WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A12G04_2_CONSENSUS (462 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 5 Sequences : less than 5 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1099 192 |====================================== 6310 907 140 |============================ 3980 767 250 |================================================== 2510 517 128 |========================= 1580 389 101 |==================== 1000 288 49 |========= 631 239 51 |========== 398 188 19 |=== 251 169 28 |===== 158 141 21 |==== 100 120 12 |== 63.1 108 9 |= 39.8 99 2 |: 25.1 97 4 |: 15.8 93 7 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 86 <<<<<<<<<<<<<<<<< 10.0 86 4 |: 6.31 82 1 |: 3.98 81 0 | 2.51 81 2 |: 1.58 79 4 |: 1.00 75 1 |: 0.63 74 1 |: 0.40 73 5 |= 0.25 68 2 |: 0.16 66 3 |: 0.10 63 2 |: 0.063 61 9 |= 0.040 52 1 |: 0.025 51 1 |: 0.016 50 0 | 0.010 50 0 | 0.0063 50 0 | 0.0040 50 2 |: 0.0025 48 1 |: 0.0016 47 2 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|1071924|pir||S49196Kunitz trypsin inhibitor precur... +3 328 1.3e-28 1 gi|11273665|pir||JC731120K protein - soybean >gi|5381... +3 308 1.7e-26 1 gi|125722|sp|P25272|KTI1_SOYBNKUNITZ-TYPE TRYPSIN INH... +3 219 4.6e-17 1 gi|2144584|pir||TISYtrypsin inhibitor A (Kunitz) prec... +3 185 6.1e-16 2 gi|125723|sp|P25273|KTI2_SOYBNKUNITZ-TYPE TRYPSIN INH... +3 207 8.7e-16 1 gi|99957|pir||S19190trypsin inhibitor B (Kunitz) prec... +3 178 3.3e-15 2 gi|125020|sp|P01070|ITRA_SOYBNTRYPSIN INHIBITORS A/C ... +3 172 1.4e-14 2 gi|81979|pir||JS0650chymotrypsin inhibitor (Kunitz) W... +3 186 1.5e-13 1 gi|124150|sp|P10822|ICW3_PSOTECHYMOTRYPSIN INHIBITOR ... +3 186 1.5e-13 1 gi|81981|pir||JS0651chymotrypsin inhibitor (Kunitz) W... +3 185 1.9e-13 1 gi|2129823|pir||JC4990chymotrypsin inhibitor ECI prec... +3 179 8.0e-13 1 gi|7638034|gb|AAF65315.1|AF233296_1(AF233296) kunitz ... +3 172 4.4e-12 1 gi|462427|sp|P24924|ITRY_ACACOTRYPSIN INHIBITOR PRECU... +3 123 7.4e-11 2 gi|299509|gb|AAB26177.1|Kunitz-type trypsin inhibitor... +3 123 7.4e-11 2 gi|81982|pir||JQ0949proteinase inhibitor nodulin prec... +3 123 1.6e-10 2 gi|7438247|pir||JC5562trypsin inhibitor ETIb precurso... +3 118 1.2e-09 2 gi|9665064|gb|AAF97266.1|AC034106_9(AC034106) Contain... +3 111 2.5e-08 2 gi|124152|sp|P09941|ID5A_ADEPATRYPSIN INHIBITOR DE5, ... +3 131 9.8e-08 1 gi|225058|prf||1208243Atrypsin isoinhibitor DE5 [Aden... +3 131 9.8e-08 1 gi|2982148|pdb|2WBC| Refined Crystal Structure (2.3... +3 127 2.6e-07 1 gi|417176|sp|P32733|ID5A_PROJUKUNITZ-TYPE TRYPSIN INH... +3 127 2.6e-07 1 gi|8569421|pdb|1EYL|AChain A, Structure Of A Recombin... +3 127 2.6e-07 1 gi|7438249|pir||T03803tumor-related protein, clone NF... +3 107 3.3e-07 2 gi|265716|gb|AAB25433.1|chymotrypsin inhibitor, ECI [... +3 122 8.8e-07 1 gi|462388|sp|P34952|IECI_ERYVACHYMOTRYPSIN INHIBITOR ... +3 122 8.8e-07 1 gi|625261|pir||A61433trypsin inhibitor 2a (Kunitz) - ... +3 117 3.0e-06 1 gi|124940|sp|P25700|IT2_PSOTETRYPSIN INHIBITOR 2 (WTI... +3 113 7.9e-06 1 gi|2129874|pir||S65830alpha fucosidase precursor - ga... +3 115 8.9e-06 1 gi|124154|sp|P09943|IDE3_ERYCATRYPSIN INHIBITOR DE-3 ... +3 111 1.3e-05 1 gi|124155|sp|P07475|IDE3_ERYLATRYPSIN INHIBITOR DE-3 ... +3 111 1.3e-05 1 gi|3913898|sp|P81366|IDE3_ERYVATRYPSIN INHIBITOR DE-3... +3 111 1.3e-05 1 gi|543617|pir||JX0311kunitz type subtilisin inhibitor... +3 111 1.3e-05 1 gi|543616|pir||JX0310kunitz type subtilisin inhibitor... +3 111 1.5e-05 1 gi|5689162|dbj|BAA82840.1|(AB023648) miraculin homolo... +3 96 1.6e-05 2 gi|3913945|sp|P81365|IT1B_ERYVATRYPSIN INHIBITOR 1B (... +3 110 1.6e-05 1 gi|348574|pir||JH0781trypsin inhibitor ETIb (Kunitz) ... +3 110 1.6e-05 1 gi|3891586|pdb|1AVW|BChain B, Complex Porcine Pancrea... +3 105 0.00019 1 gi|124938|sp|P10821|IT1A_PSOTETRYPSIN INHIBITOR 1A (W... +3 105 0.00019 1 gi|417198|sp|P32877|IT1B_PSOTETRYPSIN INHIBITOR 1B (W... +3 105 0.00019 1 gi|3891588|pdb|1AVX|BChain B, Complex Porcine Pancrea... +3 105 0.00019 1 gi|68821|pir||TISYCtrypsin inhibitor C (Kunitz) - soy... +3 105 0.00025 1 gi|3891584|pdb|1AVU| Trypsin Inhibitor From Soybean... +3 105 0.00025 1 gi|3650368|emb|CAA09607.1|(AJ011398) profucosidase [P... +3 106 0.00029 1 gi|125023|sp|P01071|ITRB_SOYBNTRYPSIN INHIBITOR B (KU... +3 104 0.00051 1 gi|7438248|pir||T07871miraculin homolog, root-knot ne... +3 97 0.00067 2 gi|1362094|pir||S57810hypothetical protein precursor ... +3 104 0.0011 1 gi|5689168|dbj|BAA82843.1|(AB023651) miraculin homolo... +3 87 0.0016 2 gi|1076518|pir||S49578trypsin inhibitor homolog - gar... +3 102 0.0022 1 gi|386583|gb|AAB27369.1|caltrin precursor=54 kda calc... +3 88 0.0035 1 gi|3859063|emb|CAA57931.1|(X82595) alpha-fucosidase [... +3 101 0.0035 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|1071924 | _________________________ gi|11273665 | ____________________________________ gi|125722 | __________________________ gi|2144584 | ______________________ gi|125723 | ________________________ gi|99957 | ______________________ gi|125020 | ______________________ gi|81979 | __________________________ gi|124150 | __________________________ gi|81981 | _________________________ gi|2129823 | ___________________________________ gi|7638034 | ______________________ gi|462427 | _____________ gi|299509 | _____________ gi|81982 | ____________________ gi|7438247 | ____________________ gi|9665064 | _______________________ gi|124152 | _________________ gi|225058 | _________________ gi|2982148 | __________________ gi|417176 | _____________ gi|8569421 | __________________ gi|7438249 | ______________________ gi|265716 | ________________ gi|462388 | ________________ gi|625261 | ___________________________ gi|124940 | _____________ gi|2129874 | _______________________ gi|124154 | _________________ gi|124155 | _________________ gi|3913898 | _________________ gi|543617 | ______________ gi|543616 | ______________ gi|5689162 | ___________ gi|3913945 | _____________ gi|348574 | _____________ gi|3891586 | ______________ gi|124938 | ________________ gi|417198 | ________________ gi|3891588 | ______________ gi|68821 | ______________ gi|3891584 | ______________ gi|3650368 | _____________________ gi|125023 | ______________ gi|7438248 | ___________________ gi|1362094 | _______________________ gi|5689168 | ____________ gi|1076518 | _______________________ gi|386583 | _________ gi|3859063 | _______________________ Prosite Hits: ______ __________________________________________________ Query sequence: | | | | | 154 0 50 100 150 __________________ Prosite hits: SOYBEAN_KUNITZ Soybean trypsin inhibitor (Kunitz) prote 38..54 __________________ Locus_ID Frame 2 Hits gi|9665064 | _____ gi|7438249 | _____ gi|5689162 | ________ gi|7438248 | _____ gi|5689168 | _____ __________________________________________________ Query sequence: | | | | | 154 0 50 100 150 Locus_ID Frame 1 Hits gi|2144584 | ___ gi|99957 | ___ gi|125020 | ___ gi|462427 | _____________________________ gi|299509 | _____________________________ gi|81982 | _______ gi|7438247 | ______________ __________________________________________________ Query sequence: | | | | | 154 0 50 100 150
