WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A07A05_CONSENSUS (510 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 1 Sequence EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 358 59 |=========================================================== 6310 299 36 |==================================== 3980 263 49 |================================================= 2510 214 34 |================================== 1580 180 50 |================================================== 1000 130 48 |================================================ 631 82 28 |============================ 398 54 1 |= 251 53 12 |============ 158 41 3 |=== 100 38 1 |= 63.1 37 2 |== 39.8 35 1 |= 25.1 34 1 |= 15.8 33 1 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 32 <<<<<<<<<<<<<<<<< 10.0 32 2 |== 6.31 30 0 | 3.98 30 2 |== 2.51 28 2 |== 1.58 26 3 |=== 1.00 23 3 |=== 0.63 20 2 |== 0.40 18 3 |=== 0.25 15 0 | 0.16 15 0 | 0.10 15 2 |== 0.063 13 0 | 0.040 13 0 | 0.025 13 0 | 0.016 13 0 | 0.010 13 1 |= 0.0063 12 0 | 0.0040 12 1 |= 0.0025 11 0 | 0.0016 11 1 |= Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|10178199|dbj|BAB11623.1|(AB016875) N-carbamyl-L-am... +2 253 3.4e-20 1 gi|10173375|dbj|BAB04480.1|(AP001509) N-carbamyl-L-am... +2 129 1.1e-06 1 gi|7473192|pir||F75429N-carbamyl-L-amino acid amidohy... +2 109 0.00017 1 gi|11350628|pir||C83591N-carbamoyl-beta-alanine amido... +2 108 0.00022 1 gi|773414|gb|AAB05989.1|(U23751) beta galactosidase [... -2 98 0.00031 1 gi|9294786|gb|AAF86670.1|AF178449_1(AF178449) beta-ga... -2 98 0.00031 1 gi|762925|emb|CAA59990.1|(X85998) elastin like protei... +2 96 0.00050 1 gi|7384996|gb|AAF61634.1|(AF153422) lacZ [Cloning vec... -2 98 0.00059 1 gi|560554|gb|AAB31222.1|(S71728) truncated protein [S... -2 95 0.00063 1 gi|560556|gb|AAB31223.1|(S71730) influenza virus hema... -2 95 0.00063 1 gi|7672255|emb|CAB89444.1|(AL354048) putative amino a... +2 100 0.0015 1 gi|4028979|emb|CAA06470.1|(AJ005323) glutamate permea... -2 98 0.0030 1 gi|12720378|gb|AAK02244.1|(AE006050) unknown [Pasteur... +2 94 0.0069 1 gi|560558|gb|AAB31224.1|(S71742) influenza virus hema... -1 76 0.063 1 gi|560560|gb|AAB31225.1|(S71745) influenza virus hema... -1 76 0.063 1 gi|417170|sp|Q01264|HYUC_PSESNHYDANTOIN UTILIZATION P... +2 87 0.27 1 gi|285313|pir||D42594N-carbamyl-L-amino acid amidohyd... +2 87 0.27 1 gi|7489187|pir||T02229protein BYJ15 - common tobacco ... +1 82 0.30 1 gi|3402817|emb|CAA07704.1|(AJ007829) lacZ' [Cloning v... +2 77 0.38 1 gi|7228243|emb|CAA16615.2|(AL021637) hyuC-like protei... +2 86 0.47 1 gi|10954712ref|NP_066647.1| similar to amaB gene [Agr... +2 85 0.49 1 gi|9294789|gb|AAF86672.1|AF178450_1(AF178450) beta-ga... +2 77 0.51 1 gi|2492828|sp|Q57051|Y588_HAEINHYPOTHETICAL PROTEIN H... +2 84 0.63 1 gi|9910619|sp|O32149|ALLC_BACSUPROBABLE ALLANTOATE AM... +2 83 0.75 1 gi|11993889|gb|AAG42155.1|(AY012159) virion-associate... +1 84 0.76 1 gi|10566719|dbj|BAB15929.1|(AB029899) N-Carbamoyl-L-c... +2 83 0.77 1 gi|7489188|pir||T02232protein BYJ6 - common tobacco (... +1 78 0.80 1 gi|2126861|pir||I40357hypothetical protein 1 - Bacill... +2 81 0.89 1 