Q91X94 - (Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) || Number of peptides = 45 || ambiguous || 99.6% Confident
SR19_MOUSE - (Q9D7A6) Signal recognition particle 19 kDa protein (SRP19) || Number of peptides = 3 || unambiguous || 99.6% Confident
RU1C_MOUSE - (Q62241) U1 small nuclear ribonucleoprotein C (U1-C) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9D7E7 - (Q9D7E7) 2310011G05Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
O00301 - (O00301) KSRP || Number of peptides = 9 || unambiguous || 99.6% Confident
H2AG_HUMAN - (P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) || Number of peptides = 34 || ambiguous || 99.6% Confident
Q9QZQ8 - (Q9QZQ8) Histone macroH2A1.2 variant || Number of peptides = 17 || ambiguous || 99.6% Confident
H33_HUMAN - (P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q) (P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q) || Number of peptides = 6 || ambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 127 || ambiguous || 99.6% Confident
Q9QYS9 - (Q9QYS9) QKI-5 protein || Number of peptides = 14 || ambiguous || 99.6% Confident
PP1A_HUMAN - (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9WVK2 - (Q9WVK2) Ring1 interactor RYBP || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9JI25 - (Q9JI25) Bromodomain-containing FSH-like protein FSRG2 || Number of peptides = 11 || ambiguous || 99.6% Confident
CIRP_MOUSE - (Q61413) Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) (A18 hnRNP) || Number of peptides = 6 || unambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9JHS9 - (Q9JHS9) Hypothetical 26.6 kDa protein (0610040D20Rik protein) (RIKEN cDNA 0610040D20 gene) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q61029 - (Q61029) Thymopoietin beta || Number of peptides = 26 || unambiguous || 99.6% Confident
Q99NB8 - (Q99NB8) UBIN (Ataxin-1 ubiquitin-like interacting protein) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CT37 - (Q9CT37) 2610003J05Rik protein (Fragment) || Number of peptides = 14 || ambiguous || 99.6% Confident
Q8WXA9 - (Q8WXA9) Splicing factor, arginine/serine-rich 12 || Number of peptides = 4 || unambiguous || 99.6% Confident
Q61818 - (Q61818) Hypothetical 196.0 kDa protein || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9DBI6 - (Q9DBI6) 1300007E16Rik protein || Number of peptides = 8 || ambiguous || 99.6% Confident
H13_MOUSE - (P43277) Histone H1.3 (H1 VAR.4) (H1D) || Number of peptides = 15 || unambiguous || 99.6% Confident
Q8R509 - (Q8R509) Polypirimidine tract binding protein || Number of peptides = 10 || unambiguous || 99.6% Confident
K1CI_HUMAN - (P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q99JF8 - (Q99JF8) Lens epithelium-derived growth factor || Number of peptides = 35 || unambiguous || 99.6% Confident
Q9CQ99 - (Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) || Number of peptides = 1 || unambiguous || 99.6% Confident
TRPS_MOUSE - (Q925H1) Zinc finger transcription factor TRPS1 || Number of peptides = 10 || unambiguous || 99.6% Confident
APE1_MOUSE - (P28352) DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP endonuclease 1) (APEX nuclease) (APEN) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9P258 - (Q9P258) Hypothetical protein KIAA1470 (Fragment) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9DBI1 - (Q9DBI1) Heterochromatin protein 2, binding protein 3 || Number of peptides = 31 || unambiguous || 99.6% Confident
RBB4_MOUSE - (Q60972) Chromatin assembly factor 1 subunit C (CAF-1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF-I 48 kDa subunit) (CAF-Ip48) (Retinoblastoma binding protein p48) (Retinoblastoma-binding protein 4) (RBBP-4) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CX86 - (Q9CX86) 3010025E17Rik protein || Number of peptides = 112 || unambiguous || 99.6% Confident
Q9CYQ1 - (Q9CYQ1) 3930401K13Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
RL4_MOUSE - (Q9D8E6) 60S ribosomal protein L4 (L1) || Number of peptides = 12 || ambiguous || 99.6% Confident
EVI1_MOUSE - (P14404) Ecotropic virus integration 1 site protein || Number of peptides = 5 || unambiguous || 99.6% Confident
RU17_MOUSE - (Q62376) U1 small nuclear ribonucleoprotein 70 kDa (U1 SNRNP 70 kDa) (snRNP70) (Fragment) || Number of peptides = 8 || ambiguous || 99.6% Confident
RS3A_MOUSE - (P97351) 40S ribosomal protein S3a || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9CRB2 - (Q9CRB2) 2410130M07Rik protein (RIKEN cDNA 2410130M07 gene) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q14980 - (Q14980) NuMA protein || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 11 || ambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 35 || unambiguous || 99.6% Confident
Q8QZY9 - (Q8QZY9) Splicing factor 3b, subunit 4, 49kD (Hypothetical 44.4 kDa protein) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q99KG3 - (Q99KG3) Similar to RNA binding motif protein 10 || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9CWK3 - (Q9CWK3) 2410024K20Rik protein (RIKEN cDNA 2410024K20 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
FUS_MOUSE - (P56959) RNA-binding protein FUS (Pigpen protein) || Number of peptides = 58 || ambiguous || 99.6% Confident
UBF1_MOUSE - (P25976) Nucleolar transcription factor 1 (Upstream binding factor 1) (UBF-1) || Number of peptides = 13 || ambiguous || 99.6% Confident
Q8VHR5 - (Q8VHR5) Transcription repressor p66 || Number of peptides = 17 || unambiguous || 99.6% Confident
Q99LI4 - (Q99LI4) Similar to nucleolar phosphoprotein p130 || Number of peptides = 13 || unambiguous || 99.6% Confident
Q9JII5 - (Q9JII5) DAZ-associated protein 1 || Number of peptides = 13 || unambiguous || 99.6% Confident
Q922M7 - (Q922M7) Similar to hypothetical protein MGC5509 || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9D1A5 - (Q9D1A5) DNA segment, Chr 13, Wayne state University 177, expressed || Number of peptides = 3 || ambiguous || 99.6% Confident
SP18_MOUSE - (O55128) Sin3 associated polypeptide p18 || Number of peptides = 8 || ambiguous || 99.6% Confident
CABA_MOUSE - (Q99020) CARG-binding factor-A (CBF-A) || Number of peptides = 88 || unambiguous || 99.6% Confident
U2AF_MOUSE - (P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) || Number of peptides = 5 || ambiguous || 99.6% Confident
CUG1_MOUSE - (P28659) CUG triplet repeat RNA-binding protein 1 (CUG-BP1) (RNA-binding protein BRUNOL-2) (Deadenylation factor CUG-BP) (Deadenylation factor EDEN-BP) (Brain protein F41) || Number of peptides = 1 || ambiguous || 99.6% Confident
RS12_MOUSE - (P09388) 40S ribosomal protein S12 || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9CVL7 - (Q9CVL7) 1810019E15Rik protein (Fragment) || Number of peptides = 17 || unambiguous || 99.6% Confident
RL6_MOUSE - (P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9CT17 - (Q9CT17) 2610019N13Rik protein (Fragment) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9Z2N8 - (Q9Z2N8) BAF53a || Number of peptides = 4 || ambiguous || 99.6% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 73 || unambiguous || 99.6% Confident
PL10_MOUSE - (P16381) Putative ATP-dependent RNA helicase PL10 || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9D8Q1 - (Q9D8Q1) 3100001N19Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
PTB_MOUSE - (P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) || Number of peptides = 27 || unambiguous || 99.6% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 4 || unambiguous || 99.6% Confident
BUB3_MOUSE - (Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9QUS3 - (Q9QUS3) BAMACAN || Number of peptides = 6 || ambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 7 || ambiguous || 99.6% Confident
Q60735 - (Q60735) P62 ras-GAP associated phosphoprotein || Number of peptides = 14 || ambiguous || 99.6% Confident
TR2B_HUMAN - (Q15815) Arginine/serine-rich splicing factor 10 (Transformer-2-beta) (HTRA2-beta) (Transformer 2 protein homolog) (Silica-induced protein 41) (RA301) (Q15815) Arginine/serine-rich splicing factor 10 (Transformer-2-beta) (HTRA2-beta) (Transformer 2 protein homolog) (Silica-induced protein 41) (RA301) || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9Z1N5 - (Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1) || Number of peptides = 5 || ambiguous || 99.6% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 49 || ambiguous || 99.6% Confident