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 36 database sequences were not reported due to the limiting value of parameter V = 50. >gi|1071924|pir||S49196 Kunitz trypsin inhibitor precursor - soybean >gi|510515|emb|CAA56343.1| (X80039) Kunitz trypsin inhibitor [Glycine max] Length = 208 Frame 3 hits (HSPs): __________________ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 208 0 50 100 150 200 __________________ Annotated Domains: DOMO DM03168: TRYPSININHIBITOR(KUNITZ) 1..21 DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 23..199 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 28..44 __________________ Plus Strand HSPs: Score = 328 (115.5 bits), Expect = 1.3e-28, P = 1.3e-28 Identities = 65/75 (86%), Positives = 65/75 (86%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT Sbjct: 1 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 60 Query: 213 RNRNMPSHCCASPFE 257 P SPFE Sbjct: 61 ETETCPLTVVQSPFE 75 >gi|11273665|pir||JC7311 20K protein - soybean >gi|5381209|dbj|BAA82254.1| (AB029441) trypsin inhibitor p20 [Glycine max] Length = 206 Frame 3 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | | 206 0 50 100 150 200 Plus Strand HSPs: Score = 308 (108.4 bits), Expect = 1.7e-26, P = 1.7e-26 Identities = 75/114 (65%), Positives = 78/114 (68%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKSTTS+ALFLLCALTSSY PS TADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT Sbjct: 1 MKSTTSVALFLLCALTSSYLPS-TADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 59 Query: 213 RNRNMPSHCCASPFESPKVYH*Y--SPHLXP*LPEDLF-GAPFLF-PPGAS-PSR 362 P SPFE K SP + E L F + PP AS PSR Sbjct: 60 ETETCPLTVVQSPFEVSKGLPLIISSPFKILDITEGLILSLSFTYVPPCASTPSR 114 >gi|125722|sp|P25272|KTI1_SOYBN KUNITZ-TYPE TRYPSIN INHIBITOR KTI1 PRECURSOR >gi|81814|pir||JQ1091 trypsin inhibitor KTi1 (Kunitz) - soybean >gi|256635|gb|AAB23482.1| (S45035) Kunitz trypsin inhibitor KTi1 [soybeans, Peptide, 203 aa] [Glycine max] Length = 203 Frame 3 hits (HSPs): ___________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | || 203 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 27..47 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 65..79 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 152..160 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 168..177 DOMO DM03168: TRYPSININHIBITOR(KUNITZ) 1..21 DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 23..197 PFAM Kunitz_legume: Trypsin and protease inhi 27..197 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 27..56 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 65..85 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 141..160 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 166..195 PRODOM PD032704: KTI1(1) KTI2(1) 1..24 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 26..163 PRODOM PD010854: 165..202 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 28..44 __________________ Plus Strand HSPs: Score = 219 (77.1 bits), Expect = 4.6e-17, P = 4.6e-17 Identities = 45/78 (57%), Positives = 52/78 (66%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKST ALFL+CA T SY PSATA V DT+ +P++NGGTYY+LPV+RGKGGGIE T Sbjct: 1 MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDST 60 Query: 213 RNRNMPSHCCASPFESPK 266 P SP E K Sbjct: 61 GKEICPLTVVQSPNELDK 78 >gi|2144584|pir||TISY trypsin inhibitor A (Kunitz) precursor - soybean >gi|18770|emb|CAA45777.1| (X64447) trypsin inhibitor subtype A [Glycine max] Length = 217 Frame 3 hits (HSPs): _______________ Frame 1 hits (HSPs): __ Annotated Domains: __________ _ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 __________________ Annotated Domains: Entrez domain: signal sequence 1..25 Entrez inhibit site: Arg (trypsin) 88 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 28..44 __________________ Plus Strand HSPs: Score = 185 (65.1 bits), Expect = 6.1e-16, Sum P(2) = 6.1e-16 Identities = 39/66 (59%), Positives = 42/66 (63%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKST ALFL CA T+SY PSA AD V D EGNP+ NGGTYY+L I GG I A T Sbjct: 1 MKSTIFFALFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPT 59 Query: 213 RNRNMP 230 N P Sbjct: 60 GNERCP 65 Score = 37 (13.0 bits), Expect = 6.1e-16, Sum P(2) = 6.1e-16 Identities = 7/8 (87%), Positives = 7/8 (87%), Frame = +1 Query: 220 ETCPLTVV 243 E CPLTVV Sbjct: 62 ERCPLTVV 69 >gi|125723|sp|P25273|KTI2_SOYBN KUNITZ-TYPE TRYPSIN INHIBITOR KTI2 PRECURSOR >gi|81815|pir||JQ1092 trypsin inhibitor KTi2 (Kunitz) - soybean >gi|256636|gb|AAB23483.1| (S45035) Kunitz trypsin inhibitor KTi2 [soybeans, Peptide, 204 aa] [Glycine max] Length = 204 Frame 3 hits (HSPs): __________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 204 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 27..47 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 65..79 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 153..161 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 169..178 PFAM Kunitz_legume: Trypsin and protease inhi 27..198 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 27..56 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 65..85 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 141..160 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 167..196 PRODOM PD032704: KTI1(1) KTI2(1) 1..24 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 26..164 PRODOM PD010854: 166..203 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 28..44 __________________ Plus Strand HSPs: Score = 207 (72.9 bits), Expect = 8.7e-16, P = 8.7e-16 Identities = 42/73 (57%), Positives = 49/73 (67%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKST ALFL+CA T SY PSATA V DT+ +P++NGGTYY+LPV+RGK GGIE T Sbjct: 1 MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKSGGIEGNST 60 Query: 213 RNRNMPSHCCASP 251 P SP Sbjct: 61 GKEICPLTVVQSP 73 >gi|99957|pir||S19190 trypsin inhibitor B (Kunitz) precursor - soybean >gi|18772|emb|CAA45778.1| (X64448) trypsin inhibitor subtype B [Glycine max] Length = 217 Frame 3 hits (HSPs): _______________ Frame 1 hits (HSPs): __ Annotated Domains: ____ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 __________________ Annotated Domains: PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 28..44 __________________ Plus Strand HSPs: Score = 178 (62.7 bits), Expect = 3.3e-15, Sum P(2) = 3.3e-15 Identities = 38/66 (57%), Positives = 42/66 (63%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKST ALFL CA T+SY PSA AD V D EGNP+ +GGTYY+L I GG I A T Sbjct: 1 MKSTIFFALFLFCAFTTSYLPSAIADFVLDNEGNPLDSGGTYYILSDITAFGG-IRAAPT 59 Query: 213 RNRNMP 230 N P Sbjct: 60 GNERCP 65 Score = 37 (13.0 bits), Expect = 3.3e-15, Sum P(2) = 3.3e-15 Identities = 7/8 (87%), Positives = 7/8 (87%), Frame = +1 Query: 220 ETCPLTVV 243 E CPLTVV Sbjct: 62 ERCPLTVV 69 >gi|125020|sp|P01070|ITRA_SOYBN TRYPSIN INHIBITORS A/C PRECURSOR (KUNITZ) >gi|99955|pir||JQ0968 trypsin inhibitor KTi3+ (Kunitz) - soybean >gi|256429|gb|AAB23464.1| (S45092) Kunitz trypsin inhibitor, KTi [soybeans, Dare and Forrest, Peptide, 216 aa] [Glycine max] Length = 216 Frame 3 hits (HSPs): _______________ Frame 1 hits (HSPs): ___ Annotated Domains: ______________________________________________ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 26..46 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 63..77 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 153..161 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 169..178 DOMO DM03168: TRYPSININHIBITOR(KUNITZ) 1..20 DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 22..199 Entrez active site: REACTIVE BOND (TRYPSIN). 