gi|2492825|sp|Q53389|AMB2_BACSTN-CARBAMOYL-L-AMINO AC... +2 81 0.94 1 gi|2506176|sp|P37113|AMB1_BACSTN-CARBAMOYL-L-AMINO AC... +2 81 0.94 1 gi|10281475|gb|AAG15510.1|U56995_1(U56995) mutant gre... +2 77 0.998 1 gi|1684629|emb|CAA70550.1|(Y09374) lacZ-PhoC [synthet... +2 77 0.999 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 2 Hits gi|10178199 | ___________________________ gi|10173375 | __________________________ gi|7473192 | ___________________________ gi|11350628 | ______________________ gi|762925 |___________ gi|7672255 | ____________________ gi|12720378 | __________________________ gi|417170 | ____________________ gi|285313 | ____________________ gi|3402817 |______ gi|7228243 | ____________________ gi|10954712 | _______________________ gi|9294789 |______ gi|2492828 | __________________________ gi|9910619 | ____________________ gi|10566719 | ________________ gi|2126861 | ____________________ gi|2492825 | ____________________ gi|2506176 | ____________________ gi|10281475 |______ gi|1684629 |______ __________________________________________________ Query sequence: | | | | | 170 0 50 100 150 Locus_ID Frame 1 Hits gi|7489187 |_______ gi|11993889 |_______ gi|7489188 |_______ __________________________________________________ Query sequence: | | | | | 170 0 50 100 150 Locus_ID Frame -1 Hits gi|560558 |______ gi|560560 |______ __________________________________________________ Query sequence: | | | | | 170 0 50 100 150 Locus_ID Frame -2 Hits gi|773414 |_________ gi|9294786 |_________ gi|7384996 |_________ gi|560554 |_______ gi|560556 |_______ gi|4028979 |_________ __________________________________________________ Query sequence: | | | | | 170 0 50 100 150
Use the and icons to retrieve links to Entrez:
>gi|10178199|dbj|BAB11623.1| (AB016875) N-carbamyl-L-amino acid amidohydrolase-like protein [Arabidopsis thaliana] Length = 441 Frame 2 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 441 0 150 300 Plus Strand HSPs: Score = 253 (89.1 bits), Expect = 3.4e-20, P = 3.4e-20 Identities = 56/90 (62%), Positives = 60/90 (66%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HIDA PYSGKYDGVVGVLGA EAI VL RSGF P LE+ F S EP FGI C GS Sbjct: 102 SHIDAIPYSGKYDGVVGVLGAIEAINVLKRSGFKPKRSLEIILFTSEEPTRFGISCLGSR 161 Query: 245 LLAGXXDLAYSLXTXX-DXQXXSFXHAAGS 331 LLAG +LA +L T D Q SF AA S Sbjct: 162 LLAGSKELAEALKTTVVDGQNVSFIEAARS 191 >gi|10173375|dbj|BAB04480.1| (AP001509) N-carbamyl-L-amino acid amidohydrolase [Bacillus halodurans] Length = 414 Frame 2 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 414 0 150 300 Plus Strand HSPs: Score = 129 (45.4 bits), Expect = 1.1e-06, P = 1.1e-06 Identities = 28/86 (32%), Positives = 46/86 (53%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HID+ P+ G++DG +GVLGA EA+ + +G +E+ SF E FG GS Sbjct: 86 SHIDSVPHGGRFDGTLGVLGAIEAVRTMKEAGIKLKHSIEIVSFTDEEGARFGAGFIGSK 145 Query: 245 LLAGXXDLAYSLXTXXDXQXXSFXHA 322 +AG +L + + D + ++ A Sbjct: 146 GMAG--ELTETTFSLADDKGVTYREA 169 >gi|7473192|pir||F75429 N-carbamyl-L-amino acid amidohydrolase (EC 3.5.1.