WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'D08G01_N13_13.ab1' (171 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 6 Sequences : less than 6 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 2032 5 |: 6310 2027 94 |=============== 3980 1933 206 |================================== 2510 1727 340 |======================================================== 1580 1387 359 |=========================================================== 1000 1028 256 |========================================== 631 772 157 |========================== 398 615 92 |=============== 251 523 87 |============== 158 436 56 |========= 100 380 96 |================ 63.1 284 158 |========================== 39.8 126 91 |=============== 25.1 35 17 |== 15.8 18 2 |: >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 16 <<<<<<<<<<<<<<<<< 10.0 16 4 |: 6.31 12 5 |: 3.98 7 6 |= 2.51 1 0 | 1.58 1 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|5091556|gb|AAD39585.1|AC007067_25(AC007067) T10O24... -2 59 0.71 2 gi|493856|pdb|1BAF|LChain L, Fab Fragment Of Murine M... +2 51 0.96 2 gi|110350|pir||S25058Ig kappa chain - mouse >gi|54829... +2 52 0.96 2 gi|5870749|gb|AAD54572.1|AF137206_1(AF137206) rhodops... +2 43 0.98 2 gi|7415929|dbj|BAA93613.1|(AB038631) ORF3 [TTV-like m... -2 40 0.98 2 gi|3212405|pdb|1A6T|AChain A, Fab Fragment Of Mab1-Ia... +2 50 0.98 2 gi|3212470|pdb|1AY1|LChain L, Anti Taq Fab Tp7 >gi|38... +2 50 0.98 2 gi|466311|gb|AAA39083.1|(L30139) immunoglobulin light... +2 59 0.98 1 gi|468353|gb|AAA39085.1|(L31516) immunoglobulin light... +2 59 0.98 1 gi|8134388|sp|Q9WWR3|CYOC_PSEPUCYTOCHROME O UBIQUINOL... +2 64 0.99 1 gi|1065189|pdb|1BQL|LChain L, Hyhel-5 Fab Complexed W... +2 49 0.993 2 gi|5931796|emb|CAB56646.1|(AJ249202) rod opsin [Angui... +2 43 0.998 2 gi|3322249|gb|AAC26549.1|(AF003724) anti BoNT/A Hc sc... +2 50 0.998 2 gi|2194074|pdb|1CLO|LChain L, Anti-Carcinoembryonic A... +2 48 0.998 2 gi|5835473ref|NP_008402.1|ND4_13475 NADH dehydrogenas... +1 41 0.9997 3 gi|1171917|sp|P41590|OPSD_ASTFARHODOPSIN >gi|2119489|... +2 45 0.99991 2
Use the and icons to retrieve links to Entrez:
>gi|5091556|gb|AAD39585.1|AC007067_25 (AC007067) T10O24.25 [Arabidopsis thaliana] Length = 288 Frame -2 hits (HSPs): _______ Frame -3 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | | 288 0 50 100 150 200 250 Minus Strand HSPs: Score = 59 (20.8 bits), Expect = 1.3, Sum P(2) = 0.71 Identities = 17/39 (43%), Positives = 23/39 (58%), Frame = -2 Query: 134 KHLNLLKGKT*PLYSKDVCLTQNTRVHXNHHRHNT*VLG 18 K+ NL + K PL++KDV N R H NHH + +LG Sbjct: 228 KNSNL-RFKLYPLWAKDV---NNNR-HHNHHPNQNCILG 261 Score = 29 (10.2 bits), Expect = 1.3, Sum P(2) = 0.71 Identities = 5/5 (100%), Positives = 5/5 (100%), Frame = -3 Query: 154 THPSQ 140 THPSQ Sbjct: 118 THPSQ 122 >gi|493856|pdb|1BAF|L Chain L, Fab Fragment Of Murine Monoclonal Antibody An02 Complex With Its Hapten (2,2,6,6-Tetramethyl-1-Piperidinyloxy- Dinitrophenyl) Length = 214 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | 214 0 50 100 150 200 Plus Strand HSPs: Score = 51 (18.0 bits), Expect = 3.1, Sum P(2) = 0.96 Identities = 12/26 (46%), Positives = 17/26 (65%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +++ P KV M+C SASSSV + W Sbjct: 10 IMSASPGEKVTMTC-SASSSVYYMYW 