LA_MOUSE - (P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) || Number of peptides = 8 || ambiguous || 99.6% Confident
RSMB_MOUSE - (P27048) Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) || Number of peptides = 32 || ambiguous || 99.6% Confident
Q61191 - (Q61191) Transcription factor C1 (HCF) || Number of peptides = 17 || ambiguous || 99.6% Confident
RL32_HUMAN - (P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32 || Number of peptides = 11 || ambiguous || 99.6% Confident
Q9CSA9 - (Q9CSA9) 5830433M19Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
O54941 - (O54941) BAF57 || Number of peptides = 5 || ambiguous || 99.6% Confident
Q99K76 - (Q99K76) Hypothetical 31.2 kDa protein || Number of peptides = 13 || ambiguous || 99.6% Confident
H14_MOUSE - (P43274) Histone H1.4 (H1 VAR.2) (H1E) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q99LF4 - (Q99LF4) Hypothetical 55.2 kDa protein || Number of peptides = 5 || ambiguous || 99.6% Confident
MEC2_MOUSE - (Q9Z2D6) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2) || Number of peptides = 5 || unambiguous || 99.6% Confident
TOP1_MOUSE - (Q04750) DNA topoisomerase I (EC 5.99.1.2) || Number of peptides = 11 || unambiguous || 99.6% Confident
TP2B_MOUSE - (Q64511) DNA topoisomerase II, beta isozyme (EC 5.99.1.3) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q9DC54 - (Q9DC54) 2500003M10Rik protein || Number of peptides = 6 || unambiguous || 99.6% Confident
CBX1_HUMAN - (P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25) (P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25) || Number of peptides = 7 || ambiguous || 99.6% Confident
BRD3_HUMAN - (Q15059) Bromodomain-containing protein 3 (RING3-like protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
RL3_MOUSE - (P27659) 60S ribosomal protein L3 (J1 protein) || Number of peptides = 5 || unambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 6 || ambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 6 || ambiguous || 99.6% Confident
O75937 - (O75937) SPF31 || Number of peptides = 6 || unambiguous || 99.6% Confident
Q922Z7 - (Q922Z7) Similar to DNA polymerase beta || Number of peptides = 1 || unambiguous || 99.6% Confident
Q8R149 - (Q8R149) Similar to hypothetical protein MGC13125 || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9JIX8 - (Q9JIX8) AcinusL protein || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CXX7 - (Q9CXX7) Small nuclear ribonucleoprotein polypeptide A || Number of peptides = 12 || ambiguous || 99.6% Confident
Q9DAB4 - (Q9DAB4) 1700015E05Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
YB1_MOUSE - (P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) || Number of peptides = 6 || ambiguous || 99.6% Confident
RU2A_MOUSE - (P57784) U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9EQC8 - (Q9EQC8) Papillary renal cell carcinoma-associated protein || Number of peptides = 6 || unambiguous || 99.6% Confident
HDA1_MOUSE - (O09106) Histone deacetylase 1 (HD1) || Number of peptides = 2 || ambiguous || 99.6% Confident
SEP7_MOUSE - (O55131) Septin 7 (CDC10 protein homolog) || Number of peptides = 2 || ambiguous || 99.6% Confident
SFR5_MOUSE - (O35326) Splicing factor, arginine/serine-rich 5 (Pre-mRNA splicing factor SRP40) (Delayed-early protein HRS) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q91VI8 - (Q91VI8) Similar to ubiquilin 2 (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
O88568 - (O88568) Heterogenous nuclear ribonucleoprotein U || Number of peptides = 63 || unambiguous || 99.6% Confident
ZF37_MOUSE - (P17141) Zinc finger protein 37 (Zfp-37) (Male germ cell specific zinc finger protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9Z172 - (Q9Z172) SMT3A protein (2810014B19RIK protein) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q99974 - (Q99974) POMBE CDC5-related protein (KIAA0432) (CDC5 (Cell division cycle 5, S. POMBE, homolog)-like) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q61399 - (Q61399) Cyclin-dependent protein kinase || Number of peptides = 2 || ambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 19 || unambiguous || 99.6% Confident
Q9CVU5 - (Q9CVU5) Adult male testis cDNA, RIKEN full-length enriched library, clone:1700029B05, full insert sequence (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 46 || ambiguous || 99.6% Confident
USF2_MOUSE - (Q64705) Upstream stimulatory factor 2 (Upstream transcription factor 2) (Major late transcription factor 2) || Number of peptides = 1 || unambiguous || 99.6% Confident
RL8_HUMAN - (P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8 || Number of peptides = 9 || ambiguous || 99.6% Confident
IF5A_HUMAN - (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9CQI7 - (Q9CQI7) 2810052G09Rik protein (U2 small nuclear ribonucleoprotein B) || Number of peptides = 1 || ambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 51 || unambiguous || 99.6% Confident
TCPE_MOUSE - (P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q8VEK7 - (Q8VEK7) Hypothetical 27.3 kDa protein || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9R047 - (Q9R047) AcinusS || Number of peptides = 18 || ambiguous || 99.6% Confident
ELV1_HUMAN - (Q15717) ELAV-like protein 1 (Hu-antigen R) (HuR) || Number of peptides = 4 || unambiguous || 99.6% Confident
ELV1_MOUSE - (P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q9ESU6 - (Q9ESU6) Cell proliferation related protein CAP || Number of peptides = 12 || unambiguous || 99.6% Confident
O08583 - (O08583) ALY || Number of peptides = 33 || ambiguous || 99.6% Confident
H2AX_MOUSE - (P27661) Histone H2A.X || Number of peptides = 3 || ambiguous || 99.6% Confident
Q924L8 - (Q924L8) High mobility group protein isoform I || Number of peptides = 9 || ambiguous || 99.6% Confident
Q9CZH5 - (Q9CZH5) 2700094L05Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 12 || ambiguous || 99.6% Confident
LAM1_MOUSE - (P14733) Lamin B1 || Number of peptides = 10 || unambiguous || 99.6% Confident
HXA5_MOUSE - (P09021) Homeobox protein Hox-A5 (Hox-1.3) (M2) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q91W39 - (Q91W39) Similar to coactivator independent of AF-2 || Number of peptides = 5 || unambiguous || 99.6% Confident
TDBP_MOUSE - (Q921F2) TAR DNA-binding protein-43 (TDP-43) || Number of peptides = 10 || ambiguous || 99.6% Confident
O35540 - (O35540) Hepatoma-derived growth factor || Number of peptides = 6 || ambiguous || 99.6% Confident
O35845 - (O35845) Brg1 protein (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
ROG_MOUSE - (O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G) || Number of peptides = 16 || unambiguous || 99.6% Confident
TP2B_HUMAN - (Q02880) DNA topoisomerase II, beta isozyme (EC 5.99.1.3) || Number of peptides = 5 || unambiguous || 99.6% Confident
ATF2_MOUSE - (P16951) Cyclic-AMP-dependent transcription factor ATF-2 (Activating transcription factor 2) (cAMP response element binding protein CRE-BP1) (MXBP protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
CU70_MOUSE - (P58468) Protein C21orf70 homolog || Number of peptides = 2 || unambiguous || 99.6% Confident
K1CJ_HUMAN - (P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CZ21 - (Q9CZ21) 2810416I22Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
LSM4_MOUSE - (Q9QXA5) U6 snRNA-associated Sm-like protein LSm4 || Number of peptides = 5 || ambiguous || 99.6% Confident
IF41_HUMAN - (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9D2M7 - (Q9D2M7) Hepatoma-derived growth factor, related protein 3 || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 2 || ambiguous || 99.6% Confident
SMD1_HUMAN - (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) || Number of peptides = 15 || ambiguous || 99.6% Confident
Q99K48 - (Q99K48) Non-POU-domain-containing, octamer-binding protein || Number of peptides = 39 || unambiguous || 99.6% Confident
NUCL_MOUSE - (P09405) Nucleolin (Protein C23) || Number of peptides = 47 || unambiguous || 99.6% Confident
ROC_MOUSE - (Q9Z204) Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1 / hnRNP C2) || Number of peptides = 23 || unambiguous || 99.6% Confident
CUT1_MOUSE - (P53564) CCAAT displacement protein (CDP) (Cut-like 1) (Homeobox protein Cux) (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