87..88 PFAM Kunitz_legume: Trypsin and protease inhi 26..199 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 26..55 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 63..83 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 141..160 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 168..197 PRODOM PD021317: ITRA(1) Q39898(1) Q39899(1) 1..24 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 26..164 PRODOM PD010854: 166..198 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 27..43 __________________ Plus Strand HSPs: Score = 172 (60.5 bits), Expect = 1.4e-14, Sum P(2) = 1.4e-14 Identities = 38/66 (57%), Positives = 41/66 (62%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKST LFL CA T+SY PSA AD V D EGNP+ NGGTYY+L I GG I A T Sbjct: 1 MKSTIFF-LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPT 58 Query: 213 RNRNMP 230 N P Sbjct: 59 GNERCP 64 Score = 37 (13.0 bits), Expect = 1.4e-14, Sum P(2) = 1.4e-14 Identities = 7/8 (87%), Positives = 7/8 (87%), Frame = +1 Query: 220 ETCPLTVV 243 E CPLTVV Sbjct: 61 ERCPLTVV 68 >gi|81979|pir||JS0650 chymotrypsin inhibitor (Kunitz) WCI-2 precursor - winged bean >gi|248875|gb|AAC60536.1| (S96733) Kunitz chymotrypsin inhibitor 2, WCI-2 [Psophocarpus tetragonolobus=winged beans, DC., Peptide, 207 aa] >gi|497834|dbj|BAA06512.1| (D31703) putative Kunitz chymotrypsin inhibitor [Psophocarpus tetragonolobus] Length = 207 Frame 3 hits (HSPs): ___________________ Annotated Domains: ___________ _ __________________________________________________ Database sequence: | | | | | | 207 0 50 100 150 200 __________________ Annotated Domains: Entrez domain: signal sequence 1..24 Entrez region: inhibitory 89..90 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 28..44 __________________ Plus Strand HSPs: Score = 186 (65.5 bits), Expect = 1.5e-13, P = 1.5e-13 Identities = 45/78 (57%), Positives = 51/78 (65%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADI-VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAK 209 MKSTT LALFLL A+ S + PS+TAD + D EGN + NGGTYY+LP I GGGIE AK Sbjct: 1 MKSTTFLALFLLSAIIS-HLPSSTADDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAK 59 Query: 210 TRNRNMPSHCCASPFESPK 266 T N P SP E K Sbjct: 60 TGNEPCPLTVVRSPNEVSK 78 >gi|124150|sp|P10822|ICW3_PSOTE CHYMOTRYPSIN INHIBITOR 3 PRECURSOR (WCI-3) >gi|81980|pir||JX0206 chymotrypsin inhibitor (Kunitz) WCI-3 precursor - winged bean >gi|632296|pir||S42564 chymotrypsin inhibitor WCI-3 - winged bean >gi|218005|dbj|BAA03084.1| (D13974) Kunitz chymotrypsin inhibitor precursor [Psophocarpus tetragonolobus] >gi|218007|dbj|BAA03085.1| (D13975) WCI-3 [Psophocarpus tetragonolobus] >gi|218009|dbj|BAA03086.1| (D13976) WCI-3 [Psophocarpus tetragonolobus] >gi|248873|gb|AAC60535.1| (S96732) Kunitz chymotrypsin inhibitor 3, WCI-3 [Psophocarpus tetragonolobus=winged beans, DC., Peptide, 207 aa] >gi|226931|prf||1611457A chymotrypsin inhibitor WCI-3 [Psophocarpus tetragonolobus] Length = 207 Frame 3 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | | | 207 0 50 100 150 200 Plus Strand HSPs: Score = 186 (65.5 bits), Expect = 1.5e-13, P = 1.5e-13 Identities = 45/78 (57%), Positives = 51/78 (65%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADI-VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAK 209 MKSTT LALFLL A+ S + PS+TAD + D EGN + NGGTYY+LP I GGGIE AK Sbjct: 1 MKSTTFLALFLLSAIIS-HLPSSTADDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAK 59 Query: 210 TRNRNMPSHCCASPFESPK 266 T N P SP E K Sbjct: 60 TGNEPCPLTVVRSPNEVSK 78 >gi|81981|pir||JS0651 chymotrypsin inhibitor (Kunitz) WCI-x precursor - winged bean >gi|248877|gb|AAC60537.1| (S96735) Kunitz chymotrypsin inhibitor x, WCI-x [Psophocarpus tetragonolobus=winged beans, DC., Peptide, 207 aa] >gi|497838|dbj|BAA06513.1| (D31707) putative Kunitz chymotrypsin inhibitor-x [Psophocarpus tetragonolobus] Length = 207 Frame 3 hits (HSPs): __________________ Annotated Domains: ___________ _ __________________________________________________ Database sequence: | | | | | | 207 0 50 100 150 200 __________________ Annotated Domains: Entrez domain: signal sequence 1..24 Entrez region: inhibitory 89..90 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 28..44 __________________ Plus Strand HSPs: Score = 185 (65.1 bits), Expect = 1.9e-13, P = 1.9e-13 Identities = 43/75 (57%), Positives = 50/75 (66%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADI-VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAK 209 MKST LALFLL A+ S + PS+TAD + D EGN + NGGTYY+LP I GGGIE AK Sbjct: 1 MKSTIFLALFLLPAIIS-HLPSSTADHDLVDVEGNLVENGGTYYLLPQITAHGGGIETAK 59 Query: 210 TRNRNMPSHCCASPFE 257 T N P SP+E Sbjct: 60 TGNEPCPLTVVQSPYE 75 >gi|2129823|pir||JC4990 chymotrypsin inhibitor ECI precursor - Erythrina variegata Length = 203 Frame 3 hits (HSPs): ___________________________ Annotated Domains: ___________ __________________________________________________ Database sequence: | | | | || 203 0 50 100 150 200 __________________ Annotated Domains: Entrez domain: signal sequence 1..24 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 27..43 __________________ Plus Strand HSPs: Score = 179 (63.0 bits), Expect = 8.0e-13, P = 8.0e-13 Identities = 47/109 (43%), Positives = 59/109 (54%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 M+STT LFL+ A S Y PS+TA + D EGN + NGGTYY+LP I GGGIE A+T Sbjct: 1 MRSTTYFVLFLVSAFIS-YLPSSTAQPLLDVEGNLVENGGTYYLLPHIWALGGGIEAART 59 Query: 213 RNRNMPSHCCASPFE--SPKVYH*YSPHLXP*LPEDLFGAP-FLFPPGAS 353 P SPFE + + S L +P+ AP F PP + Sbjct: 60 GKETCPLTVVQSPFEVSNGEPIRIASQFLSTFIPDGSPVAPGFANPPSCA 109 >gi|7638034|gb|AAF65315.1|AF233296_1 (AF233296) kunitz trypsin inhibitor 3 [Glycine max] Length = 216 Frame 3 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 172 (60.5 bits), Expect = 4.4e-12, P = 4.4e-12 Identities = 38/66 (57%), Positives = 41/66 (62%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 212 MKST LFL CA