WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A10F10_CONSENSUS (529 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 4 Sequences : less than 4 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1269 198 |================================================= 6310 1071 169 |========================================== 3980 902 188 |=============================================== 2510 714 125 |=============================== 1580 589 133 |================================= 1000 456 91 |====================== 631 365 45 |=========== 398 320 41 |========== 251 279 12 |=== 158 267 32 |======== 100 235 26 |====== 63.1 209 29 |======= 39.8 180 11 |== 25.1 169 2 |: 15.8 167 6 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 161 <<<<<<<<<<<<<<<<< 10.0 161 6 |= 6.31 155 5 |= 3.98 150 1 |: 2.51 149 5 |= 1.58 144 5 |= 1.00 139 7 |= 0.63 132 5 |= 0.40 127 8 |== 0.25 119 8 |== 0.16 111 29 |======= 0.10 82 5 |= 0.063 77 2 |: 0.040 75 4 |= 0.025 71 2 |: 0.016 69 2 |: 0.010 67 2 |: 0.0063 65 5 |= 0.0040 60 2 |: 0.0025 58 1 |: 0.0016 57 5 |= Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|3402817|emb|CAA07704.1|(AJ007829) lacZ' [Cloning v... +1 129 2.8e-14 2 gi|9294789|gb|AAF86672.1|AF178450_1(AF178450) beta-ga... +1 114 1.0e-12 2 gi|4884787|gb|AAD31805.1|AF128862_1(AF128862) LacZ [C... +1 94 2.1e-10 2 gi|11344886|gb|AAG34526.1|(AF298786) beta-galactosida... +1 114 3.7e-10 2 gi|11344916|gb|AAG34547.1|(AF298795) beta-galactosida... +1 114 3.7e-10 2 gi|7208800|emb|CAB76939.1|(AJ272004) alpha-peptide [C... +1 92 3.9e-10 2 gi|11994380|dbj|BAB02339.1|(AB019229) cucumisin-like ... -1 165 4.0e-10 1 gi|1076414|pir||S52770subtilisin-like proteinase (EC ... -1 151 1.2e-08 1 gi|3176874|gb|AAC18851.1|(AF065639) cucumisin-like se... -1 151 1.2e-08 1 gi|1132426|gb|AAA84370.1|(U39779) beta-galactosidase ... +1 92 6.7e-08 2 gi|2950220|emb|CAA71575.1|(Y10545) fused-ccdB [Escher... +1 100 1.8e-07 2 gi|2664255|emb|CAA67127.1|(X98501) fused; toxic gene ... +1 100 2.1e-07 2 gi|7435657|pir||T07171subtilisin-like proteinase (EC ... -1 138 3.1e-07 1 gi|7435656|pir||T07172subtilisin-like proteinase (EC ... -1 137 4.0e-07 1 gi|2664253|emb|CAA67126.1|(X98500) fused; toxic gene ... +1 95 5.5e-07 2 gi|971140|dbj|BAA09899.1|(D63841) modified alpha pept... +2 77 9.6e-07 2 gi|992926|dbj|BAA06206.1|(D29829) beta-galactosidase ... +2 77 9.6e-07 2 gi|9957714|gb|AAG09442.1|AF200467_1(AF200467) subtila... -1 130 2.1e-06 1 gi|971137|dbj|BAA09897.1|(D63840) modified alpha pept... +2 77 5.0e-06 2 gi|2118043|pir||I60307beta-galactosidase, alpha pepti... +2 77 5.0e-06 2 gi|773414|gb|AAB05989.1|(U23751) beta galactosidase [... +2 77 9.5e-06 2 gi|9294786|gb|AAF86670.1|AF178449_1(AF178449) beta-ga... +2 77 1.8e-05 2 gi|994736|gb|AAA75561.1|(M18327) LacOPZ-alpha peptide... -2 84 3.1e-05 2 gi|11061107|emb|CAC14450.1|(AJ403982) alfa-peptide [C... -2 84 3.1e-05 2 gi|146581|gb|AAA24056.1|(M74750) LacZ-alpha peptide [... +2 77 6.7e-05 2 gi|4006827|gb|AAC95169.1|(AC005970) putative serine p... -1 121 0.00014 1 gi|7489441|pir||T05928subtilisin-like proteinase (EC ... -1 100 0.00020 1 gi|208408|gb|AAA72910.1|(M35437) beta-galactosidase [... +2 77 0.00022 2 gi|215212|gb|AAA32255.1|(J02462) beta-galactosidase Z... +2 77 0.00022 2 gi|455368|gb|AAA72534.1|(M13163) lacZ' [unidentified ... +2 77 0.00022 2 gi|455369|gb|AAA72636.1|(M19265) lacZ' [unidentified ... +2 77 0.00022 2 gi|971146|dbj|BAA09903.1|(D63843) modified alpha pept... +2 77 0.00022 2 gi|992932|dbj|BAA06210.1|(D29831) beta-galactosidase ... +2 77 0.00022 2 gi|995518|emb|CAA62604.1|(X91197) lacZ [Escherichia c... +2 77 0.00022 2 gi|1016680|gb|AAB39960.1|(U30830) beta-galactosidase ... +2 77 0.00022 2 gi|1107463|dbj|BAA13562.1|(D88215) alpha-peptide of b... +2 77 0.00022 2 gi|1658409|gb|AAB51671.1|(U73899) beta-galactosidase ... +2 77 0.00022 2 gi|2343029|gb|AAB67680.1|(U75322) beta-galactosidase ... +2 77 0.00022 2 gi|2440157|emb|CAA75106.1|(Y14835) beta-galactosidase... +2 77 0.00022 2 gi|2981187|gb|AAC78771.1|(AF049063) lacZ alpha peptid... +2 77 0.00022 2 gi|2981192|gb|AAC78775.1|(AF049064) lacZ alpha peptid... +2 77 0.00022 2 gi|3808121|emb|CAA09780.1|(AJ011791) lacZ alpha prote... +2 77 0.00022 2 gi|3953671|dbj|BAA34768.1|(AB019612) beta-galactosida... +2 77 0.00022 2 gi|7108472|gb|AAF36427.1|AF125994_2(AF125994) lacZalp... +2 77 0.00022 2 gi|7108476|gb|AAF36430.1|AF125995_2(AF125995) lacZalp... +2 77 0.00022 2 gi|7380886|dbj|BAA93042.1|(AB040452) beta-galactosida... +2 77 0.00022 2 