-) DR1154 [similarity] - Deinococcus radiodurans (strain R1) >gi|6458894|gb|AAF10728.1|AE001965_2 (AE001965) N-carbamyl-L-amino acid amidohydrolase [Deinococcus radiodurans] Length = 416 Frame 2 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 416 0 150 300 Plus Strand HSPs: Score = 109 (38.4 bits), Expect = 0.00017, P = 0.00017 Identities = 29/87 (33%), Positives = 41/87 (47%), Frame = +2 Query: 41 PGCRNS-ARAHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXX 217 PG R +H+D P +G+YDG++GV+ A++ R P LEV F E Sbjct: 74 PGARTLYIGSHLDTVPNAGRYDGIIGVVFGY-ALVEALRERELP-FHLEVLGFSEEEGVR 131 Query: 218 FGICCXGSXLLAGXXDLAYSLXTXXDXQ 301 +G+ GS L G D L T D + Sbjct: 132 YGVSFIGSRALVGTAD---ELLTVSDRE 156 >gi|11350628|pir||C83591 N-carbamoyl-beta-alanine amidohydrolase PA0444 [imported] - Pseudomonas aeruginosa (strain PAO1) >gi|9946302|gb|AAG03833.1|AE004481_9 (AE004481) N-carbamoyl-beta-alanine amidohydrolase [Pseudomonas aeruginosa] Length = 427 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 427 0 150 300 Plus Strand HSPs: Score = 108 (38.0 bits), Expect = 0.00022, P = 0.00022 Identities = 26/72 (36%), Positives = 33/72 (45%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HID P GK+DG GV+ E I L G LEV + + E F C GS Sbjct: 91 SHIDTQPTGGKFDGCFGVMAGLEVIRTLNDLGVETEAPLEVVVWTNEEGSRFAPCMMGSG 150 Query: 245 LLAGXXDLAYSL 280 + AG L +L Sbjct: 151 VFAGKFTLEETL 162 >gi|773414|gb|AAB05989.1| (U23751) beta galactosidase [Cloning vector pBBR1MCS-2] >gi|833819|gb|AAB06689.1| (U25059) LacZ alpha peptide [Cloning vector pBBR1MCS-3] >gi|833823|gb|AAB06692.1| (U25060) LacZ alpha peptide [Cloning vector pBBR1MCS-4] >gi|833827|gb|AAB06695.1| (U25061) LacZ alpha peptide [Cloning vector pBBR1MCS-5] Length = 121 Frame -2 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | 121 0 50 100 Minus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.00031, P = 0.00031 Identities = 18/30 (60%), Positives = 21/30 (70%), Frame = -2 Query: 92 PSKV*HQCALVXNSCSPGDPLVXERPXPGW 3 PS+ +L+ NSCSPGDPLV ERP P W Sbjct: 24 PSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >gi|9294786|gb|AAF86670.1|AF178449_1 (AF178449) beta-galactosidase alpha peptide [Integration vector pCD11PKS] >gi|9294795|gb|AAF86676.1|AF178452_1 (AF178452) beta-galactosidase alpha peptide [Integration vector pCD13PKS] Length = 127 Frame -2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Minus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.00031, P = 0.00031 Identities = 18/30 (60%), Positives = 21/30 (70%), Frame = -2 Query: 92 PSKV*HQCALVXNSCSPGDPLVXERPXPGW 3 PS+ +L+ NSCSPGDPLV ERP P W Sbjct: 24 PSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >gi|762925|emb|CAA59990.1| (X85998) elastin like protein [Drosophila melanogaster] Length = 110 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | | | 110 0 20 40 60 80 100 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.00050, P = 0.00050 Identities = 23/41 (56%), Positives = 29/41 (70%), Frame = +2 Query: 2 SSPVXAALXLVDPPGCRNSAR----AHIDAXPYSG-KYDGV 109 S+ V AAL LVDPPGCRNSAR A++++ Y+G Y GV Sbjct: 3 STAVAAALELVDPPGCRNSARDRQRANLNSQLYAGYPYPGV 43 >gi|7384996|gb|AAF61634.1| (AF153422) lacZ [Cloning vector pTG8] Length = 197 Frame -2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | 197 