WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= SSH8A12.SEQ(1>217) (194 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 505,245 sequences; 158,518,215 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 16 Sequences : less than 16 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 6729 645 |======================================== 6310 6084 934 |========================================================== 3980 5150 950 |=========================================================== 2510 4200 602 |===================================== 1580 3598 594 |===================================== 1000 3004 509 |=============================== 631 2495 754 |=============================================== 398 1741 480 |============================== 251 1261 287 |================= 158 974 245 |=============== 100 729 176 |=========== 63.1 553 307 |=================== 39.8 246 65 |==== 25.1 181 54 |=== 15.8 127 42 |== >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 85 <<<<<<<<<<<<<<<<< 10.0 85 34 |== 6.31 51 16 |= 3.98 35 12 |: 2.51 23 14 |: 1.58 9 1 |: 1.00 8 2 |: 0.63 6 3 |: 0.40 3 0 | 0.25 3 0 | 0.16 3 0 | 0.10 3 2 |: 0.063 1 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|2059326|dbj|BAA19836.1|(D67067) thymic epithelial ... +2 86 0.053 1 gi|4502897ref|NP_001285.1| cleft lip and palate assoc... +2 86 0.073 1 gi|7298539|gb|AAF53758.1|(AE003661) CG15174 gene prod... -1 74 0.082 1 gi|4512707|gb|AAD21760.1|(AC006569) hypothetical prot... +2 76 0.34 1 gi|6599157|emb|CAB63723.1|(AL133576) hypothetical pro... +2 67 0.38 1 gi|6705952|dbj|BAA89442.1|(AB003159) ORF [Corynebacte... +2 71 0.40 1 gi|6682619|gb|AAF23340.1|AC016163_14(AC016163) hypoth... +2 66 0.52 1 gi|433395|gb|AAA03606.1|(U04197) HNF3 beta transcript... -1 71 0.58 1 gi|3719323|gb|AAC63308.1|(AF085252) D7-like protein [... +3 46 0.72 2 gi|913042|gb|AAB33816.1|hepatocyte nuclear factor 3 b... -1 71 0.85 1 gi|4958950|dbj|BAA78106.1|(AB028021) hepatocyte nucle... -1 71 0.85 1 gi|112412|pir||B39533transcription factor HNF-3 beta ... -1 71 0.85 1 gi|6981036ref|NP_036875.1| hepatocyte nuclear factor ... -1 71 0.85 1 gi|6753898ref|NP_034576.1| forkhead box A2 >gi|547662... -1 71 0.85 1 gi|404764|gb|AAA03161.1|(L10409) fork head related pr... -1 71 0.85 1 gi|913041|gb|AAB33815.1|hepatocyte nuclear factor 3 b... -1 71 0.85 1 gi|6633811|gb|AAF19670.1|AC009519_4(AC009519) F1N19.7... +2 55 0.86 2 gi|348522|pir||H45557orf B downstream of env - feline... +2 61 0.87 1 gi|7430738|pir||S69935ferredoxin [2Fe-2S] II - tomato... +2 61 0.87 1 gi|4733979|gb|AAD28661.1|AC007264_11(AC007264) hypoth... +2 61 0.87 1 gi|1572667|gb|AAB09083.1|(U69985) kinesin-like protei... +2 69 0.88 1 gi|4506307ref|NP_002829.1| protein tyrosine phosphata... +2 66 0.89 2 gi|539627|pir||A46546leukocyte common antigen long sp... +2 66 0.89 2 gi|3970862|dbj|BAA34795.1|(AB015337) HRIHFB2115 [Homo... +2 60 0.93 1 gi|7621167|gb|AAF64934.1|AF232470_1(AF232470) Sic1.16... +2 67 0.93 1 gi|7294803|gb|AAF50137.1|(AE003547) CG6449 gene produ... +2 45 0.93 2 gi|7506307|pir||T16692hypothetical protein R05F9.11 -... +2 56 0.93 2 gi|433501|emb|CAA53152.1|(X75383) TFIIA [Homo sapiens... -1 68 0.93 1 gi|6319605ref|NP_009687.1| involved in mating pathway... +2 51 0.95 2 gi|7294392|gb|AAF49739.1|(AE003534) CG9598 gene produ... +1 47 0.95 3 gi|7706735ref|NP_056943.1| TFIIA alpha, p55 >gi|17116... -1 68 0.96 1 gi|2149996|gb|AAB58716.1|(AF000943) TFIIA large subun... -1 68 0.96 1 gi|6561995|emb|CAB62484.1|(AL133363) hypothetical pro... +2 59 0.96 1 gi|806994|gb|AAB32547.1|(S74564) rheumatoid factor RF... -1 45 0.98 2 gi|540872|pir||JQ2384rev protein - feline immunodefic... +2 61 0.98 1 gi|3970854|dbj|BAA34791.1|(AB015332) HRIHFB2018 [Homo... +2 67 0.98 1 gi|7295764|gb|AAF51067.1|(AE003578) CG10019 gene prod... -1 65 0.99 2 gi|90157|pir||A25345troponin T, cardiac muscle, major... +2 65 0.99 1 gi|6678621ref|NP_033563.1| YY1 transcription factor >... -1 67 0.99 1 gi|1174842|sp|Q00899|TYY1_MOUSETRANSCRIPTIONAL REPRES... -1 67 0.99 1 gi|7507075|pir||T24446hypothetical protein T04C10.4 -... -1 63 0.99 1 gi|7620979|gb|AAF64840.1|AF232376_1(AF232376) Sic1.71... +2 65 0.990 1 gi|5306160|gb|AAD41944.1|AF160864_32(AF160864) NADH d... -2 59 0.991 2 gi|1352439|sp|P48724|IF5_PHAVUEUKARYOTIC TRANSLATION ... +2 67 0.993 1 gi|7518728|pir||H71173hypothetical protein PH0588 - P... +2 51 0.994 2 gi|2584819|gb|AAB82733.1|(U86868) non-structural prot... +2 69 0.995 1 gi|7621249|gb|AAF64975.1|AF232511_1(AF232511) Sic1.20... +2 64 0.996 1 gi|4056488|gb|AAC98054.1|(AC005896) unknown protein [... +2 63 0.998 1 gi|420088|pir||B34735protein-tyrosine kinase (EC 2.7.... -3 51 0.998 2 gi|7499127|pir||T20931hypothetical protein F14H3.6 - ... +2 46 0.998 2 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|3719323 |___________________________ gi|6633811 |______________ gi|7518728 | __________ Prosite Hits: _________ __________________________________________________ Query sequence: | | | | | 65 0 20 40 60 __________________ Prosite hits: RIBOSOMAL_S2_1 Ribosomal protein S2 signature 1. 