gi|7638063|gb|AAF65335.1|(AF234295) LacZ alpha, trunc... +2 77 0.00022 2 gi|8650404|gb|AAF78196.1|(AF216802) beta-galactosidas... +2 77 0.00022 2 gi|1684629|emb|CAA70550.1|(Y09374) lacZ-PhoC [synthet... +1 114 0.00051 1 gi|11265104|pir||T48553subtilisin-like proteinase hom... -1 117 0.00069 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 2 Hits gi|3402817 | ________ gi|9294789 | ________ gi|4884787 | ________ gi|11344886 | ________ gi|11344916 | ________ gi|7208800 | ________ gi|1132426 | __________ ________ gi|2950220 | ________ gi|2664255 | ________ gi|2664253 | ________ gi|971140 | ________ gi|992926 | ________ gi|971137 | ________ gi|2118043 | ________ gi|773414 | ________ gi|9294786 | ________ gi|146581 | ________ gi|208408 | ________ gi|215212 | ________ gi|455368 | ________ gi|455369 | ________ gi|971146 | ________ gi|992932 | ________ gi|995518 | ________ gi|1016680 | ________ gi|1107463 | ________ gi|1658409 | ________ gi|2343029 | ________ gi|2440157 | ________ gi|2981187 | ________ gi|2981192 | ________ gi|3808121 | ________ gi|3953671 | ________ gi|7108472 | ________ gi|7108476 | ________ gi|7380886 | ________ gi|7638063 | ________ gi|8650404 | ________ __________________________________________________ Query sequence: | | | | | 177 0 50 100 150 Locus_ID Frame 1 Hits gi|3402817 | ________ gi|9294789 | ________ gi|4884787 | _______ gi|11344886 | ________ gi|11344916 | ________ gi|7208800 | _________ gi|1132426 | ________ gi|2950220 | ____________ gi|2664255 | ____________ gi|2664253 | ________ gi|971140 | __________ gi|992926 | __________ gi|971137 | ________ gi|2118043 | ________ gi|773414 | ______ gi|9294786 | ______ gi|146581 | _______ gi|208408 | ____ gi|215212 | ____ gi|455368 | ____ gi|455369 | ____ gi|971146 | ____ gi|992932 | ____ gi|995518 | ____ gi|1016680 | ____ gi|1107463 | ____ gi|1658409 | ____ gi|2343029 | ____ gi|2440157 | ____ gi|2981187 | ____ gi|2981192 | ____ gi|3808121 | ____ gi|3953671 | ____ gi|7108472 | ____ gi|7108476 | ____ gi|7380886 | ____ gi|7638063 | ____ gi|8650404 | ____ gi|1684629 | ________ __________________________________________________ Query sequence: | | | | | 177 0 50 100 150 Locus_ID Frame -1 Hits gi|11994380 | gi|1076414 | _________________ gi|3176874 | _________________ gi|7435657 | _________________ gi|7435656 | _________________ gi|9957714 | ________________ gi|4006827 | _ gi|7489441 | ________________ gi|11265104 | __________________________________________________ Query sequence: | | | | | 177 0 50 100 150 Locus_ID Frame -2 Hits gi|994736 | _________ gi|11061107 | _________ __________________________________________________ Query sequence: | | | | | 177 0 50 100 150 Locus_ID Frame -3 Hits gi|994736 | ____ gi|11061107 | ____ __________________________________________________ Query sequence: | | | | | 177 0 50 100 150
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 111 database sequences were not reported due to the limiting value of parameter V = 50. >gi|3402817|emb|CAA07704.1| (AJ007829) lacZ' [Cloning vector pGreen] Length = 120 Frame 2 hits (HSPs): ____________ Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 120 0 50 100 Plus Strand HSPs: Score = 129 (45.4 bits), Expect = 2.8e-14, Sum P(2) = 2.8e-14 Identities = 25/26 (96%), Positives = 25/26 (96%), Frame = +1 Query: 343 SRGGPVPNSPYSESYYNSLAVVLPRR 420 SRGGPVPNSPYSESYYNSLAVVL RR Sbjct: 49 SRGGPVPNSPYSESYYNSLAVVLQRR 74 Score = 77 (27.1 bits), Expect = 2.8e-14, Sum P(2) = 2.8e-14 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 79 PGVTQLNRLAAHPPFASWRNSEEARTD 105 >gi|9294789|gb|AAF86672.1|AF178450_1 (AF178450) beta-galactosidase alpha peptide [Integration vector pCD11PSK] >gi|9294798|gb|AAF86678.1|AF178453_1 (AF178453) beta-galactosidase alpha peptide [Integration vector pCD13PSK] Length = 127 Frame 2 hits (HSPs): ___________ Frame 1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 1.0e-12, Sum P(2) = 1.0e-12 Identities = 24/27 (88%), Positives = 24/27 (88%), Frame = +1 Query: 343 SRGGPVPNSPYSESYY-NSLAVVLPRR 420 SRGGPVPNSPYSESYY SLAVVL RR Sbjct: 49 SRGGPVPNSPYSESYYARSLAVVLQRR 75 Score = 77 (27.1 bits), Expect = 1.0e-12, Sum P(2) = 1.0e-12 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 80 PGVTQLNRLAAHPPFASWRNSEEARTD 106 >gi|4884787|gb|AAD31805.1|AF128862_1 (AF128862) LacZ [Cloning vector pHIND2.2] Length = 103 Frame 2 hits (HSPs): _____________ Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | | 103 0 20 40 60 80 100 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 