0 50 100 150 Minus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.00059, P = 0.00059 Identities = 18/30 (60%), Positives = 21/30 (70%), Frame = -2 Query: 92 PSKV*HQCALVXNSCSPGDPLVXERPXPGW 3 PS+ +L+ NSCSPGDPLV ERP P W Sbjct: 27 PSRSTVSISLISNSCSPGDPLVLERPPPRW 56 >gi|560554|gb|AAB31222.1| (S71728) truncated protein [Saccharomyces cerevisiae] Length = 33 Frame -2 hits (HSPs): _________________________________ __________________________________________________ Database sequence: | | | 33 0 20 Minus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.00063, P = 0.00063 Identities = 16/22 (72%), Positives = 18/22 (81%), Frame = -2 Query: 68 ALVXNSCSPGDPLVXERPXPGW 3 +L+ NSCSPGDPLV ERP P W Sbjct: 7 SLISNSCSPGDPLVLERPPPRW 28 >gi|560556|gb|AAB31223.1| (S71730) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal, frame 1} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 45 aa] Length = 45 Frame -2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | 45 0 20 40 Minus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.00063, P = 0.00063 Identities = 16/22 (72%), Positives = 18/22 (81%), Frame = -2 Query: 68 ALVXNSCSPGDPLVXERPXPGW 3 +L+ NSCSPGDPLV ERP P W Sbjct: 19 SLISNSCSPGDPLVLERPPPRW 40 >gi|7672255|emb|CAB89444.1| (AL354048) putative amino acid hydrolase [Streptomyces coelicolor A3(2)] Length = 405 Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 405 0 150 300 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.0015, P = 0.0015 Identities = 22/64 (34%), Positives = 33/64 (51%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +H+D+ P G +DG +GV+ A A+ L G L + +F E FG+ C GS Sbjct: 74 SHLDSVPDGGAFDGPLGVVSAFAALDELRGRGARFTRPLGIVNFGDEEGARFGLACVGSR 133 Query: 245 LLAG 256 L +G Sbjct: 134 LTSG 137 >gi|4028979|emb|CAA06470.1| (AJ005323) glutamate permease [synthetic construct] >gi|4028985|emb|CAA06473.1| (AJ005326) glutamate permease [synthetic construct] >gi|4028991|emb|CAA06476.1| (AJ005329) glutamate permease [synthetic construct] Length = 459 Frame -2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Minus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.0030, P = 0.0030 Identities = 18/30 (60%), Positives = 21/30 (70%), Frame = -2 Query: 92 PSKV*HQCALVXNSCSPGDPLVXERPXPGW 3 PS+ +L+ NSCSPGDPLV ERP P W Sbjct: 197 PSRSTVSISLISNSCSPGDPLVLERPPPRW 226 >gi|12720378|gb|AAK02244.1| (AE006050) unknown [Pasteurella multocida] Length = 412 Frame 2 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 412 0 150 300 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 0.0069, P = 0.0069 Identities = 25/86 (29%), Positives = 35/86 (40%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HID +GK DG +G + E + L G LE+ F E F GS Sbjct: 78 SHIDTVVNAGKLDGPLGSVAGLEILFQLCEQGIKTRYPLELIIFTCEESSRFNYATLGSK 137 Query: 245 LLAGXXDLAYSLXTXXDXQXXSFXHA 322 ++ G + A L D Q +F A Sbjct: 138 VMCGVVEQA-GLSHLRDKQGTAFAQA 162 >gi|560558|gb|AAB31224.1| (S71742) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 50 aa] Length = 50 Frame -1 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | 50 0 20 40 Minus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.065, P = 0.063 Identities = 