O70396 - (O70396) SIK similar protein || Number of peptides = 4 || unambiguous || 99.6% Confident
XRC1_MOUSE - (Q60596) DNA-repair protein XRCC1 || Number of peptides = 3 || unambiguous || 99.6% Confident
SODC_MOUSE - (P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9QYY2 - (Q9QYY2) Poly-glutamine tract-binding protein || Number of peptides = 2 || unambiguous || 99.6% Confident
U186_MOUSE - (Q923D4) Hypothetical protein MGC11596 || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9Z0H4 - (Q9Z0H4) Apoptosis-related RNA binding protein (CUG triplet repeat,RNA binding protein 2) || Number of peptides = 4 || ambiguous || 99.6% Confident
R10A_MOUSE - (P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9D6U5 - (Q9D6U5) 2310057C03Rik protein || Number of peptides = 10 || ambiguous || 99.6% Confident
DNM1_MOUSE - (P13864) DNA (cytosine-5)-methyltransferase 1 (EC 2.1.1.37) (Dnmt1) (DNA methyltransferase MmuI) (DNA MTase MmuI) (MCMT) (M.MmuI) (Met-1) || Number of peptides = 18 || unambiguous || 99.6% Confident
SMD2_HUMAN - (P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) (P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) || Number of peptides = 12 || ambiguous || 99.6% Confident
Q9D7J5 - (Q9D7J5) 2310005N01Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
RS14_HUMAN - (P06366) 40S ribosomal protein S14 (PRO2640) (P06366) 40S ribosomal protein S14 (PRO2640) || Number of peptides = 10 || ambiguous || 99.6% Confident
Q9CSF9 - (Q9CSF9) 2410005K20Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9D945 - (Q9D945) 1190005P17Rik protein || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9DBY6 - (Q9DBY6) 1200009K13Rik protein || Number of peptides = 5 || ambiguous || 99.6% Confident
Q8VIJ6 - (Q8VIJ6) PTB-associated splicing factor || Number of peptides = 160 || unambiguous || 99.6% Confident
Q9R0U5 - (Q9R0U5) Matrin3 || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9CRI0 - (Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) || Number of peptides = 44 || ambiguous || 99.6% Confident
O08784 - (O08784) Treacle protein (Treacher collins syndrome protein) (Putative nucleolar trafficking phosphoprotein) || Number of peptides = 21 || unambiguous || 99.6% Confident
Q9Z1H6 - (Q9Z1H6) Nuclear protein np95 (Nuclear zinc finger protein Np95) || Number of peptides = 16 || unambiguous || 99.6% Confident
CYPB_MOUSE - (P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) || Number of peptides = 15 || unambiguous || 99.6% Confident
S3B1_MOUSE - (Q99NB9) Splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit) || Number of peptides = 8 || ambiguous || 99.6% Confident
ROA2_MOUSE - (O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) || Number of peptides = 190 || ambiguous || 99.6% Confident
H12_MOUSE - (P15864) Histone H1.2 (H1 VAR.1) (H1C) || Number of peptides = 45 || unambiguous || 99.6% Confident
H31_HUMAN - (P16106) Histone H3.1 (H3/a) (H3/c) (H3/d) (H3/f) (H3/h) (H3/i) (H3/j) (H3/k) (H3/l) (P16106) Histone H3.1 (H3/a) (H3/c) (H3/d) (H3/f) (H3/h) (H3/i) (H3/j) (H3/k) (H3/l) || Number of peptides = 24 || ambiguous || 99.6% Confident
RED_MOUSE - (Q9Z1M8) Red protein (RER protein) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 11 || ambiguous || 99.6% Confident
PCB2_MOUSE - (Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9ESX5 - (Q9ESX5) DYSKERIN || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9R0U0 - (Q9R0U0) Neural specific sr protein NSSR 1 || Number of peptides = 6 || ambiguous || 99.6% Confident
H4_HUMAN - (P02304) Histone H4 (P02304) Histone H4 || Number of peptides = 58 || ambiguous || 99.6% Confident
MK_MOUSE - (P12025) Midkine precursor (Retinoic acid-induced differentiation factor) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9Z130 - (Q9Z130) JKTBP (Heterogeneous nuclear ribonucleoprotein D-like) || Number of peptides = 26 || ambiguous || 99.6% Confident
H32_BOVIN - (P16105) Histone H3 (H3.2) || Number of peptides = 31 || unambiguous || 99.6% Confident
Q920B9 - (Q920B9) Chromatin-specific transcription elongation factor, 140 kDa subunit || Number of peptides = 9 || unambiguous || 99.6% Confident
Q8VCQ8 - (Q8VCQ8) Similar to caldesmon 1 || Number of peptides = 4 || unambiguous || 99.6% Confident
PCB1_HUMAN - (Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) || Number of peptides = 2 || unambiguous || 99.6% Confident
NPM_MOUSE - (Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38) || Number of peptides = 84 || ambiguous || 99.6% Confident
RL17_MOUSE - (Q9CPR4) 60S ribosomal protein L17 (L23) || Number of peptides = 13 || ambiguous || 99.6% Confident
Q925Q1 - (Q925Q1) Osa1 nuclear protein || Number of peptides = 5 || unambiguous || 99.6% Confident
FBRL_MOUSE - (P35550) Fibrillarin (Nucleolar protein 1) || Number of peptides = 17 || ambiguous || 99.6% Confident
HBB2_MOUSE - (P02089) Hemoglobin beta-2 chain (B2) (Minor) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q91W16 - (Q91W16) Unknown (Protein for MGC:7184) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9D0M8 - (Q9D0M8) 5730470C09Rik protein || Number of peptides = 11 || unambiguous || 99.6% Confident
VIME_MOUSE - (P20152) Vimentin || Number of peptides = 5 || ambiguous || 99.6% Confident
ILF3_MOUSE - (Q9Z1X4) Interleukin enhancer-binding factor 3 || Number of peptides = 25 || unambiguous || 99.6% Confident
Q91VR6 - (Q91VR6) Similar to siah binding protein 1, FBP interacting repressor, pyrimidine tr || Number of peptides = 8 || ambiguous || 99.6% Confident
Q9ERC2 - (Q9ERC2) Polyadenylation protein CSTF64 || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9Z2D8 - (Q9Z2D8) Methyl-CpG binding protein MBD3 || Number of peptides = 5 || unambiguous || 99.6% Confident
HMGC_MOUSE - (P52927) High mobility group protein HMGI-C || Number of peptides = 4 || unambiguous || 99.6% Confident
O00405 - (O00405) FB19 protein || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CQU0 - (Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
RS17_MOUSE - (P06584) 40S ribosomal protein S17 || Number of peptides = 11 || ambiguous || 99.6% Confident
Q8WYU4 - (Q8WYU4) Hypothetical protein || Number of peptides = 3 || unambiguous || 99.6% Confident
RL5_MOUSE - (P47962) 60S ribosomal protein L5 || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9H9V1 - (Q9H9V1) Hypothetical protein FLJ12529 || Number of peptides = 6 || unambiguous || 99.6% Confident
H15_MOUSE - (P43276) Histone H1.5 (H1 VAR.5) (H1B) || Number of peptides = 36 || unambiguous || 99.6% Confident
H2AZ_HUMAN - (P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z) || Number of peptides = 16 || ambiguous || 99.6% Confident
Q9D4J7 - (Q9D4J7) 4931428F02Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9DBR1 - (Q9DBR1) 5'-3' exoribonuclease 2 || Number of peptides = 6 || unambiguous || 99.6% Confident
NFIB_MOUSE - (P97863) Nuclear factor 1 B-type (Nuclear factor 1/B) (NF1-B) (NFI-B) (NF-I/B) (CCAAT-box binding transcription factor) (CTF) (TGGCA-binding protein) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q61464 - (Q61464) Nuclear protein, NP220 || Number of peptides = 6 || unambiguous || 99.6% Confident
RL21_MOUSE - (O09167) 60S ribosomal protein L21 || Number of peptides = 5 || unambiguous || 99.6% Confident
H2B1_MOUSE - (P10853) Histone H2B F (H2B 291A) || Number of peptides = 39 || ambiguous || 99.6% Confident
TYY1_MOUSE - (Q00899) Transcriptional repressor protein YY1 (Yin and yang 1) (YY-1) (Delta transcription factor) (NF-E1) (UCR-motif DNA-binding protein) || Number of peptides = 5 || ambiguous || 99.6% Confident
TP2A_MOUSE - (Q01320) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3) || Number of peptides = 20 || unambiguous || 99.6% Confident
Q9UEG4 - (Q9UEG4) Hypothetical protein KIAA0326 (Fragment) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q62189 - (Q62189) Small nuclear RNA (Small nuclear ribonucleoprotein polypeptide A) || Number of peptides = 8 || unambiguous || 99.6% Confident
ENPL_MOUSE - (P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q8R081 - (Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L || Number of peptides = 14 || ambiguous || 99.6% Confident
S3B2_HUMAN - (Q13435) Splicing factor 3B subunit 2 (Spliceosome associated protein 145) (SAP 145) (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa subunit) || Number of peptides = 16 || unambiguous || 99.6% Confident