T+SY PSA AD V D EGNP+ NGGTYY+L I GG I A T Sbjct: 1 MKSTIFF-LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPT 58 Query: 213 RNRNMP 230 N P Sbjct: 59 GNERYP 64 >gi|462427|sp|P24924|ITRY_ACACO TRYPSIN INHIBITOR PRECURSOR >gi|81736|pir||JH0607 trypsin inhibitor (Kunitz) precursor - Acacia confusa >gi|166234|gb|AAA32618.1| (M92852) trypsin inhibitor [Acacia confusa] Length = 176 Frame 3 hits (HSPs): ____________ Frame 1 hits (HSPs): _________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 176 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 2..22 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 40..54 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 126..134 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 142..151 DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..171 PFAM Kunitz_legume: Trypsin and protease inhi 2..171 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 1..133 PRODOM PD018852: ID5B(2) ITRY(1) 142..175 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 123 (43.3 bits), Expect = 7.4e-11, Sum P(2) = 7.4e-11 Identities = 20/39 (51%), Positives = 29/39 (74%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 + D +G+ +RNGG YY+LP +RGKGGG+ AKT + + P Sbjct: 3 LLDADGDILRNGGAYYILPALRGKGGGLTLAKTGDESCP 41 Score = 50 (17.6 bits), Expect = 7.4e-11, Sum P(2) = 7.4e-11 Identities = 23/86 (26%), Positives = 32/86 (37%), Frame = +1 Query: 202 LPKPETETCPLTVVHLPLSLQRSTTDIXPI*XLDSPKTYLEPHSFFPPVPHPPGNGSXGX 381 L K E+CPLTVV +R P PK + F+ P + Sbjct: 32 LAKTGDESCPLTVVQAQSETKRGL----PAVIWTPPKIAILTPGFYLNFEFQPRDLPACL 87 Query: 382 AKTHFNPWLXNXKVVEIK--PQTKKMGL 459 K PW + E+K P+ K+ L Sbjct: 88 QKYSTLPWKVEGESQEVKIAPKEKEQFL 115 >gi|299509|gb|AAB26177.1| Kunitz-type trypsin inhibitor A chain, ACTI-A [Acacia confusa, seeds, Peptide, 136 aa] Length = 136 Frame 3 hits (HSPs): _______________ Frame 1 hits (HSPs): _______________________________ Annotated Domains: _______ __________________________________________________ Database sequence: | | | | 136 0 50 100 __________________ Annotated Domains: PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 123 (43.3 bits), Expect = 7.4e-11, Sum P(2) = 7.4e-11 Identities = 20/39 (51%), Positives = 29/39 (74%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 + D +G+ +RNGG YY+LP +RGKGGG+ AKT + + P Sbjct: 3 LLDADGDILRNGGAYYILPALRGKGGGLTLAKTGDESCP 41 Score = 50 (17.6 bits), Expect = 7.4e-11, Sum P(2) = 7.4e-11 Identities = 23/86 (26%), Positives = 32/86 (37%), Frame = +1 Query: 202 LPKPETETCPLTVVHLPLSLQRSTTDIXPI*XLDSPKTYLEPHSFFPPVPHPPGNGSXGX 381 L K E+CPLTVV +R P PK + F+ P + Sbjct: 32 LAKTGDESCPLTVVQAQSETKRGL----PAVIWTPPKIAILTPGFYLNFEFQPRDLPACL 87 Query: 382 AKTHFNPWLXNXKVVEIK--PQTKKMGL 459 K PW + E+K P+ K+ L Sbjct: 88 QKYSTLPWKVEGESQEVKIAPKEKEQFL 115 >gi|81982|pir||JQ0949 proteinase inhibitor nodulin precursor - winged bean (fragment) >gi|257812|gb|AAB23733.1| (S46970) Kunitz protease inhibitor [Psophocarpus tetragonolobus] Length = 201 Frame 3 hits (HSPs): _______________ Frame 1 hits (HSPs): _____ Annotated Domains: __________ __________________________________________________ Database sequence: | | | | || 201 0 50 100 150 200 __________________ Annotated Domains: Entrez domain: signal sequence (fragment) 1..20 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 23..39 __________________ Plus Strand HSPs: Score = 123 (43.3 bits), Expect = 1.6e-10, Sum P(2) = 1.6e-10 Identities = 30/58 (51%), Positives = 36/58 (62%), Frame = +3 Query: 57 LFLLCALTSSYQPSATADI-VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 LFLL + TS Y PSATA V+DT GN +RN G YY++PV G G GI+ T P Sbjct: 4 LFLLSSFTS-YLPSATAQQPVYDTNGNQLRNNGEYYIVPV-SG-GAGIDVVATGTEKCP 59 Score = 47 (16.5 bits), Expect = 1.6e-10, Sum P(2) = 1.6e-10 Identities = 10/19 (52%), Positives = 12/19 (63%), Frame = +1 Query: 217 TETCPLTVVHLPLSLQRST 273 TE CPLT+V S + ST Sbjct: 55 TEKCPLTIVQSSSSTKYST 73 >gi|7438247|pir||JC5562 trypsin inhibitor ETIb precursor - Erythrina variegata Length = 201 Frame 3 hits (HSPs): ________________ Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | || 201 0 50 100 150 200 Plus Strand HSPs: Score = 118 (41.5 bits), Expect = 1.2e-09, Sum P(2) = 1.2e-09 Identities = 27/60 (45%), Positives = 35/60 (58%), Frame = +3 Query: 51 LALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 + LF++ + S S T +V D EG + NGGTYY+LP I G GGG+E AKT P Sbjct: 5 IVLFIVSSFFSFLHLS-TGQLV-DVEGEDVVNGGTYYMLPGIEGDGGGMEGAKTGRETCP 62 Score = 45 (15.8 bits), Expect = 1.2e-09, Sum P(2) = 1.2e-09 Identities = 14/40 (35%), Positives = 22/40 (55%), Frame = +1 Query: 208 KPETETCPLTVVHLPLSLQRSTTDIXPI*XLDSP-KTYLEP 327 K ETCP+TVV + ++ PI ++SP ++Y P Sbjct: 55 KTGRETCPITVVQS----RNDVSNGEPI-TIESPFRSYFIP 90 >gi|9665064|gb|AAF97266.1|AC034106_9 (AC034106) Contains similarity to a tumor-related protein from Nicotiana tabacum gb|U66263 and contains a trypsin and protease inhibitor PF|00197 domain. ESTs gb|AV561824, gb|T44961, gb|H36186, gb|T45060, gb|N38006, gb|F19847 come from this gene. [Ara> >gi|12083240|gb|AAG48779.1|AF332416_1 (AF332416) putative trypsin and protease inhibitor protein [Arabidopsis thaliana] Length = 196 Frame 3 hits (HSPs): ___________________ Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 196 0 50 100 150 Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 2.5e-08, Sum P(2) = 2.5e-08 Identities = 25/72 (34%), Positives = 37/72 (51%), Frame = +3 Query: 51 LALFLLCALTSSYQ---PSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNR 221 L +FLL A+ S++ A + V D G + G YY+LPVIRG+GGG+ + + Sbjct: 5 LYIFLLLAVFISHRGVTTEAAVEPVKDINGKSLLTGVNYYILPVIRGRGGGLTMSNLKTE 64 Query: 222 NMPSHCCASPFE 257 P+ FE Sbjct: 65 TCPTSVIQDQFE 76 Score = 40 (14.1 bits), Expect = 2.5e-08, Sum P(2) = 2.5e-08 Identities = 7/12 (58%), Positives = 10/12 (83%), Frame = +2 Query: 257 VSKGLPLIFXPF 292 VS+GLP+ F P+ Sbjct: 77 VSQGLPVKFSPY 88 >gi|124152|sp|P09941|ID5A_ADEPA TRYPSIN INHIBITOR DE5, ALPHA CHAIN >gi|81737|pir||A24376 trypsin inhibitor DE5 alpha chain - bead tree Length = 138 Frame 3 hits (HSPs): ___________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 138 0 50 100 __________________ Annotated Domains: DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..137 Entrez active site: REACTIVE BOND (TRYPSIN). 