2.1e-10, Sum P(2) = 2.1e-10 Identities = 19/22 (86%), Positives = 19/22 (86%), Frame = +1 Query: 355 PVPNSPYSESYYNSLAVVLPRR 420 P NSPYSESYYNSLAVVL RR Sbjct: 31 PSSNSPYSESYYNSLAVVLQRR 52 Score = 77 (27.1 bits), Expect = 2.1e-10, Sum P(2) = 2.1e-10 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 57 PGVTQLNRLAAHPPFASWRNSEEARTD 83 >gi|11344886|gb|AAG34526.1| (AF298786) beta-galactosidase [Cloning vector pUG26] Length = 193 Frame 2 hits (HSPs): ________ Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | 193 0 50 100 150 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 3.7e-10, Sum P(2) = 3.7e-10 Identities = 24/27 (88%), Positives = 24/27 (88%), Frame = +1 Query: 343 SRGGPVPNSPYSESYY-NSLAVVLPRR 420 SRGGPVPNSPYSESYY SLAVVL RR Sbjct: 51 SRGGPVPNSPYSESYYARSLAVVLQRR 77 Score = 77 (27.1 bits), Expect = 3.7e-10, Sum P(2) = 3.7e-10 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTD 108 >gi|11344916|gb|AAG34547.1| (AF298795) beta-galactosidase [Cloning vector pUG7] Length = 193 Frame 2 hits (HSPs): ________ Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | 193 0 50 100 150 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 3.7e-10, Sum P(2) = 3.7e-10 Identities = 24/27 (88%), Positives = 24/27 (88%), Frame = +1 Query: 343 SRGGPVPNSPYSESYY-NSLAVVLPRR 420 SRGGPVPNSPYSESYY SLAVVL RR Sbjct: 51 SRGGPVPNSPYSESYYARSLAVVLQRR 77 Score = 77 (27.1 bits), Expect = 3.7e-10, Sum P(2) = 3.7e-10 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTD 108 >gi|7208800|emb|CAB76939.1| (AJ272004) alpha-peptide [Cloning vector pPW78] Length = 95 Frame 2 hits (HSPs): ______________ Frame 1 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | | 95 0 20 40 60 80 Plus Strand HSPs: Score = 92 (32.4 bits), Expect = 3.9e-10, Sum P(2) = 3.9e-10 Identities = 20/31 (64%), Positives = 23/31 (74%), Frame = +1 Query: 331 QHQVSRGGPVPN-SPYSESYYNSLAVVLPRR 420 ++ SRG P +PYSESYYNSLAVVL RR Sbjct: 14 EYSSSRGSPGTELAPYSESYYNSLAVVLQRR 44 Score = 77 (27.1 bits), Expect = 3.9e-10, Sum P(2) = 3.9e-10 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 49 PGVTQLNRLAAHPPFASWRNSEEARTD 75 >gi|11994380|dbj|BAB02339.1| (AB019229) cucumisin-like serine protease; subtilisin-like protease [Arabidopsis thaliana] Length = 777 Frame -1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 777 0 150 300 450 600 750 Minus Strand HSPs: Score = 165 (58.1 bits), Expect = 4.0e-10, P = 4.0e-10 Identities = 43/101 (42%), Positives = 54/101 (53%), Frame = -1 Query: 427 SXHDVVKRRPVNCNT-THYRANWVPGPPSRPGVGVGVSPSTIVFSAENKTQAFEVTFSRV 251 S +VVK + V N ++ A + G S V + VSPS + FS E +EVTF V Sbjct: 676 STGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSV 735 Query: 250 KLDGS------ESFGSIEWTDGSHVVRSPIAVTWS-GAYSS 149 L G FGSIEWTDG HVV+SP+AV W G+ S Sbjct: 736 VLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQS 776 >gi|1076414|pir||S52770 subtilisin-like proteinase (EC 3.4.21.-), nodule-specific - Arabidopsis thaliana (fragment) >gi|757534|emb|CAA59963.1| (X85974) subtilisin-like protease [Arabidopsis thaliana] Length = 746 Frame -1 hits (HSPs): _____ Annotated Domains: __ __ __________________________________________________ Database sequence: | | | | | | 746 0 150 300 450 600 __________________ Annotated Domains: PROSITE AA_TRNA_LIGASE_II_1: Aminoacyl-transfer 92..108 PROSITE SUBTILASE_SER: Serine proteases, subtila 529..539 __________________ Minus Strand HSPs: Score = 151 (53.2 bits), Expect = 1.2e-08, P = 1.2e-08 Identities = 28/60 (46%), Positives = 41/60 (68%), Frame = -1 Query: 337 GVGVGVSPSTIVFSAENKTQAFEVTFS--RVKLDGSESFGSIEWTDGSHVVRSPIAVTWS 164 GV + V P+ + F N+ +++ VTF+ K GS SFGSIEW+DG HVV SP+A++W+ Sbjct: 687 GVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISWT 746 >gi|3176874|gb|AAC18851.1| (AF065639) cucumisin-like serine protease [Arabidopsis thaliana] >gi|9758435|dbj|BAB09021.1| (AB007645) cucumisin-like serine protease [Arabidopsis thaliana] Length = 757 Frame -1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | || 757 0 150 300 450 600 750 Minus Strand HSPs: Score = 151 (53.2 bits), Expect = 1.2e-08, P = 1.2e-08 Identities = 28/60 (46%), Positives = 41/60 (68%), Frame = -1 Query: 337 GVGVGVSPSTIVFSAENKTQAFEVTFS--RVKLDGSESFGSIEWTDGSHVVRSPIAVTWS 164 GV + V P+ + F N+ +++ VTF+ K GS SFGSIEW+DG HVV SP+A++W+ Sbjct: 698 GVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISWT 757 >gi|1132426|gb|AAA84370.1| (U39779) beta-galactosidase alpha polypeptide [Cloning vector pTriplEx] Length = 139 Frame 2 hits (HSPs): ___________ ___________ Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 139 0 50 100 Plus Strand HSPs: Score = 92 (32.4 bits), Expect = 6.7e-08, Sum P(2) = 6.7e-08 Identities = 19/26 (73%), Positives = 20/26 (76%), Frame = +1 Query: 343 SRGGPVPNSPYSESYYNSLAVVLPRR 420 S + NSPYSESYYNSLAVVL RR Sbjct: 68 SSSADLANSPYSESYYNSLAVVLQRR 93 Score = 77 (27.1 bits), Expect = 6.7e-08, Sum P(2) = 6.7e-08 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 98 PGVTQLNRLAAHPPFASWRNSEEARTD 124 Score = 43 (15.1 bits), Expect = 0.076, Sum P(2) = 0.073 Identities = 10/30 (33%), Positives = 15/30 (50%), Frame = +2 Query: 182 WTPHNMTSISPLNGAKTLRAIQLNSTKRDL 271 W P + S L+ +K + A NS+ DL Sbjct: 44 WYPGILQDPSTLDSSKLMHACGRNSSSADL 73 >gi|2950220|emb|CAA71575.1| (Y10545) fused-ccdB [Escherichia coli] Length = 217 Frame 2 hits (HSPs): _______ Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 1.8e-07, Sum P(2) = 1.8e-07 Identities = 24/38 (63%), Positives = 26/38 (68%), Frame = +1 Query: 307 SCWETHQHQHQVSRGGPVPNSPYSESYYNSLAVVLPRR 420 S W +H SRG PNSPYS+SYYNSLAVVL RR Sbjct: 43 SHWRPLEH---ASRG---PNSPYSKSYYNSLAVVLQRR 74 Score = 77 (27.1 bits), Expect = 1.8e-07, Sum P(2) = 1.8e-07 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 79 PGVTQLNRLAAHPPFASWRNSEEARTD 105 >gi|2664255|emb|CAA67127.1| (X98501) fused; toxic gene [synthetic construct] Length = 223 Frame 2 hits (HSPs): _______ Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 223 0 50 100 150 200 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 2.1e-07, Sum P(2) = 2.1e-07 Identities = 24/38 (63%), Positives = 26/38 (68%), Frame = +1 Query: 307 SCWETHQHQHQVSRGGPVPNSPYSESYYNSLAVVLPRR 420 S W +H SRG PNSPYS+SYYNSLAVVL RR Sbjct: 49 SHWRPLEH---ASRG---PNSPYSKSYYNSLAVVLQRR 80 Score = 77 (27.1 bits), Expect = 2.1e-07, Sum P(2) = 2.1e-07 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTD 111 >gi|7435657|pir||T07171 subtilisin-like proteinase (EC 3.4.21.-) 1 - tomato >gi|1771160|emb|CAA67429.1| (X98929) SBT1 [Lycopersicon esculentum] >gi|3687305|emb|CAA06999.1| (AJ006378) subtilisin-like protease [Lycopersicon esculentum] Length = 766 Frame -1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | 766 0 150 300 450 600 750 Minus Strand HSPs: Score = 138 (48.6 bits), Expect = 3.1e-07, P = 3.1e-07 Identities = 26/58 (44%), Positives = 38/58 (65%), Frame = -1 Query: 334 VGVGVSPSTIVFSAENKTQAFEVTFSRV-KLDGSESFGSIEWTDGSHVVRSPIAVTWS 164 V + V P T+ FS +N+ + + VTF+ K G+ SF +EW+DG HVV SPIA +W+ Sbjct: 709 VKILVEPQTLTFSRKNEKKTYTVTFTATSKPSGTTSFARLEWSDGQHVVASPIAFSWT 766 >gi|7435656|pir||T07172 subtilisin-like proteinase (EC 3.4.21.-) 2 - tomato >gi|1771162|emb|CAA67430.1| (X98930) SBT2 [Lycopersicon esculentum] >gi|3687307|emb|CAA07000.1| (AJ006379) subtilisin-like protease [Lycopersicon esculentum] Length = 775 Frame -1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | 775 0 150 300 450 600 750 Minus Strand HSPs: Score = 137 (48.2 bits), Expect = 4.0e-07, P = 4.0e-07 Identities = 25/57 (43%), Positives = 37/57 (64%), Frame = -1 Query: 337 GVGVGVSPSTIVFSAENKTQAFEVTFSRVKLDGSESFGSIEWTDGSHVVRSPIAVTW 167 G V V P + F+++N+ +++VTF V + FGS+ W DG+H VRSPIA+TW Sbjct: 715 GAVVKVEPERLNFTSKNQKLSYKVTFKTVSRQKAPEFGSLIWKDGTHKVRSPIAITW 771 >gi|2664253|emb|CAA67126.1| (X98500) fused; toxic gene [synthetic construct] Length = 194 Frame 2 hits (HSPs): _______ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 194 0 50 100 150 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 5.5e-07, Sum P(2) = 5.5e-07 Identities = 21/26 (80%), Positives = 22/26 (84%), Frame = +1 Query: 343 SRGGPVPNSPYSESYYNSLAVVLPRR 420 SRG PNSPYS+SYYNSLAVVL RR Sbjct: 29 SRG---PNSPYSKSYYNSLAVVLQRR 51 Score = 77 (27.1 bits), Expect = 5.5e-07, Sum P(2) = 5.5e-07 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 56 PGVTQLNRLAAHPPFASWRNSEEARTD 82 >gi|971140|dbj|BAA09899.1| (D63841) modified alpha peptide of E. coli beta-galactosidase [Cloning vector pKF297] >gi|971152|dbj|BAA09907.1| (D63845) modified alpha peptide of E. coli beta-galactosidase [Cloning vector pKF17k] Length = 106 Frame 2 hits (HSPs): _____________ Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 9.6e-07, Sum P(2) = 9.6e-07 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 42 PGVTQLNRLAAHPPFASWRNSEEARTD 68 Score = 62 (21.8 bits), Expect = 9.6e-07, Sum P(2) = 9.6e-07 Identities = 17/33 (51%), Positives = 19/33 (57%), Frame = +1 Query: 322 HQHQHQVSRGGPVPNSPYSESYYNSLAVVLPRR 420 H H+ SRG P+ P S NSLAVVL RR Sbjct: 9 HAHRWVDSRGSPLEGVPSS----NSLAVVLQRR 37 >gi|992926|dbj|BAA06206.1| (D29829) beta-galactosidase