34 Score = 30 (10.6 bits), Expect = 3.1, Sum P(2) = 0.96 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +1 Query: 148 GVLSSW 165 GVL+SW Sbjct: 158 GVLNSW 163 >gi|110350|pir||S25058 Ig kappa chain - mouse >gi|54829|emb|CAA47650.1| (X67211) immunoglobulin kappa light chain [Mus musculus] Length = 235 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): __ Annotated Domains: __ __________________________________________________ Database sequence: | | | | | | 235 0 50 100 150 200 __________________ Annotated Domains: PROSITE IG_MHC: Immunoglobulins and major histoc 213..219 __________________ Plus Strand HSPs: Score = 52 (18.3 bits), Expect = 3.2, Sum P(2) = 0.96 Identities = 12/26 (46%), Positives = 17/26 (65%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +++ P KV M+C SASSSV + W Sbjct: 32 IMSASPGEKVTMTC-SASSSVSKMQW 56 Score = 30 (10.6 bits), Expect = 3.2, Sum P(2) = 0.96 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +1 Query: 148 GVLSSW 165 GVL+SW Sbjct: 179 GVLNSW 184 >gi|5870749|gb|AAD54572.1|AF137206_1 (AF137206) rhodopsin [Acipenser sp.] Length = 288 Frame 2 hits (HSPs): _____ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | 288 0 50 100 150 200 250 Plus Strand HSPs: Score = 43 (15.1 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 7/21 (33%), Positives = 12/21 (57%), Frame = +2 Query: 14 CSLKLMYYVCDGXRALWCFVL 76 C+++ + G ALWC V+ Sbjct: 80 CNIEGFFATLGGEIALWCLVV 100 Score = 41 (14.4 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 9/22 (40%), Positives = 15/22 (68%), Frame = +1 Query: 112 PFSKFKCFG---LVMGVLSSWLL 171 P S F+ FG +MGV+ +W++ Sbjct: 112 PMSNFR-FGENHAIMGVVFTWIM 133 >gi|7415929|dbj|BAA93613.1| (AB038631) ORF3 [TTV-like mini virus] Length = 115 Frame -2 hits (HSPs): _______ __________ __________________________________________________ Database sequence: | | | | 115 0 50 100 Minus Strand HSPs: Score = 40 (14.1 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 8/21 (38%), Positives = 11/21 (52%), Frame = -2 Query: 98 LYSKDVCLTQNTRVHXNHHRH 36 L S+ + Q+T H H RH Sbjct: 60 LQSQQPGVQQHTEKHKTHRRH 80 Score = 33 (11.6 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 7/15 (46%), Positives = 10/15 (66%), Frame = -2 Query: 170 SNHELNTPITSPKHL 126 +N + +PITS K L Sbjct: 2 NNQPIPSPITSYKQL 16 >gi|3212405|pdb|1A6T|A Chain A, Fab Fragment Of Mab1-Ia Monoclonal Antibody To Human Rhinovirus 14 Nim-Ia Site >gi|3212407|pdb|1A6T|C Chain C, Fab Fragment Of Mab1-Ia Monoclonal Antibody To Human Rhinovirus 14 Nim-Ia Site Length = 210 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | 210 0 50 100 150 200 Plus Strand HSPs: Score = 50 (17.6 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 12/26 (46%), Positives = 17/26 (65%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +L+ P KV+M+C S SSSV + W Sbjct: 10 ILSASPGEKVIMTC-SPSSSVSYMQW 34 Score = 30 (10.6 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +1 Query: 148 GVLSSW 165 GVL+SW Sbjct: 157 GVLNSW 162 >gi|3212470|pdb|1AY1|L Chain L, Anti Taq Fab Tp7 >gi|3891940|pdb|1BGX|L Chain L, Taq Polymerase In Complex With Tp7, An Inhibitory Fab Length = 210 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | 210 0 50 100 150 200 Plus Strand HSPs: Score = 50 (17.6 