O00455 - (O00455) TTF-I interacting peptide 20 (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
RS7_HUMAN - (P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) || Number of peptides = 8 || ambiguous || 99.6% Confident
S3A2_MOUSE - (Q62203) Splicing factor 3A subunit 2 (Spliceosome associated protein 62) (SAP 62) (SF3a66) || Number of peptides = 17 || unambiguous || 99.6% Confident
Q9D6C6 - (Q9D6C6) 3632413F13Rik protein || Number of peptides = 12 || ambiguous || 99.6% Confident
FKB3_MOUSE - (Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9DAI0 - (Q9DAI0) 6430539P16Rik protein || Number of peptides = 7 || ambiguous || 99.6% Confident
Q8R1K5 - (Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) || Number of peptides = 59 || ambiguous || 99.6% Confident
Q9Z315 - (Q9Z315) MSART-1(806) || Number of peptides = 15 || unambiguous || 99.6% Confident
Q61769 - (Q61769) Ki-67 protein || Number of peptides = 35 || unambiguous || 99.6% Confident
RS24_HUMAN - (P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19) || Number of peptides = 4 || ambiguous || 99.6% Confident
SMD3_HUMAN - (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) || Number of peptides = 33 || ambiguous || 99.6% Confident
O54789 - (O54789) Protein L (Fragment) || Number of peptides = 60 || ambiguous || 99.6% Confident
O88286 - (O88286) WizL || Number of peptides = 9 || unambiguous || 99.6% Confident
SNF5_MOUSE - (Q9Z0H3) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 1 (Integrase interactor 1 protein) (mSNF5) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9NPI4 - (Q9NPI4) hnRNP 2H9D || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9Y3J2 - (Q9Y3J2) DJ222E13.3 (Novel protein) (Fragment) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9EPU3 - (Q9EPU3) Variant polyadenylation protein CSTF-64 || Number of peptides = 2 || unambiguous || 99.6% Confident
H10_MOUSE - (P10922) Histone H1' (H1.0) (H1(0)) || Number of peptides = 12 || unambiguous || 99.6% Confident
K2C1_HUMAN - (P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9D0T1 - (Q9D0T1) Sperm specific antigen 1 || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9BW18 - (Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit || Number of peptides = 9 || ambiguous || 99.6% Confident
GR78_MOUSE - (P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) || Number of peptides = 12 || unambiguous || 99.6% Confident
ALBU_HUMAN - (P02768) Serum albumin precursor || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9D0E1 - (Q9D0E1) 2610023M21Rik protein || Number of peptides = 23 || unambiguous || 99.6% Confident
ERH_HUMAN - (Q14259) Enhancer of rudimentary homolog (Q14259) Enhancer of rudimentary homolog || Number of peptides = 2 || ambiguous || 99.6% Confident
RBM3_MOUSE - (O89086) Putative RNA-binding protein 3 (RNA binding motif protein 3) || Number of peptides = 17 || unambiguous || 99.6% Confident
Q62019 - (Q62019) 16 kDa protein || Number of peptides = 5 || ambiguous || 99.6% Confident
P97496 - (P97496) SRG3 || Number of peptides = 24 || unambiguous || 99.6% Confident
ROA1_MOUSE - (P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) || Number of peptides = 170 || ambiguous || 99.6% Confident
Q9WTU1 - (Q9WTU1) Chromosome segregation protein SmcB || Number of peptides = 10 || ambiguous || 99.6% Confident
Q9WV02 - (Q9WV02) Heterogeneous nuclear ribonucleoprotein G (RNA binding motif protein, X chromosome) || Number of peptides = 12 || ambiguous || 99.6% Confident
Q9DBT2 - (Q9DBT2) 1200014H24Rik protein || Number of peptides = 21 || unambiguous || 99.6% Confident
HN3B_MOUSE - (P35583) Hepatocyte nuclear factor 3-beta (HNF-3B) || Number of peptides = 2 || unambiguous || 99.6% Confident
H11_MOUSE - (P43275) Histone H1.1 (H1 VAR.3) (H1A) || Number of peptides = 112 || unambiguous || 99.6% Confident
ALFA_MOUSE - (P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) || Number of peptides = 9 || unambiguous || 99.6% Confident
DDX9_MOUSE - (O70133) ATP-dependent RNA helicase A (Nuclear DNA helicase II) (NDH II) (DEAD-box protein 9) (mHEL-5) || Number of peptides = 11 || unambiguous || 99.6% Confident
RL22_MOUSE - (P41104) 60S ribosomal protein L22 (Heparin binding protein HBp15) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9D4M7 - (Q9D4M7) 4931400A14Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9CV75 - (Q9CV75) 2310008B08Rik protein (Fragment) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q9DBU4 - (Q9DBU4) RAD21 homolog (S. pombe) || Number of peptides = 5 || ambiguous || 99.6% Confident
O35737 - (O35737) Heterogeneous nuclear ribonucleoprotein H || Number of peptides = 12 || ambiguous || 99.6% Confident
O08817 - (O08817) CW17 protein || Number of peptides = 7 || unambiguous || 99.6% Confident
HMG4_MOUSE - (O54879) High mobility group protein 4 (HMG-4) (High mobility group protein 2a) (HMG-2a) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q91VL2 - (Q91VL2) Unknown (Protein for IMAGE:3669867) (Fragment) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q924H7 - (Q924H7) WAC || Number of peptides = 3 || unambiguous || 99.6% Confident
CNBP_MOUSE - (P53996) Cellular nucleic acid binding protein (CNBP) || Number of peptides = 3 || ambiguous || 99.6% Confident
CYC_MOUSE - (P00009) Cytochrome c, somatic || Number of peptides = 11 || unambiguous || 99.5% Confident
SFR3_HUMAN - (P23152) Splicing factor, arginine/serine-rich 3 (Pre-mRNA splicing factor SRP20) (X16 protein) (P23152) Splicing factor, arginine/serine-rich 3 (Pre-mRNA splicing factor SRP20) (X16 protein) || Number of peptides = 20 || ambiguous || 99.5% Confident
Q9D8X5 - (Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) || Number of peptides = 5 || ambiguous || 99.5% Confident
RS3_MOUSE - (P17073) 40S ribosomal protein S3 || Number of peptides = 4 || ambiguous || 99.5% Confident
RS10_MOUSE - (P09900) 40S ribosomal protein S10 || Number of peptides = 3 || ambiguous || 99.5% Confident
Q9NYF8 - (Q9NYF8) Bcl-2-associated transcription factor short form || Number of peptides = 10 || ambiguous || 99.5% Confident
Q9CQS2 - (Q9CQS2) 1110036B12Rik protein (Nucleolar protein family A, member 3) (H/ACA small nucleolar RNPs) || Number of peptides = 4 || ambiguous || 99.5% Confident
Q9D3V6 - (Q9D3V6) 4933432H23Rik protein || Number of peptides = 5 || unambiguous || 99.4% Confident
Q9CXT1 - (Q9CXT1) 3110009E13Rik protein || Number of peptides = 4 || ambiguous || 99.4% Confident
MAZ_MOUSE - (P56671) Myc-associated zinc finger protein (MAZI) (Purine-binding transcription factor) (Pur-1) || Number of peptides = 1 || ambiguous || 99.4% Confident
Q9CT49 - (Q9CT49) 2600011C06Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 99.4% Confident
Q8R0R6 - (Q8R0R6) Hypothetical 69.7 kDa protein || Number of peptides = 5 || ambiguous || 99.4% Confident
Q9D8D4 - (Q9D8D4) 2010005M05Rik protein || Number of peptides = 3 || ambiguous || 99.4% Confident
Q9R0R5 - (Q9R0R5) Transcription factor CA150b || Number of peptides = 6 || unambiguous || 99.4% Confident
CBX3_MOUSE - (P23198) Chromobox protein homolog 3 (Heterochromatin protein 1 homolog gamma) (HP1 gamma) (Modifier 2 protein) (M32) || Number of peptides = 7 || ambiguous || 99.4% Confident
Q9Z126 - (Q9Z126) Platelet factor 4 || Number of peptides = 3 || unambiguous || 99.4% Confident
Q923D5 - (Q923D5) Similar to Npw38-binding protein NpwBP || Number of peptides = 8 || ambiguous || 99.4% Confident
Q8R3N6 - (Q8R3N6) Similar to nuclear matrix protein p84 || Number of peptides = 4 || unambiguous || 99.4% Confident
O35638 - (O35638) SA2 nuclear protein || Number of peptides = 6 || ambiguous || 99.4% Confident
Q9CXI5 - (Q9CXI5) 3230402M22Rik protein || Number of peptides = 4 || unambiguous || 99.4% Confident
Q921T2 - (Q921T2) Unknown (Protein for MGC:6357) || Number of peptides = 3 || unambiguous || 99.4% Confident
NED4_MOUSE - (P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) || Number of peptides = 4 || unambiguous || 99.4% Confident
O55039 - (O55039) Pleiotropic regulator 1 || Number of peptides = 6 || unambiguous || 99.4% Confident
Q99LI7 - (Q99LI7) Hypothetical 82.9 kDa protein || Number of peptides = 1 || ambiguous || 99.4% Confident