64..65 PFAM Kunitz_legume: Trypsin and protease inhi 2..136 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 1..134 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 131 (46.1 bits), Expect = 9.8e-08, P = 9.8e-08 Identities = 22/51 (43%), Positives = 33/51 (64%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFESPK 266 + D +GN +RNGG+YY++P RGKGGG+E A+T + P +P E + Sbjct: 3 LLDVDGNFLRNGGSYYIVPAFRGKGGGLELARTGSETCPRTVVQAPAEQSR 53 >gi|225058|prf||1208243A trypsin isoinhibitor DE5 [Adenanthera pavonina] Length = 176 Frame 3 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | 176 0 50 100 150 Plus Strand HSPs: Score = 131 (46.1 bits), Expect = 9.8e-08, P = 9.8e-08 Identities = 22/51 (43%), Positives = 33/51 (64%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFESPK 266 + D +GN +RNGG+YY++P RGKGGG+E A+T + P +P E + Sbjct: 3 LLDVDGNFLRNGGSYYIVPAFRGKGGGLELARTGSETCPRTVVQAPAEQSR 53 >gi|2982148|pdb|2WBC| Refined Crystal Structure (2.3 Angstrom) Of A Winged Bean Chymotrypsin Inhibitor And Location Of Its Second Reactive Site >gi|1431754|pdb|1WBC| Mol_id: 1; Molecule: Chymotrypsin Inhibitor (Wci); Chain: Null >gi|4699858|pdb|4WBC|A Chain A, 2.13 A Structure Of A Kunitz-Type Winged Bean Chymotrypsin Inhibitor Protein >gi|227379|prf||1703237A Kunitz type chymotrypsin inhibitor [Psophocarpus tetragonolobus] >gi|362443|prf||1413277A chymotrypsin inhibitor WCI3 [Psophocarpus tetragonolobus] Length = 183 Frame 3 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | 183 0 50 100 150 Plus Strand HSPs: Score = 127 (44.7 bits), Expect = 2.6e-07, P = 2.6e-07 Identities = 29/53 (54%), Positives = 32/53 (60%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFESPK 266 D+V D EGN + NGGTYY+LP I GGGIE AKT N P SP E K Sbjct: 3 DLV-DAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSK 54 >gi|417176|sp|P32733|ID5A_PROJU KUNITZ-TYPE TRYPSIN INHIBITOR ALPHA CHAIN >gi|348463|pir||B45588 kunitz trypsin inhibitor alpha chain - Prosopsis juliflora >gi|243387|gb|AAB21123.1| Kunitz trypsin inhibitor alpha chain [Prosopsis juliflora, seeds, Peptide, 137 aa] Length = 137 Frame 3 hits (HSPs): _______________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 137 0 50 100 __________________ Annotated Domains: DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..136 Entrez active site: REACTIVE BOND (TRYPSIN). 64..65 PFAM Kunitz_legume: Trypsin and protease inhi 2..136 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 1..134 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 127 (44.7 bits), Expect = 2.6e-07, P = 2.6e-07 Identities = 21/39 (53%), Positives = 27/39 (69%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 + D +G +RNGG+YY+LP RGKGGG+E AKT P Sbjct: 3 LLDVDGEILRNGGSYYILPAFRGKGGGLELAKTEGETCP 41 >gi|8569421|pdb|1EYL|A Chain A, Structure Of A Recombinant Winged Bean Chymotrypsin Inhibitor Length = 186 Frame 3 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | 186 0 50 100 150 Plus Strand HSPs: Score = 127 (44.7 bits), Expect = 2.6e-07, P = 2.6e-07 Identities = 29/53 (54%), Positives = 32/53 (60%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFESPK 266 D+V D EGN + NGGTYY+LP I GGGIE AKT N P SP E K Sbjct: 6 DLV-DAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSK 57 >gi|7438249|pir||T03803 tumor-related protein, clone NF34 - common tobacco >gi|1762933|gb|AAC49969.1| (U66263) tumor-related protein [Nicotiana tabacum] Length = 210 Frame 3 hits (HSPs): _________________ Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 210 0 50 100 150 200 Plus Strand HSPs: Score = 107 (37.7 bits), Expect = 3.3e-07, Sum P(2) = 3.3e-07 Identities = 24/69 (34%), Positives = 38/69 (55%), Frame = +3 Query: 33 MKSTTSLALFLLCALTSSYQPSATADI---VFDTEGNPIRNGGTYYVLPVIRGKGGGIEF 203 MK+ FL+ ++ + S++A+ V D G +R G YY+LPV+RG+GGG+ Sbjct: 1 MKTNQLFLPFLIFTISFNSFLSSSAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTL 60 Query: 204 AKTRNRNMP 230 T N + P Sbjct: 61 DSTGNESCP 69 Score = 36 (12.7 bits), Expect = 3.3e-07, Sum P(2) = 3.3e-07 Identities = 6/11 (54%), Positives = 7/11 (63%), Frame = +2 Query: 257 VSKGLPLIFXP 289 + GLPL F P Sbjct: 80 IKNGLPLTFTP 90 >gi|265716|gb|AAB25433.1| chymotrypsin inhibitor, ECI [Erythrina variegata, var. Orientalis, seeds, Peptide, 179 aa] >gi|444800|prf||1908233A chymotrypsin inhibitor ECI [Erythrina variegata] Length = 179 Frame 3 hits (HSPs): _____________ Annotated Domains: ______ __________________________________________________ Database sequence: | | | | | 179 0 50 100 150 __________________ Annotated Domains: PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 25/46 (54%), Positives = 28/46 (60%), Frame = +3 Query: 120 DTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFE 257 D EGN + NGGTYY+LP I GGGIE A+T P SPFE Sbjct: 5 DLEGNLVENGGTYYLLPHIWALGGGIEAARTGKETCPLTVVQSPFE 50 >gi|462388|sp|P34952|IECI_ERYVA CHYMOTRYPSIN INHIBITOR ECI >gi|418814|pir||JC1487 chymotrypsin inhibitor (Kunitz) ECI - Erythrina variegata var. orientalis Length = 179 Frame 3 hits (HSPs): _____________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 179 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 2..22 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 40..54 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 127..135 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 144..153 DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..173 Entrez pyrrolidone-carboxylic-acid site 1 Entrez active site: REACTIVE BOND (CHYMOTRYPSIN 64..65 PFAM Kunitz_legume: Trypsin and protease inhi 2..173 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 2..31 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 40..60 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 115..134 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 142..171 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 1..135 PRODOM PD016102: ICW3(1) Q43708(1) Q43721(1) 140..177 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 25/46 (54%), Positives = 28/46 (60%), Frame = +3 Query: 120 DTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFE 257 D EGN + NGGTYY+LP I GGGIE A+T P SPFE Sbjct: 5 DLEGNLVENGGTYYLLPHIWALGGGIEAARTGKETCPLTVVQSPFE 50 >gi|625261|pir||A61433 trypsin inhibitor 2a (Kunitz) - winged bean Length = 180 Frame 3 hits (HSPs): ________________________ Annotated Domains: ______ _ __________________________________________________ Database sequence: | | | | | 180 0 50 100 150 __________________ Annotated Domains: Entrez modified site: pyrrolidone carboxylic ac 1 Entrez inhibit site: Arg (trypsin) 64 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 117 (41.2 bits), Expect = 3.0e-06, P = 3.0e-06 Identities = 32/85 (37%), Positives = 42/85 (49%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFESP--KVYH*YSP 287 + D EG +RNGGTYY++P +R GGGIE AK + P S E+ + SP Sbjct: 3 LLDVEGKAVRNGGTYYLVPQLRPHGGGIEVAKIGKEDCPLTVVKSLDENSNGEPIMIASP 62 Query: 288 HLXP*LPE-DLFGAPFLFPPGASPS 359 +PE L F PP +PS Sbjct: 63 LRSAFIPEYSLLKIGFSDPPKCAPS 87 >gi|124940|sp|P25700|IT2_PSOTE TRYPSIN INHIBITOR 2 (WTI-2) >gi|100088|pir||A37211 trypsin inhibitor 2 (Kunitz) - winged bean Length = 182 Frame 3 hits (HSPs): __________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 182 0 50 100 150 __________________ Annotated Domains: DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..176 Entrez active site: REACTIVE BOND (TRYPSIN). 