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 12/26 (46%), Positives = 17/26 (65%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +++ P KV M+C SASSSV + W Sbjct: 10 IMSASPGEKVTMTC-SASSSVSYMYW 34 Score = 30 (10.6 bits), Expect = 3.8, Sum P(2) = 0.98 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +1 Query: 148 GVLSSW 165 GVL+SW Sbjct: 157 GVLNSW 162 >gi|466311|gb|AAA39083.1| (L30139) immunoglobulin light chain V region [Mus musculus] Length = 106 Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 59 (20.8 bits), Expect = 4.1, P = 0.98 Identities = 13/26 (50%), Positives = 18/26 (69%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +++ P KV M+C SASSSV D+ W Sbjct: 10 IMSASPGEKVTMTC-SASSSVSDMHW 34 >gi|468353|gb|AAA39085.1| (L31516) immunoglobulin light chain V region [Mus musculus] Length = 106 Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 59 (20.8 bits), Expect = 4.1, P = 0.98 Identities = 13/26 (50%), Positives = 18/26 (69%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +++ P KV M+C SASSSV D+ W Sbjct: 10 IMSASPGEKVTMTC-SASSSVSDMHW 34 >gi|8134388|sp|Q9WWR3|CYOC_PSEPU CYTOCHROME O UBIQUINOL OXIDASE SUBUNIT III >gi|4586339|dbj|BAA76358.1| (AB016787) cytochrome o ubiquinol oxidase C [Pseudomonas putida] Length = 207 Frame 2 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | | 207 0 50 100 150 200 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 4.4, P = 0.99 Identities = 15/36 (41%), Positives = 20/36 (55%), Frame = +2 Query: 56 ALWCFVLNKH---P*NKVVMSCLSASSSVLDL*WVC 154 A+ + +NKH P K MSCLS LD+ W+C Sbjct: 161 AIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWIC 196 >gi|1065189|pdb|1BQL|L Chain L, Hyhel-5 Fab Complexed With Bobwhite Quail Lysozyme >gi|1065174|pdb|2IFF|L Chain L, Igg1 Fab Fragment (Hyhel-5) Complexed With Lysozyme Mutant With Arg 68 Replaced By Lys (R68k) >gi|1127202|pdb|3HFL|L Chain L, IgG1 Fab Fragment (HyHEL-5) Complexed With Lysozyme (E.C.3.2.1.17) Length = 212 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | 212 0 50 100 150 200 Plus Strand HSPs: Score = 49 (17.2 bits), Expect = 5.0, Sum P(2) = 0.99 Identities = 12/26 (46%), Positives = 17/26 (65%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +++ P KV M+C SASSSV + W Sbjct: 10 IMSASPGEKVTMTC-SASSSVNYMYW 34 Score = 30 (10.6 bits), Expect = 5.0, Sum P(2) = 0.99 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +1 Query: 148 GVLSSW 165 GVL+SW Sbjct: 156 GVLNSW 161 >gi|5931796|emb|CAB56646.1| (AJ249202) rod opsin [Anguilla japonica] Length = 352 Frame 2 hits (HSPs): ____ Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | 352 0 150 300 Plus Strand HSPs: Score = 43 (15.1 bits), Expect = 6.0, Sum P(2) = 1.0 Identities = 7/21 (33%), Positives = 12/21 (57%), Frame = +2 Query: 14 CSLKLMYYVCDGXRALWCFVL 76 C+++ + G ALWC V+ Sbjct: 110 CNIEGFFATLGGEIALWCLVV 130 Score = 41 (14.4 bits), Expect = 6.0, Sum P(2) = 1.0 Identities = 10/22 (45%), Positives = 14/22 (63%), Frame = +1 Query: 112 PFSKFKCFG---LVMGVLSSWLL 171 P S F+ FG +MGV +WL+ Sbjct: 142 PMSNFR-FGENHAIMGVAFTWLM 163 >gi|3322249|gb|AAC26549.1| (AF003724) anti BoNT/A Hc scFv antibody [Mus musculus] Length = 232 Frame 2 hits (HSPs): __ _______ __________________________________________________ Database sequence: | | | | | | 232 0 50 100 150 