Q9CT36 - (Q9CT36) 2610005B21Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 99.4% Confident
S3A3_MOUSE - (Q9D554) Splicing factor 3A subunit 3 (Spliceosome associated protein 61) (SAP 61) (SF3a60) || Number of peptides = 6 || ambiguous || 99.4% Confident
Q8R3E9 - (Q8R3E9) Similar to splicing factor, arginine/serine-rich 7 (35kD) || Number of peptides = 10 || ambiguous || 99.4% Confident
Q9CXY6 - (Q9CXY6) 6230405A16Rik protein (Interleukin enhancer binding factor 2) (Similar to interleukin enhancer binding factor 2, 45kD) || Number of peptides = 8 || ambiguous || 99.4% Confident
Q8VCF4 - (Q8VCF4) Similar to hypothetical protein FLJ13213 || Number of peptides = 7 || unambiguous || 99.4% Confident
RBMS_MOUSE - (Q9WVB0) RNA-binding protein with multiple splicing (RBP-MS) (HEart, RRM Expressed Sequence) (Hermes) || Number of peptides = 3 || ambiguous || 99.4% Confident
O35691 - (O35691) Pinin || Number of peptides = 4 || ambiguous || 99.4% Confident
MCM7_MOUSE - (Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) || Number of peptides = 7 || unambiguous || 99.4% Confident
RL1X_MOUSE - (P11249) 60S ribosomal protein L18a || Number of peptides = 3 || ambiguous || 99.4% Confident
AC15_MOUSE - (P35601) Activator 1 140 kDa subunit (Replication factor C large subunit) (A1 140 kDa subunit) (RF-C 140 kDa subunit) (Activator 1 large subunit) (A1-P145) (Differentiation specific element binding protein) (ISRE-binding protein) || Number of peptides = 3 || unambiguous || 99.4% Confident
RS16_MOUSE - (P14131) 40S ribosomal protein S16 || Number of peptides = 5 || ambiguous || 99.4% Confident
Q9CSM4 - (Q9CSM4) 60S ribosomal protein L27 (Fragment) || Number of peptides = 10 || ambiguous || 99.4% Confident
Q15424 - (Q15424) HSP27 ERE-TATA-binding protein (HET) (Scaffold attachment factor B) || Number of peptides = 2 || unambiguous || 99.4% Confident
O35851 - (O35851) P160 myb-binding protein || Number of peptides = 12 || unambiguous || 99.4% Confident
O15183 - (O15183) P20-CGGBP || Number of peptides = 6 || ambiguous || 99.4% Confident
FBL5_MOUSE - (Q9WVH9) Fibulin-5 precursor (FIBL-5) (Developmental arteries and neural crest EGF-like protein) (Dance) || Number of peptides = 2 || unambiguous || 99.4% Confident
O15042 - (O15042) Hypothetical protein KIAA0332 (Fragment) || Number of peptides = 2 || unambiguous || 99.4% Confident
Q9CYF3 - (Q9CYF3) 5730496N02Rik protein || Number of peptides = 3 || unambiguous || 99.4% Confident
Q9CQF3 - (Q9CQF3) 3110048P04Rik protein (RIKEN cDNA 3110048P04 gene) || Number of peptides = 4 || ambiguous || 99.4% Confident
SFR1_HUMAN - (Q07955) Splicing factor, arginine/serine-rich 1 (pre-mRNA splicing factor SF2, P33 subunit) (Alternative splicing factor ASF-1) || Number of peptides = 7 || unambiguous || 99.3% Confident
CGB0_HUMAN - (Q9Y3B4) Hypothetical protein CGI-110 (Protein HSPC175) || Number of peptides = 3 || unambiguous || 99.3% Confident
O88411 - (O88411) Female sterile homeotic-related protein Frg-1 || Number of peptides = 4 || ambiguous || 99.3% Confident
Q9CZX8 - (Q9CZX8) Ribosomal protein S19 || Number of peptides = 7 || ambiguous || 99.3% Confident
MCA1_MOUSE - (P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] || Number of peptides = 6 || unambiguous || 99.2% Confident
Q9CWL7 - (Q9CWL7) 2410018M14Rik protein || Number of peptides = 2 || unambiguous || 99.2% Confident
Q9CQ51 - (Q9CQ51) DNA segment, Chr 16, Wayne state University 83, expressed || Number of peptides = 3 || unambiguous || 99.2% Confident
MAT3_HUMAN - (P43243) Matrin 3 || Number of peptides = 13 || unambiguous || 99.2% Confident
Q9UQ35 - (Q9UQ35) RNA binding protein || Number of peptides = 5 || unambiguous || 99.2% Confident
RL7A_MOUSE - (P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) || Number of peptides = 5 || ambiguous || 99.2% Confident
CBX5_MOUSE - (Q61686) Chromobox protein homolog 5 (Heterochromatin protein 1 homolog alpha) (HP1 alpha) || Number of peptides = 6 || ambiguous || 99.2% Confident
Q8VEC9 - (Q8VEC9) Similar to hypothetical protein FLJ20085 || Number of peptides = 4 || unambiguous || 99.1% Confident
O55181 - (O55181) RBP associated molecule RAM14-1 || Number of peptides = 3 || unambiguous || 99.1% Confident
TF1B_MOUSE - (Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) || Number of peptides = 5 || unambiguous || 99.1% Confident
Q9Z2X1 - (Q9Z2X1) Ribonucleoprotein F || Number of peptides = 1 || ambiguous || 99.1% Confident
ACF7_MOUSE - (Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) || Number of peptides = 16 || unambiguous || 99.1% Confident
H1X_HUMAN - (Q92522) Histone H1x || Number of peptides = 3 || unambiguous || 99.1% Confident
O70495 - (O70495) Plenty-of-prolines-101 || Number of peptides = 8 || unambiguous || 99.1% Confident
Q99KP6 - (Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV) || Number of peptides = 6 || ambiguous || 99.1% Confident
U5S1_MOUSE - (O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) || Number of peptides = 4 || ambiguous || 99.1% Confident
PAB1_MOUSE - (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1) || Number of peptides = 4 || ambiguous || 99.1% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 9 || unambiguous || 99.1% Confident
G3BP_MOUSE - (P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) || Number of peptides = 8 || unambiguous || 99.1% Confident
Q9CSK8 - (Q9CSK8) 1810019E15Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 99.1% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 12 || unambiguous || 99.1% Confident
O35729 - (O35729) Polycomb-M33 interacting protein Ring1B (Fragment) || Number of peptides = 6 || unambiguous || 99.0% Confident
RS20_HUMAN - (P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 || Number of peptides = 3 || ambiguous || 98.9% Confident
Q9JIY2 - (Q9JIY2) E-cadherin binding protein E7 || Number of peptides = 4 || unambiguous || 98.9% Confident
RL2B_HUMAN - (P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a || Number of peptides = 3 || ambiguous || 98.9% Confident
TIAR_HUMAN - (Q01085) Nucleolysin TIAR (TIA-1 related protein) || Number of peptides = 3 || ambiguous || 98.8% Confident
TR2A_HUMAN - (Q13595) Transformer-2 protein homolog (TRA-2 alpha) || Number of peptides = 1 || unambiguous || 98.8% Confident
Q9D6F9 - (Q9D6F9) Tubulin, beta 4 || Number of peptides = 2 || ambiguous || 98.8% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 5 || ambiguous || 98.8% Confident
Q9H7S0 - (Q9H7S0) Hypothetical protein FLJ14329 || Number of peptides = 4 || unambiguous || 98.7% Confident
DDX5_MOUSE - (Q61656) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5) (DEAD-box RNA helicase DEAD1) (mDEAD1) || Number of peptides = 5 || ambiguous || 98.6% Confident
DD21_MOUSE - (Q9JIK5) Nucleolar RNA helicase II (Nucleolar RNA helicase Gu) (RH II/Gu) (DEAD-box protein 21) || Number of peptides = 17 || unambiguous || 98.6% Confident
O88323 - (O88323) Peroxisome proliferator-activated receptor gamma binding protein || Number of peptides = 8 || unambiguous || 98.6% Confident
Q9D115 - (Q9D115) 3110006P09Rik protein || Number of peptides = 1 || ambiguous || 98.6% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 2 || unambiguous || 98.6% Confident
NO56_MOUSE - (Q9D6Z1) Nucleolar protein Nop56 (Nucleolar protein 5A) || Number of peptides = 4 || unambiguous || 98.5% Confident
RS11_HUMAN - (P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11 || Number of peptides = 5 || ambiguous || 98.5% Confident
RS29_HUMAN - (P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 || Number of peptides = 1 || ambiguous || 98.5% Confident
RS26_HUMAN - (P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26 || Number of peptides = 4 || ambiguous || 98.5% Confident
Q99JM0 - (Q99JM0) Hypothetical 94.0 kDa protein (Fragment) || Number of peptides = 2 || ambiguous || 98.4% Confident
O70565 - (O70565) Cp27 protein || Number of peptides = 3 || ambiguous || 98.4% Confident
NPM3_MOUSE - (Q9CPP0) Nucleoplasmin 3 || Number of peptides = 3 || ambiguous || 98.4% Confident
Q9QYF4 - (Q9QYF4) SYNCRIP protein || Number of peptides = 5 || ambiguous || 98.3% Confident
Q9UDV1 - (Q9UDV1) WUGSC:H_DJ0900K19.2 protein || Number of peptides = 2 || unambiguous || 98.2% Confident
DD17_HUMAN - (Q92841) Probable RNA-dependent helicase p72 (DEAD-box protein p72) (DEAD-box protein 17) || Number of peptides = 12 || unambiguous || 98.2% Confident