64..65 PFAM Kunitz_legume: Trypsin and protease inhi 2..176 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 2..31 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 40..60 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 118..137 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 145..174 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 2..141 PRODOM PD009415: IDE3(3) IT1B(2) IT1A(1) 147..179 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 113 (39.8 bits), Expect = 7.9e-06, P = 7.9e-06 Identities = 20/37 (54%), Positives = 26/37 (70%), Frame = +3 Query: 120 DTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D EG +RNGGTYY++P +R GGG+E AK N + P Sbjct: 5 DVEGKTVRNGGTYYLVPQLRPGGGGMEAAKVGNEDCP 41 >gi|2129874|pir||S65830 alpha fucosidase precursor - garden pea Length = 217 Frame 3 hits (HSPs): _________________ Annotated Domains: ____ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 __________________ Annotated Domains: PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 32..48 __________________ Plus Strand HSPs: Score = 115 (40.5 bits), Expect = 8.9e-06, P = 8.9e-06 Identities = 27/70 (38%), Positives = 37/70 (52%), Frame = +3 Query: 30 KMKSTTSLALFLLCALTSSYQPSATADI--VFDTEGNPIRNGGTYYVLPVIRGK-GGGIE 200 K S +L+ FL +T+ + D+ V D GNPI GG YY+LP IRG GGG+ Sbjct: 2 KPLSPLTLSFFLFVFITNLSLAFSNEDVEQVLDINGNPIFPGGQYYILPAIRGPPGGGVR 61 Query: 201 FAKTRNRNMP 230 +T + P Sbjct: 62 LGRTGDLTCP 71 >gi|124154|sp|P09943|IDE3_ERYCA TRYPSIN INHIBITOR DE-3 >gi|81751|pir||A27220 trypsin inhibitor DE-3 (Kunitz) - kaffir tree >gi|230358|pdb|1TIE| Erythrina Trypsin Inhibitor (Kunitz) De-3 Length = 172 Frame 3 hits (HSPs): ______________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 1..21 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 39..53 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 125..133 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 139..148 DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..168 Entrez active site: REACTIVE BOND (TRYPSIN). 63..64 PFAM Kunitz_legume: Trypsin and protease inhi 1..168 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 1..30 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 39..59 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 114..133 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 137..166 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 2..132 PRODOM PD009415: IDE3(3) IT1B(2) IT1A(1) 135..171 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 2..18 __________________ Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 1.3e-05, P = 1.3e-05 Identities = 20/49 (40%), Positives = 29/49 (59%), Frame = +3 Query: 111 IVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFE 257 ++ D G ++NGGTYY+LP + +GGG++ AKT P SP E Sbjct: 1 VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTGEETCPLTVVQSPNE 49 >gi|124155|sp|P07475|IDE3_ERYLA TRYPSIN INHIBITOR DE-3 >gi|81754|pir||A24082 trypsin inhibitor DE-3 - coral bean Length = 172 Frame 3 hits (HSPs): ______________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 1..21 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 39..53 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 125..133 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 139..148 Entrez active site: REACTIVE BOND (TRYPSIN). 63..64 PFAM Kunitz_legume: Trypsin and protease inhi 1..168 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 1..30 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 39..59 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 114..133 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 137..166 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 2..132 PRODOM PD009415: IDE3(3) IT1B(2) IT1A(1) 135..171 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 2..18 __________________ Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 1.3e-05, P = 1.3e-05 Identities = 20/49 (40%), Positives = 29/49 (59%), Frame = +3 Query: 111 IVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFE 257 ++ D G ++NGGTYY+LP + +GGG++ AKT P SP E Sbjct: 1 VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTGEETCPLTVVQSPNE 49 >gi|3913898|sp|P81366|IDE3_ERYVA TRYPSIN INHIBITOR DE-3 (ETIA) >gi|348573|pir||JH0780 trypsin inhibitor ETIa (Kunitz) - Erythrina variegata >gi|262754|gb|AAB24756.1| ETIa=Kunitz-type trypsin inhibitor [Erythrina variegata, var. Orientalis, seeds, Peptide, 172 aa] >gi|383378|prf||1903155A trypsin inhibitor ET1a [Erythrina variegata orientalis] Length = 172 Frame 3 hits (HSPs): ______________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 __________________ Annotated Domains: Entrez active site: REACTIVE BOND (TRYPSIN). 63..64 PFAM Kunitz_legume: Trypsin and protease inhi 1..168 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 1..30 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 39..59 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 114..133 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 137..166 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 2..132 PRODOM PD009415: IDE3(3) IT1B(2) IT1A(1) 135..171 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 2..18 __________________ Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 1.3e-05, P = 1.3e-05 Identities = 20/49 (40%), Positives = 29/49 (59%), Frame = +3 Query: 111 IVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFE 257 ++ D G ++NGGTYY+LP + +GGG++ AKT P SP E Sbjct: 1 VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTGEETCPLTVVQSPNE 49 >gi|543617|pir||JX0311 kunitz type subtilisin inhibitor, CLSI-III - Canavalia lineata Length = 183 Frame 3 hits (HSPs): _____________ Annotated Domains: _ __________________________________________________ Database sequence: | | | | | 183 0 50 100 150 __________________ Annotated Domains: Entrez inhibit site: Arg (subtilisin) 68 Entrez inhibit site: Gly (subtilisin) 69 __________________ Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 1.3e-05, P = 1.3e-05 Identities = 21/42 (50%), Positives = 26/42 (61%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGK-GGGIEFAKTRNRNMP 230 D+V D PI GG YY++P I G GGG+ AKTRN + P Sbjct: 4 DVVMDASSKPIFPGGEYYIMPAIWGPPGGGVRLAKTRNSDCP 45 >gi|543616|pir||JX0310 kunitz type subtilisin inhibitor, CLSI-II - Canavalia lineata Length = 190 Frame 3 hits (HSPs): ____________ Annotated Domains: _______________________________________________ __________________________________________________ Database sequence: | | | | | 190 0 50 100 150 __________________ Annotated Domains: DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 2..178 Entrez inhibit site: Arg (subtilisin) 68 Entrez inhibit site: Gly (subtilisin) 69 __________________ Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 1.5e-05, P = 1.5e-05 Identities = 21/42 (50%), Positives = 26/42 (61%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGK-GGGIEFAKTRNRNMP 230 D+V D PI GG YY++P I G GGG+ AKTRN + P Sbjct: 4 DVVMDASSKPIFPGGEYYIMPAIWGPPGGGVRLAKTRNSDCP 45 >gi|5689162|dbj|BAA82840.1| (AB023648) miraculin