| |||||||||||||||||||
display_name: | traR |
---|---|
locus_tag: | Atu6134 |
old_locus_tag: | AGR_pTi_249 |
Coordinates | 152839..153543 (-1) |
protein_id: | NP_396657.1 |
---|---|
VIMSS: | 131289 |
GI: | 16119952 |
GeneID: | 1137457 |
Genome | NC_003065 |
effector: | TraM |
---|---|
effector: | conjugation factor |
site: | TraR-activated promoter region of traR | article:2518 |
---|
Key: Hover over and click on "details" for more information on a particular experiment. "Result" is a short description of the experiment result. "Methods" use a ontology to describe the methods of the experiment. "G" is to define an experiment which involves this gene while "R" is to define an experiment which involves the product of this gene as a regulator. | |||
Result | Methods | ||
---|---|---|---|
(details) | Gene/operon activation | Fusion construction; Mutant analysis; Regulator transfection | R |
(details) | Regulatory site mapping | Gel retardation | R |
(details) | Gene/operon activation | Fusion construction; Regulator transfection | R |
(details) | Gene/operon activation | Fusion construction; Mutagenesis; Nuclease mapping | G|R |
(details) | Gene/operon activation; Regulatory site mapping | Fusion construction; Mutagenesis | G |
(details) | Gene/operon activation | Fusion construction; Mutagenesis | G |
(details) | Gene/operon activation; Gene/operon repression | Fusion construction; Mutagenesis | R |
(details) | Gene/operon activation | Fusion construction; Mutagenesis | R |
(details) | Gene/operon repression | Fusion construction; Mutagenesis | R |
(details) | Gene/operon activation | Fusion construction; Mutagenesis | R |
(details) | Promoter mapping | Primer extension | R |
(details) | Promoter mapping | Primer extension | R |
(details) | Regulatory site mapping | Fusion construction; Primer extension; Mutagenesis | R |
(details) | Regulatory site mapping | Fusion construction; Primer extension; Mutagenesis | R |
(details) | Promoter mapping | Primer extension | R |
(details) | Regulatory site mapping | Primer extension; Mutagenesis | R |
(details) | Regulatory site mapping | Footprinting; Titration assay | R |
(details) | Regulatory site mapping | Gel retardation; Titration assay | R |
(details) | Gene/operon activation | Northern blot; Transcription in vitro | R |
(details) | Regulatory site mapping | Gel retardation; Titration assay | R |
(details) | Gene/operon activation; Operon structure characterization | Fusion construction; Mutagenesis; Mutant analysis | R |
(details) | Gene/operon activation | Fusion construction; Mutant analysis | R |
(details) | Gene/operon activation; Gene/operon repression | Fusion construction; Mutant analysis | R |
(details) | Gene/operon activation | Fusion construction; Mutant analysis | R |
(details) | Regulatory site prediction | Sequence analysis | R |
(details) | Gene/operon activation | Fusion construction; Mutant analysis | R |
(details) | Gene/operon activation | Fusion construction; Mutant analysis | R |
(details) | Conjugation factor of Agrobacterium tumefaciens regulates Ti plasmid transfer by autoinduction. p |
(details) | TraI, a LuxI homologue, is responsible for production of conjugation factor, the Ti plasmid N-acylhomoserine lactone autoinducer. p |
(details) | Activity of the Agrobacterium Ti plasmid conjugal transfer regulator TraR is inhibited by the product of the traM gene. p |
(details) | A new regulatory element modulates homoserine lactone-mediated autoinduction of Ti plasmid conjugal transfer. p |
(details) | Localization of OccR-activated and TraR-activated promoters that express two ABC-type permeases and the traR gene of Ti plasmid pTiR10. p |
(details) | Conserved cis-acting promoter elements are required for density-dependent transcription of Agrobacterium tumefaciens conjugal transfer genes. p |
(details) | Genetic and sequence analysis of the pTiC58 trb locus, encoding a mating-pair formation system related to members of the type IV secretion family. p |
(details) | Octopine-type Ti plasmids code for a mannopine-inducible dominant-negative allele of traR, the quorum-sensing activator that regulates Ti plasmid conjugal transfer. p |
(details) | Autoinducer binding by the quorum-sensing regulator TraR increases affinity for target promoters in vitro and decreases TraR turnover rates in whole cells. p |
(details) | Modulating quorum sensing by antiactivation: TraM interacts with TraR to inhibit activation of Ti plasmid conjugal transfer genes. p |
(details) | The antiactivator TraM interferes with the autoinducer-dependent binding of TraR to DNA by interacting with the C-terminal region of the quorum-sensing activator. p |
(details) | The replicator of the nopaline-type Ti plasmid pTiC58 is a member of the repABC family and is influenced by the TraR-dependent quorum-sensing regulatory system. p |
(details) | Domains formed within the N-terminal region of the quorum-sensing activator TraR are required for transcriptional activation and direct interaction with RpoA from agrobacterium. p |
|
---|
ATGCAGCACTGGCTGGACAAGTTGACCGATCTTGCCGCAATTCAGGGCGACGAGTGCATC CTGAAGGATGGCCTTGCCGACCTTGCCGAACATTTCGGCTTCACCGGCTATGCCTATCTC CATATCCAGCACAAACACACCATCGCGGTCACCAATTATCATCGTGACTGGCGATCGGCT TACTTCGAGAACAACTTCGACAAGCTCGATCCGGTCGTCAAGCGCGCGAAATCCAGGAAG CACGTCTTTGCCTGGTCCGGCGAACAGGAACGATCGCGGCTATCGAAGGAAGAGCGTGCC TTCTACGCGCATGCGGCCGATTTCGGCATCCGCTCCGGCATCACCATTCCGATCAAGACC GCCAACGGATCAATGTCGATGTTCACGCTGGCGTCGGAAAGGCCGGCGATCGACCTCGAC CGTGAGATCGACGCGGCCGCAGCCGCGGGCGCCGTCGGGCAGCTCCATGCCCGCATCTCT TTCCTTCAGACCACTCCGACAGTGGAAGATGCCGCCTGGCTCGATCCGAAAGAGGCGACC TATCTCAGATGGATCGCCGTCGGCATGACAATGGAGGAAGTCGCAGACGTGGAGGGCGTC AAGTACAACAGCGTCCGTGTCAAGCTCCGCGAGGCCATGAAGCGCTTCGACGTTCGCAGC AAGGCCCATCTCACCGCCCTCGCAATCAGAAGAAAGCTGATCTGA |
|
MQHWLDKLTDLAAIQGDECILKDGLADLAEHFGFTGYAYLHIQHKHTIAVTNYHRDWRSA YFENNFDKLDPVVKRAKSRKHVFAWSGEQERSRLSKEERAFYAHAADFGIRSGITIPIKT ANGSMSMFTLASERPAIDLDREIDAAAAAGAVGQLHARISFLQTTPTVEDAAWLDPKEAT YLRWIAVGMTMEEVADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI* |