39..50 __________________ Locus_ID Frame 2 Hits gi|2059326 | ___________________________________________ gi|4502897 | ___________________________________________ gi|4512707 | _________________________________ gi|6599157 | ___________________________ gi|6705952 | ________________________ gi|6682619 | _____________________ gi|3719323 | _____________ gi|6633811 | _____________ gi|348522 | ____________________________ gi|7430738 | _______________________________________ gi|4733979 |__________________________________ gi|1572667 | ______________________________ gi|4506307 | ________________________________ gi|539627 | ________________________________ gi|3970862 | ______________________________ gi|7621167 | ____________________________ gi|7294803 | ______________ gi|7506307 | _______________________________________ gi|6319605 | ________________________________ gi|7294392 | _____________ ____________ gi|6561995 | ______________________________ gi|540872 | ____________________________ gi|3970854 | ___________________________ gi|90157 | ____________________________________________ gi|7620979 | _______________________________ gi|1352439 | __________________________________ gi|7518728 | _________________________________ gi|2584819 | _______________________ gi|7621249 | ____________________________ gi|4056488 | __________________________________________ gi|7499127 | ___________________________ __________________________________________________ Query sequence: | | | | | 65 0 20 40 60 Locus_ID Frame 1 Hits gi|7294803 | ____________ gi|7294392 | _____________ __________________________________________________ Query sequence: | | | | | 65 0 20 40 60 Locus_ID Frame -1 Hits gi|7298539 | __________________________ gi|433395 | _______________________________ gi|913042 | _______________________________ gi|4958950 | _______________________________ gi|112412 | _______________________________ gi|6981036 | _______________________________ gi|6753898 | _______________________________ gi|404764 | _______________________________ gi|913041 | _______________________________ gi|433501 | __________________________ gi|7706735 | __________________________ gi|2149996 | __________________________ gi|806994 | ____________ gi|7295764 | ____________________ gi|6678621 | ________________ gi|1174842 | ________________ gi|7507075 | ___________________________ gi|5306160 | ___________ __________________________________________________ Query sequence: | | | | | 65 0 20 40 60 Locus_ID Frame -2 Hits gi|7295764 |___________ gi|5306160 | ________________________ __________________________________________________ Query sequence: | | | | | 65 0 20 40 60 Locus_ID Frame -3 Hits gi|806994 | _____________ gi|420088 | ________ ________________________ __________________________________________________ Query sequence: | | | | | 65 0 20 40 60
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 35 database sequences were not reported due to the limiting value of parameter V = 50. >gi|2059326|dbj|BAA19836.1| (D67067) thymic epithelial cell surface antigen [Mus musculus] Length = 515 Frame 2 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 515 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 0.055, P = 0.053 Identities = 23/55 (41%), Positives = 31/55 (56%), Frame = +2 Query: 26 KKKSLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVEWASYWKPNITINLVADFT 190 K K+LL G E + +++ +ED GPVE S+W PNITIN+V D T Sbjct: 207 KTKNLLTG-----ETEADPEMIKRAEDY-----GPVEVISHWHPNITINIVDDHT 251 >gi|4502897 ref|NP_001285.1| cleft lip and palate associated transmembrane protein 1 >gi|4039014|gb|AAC97420.1| (AF037338) cleft lip and palate transmembrane protein 1 [Homo sapiens] >gi|4063033|gb|AAC98151.1| (AF037339) cleft lip and palate transmembrane protein 1 [Homo sapiens] Length = 669 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 669 0 150 300 450 600 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 0.076, P = 0.073 Identities = 23/55 (41%), Positives = 31/55 (56%), Frame = +2 Query: 26 KKKSLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVEWASYWKPNITINLVADFT 190 K K+LL G E + +++ +ED GPVE S+W PNITIN+V D T Sbjct: 207 KTKNLLTG-----ETEADPEMIKRAEDY-----GPVEVISHWHPNITINIVDDHT 251 >gi|7298539|gb|AAF53758.1| (AE003661) CG15174 gene product [Drosophila melanogaster] Length = 131 Frame -1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | 131 0 50 100 Minus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.085, P = 0.082 Identities = 12/32 (37%), Positives = 16/32 (50%), Frame = -1 Query: 158 LVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH 63 ++ +KP P HHH H Q+ PP PH Sbjct: 1 MMQTLKPPPPLHHHHQHQHQLQHPPQQQPHPH 32 >gi|4512707|gb|AAD21760.1| (AC006569) hypothetical protein [Arabidopsis thaliana] Length = 371 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 371 0 150 300 Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.42, P = 0.34 Identities = 15/42 (35%), Positives = 27/42 (64%), Frame = +2 Query: 11 KSQADKKKSLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVE 136 + +A K++ G S S +A+ +SK V+E E+DD +DD ++ Sbjct: 303 EQKAKNKEAEAGTSKSSGDAEQSSKEVNEEEEDDDDDDDDLD 344 >gi|6599157|emb|CAB63723.1| (AL133576) hypothetical protein [Homo sapiens] Length = 115 Frame 2 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | 115 0 50 100 Plus Strand HSPs: Score = 67 (23.6 bits), Expect = 0.47, P = 0.38 Identities = 14/34 (41%), Positives = 20/34 (58%), Frame = +2 Query: 26 KKKSLLGGSPDSSEAQVTSKVVDESEDDDSNDDG 127 KKK GGSPD +++ T ++ D D ND+G Sbjct: 45 KKKRKQGGSPDEPDSKATRTDCSDNSDSD-NDEG 77 >gi|6705952|dbj|BAA89442.1| (AB003159) ORF [Corynebacterium ammoniagenes] Length = 193 Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | 193 0 50 100 150 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 0.51, P = 0.40 Identities = 12/30 (40%), Positives = 23/30 (76%), Frame = +2 Query: 50 SPDSSEAQVTSKVVDESEDDDSNDDGPVEW 139 S +S+EA +S+++D E D+++DDG V++ Sbjct: 29 SSESTEAAESSEIIDAGEADEASDDGAVDY 58 >gi|6682619|gb|AAF23340.1|AC016163_14 (AC016163) hypothetical protein [Arabidopsis thaliana] Length = 131 Frame 2 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 131 0 50 100 Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 0.74, P = 0.52 Identities = 14/27 (51%), Positives = 21/27 (77%), Frame = +2 Query: 53 PDSSEAQVT-SKVVDESEDDDSNDDGP 130 P+SSE +++ S+V + SEDDDS +D P Sbjct: 12 PESSEEELSDSQVSNSSEDDDSMEDEP 38 >gi|433395|gb|AAA03606.1| (U04197) HNF3 beta transcription factor [Mus musculus] Length = 259 Frame -1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | 259 0 50 100 150 200 250 Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 0.86, P = 0.58 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 177 FSINNLMSSEQQHHHSHHH---HQPHKMDLKAYEQVMHYP 213 >gi|3719323|gb|AAC63308.1| (AF085252) D7-like protein [Perca flavescens] Length = 152 Frame 3 hits (HSPs): ____________ Frame 2 hits (HSPs): ______ __________________________________________________ Database sequence: | | | || 152 0 50 100 150 Plus Strand HSPs: Score = 46 (16.2 bits), Expect = 1.3, Sum P(2) = 0.72 Identities = 13/33 (39%), Positives = 17/33 (51%), Frame = +3 Query: 6 CPSHKQIKRKVC-WEVHQILVRLK*HPRWLMNLK 104 CP K + + C + H I R K HP+ M LK Sbjct: 42 CPFDKNHQIRACRFPYHLIKCR-KNHPKLAMELK 74 Score = 34 (12.0 bits), Expect = 1.3, Sum P(2) = 0.72 Identities = 5/15 (33%), Positives = 9/15 (60%), Frame = +2 Query: 95 ESEDDDSNDDGPVEW 139 ++ED+ +D P W Sbjct: 103 DTEDEADDDAAPFVW 117 >gi|913042|gb|AAB33816.1| hepatocyte nuclear factor 3 beta, HNF3 beta [rats, AR42J exocrine pancreatic cells, Peptide, 450 aa] Length = 450 Frame -1 hits (HSPs): _____ Annotated Domains: ___ __ __________________________________________________ Database sequence: | | | | 450 0 150 300 __________________ Annotated Domains: PROSITE FORK_HEAD_1: Fork head domain signature 150..163 PROSITE FORK_HEAD_2: Fork head domain signature 194..200 __________________ Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.9, P = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 368 FSINNLMSSEQQHHHSHHH---HQPHKMDLKTYEQVMHYP 404 >gi|4958950|dbj|BAA78106.1| (AB028021) hepatocyte nuclear factor-3 beta [Homo sapiens] >gi|5231123|gb|AAD41081.1| (AF147787) hepatocyte nuclear factor-3 beta [Homo sapiens] >gi|5805394|gb|AAD51978.1|AF176110_1 (AF176110) hepatocyte nuclear factor-3 beta [Homo sapiens] >gi|7688215|emb|CAB89773.1| (AL121722) dJ788L20.1 (hepatocyte nuclear factor 3, beta) [Homo sapiens] Length = 457 Frame -1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | || 457 0 150 300 450 Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.9, P = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 376 FSINNLMSSEQQHHHSHHH---HQPHKMDLKAYEQVMHYP 412 >gi|112412|pir||B39533 transcription factor HNF-3 beta - rat Length = 458 Frame -1 hits (HSPs): _____ Annotated Domains: ___________ __________________________________________________ Database sequence: | | | || 458 0 150 300 450 __________________ Annotated Domains: Entrez domain: fork head DNA-binding domain hom 159..249 PROSITE FORK_HEAD_1: Fork head domain signature 159..172 PROSITE FORK_HEAD_2: Fork head domain signature 203..209 __________________ Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.9, P = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 376 FSINNLMSSEQQHHHSHHH---HQPHKMDLKTYEQVMHYP 412 >gi|6981036 ref|NP_036875.1| hepatocyte nuclear factor 3 beta >gi|417134|sp|P32182|HN3B_RAT HEPATOCYTE NUCLEAR FACTOR 3-BETA (HNF-3B) >gi|204623|gb|AAA41338.1| (L09647) HNF-3 beta [Rattus norvegicus] Length = 458 Frame -1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | || 458 0 150 300 450 Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.9, P = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 376 FSINNLMSSEQQHHHSHHH---HQPHKMDLKTYEQVMHYP 412 >gi|6753898 ref|NP_034576.1| forkhead box A2 >gi|547662|sp|P35583|HN3B_MOUSE HEPATOCYTE NUCLEAR FACTOR 3-BETA (HNF-3B) >gi|1083354|pir||B54258 transcription