alpha-peptide [Cloning vector pKF17c] >gi|992936|dbj|BAA06198.1| (D29825) beta-galactosidase alpha-peptide [Cloning vector pKF397] Length = 80 Frame 2 hits (HSPs): _________________ Frame 1 hits (HSPs): __________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 9.6e-07, Sum P(2) = 9.6e-07 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 42 PGVTQLNRLAAHPPFASWRNSEEARTD 68 Score = 62 (21.8 bits), Expect = 9.6e-07, Sum P(2) = 9.6e-07 Identities = 17/33 (51%), Positives = 19/33 (57%), Frame = +1 Query: 322 HQHQHQVSRGGPVPNSPYSESYYNSLAVVLPRR 420 H H+ SRG P+ P S NSLAVVL RR Sbjct: 9 HAHRWVDSRGSPLEGVPSS----NSLAVVLQRR 37 >gi|9957714|gb|AAG09442.1|AF200467_1 (AF200467) subtilase; SP1 [Oryza sativa] Length = 736 Frame -1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 736 0 150 300 450 600 Minus Strand HSPs: Score = 130 (45.8 bits), Expect = 2.1e-06, P = 2.1e-06 Identities = 28/57 (49%), Positives = 37/57 (64%), Frame = -1 Query: 340 PGVGVGVSPSTIVFSAENKTQAFEVTFSRV-KLDGSESFGSIEWTDGSHVVRSPIAV 173 PGV + V PS +VF A NK F+V+FS + KL G +FGS+ W + + VR PIAV Sbjct: 668 PGVKMVVEPSVLVFDAANKVHTFKVSFSPLWKLQGDYTFGSLTWHNDNKSVRIPIAV 724 >gi|971137|dbj|BAA09897.1| (D63840) modified alpha peptide of E. coli beta-galactosidase [Cloning vector pKF296] >gi|971149|dbj|BAA09905.1| (D63844) modified alpha peptide of E. coli beta-galactosidase [Cloning vector pKF16k] Length = 106 Frame 2 hits (HSPs): _____________ Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 5.0e-06, Sum P(2) = 5.0e-06 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 42 PGVTQLNRLAAHPPFASWRNSEEARTD 68 Score = 55 (19.4 bits), Expect = 5.0e-06, Sum P(2) = 5.0e-06 Identities = 15/26 (57%), Positives = 16/26 (61%), Frame = +1 Query: 343 SRGGPVPNSPYSESYYNSLAVVLPRR 420 SRG P+ P S NSLAVVL RR Sbjct: 16 SRGSPIDGVPSS----NSLAVVLQRR 37 >gi|2118043|pir||I60307 beta-galactosidase, alpha peptide - Escherichia coli >gi|992923|dbj|BAA06204.1| (D29828) beta-galactosidase alpha-peptide [Cloning vector pKF16c] >gi|1272693|dbj|BAA06196.1| (D29824) beta-galactosidase alpha-peptide [Cloning vector pKF396] Length = 80 Frame 2 hits (HSPs): _________________ Frame 1 hits (HSPs): ______________ Annotated Domains: _________________________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 __________________ Annotated Domains: DOMO DM01511: GLYCOSYLHYDROLASESFAMILY2 29..80 __________________ Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 5.0e-06, Sum P(2) = 5.0e-06 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 42 PGVTQLNRLAAHPPFASWRNSEEARTD 68 Score = 55 (19.4 bits), Expect = 5.0e-06, Sum P(2) = 5.0e-06 Identities = 15/26 (57%), Positives = 16/26 (61%), Frame = +1 Query: 343 SRGGPVPNSPYSESYYNSLAVVLPRR 420 SRG P+ P S NSLAVVL RR Sbjct: 16 SRGSPIDGVPSS----NSLAVVLQRR 37 >gi|773414|gb|AAB05989.1| (U23751) beta galactosidase [Cloning vector pBBR1MCS-2] >gi|833819|gb|AAB06689.1| (U25059) LacZ alpha peptide [Cloning vector pBBR1MCS-3] >gi|833823|gb|AAB06692.1| (U25060) LacZ alpha peptide [Cloning vector pBBR1MCS-4] >gi|833827|gb|AAB06695.1| (U25061) LacZ alpha peptide [Cloning vector pBBR1MCS-5] Length = 121 Frame 2 hits (HSPs): ____________ Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 121 0 50 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 9.5e-06, Sum P(2) = 9.5e-06 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 80 PGVTQLNRLAAHPPFASWRNSEEARTD 106 Score = 75 (26.4 bits), Expect = 9.5e-06, Sum P(2) = 9.5e-06 Identities = 17/20 (85%), Positives = 17/20 (85%), Frame = +1 Query: 364 NSPYSESYY-NSLAVVLPRR 420 NSPYSESYY SLAVVL RR Sbjct: 56 NSPYSESYYARSLAVVLQRR 75 >gi|9294786|gb|AAF86670.1|AF178449_1 (AF178449) beta-galactosidase alpha peptide [Integration vector pCD11PKS] >gi|9294795|gb|AAF86676.1|AF178452_1 (AF178452) beta-galactosidase alpha peptide [Integration vector pCD13PKS] Length = 127 Frame 2 hits (HSPs): ___________ Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 1.8e-05, Sum P(2) = 1.8e-05 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 80 PGVTQLNRLAAHPPFASWRNSEEARTD 106 Score = 75 (26.4 bits), Expect = 1.8e-05, Sum P(2) = 1.8e-05 Identities = 17/20 (85%), Positives = 17/20 (85%), Frame = +1 Query: 364 NSPYSESYY-NSLAVVLPRR 420 NSPYSESYY SLAVVL RR Sbjct: 56 NSPYSESYYARSLAVVLQRR 75 >gi|994736|gb|AAA75561.1| (M18327) LacOPZ-alpha peptide from pUC9; putative [unidentified cloning vector] >gi|994738|gb|AAA75563.1| (M18328) LacOPZ-alpha peptide from pUC9; putative [Cloning vector pBGS9+] >gi|994740|gb|AAA75565.1| (M18329) LacOPZ-alpha