Q9CSW7 - (Q9CSW7) 2610101N10Rik protein (Fragment) || Number of peptides = 6 || ambiguous || 98.1% Confident
O88574 - (O88574) SIN3-associated protein (Cyclin-dependent kinase 2) || Number of peptides = 2 || unambiguous || 98.0% Confident
ATF7_HUMAN - (P17544) Cyclic-AMP-dependent transcription factor ATF-7 (Activating transcription factor 7) (Transcription factor ATF-A) || Number of peptides = 4 || ambiguous || 98.0% Confident
DP30_MOUSE - (Q99LT0) Dpy-30-like protein || Number of peptides = 2 || ambiguous || 97.9% Confident
Q922Q8 - (Q922Q8) Similar to hypothetical protein PRO1855 || Number of peptides = 1 || unambiguous || 97.9% Confident
EBP2_MOUSE - (Q9D903) Probable rRNA processing protein EBP2 || Number of peptides = 2 || unambiguous || 97.9% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 13 || ambiguous || 97.9% Confident
Q9CYA6 - (Q9CYA6) 5730565F05Rik protein || Number of peptides = 6 || ambiguous || 97.8% Confident
Q16670 - (Q16670) SRE-ZBP protein (Fragment) || Number of peptides = 1 || unambiguous || 97.7% Confident
Q8VDM6 - (Q8VDM6) Similar to E1B-55 kDa-associated protein 5 || Number of peptides = 6 || unambiguous || 97.7% Confident
Q9CTD4 - (Q9CTD4) 6030455P07Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 97.7% Confident
Q12828 - (Q12828) FUSE binding protein || Number of peptides = 1 || unambiguous || 97.6% Confident
FBN1_MOUSE - (Q61554) Fibrillin 1 precursor || Number of peptides = 2 || ambiguous || 97.6% Confident
Q91YQ5 - (Q91YQ5) Similar to ribophorin I || Number of peptides = 1 || unambiguous || 97.6% Confident
Q8R2K0 - (Q8R2K0) Similar to CG2974 gene product (H. sapiens) (Fragment) || Number of peptides = 1 || unambiguous || 97.5% Confident
HMGT_MOUSE - (P40630) Testis-specific high mobility group protein (TS-HMG) || Number of peptides = 2 || ambiguous || 97.3% Confident
P70333 - (P70333) Heterogeneous nuclear ribonucleoprotein H' (hnRNP H') (FTP-3) || Number of peptides = 3 || ambiguous || 97.2% Confident
EBP2_HUMAN - (Q99848) Probable rRNA processing protein EBP2 (EBNA1 binding protein 2) (Nucleolar protein p40) || Number of peptides = 1 || unambiguous || 97.2% Confident
Q9Z162 - (Q9Z162) Vascular endothelial zinc finger 1 || Number of peptides = 2 || unambiguous || 97.1% Confident
Q9DBB2 - (Q9DBB2) 1300019H17Rik protein || Number of peptides = 6 || ambiguous || 97.0% Confident
Q8VDJ3 - (Q8VDJ3) Similar to lipoprotein-binding protein (Expressed sequence AA960365) || Number of peptides = 6 || unambiguous || 97.0% Confident
COXG_MOUSE - (P56391) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1) (AED) || Number of peptides = 2 || ambiguous || 97.0% Confident
TTF1_MOUSE - (P50220) Thyroid transcription factor 1 (Thyroid nuclear factor 1) (TTF-1) (Homeobox protein NKX-2.1) || Number of peptides = 3 || ambiguous || 97.0% Confident
RL44_HUMAN - (P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a) || Number of peptides = 1 || ambiguous || 96.9% Confident
MPK4_MOUSE - (P47809) Dual specificity mitogen-activated protein kinase kinase 4 (EC 2.7.1.-) (MAP kinase kinase 4) (MAPKK 4) (MAPK/ERK kinase 4) (JNK activating kinase 1) (C-JUN N-terminal kinase kinase 1) (JNK kinase 1) (JNKK 1) (SAPK/ERK kinase 1) (SEK1) || Number of peptides = 3 || unambiguous || 96.7% Confident
DYL1_HUMAN - (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) || Number of peptides = 2 || ambiguous || 96.5% Confident
RL23_HUMAN - (P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) || Number of peptides = 3 || ambiguous || 96.5% Confident
Q9UJV1 - (Q9UJV1) MG81 protein (Fragment) || Number of peptides = 2 || ambiguous || 96.5% Confident
Q9BRZ1 - (Q9BRZ1) Similar to RIKEN cDNA 2410015A15 gene || Number of peptides = 11 || ambiguous || 96.4% Confident
GTFI_MOUSE - (Q9ESZ8) General transcription factor II-I (GTFII-I) (TFII-I) (Bruton tyrosine kinase-associated protein-135) (BTK-associated protein-135) (BAP-135) || Number of peptides = 8 || ambiguous || 96.4% Confident
Q9BZB4 - (Q9BZB4) IL-5 promoter REII-region-binding protein || Number of peptides = 4 || ambiguous || 96.2% Confident
Q9DCA5 - (Q9DCA5) 1110064N10Rik protein || Number of peptides = 3 || ambiguous || 96.2% Confident
Q9JJ89 - (Q9JJ89) Brain cDNA, clone MNCb-4327 (Fragment) || Number of peptides = 3 || unambiguous || 96.1% Confident
Q9BY44 - (Q9BY44) CDA02 || Number of peptides = 1 || unambiguous || 96.0% Confident
Q9D0K3 - (Q9D0K3) 2610008M13Rik protein || Number of peptides = 1 || ambiguous || 95.9% Confident
Q8VCD2 - (Q8VCD2) Similar to protein with polyglutamine repeat, calcium (ca2+) homeostasis endoplasmic reticulum protein || Number of peptides = 3 || unambiguous || 95.9% Confident
LMA3_HUMAN - (Q16787) Laminin alpha-3 chain precursor (Epiligrin 170 kDa subunit) (E170) (Nicein alpha subunit) || Number of peptides = 4 || unambiguous || 95.9% Confident
Q9Z1R9 - (Q9Z1R9) Trypsinogen 16 || Number of peptides = 2 || ambiguous || 95.6% Confident
RS5_MOUSE - (P97461) 40S ribosomal protein S5 || Number of peptides = 5 || unambiguous || 95.6% Confident
Q8VE37 - (Q8VE37) Similar to chromosome condensation 1 || Number of peptides = 3 || unambiguous || 95.5% Confident
TRAB_HUMAN - (Q9UGI0) TRABID protein || Number of peptides = 1 || unambiguous || 95.5% Confident
RS8_HUMAN - (P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8 || Number of peptides = 2 || ambiguous || 95.4% Confident
Q9BVZ8 - (Q9BVZ8) Similar to CG8054 gene product || Number of peptides = 1 || unambiguous || 95.4% Confident
Q922B8 - (Q922B8) Similar to DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1 || Number of peptides = 3 || ambiguous || 95.4% Confident
Q96PV9 - (Q96PV9) Hypothetical protein KIAA1929 (Fragment) || Number of peptides = 1 || unambiguous || 95.2% Confident
Q9BUT9 - (Q9BUT9) Hypothetical protein (Fragment) || Number of peptides = 6 || unambiguous || 95.1% Confident
Q9D3U4 - (Q9D3U4) 4933434H11Rik protein || Number of peptides = 3 || ambiguous || 95.0% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 4 || unambiguous || 95.0% Confident
Q9CYI4 - (Q9CYI4) 2410018D03Rik protein || Number of peptides = 1 || ambiguous || 95.0% Confident
Q9DBC2 - (Q9DBC2) Adult male liver cDNA, RIKEN full-length enriched library, clone:1300018I14, full insert sequence || Number of peptides = 1 || ambiguous || 94.9% Confident
Q9DCX3 - (Q9DCX3) 0610009C03Rik protein || Number of peptides = 5 || ambiguous || 94.9% Confident
HDGF_MOUSE - (P51859) Hepatoma-derived growth factor (HDGF) || Number of peptides = 6 || unambiguous || 94.9% Confident
O75939 - (O75939) 45kDa splicing factor || Number of peptides = 4 || unambiguous || 94.9% Confident
Q9D5P9 - (Q9D5P9) 4930402F02Rik protein || Number of peptides = 1 || ambiguous || 94.9% Confident
Q9CSV0 - (Q9CSV0) 2610209M04Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 94.9% Confident
XPC_MOUSE - (P51612) DNA-repair protein complementing XP-C cells homolog (Xeroderma pigmentosum group C complementing protein homolog) (P125) || Number of peptides = 4 || unambiguous || 94.9% Confident
Q99PV0 - (Q99PV0) Pre-mRNA processing 8 protein || Number of peptides = 7 || unambiguous || 94.8% Confident
Q9CW46 - (Q9CW46) 1300006N24Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 94.7% Confident
FBN2_MOUSE - (Q61555) Fibrillin 2 precursor || Number of peptides = 12 || unambiguous || 94.5% Confident
U520_HUMAN - (O75643) U5 small nuclear ribonucleoprotein 200 kDa helicase (U5 snRNP-specific 200 kDa protein) (U5-200KD) (Fragment) || Number of peptides = 2 || ambiguous || 94.5% Confident
Q9R126 - (Q9R126) Ribonuclease 7 precursor (Eosinophil-associated ribonuclease 7) (Fragment) || Number of peptides = 2 || ambiguous || 94.4% Confident
Q9D795 - (Q9D795) C130020J04Rik protein || Number of peptides = 2 || unambiguous || 94.4% Confident
Q925M9 - (Q925M9) DNA-dependent ATPase SNF2H || Number of peptides = 8 || ambiguous || 94.4% Confident
SAP_HUMAN - (P07602) Proactivator polypeptide precursor [Contains: Saposin A (Protein A); Saposin B (Sphingolipid activator protein 1) (SAP-1) (Cerebroside sulfate activator) (CSAct) (Dispersin) (Sulfatide/GM1 activator); Saposin C (Co-beta-glucosidase) (A1 activator) (Glucosylceramidase activator) (Sphingolipid activator protein 2) (SAP-2); Saposin D (Protein C) (Component C)] || Number of peptides = 8 || unambiguous || 94.4% Confident