factor HNF-3 beta - mouse >gi|402191|emb|CAA52891.1| (X74937) HNF-3beta [Mus musculus] Length = 459 Frame -1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.9, P = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 377 FSINNLMSSEQQHHHSHHH---HQPHKMDLKAYEQVMHYP 413 >gi|404764|gb|AAA03161.1| (L10409) fork head related protein [Mus musculus] Length = 459 Frame -1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.9, P = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 377 FSINNLMSSEQQHHHSHHH---HQPHKMDLKAYEQVMHYP 413 >gi|913041|gb|AAB33815.1| hepatocyte nuclear factor 3 beta, HNF3 beta [rats, AR42J exocrine pancreatic cells, Peptide, 459 aa] Length = 459 Frame -1 hits (HSPs): _____ Annotated Domains: __ _ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 __________________ Annotated Domains: PROSITE FORK_HEAD_1: Fork head domain signature 159..172 PROSITE FORK_HEAD_2: Fork head domain signature 203..209 __________________ Minus Strand HSPs: Score = 71 (25.0 bits), Expect = 1.9, P = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%), Frame = -1 Query: 161 YLVSNMKPTPQDHHH*NHHLQIHQPPWMSLEPH*NLVNLP 42 + ++N+ + Q HHH +HH HQP M L+ + +++ P Sbjct: 377 FSINNLMSSEQQHHHSHHH---HQPHKMDLKTYEQVMHYP 413 >gi|6633811|gb|AAF19670.1|AC009519_4 (AC009519) F1N19.7 [Arabidopsis thaliana] Length = 368 Frame 3 hits (HSPs): ___ Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 368 0 150 300 Plus Strand HSPs: Score = 55 (19.4 bits), Expect = 1.9, Sum P(2) = 0.86 Identities = 8/16 (50%), Positives = 10/16 (62%), Frame = +2 Query: 92 DESEDDDSNDDGPVEW 139 D+ +DDD DD P W Sbjct: 60 DDDDDDDDGDDAPKTW 75 Score = 33 (11.6 bits), Expect = 1.9, Sum P(2) = 0.86 Identities = 7/17 (41%), Positives = 10/17 (58%), Frame = +3 Query: 6 CPSHKQIKRKVCWEVHQ 56 C S KQ K V +V++ Sbjct: 3 CTSSKQAKANVVADVYK 19 >gi|348522|pir||H45557 orf B downstream of env - feline immunodeficiency virus Length = 85 Frame 2 hits (HSPs): ______________________ Annotated Domains: ____________________________________________ __________________________________________________ Database sequence: | | | | | | 85 0 20 40 60 80 __________________ Annotated Domains: DOMO DM02889: FIVNEFPROTEIN 11..84 __________________ Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 2.0, P = 0.87 Identities = 11/36 (30%), Positives = 17/36 (47%), Frame = +2 Query: 77 TSKVVDESEDDDSNDDGPVEWASYWKPNITINLVAD 184 T DE+E+ S + V+W YW P ++ D Sbjct: 50 TPSTTDETEEKTSAKEKRVDWEDYWDPEEIEKMLMD 85 >gi|7430738|pir||S69935 ferredoxin [2Fe-2S] II - tomato >gi|1589259|prf||2210387B ferredoxin:ISOTYPE=II [Lycopersicon esculentum] Length = 97 Frame 2 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | | 97 0 20 40 60 80 Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 2.0, P = 0.87 Identities = 20/54 (37%), Positives = 28/54 (51%), Frame = +2 Query: 23 DKKKSLLGGSPDSSEAQVTSKVVDESE----DDDSNDDGPV-EWASYWKPNITI 169 D S G+ S +VT+ VD+S+ DDD D+G V +Y K N+TI Sbjct: 34 DLPYSCRAGACSSCAGKVTAGSVDQSDNSFLDDDQIDEGFVLTCVAYPKSNVTI 87 >gi|4733979|gb|AAD28661.1|AC007264_11 (AC007264) hypothetical protein [Arabidopsis thaliana] Length = 85 Frame 2 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | | 85 0 20 40 60 80 Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 2.0, P = 0.87 Identities = 16/42 (38%), Positives = 25/42 (59%), Frame = +2 Query: 5 LPKSQADKKKSLL-GGSPDSSEAQVTSKVVDESEDDDSNDDGP 130 LP + D K SLL GG P S+ A++ +K V++ ++N P Sbjct: 11 LPFNGDDTKSSLLTGGDPPSA-AELAAKTVEDQLPREANPTAP 52 >gi|1572667|gb|AAB09083.1| (U69985) kinesin-like protein K8 [Dictyostelium discoideum] Length = 338 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 338 0 150 300 Plus Strand HSPs: Score = 69 (24.3 bits), Expect = 2.1, P = 0.88 Identities = 15/41 (36%), Positives = 24/41 (58%), Frame = +2 Query: 11 KSQADKKKSLLGGSPDS---SEAQVTSKVVDESEDDDSNDD 124 K Q+ KK + SPDS ++ +S ++DE E+DD D+ Sbjct: 239 KKQSKGKKKMFSSSPDSLSPNKDDDSSIMIDEDEEDDEEDE 279 >gi|4506307 ref|NP_002829.1| protein tyrosine phosphatase, receptor type, c polypeptide >gi|116006|sp|P08575|CD45_HUMAN LEUKOCYTE COMMON ANTIGEN PRECURSOR (L-CA) (CD45 ANTIGEN) (T200) >gi|34281|emb|CAA68669.1| (Y00638) LCA (AA -23 to 1281) [Homo sapiens] Length = 1304 Frame 2 hits (HSPs): __ __ __________________________________________________ Database sequence: | | | | 1304 0 500 1000 Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 2.2, Sum P(2) = 0.89 Identities = 14/32 (43%), Positives = 19/32 (59%), Frame = +2 Query: 92 DESEDDDSNDDGPVEWA------SYWKPNITI 169 DES DDDS+ + P ++ SYWKP + I Sbjct: 1000 DESSDDDSDSEEPSKYINASFIMSYWKPEVMI 1031 Score = 33 (11.6 bits), Expect = 2.2, Sum P(2) = 0.89 Identities = 6/17 (35%), Positives = 11/17 (64%), Frame = +2 Query: 50 SPDSSEAQVTSKVVDES 100 SPD++ QV+ +D + Sbjct: 75 SPDNTSTQVSPDSLDNA 91 >gi|539627|pir||A46546 leukocyte common antigen long splice form precursor - human Length = 1304 Frame 2 hits (HSPs): __ __ Annotated Domains: __________________________ __________________________________________________ Database sequence: | | | | 1304 0 500 1000 __________________ Annotated Domains: Entrez domain: leukocyte common antigen cytosol 594..1235 Entrez active site: Cys (phosphocysteine interm 851 Entrez binding site: substrate phosphate (Arg) 857 PROSITE TYR_PHOSPHATASE_1: Tyrosine specific pro 1165..1177 PROSITE TYR_PHOSPHATASE_1: Tyrosine specific pro 849..861 __________________ Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 2.2, Sum P(2) = 0.89 Identities = 14/32 (43%), Positives = 19/32 (59%), Frame = +2 Query: 92 DESEDDDSNDDGPVEWA------SYWKPNITI 169 DES DDDS+ + P ++ SYWKP + I Sbjct: 1000 DESSDDDSDSEEPSKYINASFIMSYWKPEVMI 1031 Score = 33 (11.6 bits), Expect = 2.2, Sum P(2) = 0.89 Identities = 6/17 (35%), Positives = 11/17 (64%), Frame = +2 Query: 50 SPDSSEAQVTSKVVDES 100 SPD++ QV+ +D + Sbjct: 75 SPDNTSTQVSPDSLDNA 91 >gi|3970862|dbj|BAA34795.1| (AB015337) HRIHFB2115 [Homo sapiens] Length = 105 Frame 2 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | | 105 0 20 40 60 80 100 Plus Strand HSPs: Score = 60 (21.1 bits), Expect = 2.6, P = 0.93 Identities = 18/45 (40%), Positives = 22/45 (48%), Frame = +2 Query: 8 PKSQADKKKSLLGGS-----PDSSEAQVTSKV--VDESEDDDSND 121 PK D KS+ GS P +S AQ V VD E+D SN+ Sbjct: 21 PKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNN 65 >gi|7621167|gb|AAF64934.1|AF232470_1 (AF232470) Sic1.165 [Streptococcus pyogenes] Length = 276 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 276 0 50 100 150 200 250 Plus Strand HSPs: Score = 67 (23.6 bits), Expect = 2.6, P = 0.93 Identities = 16/35 (45%), Positives = 19/35 (54%), Frame = +2 Query: 35 SLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVEW 139 +LLG + S TS+ D S DD S DD P EW Sbjct: 22 ALLGATQPVSAETYTSRNFDWSGDDWSGDDWPEEW 56 >gi|7294803|gb|AAF50137.1| (AE003547) CG6449 gene product [Drosophila melanogaster] Length = 196 Frame 2 hits (HSPs): ____ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 196 0 50 100 150 Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 2.6, Sum P(2) = 0.93 Identities = 9/16 (56%), Positives = 13/16 (81%), Frame = +2 Query: 83 KVVDESEDDDSNDDGP 130 +V+ E++DDD NDD P Sbjct: 18 QVLPETDDDD-NDDRP 32 Score = 41 (14.4 bits), Expect = 2.6, Sum P(2) = 0.93 Identities = 9/15 (60%), Positives = 10/15 (66%), Frame = +1 Query: 133 GVGFILETKYNNKLG 177 GVG IL +YN K G Sbjct: 137 GVGLILNGQYNIKNG 151 >gi|7506307|pir||T16692 hypothetical protein R05F9.11 - Caenorhabditis elegans >gi|1109819|gb|AAA83173.1| (U41533) weak similarity to A. thaliana ELI3-2 protein (PIR:S28044) [Caenorhabditis elegans] Length = 521 Frame 2 hits (HSPs): ___ ____ __________________________________________________ Database sequence: | | | | | 521 0 150 300 450 Plus Strand HSPs: Score = 56 (19.7 bits), Expect = 2.7, Sum P(2) = 0.93 Identities = 12/28 (42%), Positives = 23/28 (82%), Frame = +2 Query: 92 DESEDDDSNDDGPVEWASYWKPNITINL 175 DES++++S++D PV +S+ +P++TI L Sbjct: 435 DESDEENSDED-PVAESSH-RPHLTIQL 460 Score = 34 (12.0 bits), Expect = 2.7, Sum P(2) = 0.93 Identities = 6/25 (24%), Positives = 16/25 (64%), Frame = +2 Query: 26 KKKSLLGGSPDSSEAQVTSKVVDES 100 K K + G+P + ++ S+V++++ Sbjct: 191 KDKFGITGNPLNDPTEILSRVIEKN 215 >gi|433501|emb|CAA53152.1| (X75383) TFIIA [Homo sapiens] >gi|727195|dbj|BAA03603.1| (D14886) TFIIA-37 [Homo sapiens] Length = 337 Frame -1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | 337 0 150 300 Minus Strand HSPs: Score = 68 (23.9 bits), Expect = 2.7, P = 0.93 Identities = 14/33 (42%), Positives = 19/33 (57%), Frame = -1 Query: 185 SQQPSLLLYLVSNMKPTPQDHHH*NHHLQIHQP 87 S++ LLL + +P Q HHH +HH Q QP Sbjct: 22 SEEQQLLLQVQQQHQPQQQQHHHHHHHQQA-QP 53 >gi|6319605 ref|NP_009687.1| involved in mating pathway; Opy1p >gi|586539|sp|P38271|OPY1_YEAST OPY1 PROTEIN (OVERPRODUCTION INDUCED PHEROMONE RESISTANT YEAST 1) >gi|626518|pir||S45998 hypothetical protein YBR129c - yeast (Saccharomyces cerevisiae) >gi|496860|emb|CAA53488.1| (X75891) YBR1004 [Saccharomyces cerevisiae] >gi|536417|emb|CAA85086.1| (Z35998) ORF YBR129c [Saccharomyces cerevisiae] >gi|2440017|gb|AAB81505.1| (AF016262) overproduction induced pheromone resistant yeast 1 [Saccharomyces cerevisiae] >gi|1582516|prf||2118402D YBR1004 gene [Saccharomyces cerevisiae] Length = 328 Frame 2 hits (HSPs): ____ ____ __________________________________________________ Database sequence: | | | | 328 0 150 300 Plus Strand HSPs: Score = 51 (18.0 bits), Expect = 3.0, Sum P(2) = 0.95 Identities = 10/21 (47%), Positives = 12/21 (57%), Frame = +2 Query: 50 SPDSSEAQVTSKVVDESEDDD 112 SP +E+ T DE EDDD Sbjct: 151 SPSGNESVTTGSDYDEEEDDD 171 Score = 34 (12.0 bits), Expect = 3.0, Sum P(2) = 0.95 Identities = 7/19 (36%), Positives = 10/19 (52%), Frame = +2 Query: 113 SNDDGPVEWASYWKPNITI 169 +ND V+W +K I I Sbjct: 301 ANDQDMVDWIINFKSGILI 319 >gi|7294392|gb|AAF49739.1| (AE003534) CG9598 gene product [Drosophila melanogaster] Length = 1100 Frame 2 hits (HSPs): __ __ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | | | | 1100 0 150 300 450 600 750 900 1050 Plus Strand HSPs: Score = 47 (16.5 