peptide from pUC9; putative [Cloning vector pBGS9-] Length = 93 Frame -2 hits (HSPs): _________________ Frame -3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 93 0 20 40 60 80 Minus Strand HSPs: Score = 84 (29.6 bits), Expect = 3.1e-05, Sum P(2) = 3.1e-05 Identities = 19/30 (63%), Positives = 21/30 (70%), Frame = -2 Query: 516 GRQSVRPFRIT-PVGXGGCAARRLXWVTPGF 427 GR SVR + + GGCAARRL WVTPGF Sbjct: 12 GR-SVRASSLLRQLAKGGCAARRLSWVTPGF 41 Score = 39 (13.7 bits), Expect = 3.1e-05, Sum P(2) = 3.1e-05 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = -3 Query: 422 SRRGKTTASE 393 SRR KTTASE Sbjct: 44 SRRCKTTASE 53 >gi|11061107|emb|CAC14450.1| (AJ403982) alfa-peptide [Cloning vector pBPSCat2] >gi|11061114|emb|CAC14453.1| (AJ403983) alfa-peptide [Cloning vector pBPSGen4] >gi|11061120|emb|CAC14456.1| (AJ403984) alfa-peptide [Cloning vector pBPSKan2] Length = 55 Frame -2 hits (HSPs): ___________________________ Frame -3 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 55 0 20 40 Minus Strand HSPs: Score = 84 (29.6 bits), Expect = 3.1e-05, Sum P(2) = 3.1e-05 Identities = 19/30 (63%), Positives = 21/30 (70%), Frame = -2 Query: 516 GRQSVRPFRIT-PVGXGGCAARRLXWVTPGF 427 GR SVR + + GGCAARRL WVTPGF Sbjct: 12 GR-SVRASSLLRQLAKGGCAARRLSWVTPGF 41 Score = 39 (13.7 bits), Expect = 3.1e-05, Sum P(2) = 3.1e-05 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = -3 Query: 422 SRRGKTTASE 393 SRR KTTASE Sbjct: 44 SRRCKTTASE 53 >gi|146581|gb|AAA24056.1| (M74750) LacZ-alpha peptide [Escherichia coli] >gi|450838|gb|AAA61620.1| (U04894) beta-galactosidase alpha peptide [Cloning vector pKSM711] >gi|450841|gb|AAA61622.1| (U04895) beta-galactosidase alpha peptide [Cloning vector pKSM713] >gi|450845|gb|AAA61625.1| (U04896) beta-galactosidase alpha peptide [Cloning vector pKSM715] >gi|3559832|emb|CAA07595.1| (AJ007660) beta-galactosidase alpha peptide [Cloning vector pEH3] >gi|3560096|emb|CAA07592.1| (AJ007659) beta-galactosidase, alpha peptide [Cloning vector pEH1] Length = 90 Frame 2 hits (HSPs): _______________ Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | 90 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 6.7e-05, Sum P(2) = 6.7e-05 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTD 60 Score = 44 (15.5 bits), Expect = 6.7e-05, Sum P(2) = 6.7e-05 Identities = 13/21 (61%), Positives = 15/21 (71%), Frame = +1 Query: 358 VPNSPYSESYYNSLAVVLPRR 420 VP++ S S NSLAVVL RR Sbjct: 10 VPHA-ISSSPGNSLAVVLQRR 29 >gi|4006827|gb|AAC95169.1| (AC005970) putative serine protease [Arabidopsis thaliana] Length = 754 Frame -1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | || 754 0 150 300 450 600 750 Minus Strand HSPs: Score = 121 (42.6 bits), Expect = 0.00014, P = 0.00014 Identities = 24/62 (38%), Positives = 37/62 (59%), Frame = -1 Query: 340 PGVGVGVSPSTIVFSAENKTQAFEVTF-SR--VKLDGSESFGSIEWTDGSHVVRSPIAVT 170 P VG+ V PS + F + + + + VTF S+ V + FGSI W++ H VRSP+A + Sbjct: 691 PSVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAFS 750 Query: 169 WS 164 W+ Sbjct: 751 WN 752 >gi|7489441|pir||T05928 subtilisin-like proteinase (EC 3.4.21.-) - barley (fragment) >gi|2695937|emb|CAA10987.1| (AJ222782) subtilisin-like protease [Hordeum vulgare] Length = 106 Frame -1 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Minus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.00020, P = 0.00020 Identities = 21/54 (38%), Positives = 31/54 (57%), Frame = -1 Query: 337 GVGVGVSPSTIVFSAENKTQAFEVTFSRV-KLDGSESFGSIEWTDGSHVVRSPI 179 GV + V P ++F A NK Q ++V S + KL G +FGS+ W + VR P+ Sbjct: 53 GVKMEVFPPVLMFDAANKVQTYQVKLSPMWKLHGDYTFGSLTWHNDQKAVRIPV 106 >gi|208408|gb|AAA72910.1| (M35437) beta-galactosidase [unidentified cloning vector] Length = 51 Frame 2 hits (HSPs): ___________________________ Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 51 0 20 40 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 20 PGVTQLNRLAAHPPFASWRNSEEARTD 46 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 6 NSLAVVLQRR 15 >gi|215212|gb|AAA32255.1| (J02462) beta-galactosidase Z-alpha [Coliphage M13] Length = 48 Frame 2 hits (HSPs): _____________________________ Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 48 0 20 40 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 20 PGVTQLNRLAAHPPFASWRNSEEARTD 46 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 6 NSLAVVLQRR 15 >gi|455368|gb|AAA72534.1| (M13163) lacZ' [unidentified cloning vector] Length = 92 Frame 2 hits (HSPs): _______________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 