Q9Y2S6 - (Q9Y2S6) HSPC016 protein (Hypothetical protein) || Number of peptides = 3 || unambiguous || 94.2% Confident
U123_HUMAN - (Q9UH06) Hypothetical protein BK223H9.2/MGC1346 (Q9UH06) Hypothetical protein BK223H9.2/MGC1346 || Number of peptides = 3 || ambiguous || 94.1% Confident
Q8VDL0 - (Q8VDL0) Hypothetical 53.8 kDa protein || Number of peptides = 1 || unambiguous || 93.9% Confident
PDX2_MOUSE - (Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) || Number of peptides = 2 || unambiguous || 93.9% Confident
PR17_MOUSE - (Q9DC48) Pre-mRNA splicing factor PRP17 || Number of peptides = 2 || ambiguous || 93.9% Confident
CYPE_MOUSE - (Q9QZH3) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) (Fragment) || Number of peptides = 2 || ambiguous || 93.8% Confident
MCM3_MOUSE - (P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) || Number of peptides = 6 || unambiguous || 93.6% Confident
TLR4_HUMAN - (O00206) Toll-like receptor 4 precursor (hToll) || Number of peptides = 1 || unambiguous || 93.4% Confident
GBLP_HUMAN - (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) || Number of peptides = 4 || ambiguous || 93.3% Confident
Q96KM6 - (Q96KM6) DJ591C20.5 (Hypothetical protein KIAA1196) || Number of peptides = 2 || unambiguous || 93.2% Confident
Q8VDW0 - (Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family || Number of peptides = 7 || ambiguous || 93.1% Confident
O75984 - (O75984) DJ1189B24.4 (Novel putative protein similar to hypothetical proteins S. pombe C22F3.14C and C. elegans C16A3.8) (Fragment) || Number of peptides = 4 || unambiguous || 93.1% Confident
Q9D2N0 - (Q9D2N0) 4632409L19Rik protein || Number of peptides = 1 || unambiguous || 92.6% Confident
HXB4_MOUSE - (P10284) Homeobox protein Hox-B4 (Hox-2.6) || Number of peptides = 1 || ambiguous || 92.6% Confident
Q9D9X2 - (Q9D9X2) Ly1 antibody reactive clone || Number of peptides = 2 || unambiguous || 92.4% Confident
Q925I6 - (Q925I6) MacroH2A2 || Number of peptides = 2 || ambiguous || 92.3% Confident
Q9UPT8 - (Q9UPT8) Hypothetical protein KIAA1064 (Fragment) || Number of peptides = 8 || unambiguous || 92.3% Confident
GGT1_HUMAN - (P19440) Gamma-glutamyltranspeptidase 1 precursor (EC 2.3.2.2) (Gamma-glutamyltransferase 1) (CD224 antigen) || Number of peptides = 1 || unambiguous || 92.2% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 5 || ambiguous || 92.2% Confident
RL29_MOUSE - (P47915) 60S ribosomal protein L29 || Number of peptides = 6 || unambiguous || 92.2% Confident
Q9D6B8 - (Q9D6B8) 2410084F24Rik protein || Number of peptides = 6 || ambiguous || 92.0% Confident
EWS_MOUSE - (Q61545) RNA-binding protein EWS || Number of peptides = 3 || ambiguous || 92.0% Confident
ITB1_MOUSE - (P09055) Integrin beta-1 precursor (Fibronectin receptor beta subunit) (CD29 antigen) (Integrin VLA-4 beta subunit) || Number of peptides = 3 || unambiguous || 91.8% Confident
Q8R4A0 - (Q8R4A0) Translocated promoter region protein (Fragment) || Number of peptides = 6 || unambiguous || 91.4% Confident
Q9CYQ4 - (Q9CYQ4) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810486E17, full insert sequence || Number of peptides = 2 || ambiguous || 91.2% Confident
Q9BT23 - (Q9BT23) Hypothetical protein || Number of peptides = 1 || unambiguous || 91.1% Confident
Q92585 - (Q92585) Hypothetical protein KIAA0200 || Number of peptides = 3 || unambiguous || 91.1% Confident
RRS1_MOUSE - (Q9CYH6) Ribosome biogenesis regulatory protein homolog || Number of peptides = 3 || unambiguous || 91.0% Confident
ZF95_HUMAN - (Q9Y2L8) Zinc finger protein Zfp-95 || Number of peptides = 6 || unambiguous || 90.9% Confident
Q9JHJ3 - (Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) || Number of peptides = 4 || unambiguous || 90.9% Confident
O75940 - (O75940) 30 kDa splicing factor (Similar to splicing factor 30, survival of motor neuron-related) || Number of peptides = 2 || unambiguous || 90.7% Confident
O88635 - (O88635) Serine/threonine protein kinase 51PK(S) || Number of peptides = 3 || ambiguous || 90.6% Confident
HP28_HUMAN - (Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) || Number of peptides = 2 || unambiguous || 90.5% Confident
RL31_HUMAN - (P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31 || Number of peptides = 2 || ambiguous || 90.4% Confident
AHNK_HUMAN - (Q09666) Neuroblast differentiation associated protein AHNAK (Desmoyokin) (Fragments) || Number of peptides = 7 || unambiguous || 90.3% Confident
Q9D6J3 - (Q9D6J3) 2900016D05Rik protein || Number of peptides = 1 || unambiguous || 89.8% Confident
Q9NVE7 - (Q9NVE7) Hypothetical protein FLJ10782 || Number of peptides = 2 || unambiguous || 89.7% Confident
Q8R5C8 - (Q8R5C8) Similar to adenovirus 5 E1A binding protein || Number of peptides = 5 || ambiguous || 89.7% Confident
NUKS_HUMAN - (Q9H1E3) Nuclear ubiquitous casein and cyclin-dependent kinases substrate || Number of peptides = 1 || unambiguous || 89.6% Confident
Q8TAQ2 - (Q8TAQ2) Similar to SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 || Number of peptides = 5 || ambiguous || 89.5% Confident
Q9CY66 - (Q9CY66) C430047J18Rik protein || Number of peptides = 4 || unambiguous || 89.4% Confident
Q99MQ0 - (Q99MQ0) Histone acetylase complex subunit MRG15-2 || Number of peptides = 4 || unambiguous || 88.8% Confident
Q8VE87 - (Q8VE87) Similar to hypothetical protein FLJ11294 (Fragment) || Number of peptides = 6 || unambiguous || 88.6% Confident
ARS2_MOUSE - (Q99MR6) Arsenite-resistance protein 2 || Number of peptides = 6 || ambiguous || 88.2% Confident
DDX3_MOUSE - (Q62167) DEAD-box protein 3 (DEAD-box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1PAS1 related sequence 2) || Number of peptides = 2 || unambiguous || 88.1% Confident
RB56_HUMAN - (Q92804) TATA-binding protein associated factor 2N (RNA-binding protein 56) (TAFII68) (TAF(II)68) || Number of peptides = 6 || unambiguous || 87.9% Confident
Q96EL3 - (Q96EL3) Similar to RIKEN cDNA 1110007K17 gene || Number of peptides = 5 || unambiguous || 87.8% Confident
SUI1_MOUSE - (P48024) Protein translation factor SUI1 homolog || Number of peptides = 1 || ambiguous || 87.8% Confident
O35841 - (O35841) Apoptosis inhibitory protein 5 || Number of peptides = 4 || ambiguous || 87.8% Confident
Q96AE5 - (Q96AE5) HSPC049 protein || Number of peptides = 1 || ambiguous || 87.7% Confident
Q9CQB3 - (Q9CQB3) 1600025E09Rik protein || Number of peptides = 3 || unambiguous || 87.7% Confident
RS1A_HUMAN - (P39027) 40S ribosomal protein S15a || Number of peptides = 1 || unambiguous || 87.6% Confident
APOH_MOUSE - (Q01339) Beta-2-glycoprotein I precursor (Apolipoprotein H) (Apo-H) (B2GPI) (Beta(2)GPI) (Activated protein C-binding protein) (APC inhibitor) || Number of peptides = 3 || unambiguous || 87.4% Confident
Q9CT27 - (Q9CT27) 2610015J01Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 87.1% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 8 || ambiguous || 86.8% Confident
DM3A_MOUSE - (O88508) DNA (cytosine-5)-methyltransferase 3A (EC 2.1.1.37) (Dnmt3a) (DNA methyltransferase MmuIIIA) (DNA MTase MmuIIIA) (M.MmuIIIA) || Number of peptides = 4 || unambiguous || 86.0% Confident
O70200 - (O70200) Allograft inflammatory factor-1 (Ionized calcium binding adapter molecule 1) (Allograft inflammatory factor 1) || Number of peptides = 1 || unambiguous || 86.0% Confident
NU50_MOUSE - (Q9JIH2) Nucleoporin 50 kDa (Nuclear pore-associated protein 60 kDa-like) || Number of peptides = 6 || unambiguous || 85.9% Confident
CHD4_HUMAN - (Q14839) Chromodomain helicase-DNA-binding protein 4 (CHD-4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta) || Number of peptides = 6 || unambiguous || 85.5% Confident
Q8VHY2 - (Q8VHY2) H+,K+-ATPase alpha 2 subunit || Number of peptides = 9 || unambiguous || 85.0% Confident
PR4H_MOUSE - (Q61136) Serine/threonine-protein kinase PRP4 homolog (EC 2.7.1.37) || Number of peptides = 2 || ambiguous || 84.8% Confident
O95639 - (O95639) No arches || Number of peptides = 1 || ambiguous || 84.8% Confident
PPOL_MOUSE - (P11103) Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30) (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1) (Poly[ADP-ribose] synthetase-1) (msPARP) || Number of peptides = 8 || ambiguous || 84.8% Confident