bits), Expect = 3.1, Sum P(3) = 0.95 Identities = 8/17 (47%), Positives = 13/17 (76%), Frame = +1 Query: 127 SCGVGFILETKYNNKLG 177 SCG+GF +E +++ LG Sbjct: 1024 SCGLGFSIEGGFDSPLG 1040 Score = 36 (12.7 bits), Expect = 3.1, Sum P(3) = 0.95 Identities = 7/16 (43%), Positives = 10/16 (62%), Frame = +2 Query: 8 PKSQADKKKSLLGGSP 55 P D ++SL GG+P Sbjct: 185 PSLTRDYQRSLSGGTP 200 Score = 31 (10.9 bits), Expect = 3.1, Sum P(3) = 0.95 Identities = 6/15 (40%), Positives = 10/15 (66%), Frame = +2 Query: 77 TSKVVDESEDDDSND 121 ++K + ED+DS D Sbjct: 568 SAKSRGQEEDNDSTD 582 >gi|7706735 ref|NP_056943.1| TFIIA alpha, p55 >gi|1711663|sp|P52655|T2AA_HUMAN TRANSCRIPTION INITIATION FACTOR IIA ALPHA AND BETA CHAINS (TFIIA P35 AND P19 SUBUNITS) (TFIIA-42) (TFIIAL) >gi|627655|pir||A49077 transcription initiation factor IIA alpha chain precursor - human >gi|433500|emb|CAA53151.1| (X75383) TFIIA [Homo sapiens] >gi|452272|emb|CAA54442.1| (X77225) TFIIA/alpha, p55 [Homo sapiens] >gi|727197|dbj|BAA03604.1| (D14887) 'TFIIA-42' [Homo sapiens] >gi|6721137|gb|AAF26776.1|AC010582_2 (AC010582) TFIIA-42 [Homo sapiens] Length = 376 Frame -1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 376 0 150 300 Minus Strand HSPs: Score = 68 (23.9 bits), Expect = 3.1, P = 0.96 Identities = 14/33 (42%), Positives = 19/33 (57%), Frame = -1 Query: 185 SQQPSLLLYLVSNMKPTPQDHHH*NHHLQIHQP 87 S++ LLL + +P Q HHH +HH Q QP Sbjct: 61 SEEQQLLLQVQQQHQPQQQQHHHHHHHQQA-QP 92 >gi|2149996|gb|AAB58716.1| (AF000943) TFIIA large subunit [Rattus norvegicus] Length = 377 Frame -1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 377 0 150 300 Minus Strand HSPs: Score = 68 (23.9 bits), Expect = 3.1, P = 0.96 Identities = 14/33 (42%), Positives = 19/33 (57%), Frame = -1 Query: 185 SQQPSLLLYLVSNMKPTPQDHHH*NHHLQIHQP 87 S++ LLL + +P Q HHH +HH Q QP Sbjct: 61 SEEQQLLLQVQQQHQPQQQQHHHHHHHQQA-QP 92 >gi|6561995|emb|CAB62484.1| (AL133363) hypothetical protein [Arabidopsis thaliana] Length = 95 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | | 95 0 20 40 60 80 Plus Strand HSPs: Score = 59 (20.8 bits), Expect = 3.3, P = 0.96 Identities = 12/38 (31%), Positives = 20/38 (52%), Frame = +2 Query: 23 DKKKSLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVE 136 ++ ++L G +SSE T D +DD+ +DD E Sbjct: 38 EEDRNLSGDDSESSEDDYTDSNSDSDDDDEEDDDDEEE 75 >gi|806994|gb|AAB32547.1| (S74564) rheumatoid factor RF1-7=IgM autoantibody kappa chain variable region {clone RF1-7K} [mice, MRL/lpr, spleen, B cell hybridoma, Peptide Partial Mutant, 109 aa] [Mus sp.] Length = 109 Frame -1 hits (HSPs): _______ Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | 109 0 20 40 60 80 100 Minus Strand HSPs: Score = 45 (15.8 bits), Expect = 3.7, Sum P(2) = 0.98 Identities = 8/14 (57%), Positives = 12/14 (85%), Frame = -1 Query: 182 QQPSLLLYLVSNMK 141 Q P LL+Y+VSN++ Sbjct: 46 QPPRLLIYVVSNLE 59 Score = 31 (10.9 bits), Expect = 3.7, Sum P(2) = 0.98 Identities = 6/17 (35%), Positives = 9/17 (52%), Frame = -3 Query: 126 PSSLESSSSDSSTTLDV 76 P+ S S + TLD+ Sbjct: 63 PARFSGSGSGTDFTLDI 79 >gi|540872|pir||JQ2384 rev protein - feline immunodeficiency virus >gi|455722|gb|AAB28971.1| (S67436) Rev=regulatory protein {alternatively spliced} [feline immunodeficiency virus FIV, TM2, Peptide, 148 aa] [Feline immunodeficiency virus] Length = 148 Frame 2 hits (HSPs): _____________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 148 0 50 100 __________________ Annotated Domains: DOMO DM04773: FIVNEFPROTEIN 1..71 DOMO DM02889: FIVNEFPROTEIN 73..147 __________________ Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 4.0, P = 0.98 Identities = 11/36 (30%), Positives = 17/36 (47%), Frame = +2 Query: 77 TSKVVDESEDDDSNDDGPVEWASYWKPNITINLVAD 184 T DE+E+ S + V+W YW P ++ D Sbjct: 113 TPSTTDETEEKTSAKEKRVDWEDYWDPEEIEKMLMD 148 >gi|3970854|dbj|BAA34791.1| (AB015332) HRIHFB2018 [Homo sapiens] Length = 373 Frame 2 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 373 0 150 300 Plus Strand HSPs: Score = 67 (23.6 bits), Expect = 4.0, P = 0.98 Identities = 14/34 (41%), Positives = 20/34 (58%), Frame = +2 Query: 26 KKKSLLGGSPDSSEAQVTSKVVDESEDDDSNDDG 127 KKK GGSPD +++ T ++ D D ND+G Sbjct: 290 KKKRKQGGSPDEPDSKATRTDCSDNSDSD-NDEG 322 >gi|7295764|gb|AAF51067.1| (AE003578) CG10019 gene product [Drosophila melanogaster] Length = 1131 Frame -1 hits (HSPs): __ Frame -2 hits (HSPs): _ __________________________________________________ Database sequence: | | | | | | | | | 1131 0 150 300 450 600 750 900 1050 Minus Strand HSPs: Score = 65 (22.9 bits), Expect = 4.2, Sum P(2) = 0.99 Identities = 12/26 (46%), Positives = 15/26 (57%), Frame = -1 Query: 161 YLVSNMKPTPQDHH-H*NHHLQIHQP 87 Y+ + M P Q HH H +HH Q H P Sbjct: 274 YMYNPMPPAHQSHHQHDHHHAQQHHP 299 Score = 30 (10.6 bits), Expect = 4.2, Sum P(2) = 0.99 Identities = 8/13 (61%), Positives = 9/13 (69%), Frame = -2 Query: 40 QTFLFICL*LGQV 2 QTFL I + LG V Sbjct: 683 QTFLGISMALGVV 695 >gi|90157|pir||A25345 troponin T, cardiac muscle, major isoform - rabbit Length = 276 Frame 2 hits (HSPs): ___________ Annotated Domains: ____ __________________________________________________ Database sequence: | | | | | | | 276 0 50 100 150 200 250 __________________ Annotated Domains: PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 217..238 __________________ Plus Strand HSPs: Score = 65 (22.9 bits), Expect = 4.3, P = 0.99 Identities = 20/57 (35%), Positives = 31/57 (54%), Frame = +2 Query: 11 KSQADKKKSLLGGSPDSSEAQVTSKVVDESEDDDSND-DGPVEWASYWKPNITI-NLV 178 + +A +++ GG+ +E + T D E++D D DGPVE S KP + NLV Sbjct: 16 EQEAGEEEEAGGGAEAEAETEETQAEEDGQEEEDKEDEDGPVE-ESKPKPRPFMPNLV 72 >gi|6678621 ref|NP_033563.1| YY1 transcription factor >gi|1083540|pir||A56418 transcription factor delta - mouse >gi|192941|gb|AAA37521.1| (M74590) delta-transcription factor [Mus musculus] Length = 414 Frame -1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 414 0 150 300 Minus Strand HSPs: Score = 67 (23.6 bits), Expect = 4.6, P = 0.99 Identities = 10/20 (50%), Positives = 14/20 (70%), Frame = -1 Query: 125 HHH*NHHLQIHQPPWMSLEP 66 HHH +HH H PP ++L+P Sbjct: 71 HHHHHHHHHHHHPPMIALQP 90 >gi|1174842|sp|Q00899|TYY1_MOUSE TRANSCRIPTIONAL REPRESSOR PROTEIN YY1 (YIN AND YANG 1) (YY-1) (DELTA TRANSCRIPTION FACTOR) (NF-E1) (UCR-MOTIF DNA-BINDING PROTEIN) >gi|2137259|pir||A48273 delta/YY1/NF-E1/UCRBP transcription factor - mouse >gi|202271|gb|AAA40522.1| (M73963) UCR-motif DNA binding protein [Mus musculus] >gi|293849|gb|AAA40477.1| (L13968) delta/YY1/NF-E1/UCRBP transcription factor [Mus musculus] Length = 414 Frame -1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 414 0 150 300 Minus Strand HSPs: Score = 67 (23.6 bits), Expect = 4.6, P = 0.99 Identities = 10/20 (50%), Positives = 14/20 (70%), Frame = -1 Query: 125 HHH*NHHLQIHQPPWMSLEP 66 HHH +HH H PP ++L+P Sbjct: 71 HHHHHHHHHHHHPPMIALQP 90 >gi|7507075|pir||T24446 hypothetical protein T04C10.4 - Caenorhabditis elegans >gi|3879473|emb|CAA93757.1| (Z69885) Similarity to Human transcription factor ATF-4 (SW:ATF4_HUMAN)~cDNA EST EMBL:Z14931 comes from this gene~cDNA EST EMBL:D32684 comes from this gene~cDNA EST EMBL:T01302 comes from this gene~cDNA EST EMBL:D35394 comes from this gene~cDNA EST yk2> Length = 208 Frame -1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 208 0 50 100 150 200 Minus Strand HSPs: Score = 63 (22.2 bits), Expect = 4.6, P = 0.99 Identities = 15/33 (45%), Positives = 19/33 (57%), Frame = -1 Query: 182 QQPSLLLY--LVSNMKPTPQDHHH*NHHLQIHQPP 84 Q P LLY + + TPQ H+H +HH HQ P Sbjct: 7 QNPQFLLYNGMHNQTHSTPQYHNHHHHH---HQSP 38 >gi|7620979|gb|AAF64840.1|AF232376_1 (AF232376) Sic1.71 [Streptococcus pyogenes] Length = 290 Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | 290 0 50 100 150 200 250 Plus Strand HSPs: Score = 65 (22.9 bits), Expect = 4.6, P = 0.99 Identities = 17/41 (41%), Positives = 22/41 (53%), Frame = +2 Query: 35 SLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVE-WASY-W 151 +LLG + S TS+ D S DD S DD P + W+ Y W Sbjct: 22 ALLGATQPVSAETYTSRNFDWSGDDWSGDDWPEDDWSKYGW 62 >gi|5306160|gb|AAD41944.1|AF160864_32 (AF160864) NADH dehydrogenase subunit 5 [Tetrahymena pyriformis] Length = 755 Frame -1 hits (HSPs): __ Frame -2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | || 755 0 150 300 450 600 750 Minus Strand HSPs: Score = 59 (20.8 bits), Expect = 4.7, Sum P(2) = 0.99 Identities = 11/29 (37%), Positives = 21/29 (72%), Frame = -2 Query: 169 YCYIWFPI*SPLHRTIIIRIIIFRFINHL 83 YC + F I +PL+ T++++ II+ +IN + Sbjct: 87 YCKVIFNI-APLYLTLLVKNIIYLYINFI 114 Score = 32 (11.3 bits), Expect = 4.7, Sum P(2) = 0.99 Identities = 6/13 (46%), Positives = 7/13 (53%), Frame = -1 Query: 59 NLVNLPTDFSFYL 21 NL LP FY+ Sbjct: 566 NLSGLPLTLGFYI 578 >gi|1352439|sp|P48724|IF5_PHAVU EUKARYOTIC TRANSLATION INITIATION FACTOR 5 (EIF-5) >gi|7488764|pir||T11804 eukaryotic translation initiation factor 5 - kidney bean >gi|1008881|gb|AAA92861.1| (L47221) eukaryotic initiation factor 5 [Phaseolus vulgaris] Length = 443 Frame 2 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 443 0 150 300 __________________ Annotated Domains: DOMO DM03318: GTPNP_BIND 1..442 Entrez np-binding site: GTP (POTENTIAL). 29..36 Entrez Domain: POLY-ASP. 229..236 Entrez Domain: POLY-LYS. 274..277 PFAM eIF5_eIF2B: Domain found in IF2B/IF5 1..131 PRODOM PD004078: IF2B(10) IF5(7) 10..126 PRODOM PD037964: IF5(2) 128..216 PRODOM PD006913: IF5(7) Q15394(1) O49733(1) 240..435 __________________ Plus Strand HSPs: Score = 67 (23.6 bits), Expect = 5.0, P = 0.99 Identities = 17/43 (39%), Positives = 22/43 (51%), Frame = +2 Query: 11 KSQADKKKSLLGGSPDSSEAQVTSKVVDESE---DDDSNDDGPVEW 139 KS KKK G D T K ++E E D+D +DD V+W Sbjct: 198 KSTISKKK---GSGSDEDRRSPTHKQIEEKEEAKDEDDDDDDGVQW 240 >gi|7518728|pir||H71173 hypothetical protein PH0588 - Pyrococcus horikoshii >gi|3256994|dbj|BAA29677.1| (AP000002) 626aa long hypothetical protein [Pyrococcus horikoshii] Length = 626 Frame 3 hits (HSPs): _ Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | 626 0 150 300 450 600 Plus Strand HSPs: Score = 51 (18.0 bits), Expect = 5.1, Sum P(2) = 0.99 Identities = 12/42 (28%), Positives = 20/42 (47%), Frame = +2 Query: 11 KSQADKKKSLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVE 136 KSQ +K+S SP + VD+++ + + PVE Sbjct: 27 KSQEKQKQSKASTSPPQPSPPIPESTVDKTQIQKFSKEEPVE 68 Score = 38 (13.4 bits), Expect = 5.1, Sum P(2) = 0.99 Identities = 5/12 (41%), Positives = 10/12 (83%), Frame = +3 Query: 126 VLWSGLHIGNQI 161 ++W+ LH+G +I Sbjct: 377 IVWNKLHLGAEI 388 >gi|2584819|gb|AAB82733.1| (U86868) non-structural protein 1 [chipmunk parvovirus] Length = 711 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | 711 0 150 300 450 600 Plus Strand HSPs: Score = 69 (24.3 bits), Expect = 5.4, P = 1.