200 Plus Strand HSPs: Score = 50 (17.6 bits), Expect = 6.3, Sum P(2) = 1.0 Identities = 11/26 (42%), Positives = 18/26 (69%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +++ P KV+++C SASSSV + W Sbjct: 135 IMSSSPGEKVIITC-SASSSVSYMHW 159 Score = 29 (10.2 bits), Expect = 6.3, Sum P(2) = 1.0 Identities = 5/7 (71%), Positives = 6/7 (85%), Frame = +2 Query: 29 MYYVCDG 49 +YYV DG Sbjct: 100 IYYVYDG 106 >gi|2194074|pdb|1CLO|L Chain L, Anti-Carcinoembryonic Antigen Monoclonal Antibody A5b7 Length = 213 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | 213 0 50 100 150 200 Plus Strand HSPs: Score = 48 (16.9 bits), Expect = 6.5, Sum P(2) = 1.0 Identities = 12/26 (46%), Positives = 16/26 (61%), Frame = +2 Query: 71 VLNKHP*NKVVMSCLSASSSVLDL*W 148 +L+ P KV M+C ASSSV + W Sbjct: 10 ILSASPGEKVTMTC-RASSSVTYIHW 34 Score = 30 (10.6 bits), Expect = 6.5, Sum P(2) = 1.0 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +1 Query: 148 GVLSSW 165 GVL+SW Sbjct: 157 GVLNSW 162 >gi|5835473 ref|NP_008402.1|ND4_13475 NADH dehydrogenase subunit 4 [Balanoglossus carnosus] >gi|7432327|pir||T11136 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 - acorn worm mitochondrion >gi|3065683|gb|AAD11946.1| (AF051097) NADH dehydrogenase subunit 4 [Balanoglossus carnosus] Length = 462 Frame 3 hits (HSPs): __ Frame 2 hits (HSPs): __ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 462 0 150 300 450 Plus Strand HSPs: Score = 41 (14.4 bits), Expect = 8.1, Sum P(3) = 1.0 Identities = 7/21 (33%), Positives = 15/21 (71%), Frame = +1 Query: 31 VLCL*WXS-CTLVFCVKQTSLE 93 ++C+ W + T + CV+QT ++ Sbjct: 265 IICI-WGALATSLICVRQTDMK 285 Score = 29 (10.2 bits), Expect = 8.1, Sum P(3) = 1.0 Identities = 6/11 (54%), Positives = 8/11 (72%), Frame = +2 Query: 8 LMCSLKLMYYV 40 L+CSL L+ V Sbjct: 99 LLCSLTLILIV 109 Score = 29 (10.2 bits), Expect = 8.1, Sum P(3) = 1.0 Identities = 6/15 (40%), Positives = 8/15 (53%), Frame = +3 Query: 126 QVFWTCDGCVKLMVA 170 Q W G + LM+A Sbjct: 306 QTTWGIHGSLILMIA 320 >gi|1171917|sp|P41590|OPSD_ASTFA RHODOPSIN >gi|2119489|pir||I50047 rhodopsin - Mexican tetra >gi|525316|gb|AAA74422.1| (U12328) rhodopsin [Astyanax mexicanus] Length = 352 Frame 2 hits (HSPs): ____ Frame 1 hits (HSPs): ____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 352 0 150 300 __________________ Annotated Domains: BLOCKS BL00237A: G-protein coupled receptors pr 103..142 BLOCKS BL00237B: G-protein coupled receptors pr 212..223 BLOCKS BL00237C: G-protein coupled receptors pr 245..271 BLOCKS BL00237D: G-protein coupled receptors pr 298..314 DOMO DM00013: G-PROTEINCOUPLEDRECEPTORS 31..322 Entrez Domain: EXTRACELLULAR (POTENTIAL). 1..36 Entrez Transmembrane region: 1 (POTENTIAL). 37..61 Entrez Domain: CYTOPLASMIC (POTENTIAL). 62..73 Entrez Transmembrane region: 2 (POTENTIAL). 74..98 Entrez Domain: EXTRACELLULAR (POTENTIAL). 99..113 Entrez Transmembrane region: 3 (POTENTIAL). 114..133 Entrez Domain: CYTOPLASMIC (POTENTIAL). 134..152 Entrez Transmembrane region: 4 (POTENTIAL). 153..176 Entrez Domain: EXTRACELLULAR (POTENTIAL). 177..202 Entrez Transmembrane region: 5 (POTENTIAL). 203..230 Entrez Domain: CYTOPLASMIC (POTENTIAL). 231..252 Entrez Transmembrane region: 6 (POTENTIAL). 253..276 Entrez Domain: EXTRACELLULAR (POTENTIAL). 