of the residues that compose this conserved feature have been mapped to the query sequence.
Click on the triangle to view details about the feature, including a multiple sequence alignment
of your query sequence and the protein sequences used to curate the domain model,
where hash marks (#) above the aligned sequences show the location of the conserved feature residues.
The thumbnail image, if present, provides an approximate view of the feature's location in 3 dimensions.
Click on the triangle for interactive 3D structure viewing options.
|
This image shows a graphical summary of conserved domains identified on the query sequence.
The Show Concise/Full Display button at the top of the page can be used to select the desired level of detail: only top scoring hits
(labeled illustration) or all hits
(labeled illustration).
Domains are color coded according to superfamilies
to which they have been assigned. Hits with scores that pass a domain-specific threshold
(specific hits) are drawn in bright colors.
Others (non-specific hits) and
superfamily placeholders are drawn in pastel colors.
if a domain or superfamily has been annotated with functional sites (conserved features),
they are mapped to the query sequence and indicated through sets of triangles
with the same color and shade of the domain or superfamily that provides the annotation.
Mouse over the colored bars or triangles to see descriptions of the domains and features.
click on the bars or triangles to view your query sequence embedded in a multiple sequence alignment of the proteins used to develop the corresponding domain model.
|
The table lists conserved domains identified on the query sequence. Click on the plus sign (+) on the left to display full descriptions, alignments, and scores.
Click on the PssmId to view the multiple sequence alignment of the proteins used to develop the corresponding domain model.
To view your query sequence embedded in that multiple sequence alignment, click on the colored bars in the Graphical Summary portion of the search results page,
or click on the triangles, if present, that represent functional sites (conserved features)
mapped to the query sequence.
|
Concise Display shows only the best scoring domain model, in each hit category listed below except non-specific hits, for each region on the query sequence.
(labeled illustration)
Full Display shows all domain models, in each hit category below, that meet or exceed the RPS-BLAST threshold for statistical significance.
(labeled illustration)
Four types of hits can be shown, as available,
for each region on the query sequence:
- specific hits meet or exceed a domain-specific e-value threshold
(illustrated example)
and represent a very high confidence that the query sequence belongs to the same protein family as the sequences use to create the domain model
- non-specific hits
meet or exceed the RPS-BLAST threshold for statistical significance (default E-value cutoff of 0.01, or an E-value selected by user via the
advanced search options)
- the domain superfamily to which the specific and non-specific hits belong
-
multi-domain models that were computationally detected and are likely to contain multiple single domains
The CD-Search help document provides more detail about the tool and its features.
|
Retrieve proteins that contain one or more of the domains present in the query sequence, using the Conserved Domain Architecture Retrieval Tool
(CDART).
|
111333 |
pfam02427 |
PSI_PsaE |
Photosystem I reaction centre subunit IV / PsaE |
Photosystem I reaction centre subunit IV / PsaE |
true |
false |
false |
62 |
2e-21 |
96.36 |
100.00 |
10 20 30 40 50 60
....*....|....*....|....*....|....*....|....*....|....*....|...
local 84 PKRGSKVKILRKESYWYKNVGSVVAVDQDpKTRYPVVVRFAKVNYA-NISTNNYALDEVEEVK 145
pfam02427 1 IKRGSKVRILRPESYWYNEVGTVASVDQS-GIRYPVIVRFEKVNYNgGVNTNNFALDELVEVA 62
|
|
cl03585 |
122278 |
PSI_PsaE |
Photosystem I reaction centre subunit IV / PsaE |
Photosystem I reaction centre subunit IV / PsaE |
-1 |
100234 |
CHL00125 |
psaE |
photosystem I subunit IV; Reviewed |
photosystem I subunit IV; Reviewed |
false |
false |
false |
65 |
3e-20 |
92.56 |
92.31 |
10 20 30 40 50 60
....*....|....*....|....*....|....*....|....*....|....*....|.
local 85 KRGSKVKILRKESYWYKNVGSVVAVDQDpKTRYPVVVRFAKVNYANISTNNYALDEVEEVK 145
CHL00125 3 KRGSKVRILRKESYWYQEIGTVATVDQS-GIRYPVLVRFEKVNYSGVNTNNFALDELVEVK 62
|
|
cl03585 |
122278 |
PSI_PsaE |
Photosystem I reaction centre subunit IV / PsaE |
Photosystem I reaction centre subunit IV / PsaE |
-1 |
101099 |
PRK02749 |
PRK02749 |
photosystem I reaction center subunit IV; Provisional |
photosystem I reaction center subunit IV; Provisional |
false |
false |
false |
71 |
3e-17 |
82.49 |
94.37 |
10 20 30 40 50 60
....*....|....*....|....*....|....*....|....*....|....*....|....*...
local 85 KRGSKVKILRKESYWYKNVGSVVAVDQDpKTRYPVVVRFAKVNYANIS-------TNNYALDEVEEVK 145
PRK02749 4 SRGDKVRIKRPESYWYNEVGTVASVDTS-GIKYPVVVRFDKVNYNGFSgvdgginTNNFAESELEEAA 70
|
|
cl03585 |
122278 |
PSI_PsaE |
Photosystem I reaction centre subunit IV / PsaE |
Photosystem I reaction centre subunit IV / PsaE |
-1 |
|
|
|