOMO DM01222: GTP-BINDINGNUCLEARPROTEINRAN 156..222 Entrez np-binding site: GTP (BY SIMILARITY). 18..25 Entrez np-binding site: GTP (BY SIMILARITY). 66..70 Entrez np-binding site: GTP (BY SIMILARITY). 123..126 Entrez Domain: IBB DOMAIN (BY SIMILARITY). 128..143 PFAM ras: Ras family 13..183 PRINTS RASTRNSFRMNG1: P21 RAS motif I - 3 12..33 PRINTS 1: RAN family motif I - 2 25..39 PRINTS RASTRNSFRMNG2: P21 RAS motif II - 3 35..51 PRINTS RASTRNSFRMNG3: P21 RAS motif III - 3 53..75 PRINTS 2: RAN family motif II - 2 72..90 PRINTS 3: RAN family motif III - 2 92..113 PRINTS RASTRNSFRMNG4: P21 RAS motif IV - 3 114..127 PRINTS 4: RAN family motif IV - 2 128..146 PRINTS RASTRNSFRMNG5: P21 RAS motif V - 3 147..169 PRINTS 5: RAN family motif V - 2 166..188 PRODOM PD000015: GBA1(22) IF2(15) ARF1(14) 12..168 PRODOM PD002821: RAN(9) RAN1(2) RAN2(2) 171..219 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 18..25 PROSITE RAN: GTP-binding nuclear protein ran sig 66..81 __________________ Plus Strand HSPs: Score = 470 (165.4 bits), Expect = 1.3e-48, Sum P(2) = 1.3e-48 Identities = 85/129 (65%), Positives = 103/129 (79%), Frame = +3 Query: 147 KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH 326 KTTFV RH TGEFEK+Y T GV V + T G IRF WDTAGQEK GGLR+GYYI Sbjct: 24 KTTFVTRHQTGEFEKRYIATQGVNVSNMILHTTKGAIRFNIWDTAGQEKLGGLREGYYIG 83 Query: 327 GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK 506 AI+MFDVT+R+TYKN+P WH+DL R+CEN+PIVL GNKVD K+ +VKA+Q+TFHRK+ Sbjct: 84 ADAAIMMFDVTSRITYKNIPKWHKDLTRICENVPIVLVGNKVDSKDSKVKARQITFHRKR 143 Query: 507 NLQYYEISA 533 +LQYY++SA Sbjct: 144 SLQYYDVSA 152 Score = 64 (22.5 bits), Expect = 1.3e-48, Sum P(2) = 1.3e-48 Identities = 14/22 (63%), Positives = 16/22 (72%), Frame = +1 Query: 85 NQQTVDYPSFKLVIVGDGGTGK 150 N+Q V FKLV+VGDGG GK Sbjct: 4 NKQDV-VAEFKLVLVGDGGVGK 24 WARNING: HSPs involving 1223 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.98 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.333 0.145 0.491 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.348 0.152 0.593 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.330 0.140 0.433 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.340 0.150 0.518 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.347 0.149 0.538 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.360 0.158 0.604 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 182 182 10. 76 3 12 22 0.12 34 31 0.12 37 +2 0 182 181 10. 76 3 12 22 0.12 34 31 0.12 37 +1 0 182 181 10. 76 3 12 22 0.12 34 31 0.12 37 -1 0 182 182 10. 76 3 12 22 0.12 34 31 0.12 37 -2 0 182 182 10. 76 3 12 22 0.12 34 31 0.12 37 -3 0 182 181 10. 76 3 12 22 0.12 34 31 0.12 37 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 1273 No. of states in DFA: 592 (58 KB) Total size of DFA: 234 KB (256 KB) Time to generate neighborhood: 0.01u 0.01s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 197.45u 1.09s 198.54t Elapsed: 00:00:34 Total cpu time: 197.51u 1.13s 198.64t Elapsed: 00:00:34 Start: Sat Feb 2 03:17:36 2002 End: Sat Feb 2 03:18:10 2002 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000