277..284 Entrez Transmembrane region: 7 (POTENTIAL). 285..309 Entrez Domain: CYTOPLASMIC (POTENTIAL). 310..352 Entrez glycosylation site: BY SIMILARITY. 2 Entrez glycosylation site: BY SIMILARITY. 15 Entrez binding site: RETINAL CHROMOPHORE (BY SI 296 Entrez lipid-binding site: PALMITATE (BY SIMILA 322 Entrez lipid-binding site: PALMITATE (BY SIMILA 323 Entrez mutagenized site: Y->F: DECREASE OF ABSO 261 PFAM 7tm_1: 7 transmembrane receptor (rhodops 54..306 PRINTS RHODOPSIN1: Rhodopsin motif I - 2 3..21 PRINTS RHODOPSIN2: Rhodopsin motif II - 2 22..38 PRINTS GPCRRHODOPSN1: GPCR transmembrane motif 39..63 PRINTS OPSIN1: Opsin motif I - 1 60..72 PRINTS GPCRRHODOPSN2: GPCR transmembrane motif 72..93 PRINTS RHODOPSIN3: Rhodopsin motif III - 2 85..101 PRINTS GPCRRHODOPSN3: GPCR transmembrane motif 117..139 PRINTS GPCRRHODOPSN4: GPCR transmembrane motif 152..173 PRINTS OPSIN2: Opsin motif II - 1 174..186 PRINTS RHODOPSIN4: Rhodopsin motif IV - 2 191..207 PRINTS GPCRRHODOPSN5: GPCR transmembrane motif 204..227 PRINTS GPCRRHODOPSN6: GPCR transmembrane motif 250..274 PRINTS RHODOPSIN5: Rhodopsin motif V - 2 271..289 PRINTS OPSIN3: Opsin motif III - 1 285..297 PRINTS GPCRRHODOPSN7: GPCR transmembrane motif 288..314 PRINTS RHODOPSIN6: Rhodopsin motif VI - 2 319..332 PRODOM PD000638: OPSD(41) OPSB(12) OPSG(9) 6..65 PRODOM PD000009: OPSD(50) OPSB(13) MSHR(13) 67..174 PRODOM PD000346: OPSD(50) OPSB(13) OPSG(9) 176..228 PRODOM PD028783: OPSD(33) OPSB(11) OPSG(9) 231..278 PRODOM PD000965: OPSD(41) OPSB(12) OPSG(9) 280..333 PROSITE OPSIN: Visual pigments (opsins) retinal 290..306 __________________ Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 9.4, Sum P(2) = 1.0 Identities = 8/23 (34%), Positives = 13/23 (56%), Frame = +2 Query: 8 LMCSLKLMYYVCDGXRALWCFVL 76 L C+L+ + G +LWC V+ Sbjct: 108 LGCNLEGFFATFGGINSLWCLVV 130 Score = 37 (13.0 bits), Expect = 9.4, Sum P(2) = 1.0 Identities = 9/22 (40%), Positives = 13/22 (59%), Frame = +1 Query: 112 PFSKFKCFG---LVMGVLSSWLL 171 P S F+ FG +MGV +W + Sbjct: 142 PMSNFR-FGENHAIMGVAFTWFM 163 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.87 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.363 0.154 0.633 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.358 0.154 0.645 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.356 0.157 0.612 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.363 0.157 0.551 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.336 0.145 0.481 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.378 0.163 0.641 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 56 54 10. 58 3 12 22 0.12 29 26 0.097 29 +2 0 56 53 10. 58 3 12 22 0.11 29 26 0.090 29 +1 0 57 55 10. 58 3 12 22 0.12 29 26 0.10 29 -1 0 57 54 10. 58 3 12 22 0.12 29 26 0.097 29 -2 0 56 54 10. 58 3 12 22 0.12 29 26 0.097 29 -3 0 56 53 10. 58 3 12 22 0.11 29 26 0.090 29 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 16 No. of states in DFA: 573 (56 KB) Total size of DFA: 109 KB (128 KB) Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 55.87u 0.89s 56.76t Elapsed: 00:00:16 Total cpu time: 55.91u 0.91s 56.82t Elapsed: 00:00:17 Start: Wed Jan 16 21:53:04 2002 End: Wed Jan 16 21:53:21 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000