15/19 (78%), Positives = 16/19 (84%), Frame = -1 Query: 57 EFLQPGGSTSXRAAXTGLE 1 EFLQPGGSTS RAA T +E Sbjct: 28 EFLQPGGSTSSRAAATAVE 46 >gi|560560|gb|AAB31225.1| (S71745) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal, frame 3} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 56 aa] Length = 56 Frame -1 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | 56 0 20 40 Minus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.065, P = 0.063 Identities = 15/19 (78%), Positives = 16/19 (84%), Frame = -1 Query: 57 EFLQPGGSTSXRAAXTGLE 1 EFLQPGGSTS RAA T +E Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >gi|417170|sp|Q01264|HYUC_PSESN HYDANTOIN UTILIZATION PROTEIN C (ORF4) >gi|151284|gb|AAA25847.1| (M72717) DL-hydantoinase [Pseudomonas sp.] >gi|216833|dbj|BAA01379.1| (D10494) N-carbamyl-L-amino acid amidohydrolase [Pseudomonas sp.] Length = 414 Frame 2 hits (HSPs): _________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 414 0 150 300 __________________ Annotated Domains: DOMO DM03866: 1..413 PRODOM PD038201: AMB1(1) AMB2(1) HYUC(1) 6..61 PRODOM PD001808: Q93332(3) QPCT(2) 63..143 PRODOM PD210834: HYUC_PSESN 145..209 PRODOM PD001757: PEPT(5) DAPE(3) ACY1(2) 211..412 __________________ Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.32, P = 0.27 Identities = 20/64 (31%), Positives = 30/64 (46%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HID+ GK+DGV+GVL E + + + +EV +F E F GS Sbjct: 82 SHIDSVRNGGKFDGVIGVLAGIEIVHAISEANVVHEHSIEVVAFCEEEGSRFNDGLFGSR 141 Query: 245 LLAG 256 + G Sbjct: 142 GMVG 145 >gi|285313|pir||D42594 N-carbamyl-L-amino acid amidohydrolase (EC 3.5.1.-) hyuC [similarity] - Pseudomonas sp. plasmid pHN671 Length = 414 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 414 0 150 300 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.32, P = 0.27 Identities = 20/64 (31%), Positives = 30/64 (46%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HID+ GK+DGV+GVL E + + + +EV +F E F GS Sbjct: 82 SHIDSVRNGGKFDGVIGVLAGIEIVHAISEANVVHEHSIEVVAFCEEEGSRFNDGLFGSR 141 Query: 245 LLAG 256 + G Sbjct: 142 GMVG 145 >gi|7489187|pir||T02229 protein BYJ15 - common tobacco (fragment) >gi|2280518|dbj|BAA21615.1| (AB005878) BYJ15 [Nicotiana tabacum] Length = 172 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 0.35, P = 0.30 Identities = 17/23 (73%), Positives = 18/23 (78%), Frame = +1 Query: 1 LQPGXGRSXTSGSPGLQEFXTSA 69 L G GRS TSGSPGLQEF TS+ Sbjct: 3 LHRGGGRSRTSGSPGLQEFGTSS 25 >gi|3402817|emb|CAA07704.1| (AJ007829) lacZ' [Cloning vector pGreen] Length = 120 Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 120 0 50 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.48, P = 0.38 Identities = 15/19 (78%), Positives = 16/19 (84%), Frame = +2 Query: 2 SSPVXAALXLVDPPGCRNS 58 S+ V AAL LVDPPGCRNS Sbjct: 21 STAVAAALELVDPPGCRNS 39 >gi|7228243|emb|CAA16615.2| (AL021637) hyuC-like protein [Arabidopsis thaliana] >gi|7268802|emb|CAB79007.1| (AL161552) hyuC-like protein [Arabidopsis thaliana] Length = 525 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 525 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 0.63, P = 0.47 Identities = 23/66 (34%), Positives = 33/66 (50%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIX--LEVXSFXSXEPXXFGICCXG 238 +H+D +GKYDG +G++ A A+ VL G + +EV +F E F G Sbjct: 166 SHMDTVIDAGKYDGSLGIISAISALKVLKIDGRLGELKRPVEVIAFSDEEGVRFQSTFLG 225 Query: 239 SXLLAG 256 S LAG Sbjct: 226 SAALAG 231 >gi|10954712 ref|NP_066647.1| similar to amaB gene [Agrobacterium rhizogenes] >gi|8918712|dbj|BAA97777.1| (AB039932) similar to amaB gene [Agrobacterium rhizogenes] >gi|10567376|dbj|BAB16185.1| (AP002086) similar to amaB gene [Agrobacterium rhizogenes] Length = 421 Frame 2 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 421 0 150 300 Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 0.67, P = 0.49 Identities = 22/78 (28%), Positives = 37/78 (47%), Frame = +2 Query: 59 ARAHIDAXPYSGKYDGVVGVLGAXEAIIVLX----RSGFXPXIXLEVXSFXSXEPXXFGI 226 A +H+D P G++DG +GVL A +A + + R P L V ++ + E + Sbjct: 81 AGSHLDTQPRGGRFDGTLGVLAAGQAALDIHAEVQRGRCKPRYNLAVVNWTNEEGARYQP 140 Query: 227 CCXGSXLLAGXXDLAYSL 280 GS + +G L +L Sbjct: 141 SLTGSAVFSGTLGLEDAL 158 >gi|9294789|gb|AAF86672.1|AF178450_1 (AF178450) beta-galactosidase alpha peptide [Integration vector pCD11PSK] >gi|9294798|gb|AAF86678.1|AF178453_1 (AF178453) beta-galactosidase alpha peptide [Integration vector pCD13PSK] Length = 127 Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.71, P = 0.51 Identities = 15/19 (78%), Positives = 16/19 (84%), Frame = +2 Query: 2 SSPVXAALXLVDPPGCRNS 58 S+ V AAL LVDPPGCRNS Sbjct: 21 STAVAAALELVDPPGCRNS 39 >gi|2492828|sp|Q57051|Y588_HAEIN HYPOTHETICAL PROTEIN HI0588 >gi|1075052|pir||D64079 probable N-carbamyl-L-amino acid amidohydrolase (EC 3.5.1.-) HI0588 [similarity] - Haemophilus influenzae (strain Rd KW20) >gi|1573578|gb|AAC22245.1| (U32740) N-carbamyl-L-amino acid amidohydrolase [Haemophilus influenzae Rd] Length = 411 Frame 2 hits (HSPs): ___________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | 411 0 150 300 __________________ Annotated Domains: PFAM Peptidase_M20: Peptidase family M20/M25/ 11..357 PRODOM PD009793: O32149(1) YLBB(1) Y588(1) 6..129 PRODOM PD116073: O32149(1) O85664(1) Y588(1) 135..204 PRODOM PD001757: PEPT(5) DAPE(3) ACY1(2) 206..403 PROSITE ARGE_DAPE_CPG2_1: ArgE / dapE / ACY1 / C 74..83 __________________ Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 0.99, P = 0.63 Identities = 22/86 (25%), Positives = 34/86 (39%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HID +GK+DG +G + E ++ L LE+ F E F GS Sbjct: 78 SHIDTVVNAGKFDGPLGSVAGLEILLQLCEQNIQTRYPLELIIFTCEESSRFNFATLGSK 137 Query: 245 LLAGXXDLAYSLXTXXDXQXXSFXHA 322 ++ G + L + D Q A Sbjct: 138 VMCGIVNQE-KLSSLRDKQGKGLSEA 162 >gi|9910619|sp|O32149|ALLC_BACSU PROBABLE ALLANTOATE AMIDOHYDROLASE >gi|7428263|pir||G70017 probable N-carbamyl-L-amino acid amidohydrolase (EC 3.5.1.