homologue [Youngia japonica] Length = 142 Frame 3 hits (HSPs): ___________ Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 142 0 50 100 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 1.6e-05, Sum P(2) = 1.6e-05 Identities = 17/31 (54%), Positives = 21/31 (67%), Frame = +3 Query: 138 IRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 +R+G YY+LPV RG GGG+ A TRN P Sbjct: 1 LRSGTEYYILPVFRGMGGGLTLASTRNDTCP 31 Score = 39 (13.7 bits), Expect = 1.6e-05, Sum P(2) = 1.6e-05 Identities = 9/20 (45%), Positives = 11/20 (55%), Frame = +2 Query: 230 LSLLCISL*VSKGLPLIFXP 289 L ++ L V GLPL F P Sbjct: 32 LDVVQADLEVDNGLPLTFTP 51 >gi|3913945|sp|P81365|IT1B_ERYVA TRYPSIN INHIBITOR 1B (ETIB) >gi|262753|gb|AAB24755.1| ETIb=Kunitz-type trypsin inhibitor [Erythrina variegata, var. Orientalis, seeds, Peptide, 176 aa] >gi|383379|prf||1903155B trypsin inhibitor ET1b [Erythrina variegata orientalis] Length = 176 Frame 3 hits (HSPs): ____________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 176 0 50 100 150 __________________ Annotated Domains: Entrez active site: REACTIVE BOND (TRYPSIN) (BY 63..64 PFAM Kunitz_legume: Trypsin and protease inhi 1..172 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 1..30 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 39..59 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 114..133 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 141..170 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 1..135 PRODOM PD009415: IDE3(3) IT1B(2) IT1A(1) 143..175 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 2..18 __________________ Plus Strand HSPs: Score = 110 (38.7 bits), Expect = 1.6e-05, P = 1.6e-05 Identities = 21/37 (56%), Positives = 24/37 (64%), Frame = +3 Query: 120 DTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D EG + NGGTYY+LP I G GGG+E AKT P Sbjct: 4 DVEGEDVVNGGTYYMLPGIEGDGGGMEGAKTGRETCP 40 >gi|348574|pir||JH0781 trypsin inhibitor ETIb (Kunitz) - Erythrina variegata Length = 176 Frame 3 hits (HSPs): ____________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 176 0 50 100 150 __________________ Annotated Domains: DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..172 Entrez modified site: pyrrolidone carboxylic ac 1 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 2..18 __________________ Plus Strand HSPs: Score = 110 (38.7 bits), Expect = 1.6e-05, P = 1.6e-05 Identities = 21/37 (56%), Positives = 24/37 (64%), Frame = +3 Query: 120 DTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D EG + NGGTYY+LP I G GGG+E AKT P Sbjct: 4 DVEGEDVVNGGTYYMLPGIEGDGGGMEGAKTGRETCP 40 >gi|3891586|pdb|1AVW|B Chain B, Complex Porcine Pancreatic TrypsinSOYBEAN TRYPSIN Inhibitor, Orthorhombic Crystal Form Length = 171 Frame 3 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | 171 0 50 100 150 Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.00019, P = 0.00019 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D V D EGNP+ NGGTYY+L I GG I A T N P Sbjct: 1 DFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPTGNERCP 40 >gi|124938|sp|P10821|IT1A_PSOTE TRYPSIN INHIBITOR 1A (WTI-1A) >gi|68824|pir||TIWDK trypsin inhibitor 1A (Kunitz) - winged bean Length = 172 Frame 3 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.00019, P = 0.00019 Identities = 23/48 (47%), Positives = 27/48 (56%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFE 257 + D+EG +RNGGTYY+LP GGGIE A T P SP E Sbjct: 3 LLDSEGELVRNGGTYYLLPDRWALGGGIEAAATGTETCPLTVVRSPNE 50 >gi|417198|sp|P32877|IT1B_PSOTE TRYPSIN INHIBITOR 1B (WTI-1B) >gi|68825|pir||TIWDKB trypsin inhibitor 1B (Kunitz) - winged bean >gi|351621|prf||0910196A inhibitor WTI,trypsin [Psophocarpus tetragonolobus] Length = 172 Frame 3 hits (HSPs): _______________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 2..22 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 40..54 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 126..134 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 139..148 DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 1..168 Entrez active site: REACTIVE BOND (TRYPSIN). 64..65 PFAM Kunitz_legume: Trypsin and protease inhi 2..168 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 2..31 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 40..60 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 115..134 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 137..166 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 1..132 PRODOM PD009415: IDE3(3) IT1B(2) IT1A(1) 134..171 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.00019, P = 0.00019 Identities = 23/48 (47%), Positives = 27/48 (56%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMPSHCCASPFE 257 + D+EG +RNGGTYY+LP GGGIE A T P SP E Sbjct: 3 LLDSEGELVRNGGTYYLLPDRWALGGGIEAAATGTETCPLTVVRSPNE 50 >gi|3891588|pdb|1AVX|B Chain B, Complex Porcine Pancreatic TrypsinSOYBEAN TRYPSIN Inhibitor, Tetragonal Crystal Form Length = 172 Frame 3 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.00019, P = 0.00019 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D V D EGNP+ NGGTYY+L I GG I A T N P Sbjct: 1 DFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPTGNERCP 40 >gi|68821|pir||TISYC trypsin inhibitor C (Kunitz) - soybean >gi|354136|prf||1108235C inhibitor Tic,trypsin [Glycine max] Length = 181 Frame 3 hits (HSPs): ___________ Annotated Domains: _____ _ __________________________________________________ Database sequence: | | | | | 181 0 50 100 150 __________________ Annotated Domains: Entrez inhibit site: Arg (trypsin) 63 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.00025, P = 0.00025 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D V D EGNP+ NGGTYY+L I GG I A T N P Sbjct: 1 DFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPTGNERCP 40 >gi|3891584|pdb|1AVU| Trypsin Inhibitor From Soybean (Sti) >gi|3318878|pdb|1BA7|B Chain B, Soybean Trypsin Inhibitor >gi|3318877|pdb|1BA7|A Chain A, Soybean Trypsin Inhibitor >gi|354134|prf||1108235A inhibitor Tia,trypsin [Glycine max] Length = 181 Frame 3 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | 181 0 50 100 150 Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.00025, P = 0.00025 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D V D EGNP+ NGGTYY+L I GG I A T N P Sbjct: 1 DFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPTGNERCP 40 >gi|3650368|emb|CAA09607.1| (AJ011398) profucosidase [Pisum sativum] Length = 217 Frame 3 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 Plus Strand HSPs: Score = 106 (37.3 bits), Expect = 0.00029, P = 0.00029 Identities = 24/64 (37%), Positives = 31/64 (48%), Frame = +3 Query: 42 TTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGK-GGGIEFAKTRN 218 T S LF+ S + + V D G PI GG YY+LP IRG GGG+ +T + Sbjct: 8 TLSFLLFVFITTLSLAFSNEDVEQVLDVNGKPIFPGGQYYILPAIRGPPGGGVRLGRTGD 67 Query: 219 RNMP 230 P Sbjct: 68 LTCP 71 >gi|125023|sp|P01071|ITRB_SOYBN TRYPSIN INHIBITOR B (KUNITZ) >gi|68823|pir||TISYB trypsin inhibitor B (Kunitz) - soybean >gi|354135|prf||1108235B inhibitor Tib,trypsin [Glycine max] Length = 181 Frame 3 hits (HSPs): ___________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 181 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00283A: Soybean trypsin inhibitor (Kun 2..22 BLOCKS BL00283B: Soybean trypsin inhibitor (Kun 39..53 BLOCKS BL00283C: Soybean trypsin inhibitor (Kun 129..137 BLOCKS BL00283D: Soybean trypsin inhibitor (Kun 145..154 Entrez active site: REACTIVE BOND (TRYPSIN). 