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Frame = +2 Query: 41 LGGSPDSSEAQVTSKVVDESEDDDSNDDG 127 LGGSP + + T DE EDDD++ G Sbjct: 558 LGGSPAPAVSSTTESSADEDEDDDTSSSG 586 >gi|7621249|gb|AAF64975.1|AF232511_1 (AF232511) Sic1.206 [Streptococcus pyogenes] Length = 276 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 276 0 50 100 150 200 250 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 5.6, P = 1.0 Identities = 15/35 (42%), Positives = 19/35 (54%), Frame = +2 Query: 35 SLLGGSPDSSEAQVTSKVVDESEDDDSNDDGPVEW 139 +LLG + S TS+ D S DD S DD P +W Sbjct: 22 ALLGATQPVSAETYTSRNFDWSGDDWSGDDWPEDW 56 >gi|4056488|gb|AAC98054.1| (AC005896) unknown protein [Arabidopsis thaliana] Length = 249 Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 249 0 50 100 150 200 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 6.1, P = 1.0 Identities = 19/53 (35%), Positives = 24/53 (45%), Frame = +2 Query: 8 PKSQADKKKSLLGGSP-DSSEAQVTSKVVDESEDDDSNDDGPVEWASYWKPNIT 166 PK Q + GGSP D+ V S VV D D PV+ ++PN T Sbjct: 190 PKLQKEVGSDRDGGSPQDNGRNSVVSPVVGAGGDSSKEDRSPVD--DDYEPNRT 241 >gi|420088|pir||B34735 protein-tyrosine kinase (EC 2.7.1.112) (ret) - human (fragment) Length = 402 Frame -3 hits (HSPs): _____ ___ Annotated Domains: _____________________________________ __________________________________________________ Database sequence: | | | | 402 0 150 300 __________________ Annotated Domains: Entrez domain: protein kinase homology #label K 10..300 Entrez region: protein kinase ATP-binding motif 18..26 PROSITE PROTEIN_KINASE_TYR: Tyrosine protein kin 158..170 __________________ Minus Strand HSPs: Score = 51 (18.0 bits), Expect = 6.1, Sum P(2) = 1.0 Identities = 12/32 (37%), Positives = 18/32 (56%), Frame = -3 Query: 174 KFIVIFGFQYEAHSTGPSSLESSSSDSSTTLD 79 K+ + GF E+ GP L S S +S++LD Sbjct: 96 KYGSLRGFLRESRKVGPGYLGSGGSRNSSSLD 127 Score = 33 (11.6 bits), Expect = 6.1, Sum P(2) = 1.0 Identities = 7/10 (70%), Positives = 7/10 (70%), Frame = -3 Query: 54 GEPPNRLFFL 25 G PP RLF L Sbjct: 242 GIPPERLFNL 251 >gi|7499127|pir||T20931 hypothetical protein F14H3.6 - Caenorhabditis elegans >gi|5824456|emb|CAB05487.2| (Z83105) cDNA EST EMBL:D68878 comes from this gene~cDNA EST EMBL:C09019 comes from this gene~cDNA EST EMBL:C08332 comes from this gene~cDNA EST EMBL:C10040 comes from this gene~cDNA EST EMBL:C10083 comes from this gene~cDNA EST yk263c7.5 comes from thi> Length = 245 Frame 2 hits (HSPs): ____ ____ __________________________________________________ Database sequence: | | | | | | 245 0 50 100 150 200 Plus Strand HSPs: Score = 46 (16.2 bits), Expect = 6.2, Sum P(2) = 1.0 Identities = 7/14 (50%), Positives = 9/14 (64%), Frame = +2 Query: 104 DDDSNDDGPVEWAS 145 D D +DDGP W + Sbjct: 225 DGDDDDDGPGNWGN 238 Score = 33 (11.6 bits), Expect = 6.2, Sum P(2) = 1.0 Identities = 8/20 (40%), Positives = 8/20 (40%), Frame = +2 Query: 44 GGSPDSSEAQVTSKVVDESE 103 GG D E V V E E Sbjct: 21 GGGNDGQEEDVQMAEVSEQE 40 WARNING: HSPs involving 35 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.88 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.353 0.150 0.589 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.302 0.124 0.352 same same same Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.417 0.196 0.906 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.343 0.148 0.545 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.361 0.163 0.620 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.330 0.140 0.410 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 64 64 10. 57 3 12 22 0.11 30 27 0.12 30 +2 0 64 63 10. 57 3 12 23 0.11 31 26 0.084 31 +1 0 64 63 10. 57 3 12 22 0.11 30 26 0.12 30 -1 0 64 64 10. 57 3 12 22 0.11 30 27 0.12 30 -2 0 64 64 10. 57 3 12 22 0.11 30 27 0.12 30 -3 0 64 63 10. 57 3 12 22 0.11 30 26 0.12 30 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 8:50 PM CDT May 27, 2000 Format: BLAST # of letters in database: 158,518,215 # of sequences in database: 505,245 # of database sequences satisfying E: 85 No. of states in DFA: 583 (57 KB) Total size of DFA: 118 KB (128 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 4 Search cpu time: 93.83u 1.24s 95.07t Elapsed: 00:00:24 Total cpu time: 93.88u 1.31s 95.19t Elapsed: 00:00:24 Start: Thu Feb 15 01:32:48 2001 End: Thu Feb 15 01:33:12 2001 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000