92 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 31 PGVTQLNRLAAHPPFASWRNSEEARTD 57 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 17 NSLAVVLQRR 26 >gi|455369|gb|AAA72636.1| (M19265) lacZ' [unidentified cloning vector] Length = 99 Frame 2 hits (HSPs): ______________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 99 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|971146|dbj|BAA09903.1| (D63843) modified alpha peptide of E. coli beta-galactosidase [Cloning vector pKF299] >gi|971158|dbj|BAA09911.1| (D63847) modified alpha peptide of E. coli beta-galactosidase [Cloning vector pKF19k] >gi|3953651|dbj|BAA34750.1| (AB019606) beta-galactosidase alpha-peptide [Cloning vector pTH19kr] >gi|3953655|dbj|BAA34753.1| (AB019607) beta-galactosidase alpha-peptide [Cloning vector pTH19ks1] >gi|3953659|dbj|BAA34756.1| (AB019608) beta-galactosidase alpha-peptide [Cloning vector pTH19ks5] >gi|6692773|dbj|BAA89410.1| (AB031078) lacZ alpha [Cloning vector pMG105] Length = 102 Frame 2 hits (HSPs): _____________ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | | 102 0 20 40 60 80 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|992932|dbj|BAA06210.1| (D29831) beta-galactosidase alpha-peptide [Cloning vector pKF19c] >gi|992942|dbj|BAA06202.1| (D29827) beta-galactosidase alpha-peptide [Cloning vector pKF399] Length = 76 Frame 2 hits (HSPs): __________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 76 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|995518|emb|CAA62604.1| (X91197) lacZ [Escherichia coli] Length = 81 Frame 2 hits (HSPs): _________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 18 PGVTQLNRLAAHPPFASWRNSEEARTD 44 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 4 NSLAVVLQRR 13 >gi|1016680|gb|AAB39960.1| (U30830) beta-galactosidase [Cloning vector pFD288] Length = 95 Frame 2 hits (HSPs): _______________ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 95 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|1107463|dbj|BAA13562.1| (D88215) alpha-peptide of beta-galactosidase [Cloning vector pHSG576] Length = 71 Frame 2 hits (HSPs): ___________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 31 PGVTQLNRLAAHPPFASWRNSEEARTD 57 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 17 NSLAVVLQRR 26 >gi|1658409|gb|AAB51671.1| (U73899) beta-galactosidase [Cloning vector pJB3] Length = 76 Frame 2 hits (HSPs): __________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 76 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 39 PGVTQLNRLAAHPPFASWRNSEEARTD 65 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 25 NSLAVVLQRR 34 >gi|2343029|gb|AAB67680.1| (U75322) beta-galactosidase [Cloning vector pJB3Cm6] >gi|2343034|gb|AAB67684.1| (U75323) beta-galactosidase [Cloning vector pJB3Km1] >gi|2343040|gb|AAB67689.1| (U75324) beta-galactosidase [Cloning vector pJB3Tc20] >gi|2343045|gb|AAB67693.1| (U75325) beta-galactosidase [Cloning vector pJB321] Length = 79 Frame 2 hits (HSPs): _________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 79 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|2440157|emb|CAA75106.1| (Y14835) beta-galactosidase [Phagemid cloning vector pTZ19R] Length = 88 Frame 2 hits (HSPs): _______________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 47 PGVTQLNRLAAHPPFASWRNSEEARTD 73 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 33 NSLAVVLQRR 42 >gi|2981187|gb|AAC78771.1| (AF049063) lacZ alpha peptide [Expression vector pYZ1N] >gi|3136318|gb|AAC78828.1| (AF064066) lacZ alpha peptide [Expression vector pYZ41N] >gi|3136322|gb|AAC78831.1| (AF064067) lacZ alpha peptide [Expression vector pYZ81N] Length = 79 Frame 2 hits (HSPs): _________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 79 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|2981192|gb|AAC78775.1| (AF049064) lacZ alpha peptide [Expression vector pYZ3N-GFP] Length = 80 Frame 2 hits (HSPs): _________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|3808121|emb|CAA09780.1| (AJ011791) lacZ alpha protein [Promoter search vector pME4507] >gi|3808125|emb|CAA09783.1| (AJ011792) lacZ alpha protein [Promoter search vector pME4510] Length = 63 Frame 2 hits (HSPs): ______________________ Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | 63 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 17 PGVTQLNRLAAHPPFASWRNSEEARTD 43 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 3 NSLAVVLQRR 12 >gi|3953671|dbj|BAA34768.1| (AB019612) beta-galactosidase