-) yurH [similarity] - Bacillus subtilis >gi|2635750|emb|CAB15243.1| (Z99120) similar to N-carbamyl-L-amino acid amidohydrolase [Bacillus subtilis] Length = 412 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 412 0 150 300 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 1.4, P = 0.75 Identities = 23/64 (35%), Positives = 28/64 (43%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +HID GKYDG GVL A A+ L + P LE S E F + GS Sbjct: 83 SHIDTVINGGKYDGAYGVLAAMLALKQLKETYGAPKKTLEAVSLCEEEGSRFPMTYWGSG 142 Query: 245 LLAG 256 + G Sbjct: 143 NMTG 146 >gi|11993889|gb|AAG42155.1| (AY012159) virion-associated nuclear-shuttling protein [Mus musculus] Length = 576 Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 576 0 150 300 450 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 1.4, P = 0.76 Identities = 17/24 (70%), Positives = 17/24 (70%), Frame = +1 Query: 1 LQPGXGRSXTSGSPGLQEFXTSAH 72 L G GRS TSGSPGLQEF T H Sbjct: 7 LHRGGGRSRTSGSPGLQEFGTRVH 30 >gi|10566719|dbj|BAB15929.1| (AB029899) N-Carbamoyl-L-cysteine amidohydrolase [Pseudomonas sp. ON4a] Length = 435 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 435 0 150 300 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 1.5, P = 0.77 Identities = 18/52 (34%), Positives = 25/52 (48%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXF 220 +H D P G+YDG+ GVLG E I L +G +E + + E F Sbjct: 103 SHADTQPTGGRYDGIYGVLGGLEVIRTLNDAGVRTEHPVEAVIWTNEEGSRF 154 >gi|7489188|pir||T02232 protein BYJ6 - common tobacco (fragment) >gi|2280520|dbj|BAA21616.1| (AB005879) BYJ6 [Nicotiana tabacum] Length = 177 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 177 0 50 100 150 Plus Strand HSPs: Score = 78 (27.5 bits), Expect = 1.6, P = 0.80 Identities = 16/20 (80%), Positives = 16/20 (80%), Frame = +1 Query: 10 GXGRSXTSGSPGLQEFXTSA 69 G GRS TSGSPGLQEF T A Sbjct: 7 GGGRSRTSGSPGLQEFGTRA 26 >gi|2126861|pir||I40357 hypothetical protein 1 - Bacillus stearothermophilus (fragment) >gi|436796|emb|CAA52341.1| (X74289) ORF1 [Bacillus stearothermophilus] Length = 350 Frame 2 hits (HSPs): __________ Annotated Domains: __ __________________________________________________ Database sequence: | | | | 350 0 150 300 __________________ Annotated Domains: PROSITE MYB_1: Myb DNA-binding domain repeat sig 326..334 __________________ Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 2.2, P = 0.89 Identities = 19/64 (29%), Positives = 29/64 (45%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +H+D+ G +DG +GVL E + + G +EV +F E F GS Sbjct: 19 SHLDSVYNGGCFDGPLGVLAGVEVVQTMNEHGVVTHHPIEVVAFTDEEGARFRFGMIGSR 78 Query: 245 LLAG 256 +AG Sbjct: 79 AMAG 82 >gi|2492825|sp|Q53389|AMB2_BACST N-CARBAMOYL-L-AMINO ACID AMIDOHYDROLASE (L-CARBAMOYLASE) >gi|538915|pir||JN0885 N-carbamyl-L-amino acid amidohydrolase (EC 3.5.1.-) [validated] - Bacillus stearothermophilus (strain NS1122A) >gi|460895|gb|AAC60456.1| (S67784) N-carbamyl-L-amino acid amidohydrolase [Bacillus stearothermophilus, NS1122A, Peptide, 409 aa] Length = 409 Frame 2 hits (HSPs): _________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | 409 0 150 300 __________________ Annotated Domains: PFAM Peptidase_M20: Peptidase family M20/M25/ 25..355 PRODOM PD038201: AMB1(1) AMB2(1) HYUC(1) 1..57 PRODOM PD001808: Q93332(3) QPCT(2) 59..139 PRODOM PD155651: AMB1(1) AMB2(1) 141..193 PRODOM PD001757: PEPT(5) DAPE(3) ACY1(2) 195..401 __________________ Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 2.8, P = 0.94 Identities = 19/64 (29%), Positives = 29/64 (45%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +H+D+ G +DG +GVL E + + G +EV +F E F GS Sbjct: 78 SHLDSVYNGGCFDGPLGVLAGVEVVQTMNEHGVVTHHPIEVVAFTDEEGARFRFGMIGSR 137 Query: 245 LLAG 256 +AG Sbjct: 138 AMAG 141 >gi|2506176|sp|P37113|AMB1_BACST N-CARBAMOYL-L-AMINO ACID AMIDOHYDROLASE (L-CARBAMOYLASE) >gi|1842192|emb|CAA69999.1| (Y08752) N-carbamyl-L-amino acid amidohydrolase [Bacillus stearothermophilus] Length = 409 Frame 2 hits (HSPs): _________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | 409 0 150 300 __________________ Annotated Domains: PRODOM PD038201: AMB1(1) AMB2(1) HYUC(1) 1..57 PRODOM PD001808: Q93332(3) QPCT(2) 59..139 PRODOM PD155651: AMB1(1) AMB2(1) 141..193 PRODOM PD001757: PEPT(5) DAPE(3) ACY1(2) 195..401 PROSITE MYB_1: Myb DNA-binding domain repeat sig 385..393 __________________ Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 2.8, P = 0.94 Identities = 19/64 (29%), Positives = 29/64 (45%), Frame = +2 Query: 65 AHIDAXPYSGKYDGVVGVLGAXEAIIVLXRSGFXPXIXLEVXSFXSXEPXXFGICCXGSX 244 +H+D+ G +DG +GVL E + + G +EV +F E F GS Sbjct: 78 SHLDSVYNGGCFDGPLGVLAGVEVVQTMNEHGVVTHHPIEVVAFTDEEGARFRFGMIGSR 137 Query: 245 LLAG 256 +AG Sbjct: 138 AMAG 141 >gi|10281475|gb|AAG15510.1|U56995_1 (U56995) mutant green fluorescent protein [Cloning vector pGreenscript A] Length = 302 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | || 302 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 6.4, P = 1.0 Identities = 15/19 (78%), Positives = 16/19 (84%), Frame = +2 Query: 2 SSPVXAALXLVDPPGCRNS 58 S+ V AAL LVDPPGCRNS Sbjct: 21 STAVAAALELVDPPGCRNS 39 >gi|1684629|emb|CAA70550.1| (Y09374) lacZ-PhoC [synthetic construct] Length = 316 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | | 316 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 6.8, P = 1.0 Identities = 15/19 (78%), Positives = 16/19 (84%), Frame = +2 Query: 2 SSPVXAALXLVDPPGCRNS 58 S+ V AAL LVDPPGCRNS Sbjct: 21 STAVAAALELVDPPGCRNS 39 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.92 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.359 0.162 0.591 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.324 0.141 0.446 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.339 0.151 0.591 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.334 0.142 0.456 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.339 0.152 0.537 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.356 0.157 0.532 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 169 126 10. 72 3 12 22 0.10 33 29 0.12 35 +2 0 169 126 10. 72 3 12 22 0.10 33 29 0.12 35 +1 0 170 125 10. 72 3 12 22 0.10 33 29 0.11 35 -1 0 170 127 10. 72 3 12 22 0.10 33 29 0.12 35 -2 0 169 127 10. 72 3 12 22 0.10 33 29 0.12 35 -3 0 169 121 10. 71 3 12 22 0.098 33 29 0.11 35 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 32 No. of states in DFA: 590 (58 KB) Total size of DFA: 145 KB (192 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 101.25u 1.13s 102.38t Elapsed: 00:00:18 Total cpu time: 101.28u 1.16s 102.44t Elapsed: 00:00:18 Start: Mon Oct 1 20:36:30 2001 End: Mon Oct 1 20:36:48 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000