33 proteins |
H | COG1072 | Panthothenate kinase | Help | |
---|---|---|---|---|---|
1 from | query genome Bacillus halodurans (Bacillales | Bacilli) | ||||
BH2875 |
147 letters (r) 0 0 629 ||| 1 BH2338 (147) 117 250 71 _ |||155 BS_gntK (513) COG1070 340 441 66 _ 255 DRA0188 (922) COG0178 199 -36 65 = || 71 SPy1233 (306) = 29 298 63 _ 255 YPO2984 (471) COG0008 170 -11 60 _ 255 Cgl0675 (305) COG2513 65 44 60 _ 255 aq_527 (254) COG0315
BLASTP 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BH2338 (147 letters) Database: myva 192,987 sequences; 59,019,183 total letters Score E Sequences producing significant alignments: (bits) Value BH2338 246 9e-66 BS_gntK 32 0.46 DRA0188 30 1.9 SPy1233 30 2.1 YPO2984 29 3.9 Cgl0675 28 9.3 aq_527 28 9.4 # >BH2338 # Length = 147 # # Score = 246 bits (629), Expect = 9e-66 # Identities = 147/147 (100%), Positives = 147/147 (100%) # # Query: 1 MGQESNLFFMRDSYATSHFLDWFSKEREDILTKEQIRFLSIMKYFQRDRFDEYTIPYSQL 60 # MGQESNLFFMRDSYATSHFLDWFSKEREDILTKEQIRFLSIMKYFQRDRFDEYTIPYSQL # Sbjct: 1 MGQESNLFFMRDSYATSHFLDWFSKEREDILTKEQIRFLSIMKYFQRDRFDEYTIPYSQL 60 # # Query: 61 PDKCKPYSESARDHHKRRIKGRIENAYANAEKKSLREMAEDRELEFGAEFMEIVEIDDQN 120 # PDKCKPYSESARDHHKRRIKGRIENAYANAEKKSLREMAEDRELEFGAEFMEIVEIDDQN # Sbjct: 61 PDKCKPYSESARDHHKRRIKGRIENAYANAEKKSLREMAEDRELEFGAEFMEIVEIDDQN 120 # # Query: 121 SKCNSFFSYRTGKRNKTSSIFVKYQRR 147 # SKCNSFFSYRTGKRNKTSSIFVKYQRR # Sbjct: 121 SKCNSFFSYRTGKRNKTSSIFVKYQRR 147 # # # >BS_gntK # Length = 513 # # Score = 32.0 bits (71), Expect = 0.46 # Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) # # Query: 22 WFSKEREDILTKEQIRFLSIMKYFQRDRFDEYTIPYS 58 # W + ER++I +K + +++ I +Y + F+EY I YS # Sbjct: 139 WITNERKEIASKAK-KYIGIKEYIFKQLFNEYVIDYS 174 # # # >DRA0188 # Length = 922 # # Score = 30.0 bits (66), Expect = 1.9 # Identities = 15/47 (31%), Positives = 24/47 (50%), Gaps = 6/47 (12%) # # Query: 55 IPYSQLPDKCKPYSESARDHHKRRIKGRIENAYANAEKKSLREMAED 101 # +P +++ + +PY+E H R+K R E A A L+ MA D # Sbjct: 395 LPLARVSELLRPYAEEREPGHAERVKNRPEQAIA------LQRMAAD 435 # # # >SPy1233 # Length = 306 # # Score = 29.6 bits (65), Expect = 2.1 # Identities = 21/59 (35%), Positives = 32/59 (53%), Gaps = 4/59 (6%) # # Query: 3 QESNLFFMRDSYATSHFLDWFSKEREDILTKEQIRFLSIMKYFQRDRFDEYTIPYSQLP 61 # Q++N +M D + S ++D S E + RFLSI+K +RD + Y Y+QLP # Sbjct: 202 QQNNRLYMSDYFDFSIYIDADSSHIETWYIE---RFLSILKLAKRDPHNYYA-QYAQLP 256 # # # >YPO2984 # Length = 471 # # Score = 28.9 bits (63), Expect = 3.9 # Identities = 21/71 (29%), Positives = 27/71 (37%), Gaps = 3/71 (4%) # # Query: 44 YFQRDRFDEYTIPYSQLPDKCKPYSESARDHHKRRIKGRIENAYANAEKKSLREMAEDRE 103 # YFQ RFD Y Q+ D Y K R++ E AN EK D + # Sbjct: 73 YFQTKRFDRYNAVIDQMLDAGTAYRCYCS---KERLEALREAQMANGEKPRYDGHCRDSQ 129 # # Query: 104 LEFGAEFMEIV 114 # GA+ +V # Sbjct: 130 CTHGADEPSVV 140 # # # >Cgl0675 # Length = 305 # # Score = 27.7 bits (60), Expect = 9.3 # Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%) # # Query: 81 GRIENAYANAEKKSLREMAEDRELEFGAEFMEIVEIDDQNSKCNSFFSYRTGKRNK 136 # G++E A A ++ +E DR ++ + E++ +D N F+YR G+ N+ # Sbjct: 251 GQVEQALAEIKEHGTQEGWLDR-MQHRSRLYELLRYEDYNVFDQHIFTYRKGENNE 305 # # # >aq_527 # Length = 254 # # Score = 27.7 bits (60), Expect = 9.4 # Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) # # Query: 77 RRIKGRIENAYANAEKKSLREMAEDRELEFGAEFMEIVEI 116 # RR+ G N + AE + LR++AED E GA F E E+ # Sbjct: 142 RRLDGVKVNLH--AENEGLRKIAEDYLKELGATFAEEAEL 179 # # Database: myva Posted date: Sep 16, 2002 2:25 PM Number of letters in database: 59,019,183 Number of sequences in database: 192,987 Lambda K H 0.320 0.134 0.387 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,052,854 Number of Sequences: 192987 Number of extensions: 538855 Number of successful extensions: 1420 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 1416 Number of HSP's gapped (non-prelim): 22 length of query: 147 length of database: 59,019,183 effective HSP length: 99 effective length of query: 48 effective length of database: 39,913,470 effective search space: 1915846560 effective search space used: 1915846560 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 60 (27.7 bits) S2: 60 (27.7 bits)