alpha-peptide [Cloning vector pTH19cr] >gi|3953675|dbj|BAA34771.1| (AB019613) beta-galactosidase alpha-peptide [Cloning vector pTH19cs1] >gi|3953679|dbj|BAA34774.1| (AB019614) beta-galactosidase alpha-peptide [Cloning vector pTH19cs5] Length = 78 Frame 2 hits (HSPs): __________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 78 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|7108472|gb|AAF36427.1|AF125994_2 (AF125994) lacZalpha peptide [Shuttle vector pUCP-Nco] Length = 84 Frame 2 hits (HSPs): ________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 84 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|7108476|gb|AAF36430.1|AF125995_2 (AF125995) lacZalpha peptide [Shuttle vector pUCP-Nde] Length = 84 Frame 2 hits (HSPs): ________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 84 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|7380886|dbj|BAA93042.1| (AB040452) beta-galactosidase [Shuttle vector pRES19] Length = 92 Frame 2 hits (HSPs): _______________ Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 92 0 20 40 60 80 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|7638063|gb|AAF65335.1| (AF234295) LacZ alpha, truncated [Binary vector pCAMBIA-1291Z] >gi|7638132|gb|AAF65387.1| (AF234312) LacZ alpha, truncated [Binary vector pCAMBIA-1391Z] Length = 66 Frame 2 hits (HSPs): _____________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 66 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 31 PGVTQLNRLAAHPPFASWRNSEEARTD 57 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 17 NSLAVVLQRR 26 >gi|8650404|gb|AAF78196.1| (AF216802) beta-galactosidase alpha peptide [Shuttle vector pDL278] Length = 80 Frame 2 hits (HSPs): _________________ Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 17/27 (62%), Positives = 19/27 (70%), Frame = +2 Query: 431 PGVTXLNRLAAHPPFPTGV-IRKGRTD 508 PGVT LNRLAAHPPF + + RTD Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTD 64 Score = 39 (13.7 bits), Expect = 0.00022, Sum P(2) = 0.00022 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = +1 Query: 391 NSLAVVLPRR 420 NSLAVVL RR Sbjct: 24 NSLAVVLQRR 33 >gi|1684629|emb|CAA70550.1| (Y09374) lacZ-PhoC [synthetic construct] Length = 316 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | | | 316 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 0.00051, P = 0.00051 Identities = 24/27 (88%), Positives = 24/27 (88%), Frame = +1 Query: 343 SRGGPVPNSPYSESYY-NSLAVVLPRR 420 SRGGPVPNSPYSESYY SLAVVL RR Sbjct: 49 SRGGPVPNSPYSESYYARSLAVVLQRR 75 >gi|11265104|pir||T48553 subtilisin-like proteinase homolog F14F18.110 [imported] - Arabidopsis thaliana >gi|7573361|emb|CAB87667.1| (AL163812) subtilisin-like protease-like protein [Arabidopsis thaliana] Length = 755 Frame -1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | || 755 0 150 300 450 600 750 Minus Strand HSPs: Score = 117 (41.2 bits), Expect = 0.00069, P = 0.00069 Identities = 31/86 (36%), Positives = 46/86 (53%), Frame = -1 Query: 430 FSXHDVVKRRPV-NCNTTHYRANWVPGPPSRPGVGVGVSPSTIVFSAENKTQAFEVTFSR 254 F DV R V N + PP GV + V+P+T++F++ K +++VT S Sbjct: 660 FLKEDVTLTRTVTNVGPVDSVYKLIVEPPL--GVKISVTPNTLLFNSNVKILSYKVTVST 717 Query: 253 V-KLDGSESFGSIEWTDGSHVVRSPIAV 173 K + FGS+ WTDGSH V P++V Sbjct: 718 THKSNSIYYFGSLTWTDGSHKVTIPLSV 745 WARNING: HSPs involving 111 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.94 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.337 0.147 0.456 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.328 0.141 0.458 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.349 0.149 0.568 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.325 0.139 0.458 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.353 0.159 0.557 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.363 0.166 0.728 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 175 171 10. 75 3 12 22 0.11 34 31 0.11 37 +2 0 176 174 10. 75 3 12 22 0.11 34 31 0.11 37 +1 0 176 172 10. 75 3 12 22 0.11 34 31 0.11 37 -1 0 176 172 10. 75 3 12 22 0.11 34 31 0.11 37 -2 0 176 173 10. 75 3 12 22 0.11 34 31 0.11 37 -3 0 175 172 10. 75 3 12 22 0.11 34 31 0.11 37 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 161 No. of states in DFA: 594 (59 KB) Total size of DFA: 218 KB (256 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 190.52u 0.98s 191.50t Elapsed: 00:00:49 Total cpu time: 190.55u 1.03s 191.58t Elapsed: 00:00:49 Start: Mon Oct 1 23:04:33 2001 End: Mon Oct 1 23:05:22 2001 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000