63..64 PFAM Kunitz_legume: Trypsin and protease inhi 2..175 PRINTS KUNITZINHBTR1: Kunitz-type STI motif I - 2..31 PRINTS KUNITZINHBTR2: Kunitz-type STI motif II 39..59 PRINTS KUNITZINHBTR3: Kunitz-type STI motif III 117..136 PRINTS KUNITZINHBTR4: Kunitz-type STI motif IV 144..173 PRODOM PD000891: IDE3(3) IAAS(3) IT1B(2) 2..140 PRODOM PD010854: 142..174 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 104 (36.6 bits), Expect = 0.00051, P = 0.00051 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = +3 Query: 108 DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 D V D EGNP+ NGGTYY+L I GG I A T N P Sbjct: 1 DFVLDNEGNPLSNGGTYYILSDITAFGG-IRAAPTGNERCP 40 >gi|7438248|pir||T07871 miraculin homolog, root-knot nematode-induced - tomato >gi|2654440|gb|AAC63057.1| (U70076) Lemir [Lycopersicon esculentum] Length = 205 Frame 3 hits (HSPs): _______________ Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 205 0 50 100 150 200 Plus Strand HSPs: Score = 97 (34.1 bits), Expect = 0.00067, Sum P(2) = 0.00067 Identities = 21/60 (35%), Positives = 35/60 (58%), Frame = +3 Query: 60 FLLCALTSSYQPSATADI---VFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 FL+ A++ + S+ A+ V D +G +R G YY+LPV+RG+GGG+ ++ P Sbjct: 10 FLILAISFNSLLSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKMCP 69 Score = 37 (13.0 bits), Expect = 0.00067, Sum P(2) = 0.00067 Identities = 6/11 (54%), Positives = 8/11 (72%), Frame = +2 Query: 257 VSKGLPLIFXP 289 + +GLPL F P Sbjct: 80 IDQGLPLTFTP 90 >gi|1362094|pir||S57810 hypothetical protein precursor (clone TPP11) - tomato >gi|924626|gb|AAA80497.1| (U20592) unknown [Lycopersicon esculentum] Length = 225 Frame 3 hits (HSPs): _______________ Annotated Domains: __________________________________________ __________________________________________________ Database sequence: | | | | | | 225 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 40..223 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 44..60 __________________ Plus Strand HSPs: Score = 104 (36.6 bits), Expect = 0.0011, P = 0.0011 Identities = 24/68 (35%), Positives = 39/68 (57%), Frame = +3 Query: 24 PKKMKSTTSLALFLLCALTSSYQPSA-TADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIE 200 P + ST S L L + P+ T V D++GNP++ G Y+VLP +RG GGG+ Sbjct: 16 PLALSSTFSSDLLLP---SDEVVPNGKTYASVVDSDGNPVKAGAKYFVLPSLRGSGGGLV 72 Query: 201 FAKTRNRNM 227 ++ ++N+ Sbjct: 73 LSRVVDKNV 81 >gi|5689168|dbj|BAA82843.1| (AB023651) miraculin homologue [Solanum melongena] Length = 160 Frame 3 hits (HSPs): ___________ Frame 2 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 160 0 50 100 150 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.0016, Sum P(2) = 0.0016 Identities = 15/34 (44%), Positives = 21/34 (61%), Frame = +3 Query: 129 GNPIRNGGTYYVLPVIRGKGGGIEFAKTRNRNMP 230 G +R G YY+LPV+RG+GGG+ N+ P Sbjct: 1 GKILRTGIDYYILPVVRGRGGGLTMDSIGNKTCP 34 Score = 44 (15.5 bits), Expect = 0.0016, Sum P(2) = 0.0016 Identities = 8/12 (66%), Positives = 9/12 (75%), Frame = +2 Query: 257 VSKGLPLIFXPF 292 V +GLPL F PF Sbjct: 45 VKQGLPLTFTPF 56 >gi|1076518|pir||S49578 trypsin inhibitor homolog - garden pea Length = 217 Frame 3 hits (HSPs): _________________ Annotated Domains: _________________________________________ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00338: SOYBEANTRYPSININHIBITOR(KUNITZ) 28..204 PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 32..48 __________________ Plus Strand HSPs: Score = 102 (35.9 bits), Expect = 0.0022, P = 0.0022 Identities = 25/70 (35%), Positives = 36/70 (51%), Frame = +3 Query: 30 KMKSTTSLALFLLCALTSSYQPSATADI--VFDTEGNPIRNGGTYYVLPVIRGK-GGGIE 200 K S +L+ FL +T+ + D+ V D GNPI G Y++LP IRG GGG+ Sbjct: 2 KPLSPLTLSFFLFVFITNLSLAFSNEDVEQVLDINGNPIFPGVQYFILPAIRGPPGGGVR 61 Query: 201 FAKTRNRNMP 230 +T + P Sbjct: 62 LGRTGDLTCP 71 >gi|386583|gb|AAB27369.1| caltrin precursor=54 kda calcium transport inhibitor {internal fragment b} [rats, seminal vesicles, Peptide Partial, 32 aa] Length = 32 Frame 3 hits (HSPs): ________________________________________ Annotated Domains: __________________________ __________________________________________________ Database sequence: | | | 32 0 20 __________________ Annotated Domains: PROSITE SOYBEAN_KUNITZ: Soybean trypsin inhibito 3..19 __________________ Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 0.0035, P = 0.0035 Identities = 16/26 (61%), Positives = 18/26 (69%), Frame = +3 Query: 114 VFDTEGNPIRNGGTYYVLPVIRGKGG 191 V D EGNP+ NGGTYY+L I GG Sbjct: 3 VLDNEGNPLENGGTYYILSDITAFGG 28 >gi|3859063|emb|CAA57931.1| (X82595) alpha-fucosidase [Pisum sativum] Length = 217 Frame 3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 0.0036, P = 0.0035 Identities = 25/70 (35%), Positives = 36/70 (51%), Frame = +3 Query: 30 KMKSTTSLALFLLCALTSSYQPSATADI--VFDTEGNPIRNGGTYYVLPVIRGK-GGGIE 200 K S +L+ FL +T+ + D+ V D GNPI G Y++LP IRG GGG+ Sbjct: 2 KPLSPLTLSFFLFVFITNLSLAFSNEDVEQVLDFNGNPIFPGVQYFILPAIRGPAGGGVR 61 Query: 201 FAKTRNRNMP 230 +T + P Sbjct: 62 LGRTGDLTCP 71 WARNING: HSPs involving 36 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.97 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.334 0.149 0.495 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.336 0.147 0.512 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.339 0.151 0.524 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.344 0.155 0.550 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.348 0.157 0.568 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.339 0.153 0.541 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 153 147 10. 74 3 12 22 0.12 33 30 0.11 36 +2 0 153 146 10. 74 3 12 22 0.12 33 30 0.11 36 +1 0 154 148 10. 74 3 12 22 0.091 34 30 0.11 36 -1 0 154 147 10. 74 3 12 22 0.12 33 30 0.11 36 -2 0 153 148 10. 74 3 12 22 0.091 34 30 0.11 36 -3 0 153 147 10. 74 3 12 22 0.12 33 30 0.11 36 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 86 No. of states in DFA: 593 (58 KB) Total size of DFA: 188 KB (192 KB) Time to generate neighborhood: 0.01u 0.01s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 170.57u 1.14s 171.71t Elapsed: 00:00:34 Total cpu time: 170.59u 1.20s 171.79t Elapsed: 00:00:34 Start: Wed Oct 3 10:01:47 2001 End: Wed Oct 3 10:02:21 2001 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000