O88558 - (O88558) SHYC || Number of peptides = 3 || ambiguous || 84.4% Confident
RFA2_MOUSE - (Q62193) Replication protein A 32 kDa subunit (RP-A) (RF-A) (Replication factor-A protein 2) || Number of peptides = 3 || unambiguous || 84.3% Confident
Q99KC3 - (Q99KC3) Hypothetical 46.8 kDa protein || Number of peptides = 4 || ambiguous || 84.2% Confident
Q8R3G1 - (Q8R3G1) Similar to protein phosphatase 1, regulatory (Inhibitor) subunit 8 || Number of peptides = 4 || ambiguous || 84.2% Confident
Q60520 - (Q60520) Paired amphipathic helix protein SIN3A || Number of peptides = 6 || unambiguous || 84.1% Confident
RS15_HUMAN - (P11174) 40S ribosomal protein S15 (RIG protein) (P11174) 40S ribosomal protein S15 (RIG protein) || Number of peptides = 1 || ambiguous || 83.9% Confident
Q9D1I8 - (Q9D1I8) 2610203K23Rik protein || Number of peptides = 5 || ambiguous || 83.4% Confident
MYH6_MOUSE - (Q02566) Myosin heavy chain, cardiac muscle alpha isoform (MyHC-alpha) || Number of peptides = 8 || ambiguous || 83.4% Confident
Q9WTU0 - (Q9WTU0) PHD-finger protein || Number of peptides = 2 || ambiguous || 83.3% Confident
O70279 - (O70279) ES2 protein || Number of peptides = 1 || unambiguous || 82.8% Confident
HG17_MOUSE - (P09602) Nonhistone chromosomal protein HMG-17 || Number of peptides = 1 || ambiguous || 82.8% Confident
O75139 - (O75139) Hypothetical protein KIAA0644 || Number of peptides = 5 || unambiguous || 82.8% Confident
Q9CWX9 - (Q9CWX9) 4930588A18Rik protein || Number of peptides = 5 || unambiguous || 82.4% Confident
Q9JII1 - (Q9JII1) Inositol polyphosphate 5-phosphatase || Number of peptides = 4 || unambiguous || 82.4% Confident
Q9D9V1 - (Q9D9V1) 4921506I22Rik protein || Number of peptides = 1 || ambiguous || 82.3% Confident
Q96PU4 - (Q96PU4) Np95-like ring finger protein || Number of peptides = 4 || unambiguous || 82.3% Confident
Q9BWF3 - (Q9BWF3) RNA binding motif protein 4 || Number of peptides = 1 || ambiguous || 82.3% Confident
RS4_HUMAN - (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) || Number of peptides = 3 || ambiguous || 82.1% Confident
SKIP_HUMAN - (Q13573) Nuclear protein SkiP (Ski-interacting protein) (SNW1 protein) (Nuclear receptor coactivator NCoA-62) || Number of peptides = 5 || unambiguous || 82.0% Confident
Z236_HUMAN - (Q9UL36) Zinc finger protein 236 || Number of peptides = 1 || unambiguous || 82.0% Confident
Q8WWT4 - (Q8WWT4) RNA-binding protein splice variant a || Number of peptides = 2 || ambiguous || 82.0% Confident
Q9QYY5 - (Q9QYY5) MTAFII30 protein || Number of peptides = 2 || unambiguous || 82.0% Confident
PLD2_MOUSE - (P97813) Phospholipase D2 (EC 3.1.4.4) (PLD 2) (Choline phosphatase 2) (Phosphatidylcholine-hydrolyzing phospholipase D2) (PLD1C) (mPLD2) || Number of peptides = 4 || unambiguous || 81.8% Confident
Q9CZ17 - (Q9CZ17) 2810417H13Rik protein || Number of peptides = 1 || ambiguous || 81.8% Confident
LAMA_MOUSE - (P48678) Lamin A || Number of peptides = 2 || ambiguous || 81.5% Confident
Q96I05 - (Q96I05) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 81.4% Confident
Q91YR7 - (Q91YR7) Hypothetical 106.7 kDa protein || Number of peptides = 6 || unambiguous || 81.2% Confident
HS47_HUMAN - (P29043) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Colligin 1) || Number of peptides = 3 || ambiguous || 81.2% Confident
Q91XD4 - (Q91XD4) Similar to formiminotransferase cyclodeaminase || Number of peptides = 20 || unambiguous || 81.1% Confident
Q8TDT3 - (Q8TDT3) Putative G-protein coupled receptor || Number of peptides = 1 || unambiguous || 81.1% Confident
Q91YJ1 - (Q91YJ1) Hypothetical 29.5 kDa protein || Number of peptides = 2 || unambiguous || 81.1% Confident
Q8VCV8 - (Q8VCV8) Hypothetical 45.3 kDa protein || Number of peptides = 1 || ambiguous || 80.7% Confident
Q9NYI6 - (Q9NYI6) Mesenchymal stem cell protein DSC43 (Similar to mesenchymal stem cell protein DSC43) || Number of peptides = 1 || ambiguous || 80.5% Confident
Q91YX0 - (Q91YX0) Hypothetical 74.5 kDa protein (Fragment) || Number of peptides = 3 || unambiguous || 80.2% Confident
HTF4_MOUSE - (Q61286) Transcription factor 12 (Transcription factor HTF-4) (E-box-binding protein) (DNA-binding protein HTF4) (Class A helix-loop-helix transcription factor ME1) || Number of peptides = 1 || unambiguous || 80.1% Confident
HD_HUMAN - (P42858) Huntingtin (Huntington's disease protein) (HD protein) || Number of peptides = 22 || unambiguous || 80.1% Confident
P97868 - (P97868) Retinoblastoma binding protein 6 (Proliferation potential-related protein) (P53-associated cellular protein) (PACT) || Number of peptides = 6 || unambiguous || 79.9% Confident
Q9DCB7 - (Q9DCB7) 3100001N19Rik protein || Number of peptides = 1 || ambiguous || 79.8% Confident
LRP1_HUMAN - (Q07954) Low-density lipoprotein receptor-related protein 1 precursor (LRP) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD91) || Number of peptides = 6 || unambiguous || 79.8% Confident
Q96RE7 - (Q96RE7) NAC1 protein || Number of peptides = 4 || unambiguous || 79.7% Confident
Q9CVU9 - (Q9CVU9) 1700027L20Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 79.6% Confident
CAB5_MOUSE - (Q9JLK3) Calcium-binding protein CaBP5 || Number of peptides = 5 || unambiguous || 79.6% Confident
RP1_MOUSE - (P56716) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein homolog) || Number of peptides = 8 || unambiguous || 79.4% Confident
Q921K2 - (Q921K2) Similar to ADP-ribosyltransferase (NAD+, poly (ADP-ribose) polymerase) || Number of peptides = 3 || unambiguous || 78.8% Confident
TE2I_MOUSE - (Q91VL8) Telomeric repeat binding factor 2 interacting protein 1 (TRF2-interacting telomeric protein Rap1) || Number of peptides = 2 || unambiguous || 78.5% Confident
Q9CXA2 - (Q9CXA2) 2810055F11Rik protein || Number of peptides = 2 || unambiguous || 78.4% Confident
Q9R190 - (Q9R190) Metastasis associated protein MTA2 (Mta2 protein) || Number of peptides = 3 || unambiguous || 78.3% Confident
Q9NNY3 - (Q9NNY3) Ribosomal protein L18a || Number of peptides = 1 || unambiguous || 78.2% Confident
BTF3_MOUSE - (Q64152) Transcription factor BTF3 (RNA polymerase B transcription factor 3) || Number of peptides = 2 || unambiguous || 78.1% Confident
SY19_HUMAN - (Q99731) Small inducible cytokine A19 precursor (CCL19) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (EBI1-ligand chemokine) (ELC) (Beta chemokine exodus-3) (CK beta-11) || Number of peptides = 1 || unambiguous || 77.9% Confident
DIA1_HUMAN - (O60610) Diaphanous protein homolog 1 (Diaphanous-related formin 1) (DRF1) || Number of peptides = 16 || unambiguous || 77.6% Confident
RL9_MOUSE - (P51410) 60S ribosomal protein L9 || Number of peptides = 1 || ambiguous || 77.6% Confident
G10_HUMAN - (P41223) G10 protein homolog (EDG-2) || Number of peptides = 1 || ambiguous || 77.3% Confident
Q924Z6 - (Q924Z6) RANBP20 || Number of peptides = 2 || ambiguous || 77.1% Confident
Q9DAW6 - (Q9DAW6) 1600015H11Rik protein || Number of peptides = 2 || ambiguous || 77.0% Confident
ALS_MOUSE - (P70389) Insulin-like growth factor binding protein complex acid labile chain precursor (ALS) || Number of peptides = 1 || unambiguous || 76.3% Confident
O88624 - (O88624) ETOILE || Number of peptides = 2 || ambiguous || 76.0% Confident
Q96PW5 - (Q96PW5) Hypothetical protein KIAA1923 (Fragment) || Number of peptides = 5 || unambiguous || 75.9% Confident
RL24_HUMAN - (P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30) || Number of peptides = 1 || ambiguous || 75.8% Confident
Q61164 - (Q61164) 11-zinc-finger transcription factor || Number of peptides = 5 || ambiguous || 75.6% Confident
POR1_MOUSE - (Q60932) Voltage-dependent anion-selective channel protein 1 (VDAC-1) (mVDAC1) (mVDAC5) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) || Number of peptides = 3 || ambiguous || 75.4% Confident
Q14673 - (Q14673) Hypothetical protein KIAA0164 (BK211L9.1) || Number of peptides = 2 || unambiguous || 75.1% Confident
RL10_MOUSE - (P45634) 60S ribosomal protein L10 (QM protein homolog) || Number of peptides = 4 || ambiguous || 74.7% Confident
Q9CQX8 - (Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) || Number of peptides = 2 || unambiguous || 74.6% Confident
Q925F2 - (Q925F2) Endothelial cell-selective adhesion molecule || Number of peptides = 1 || unambiguous || 73.9% Confident
KLFC_MOUSE - (O35738) Krueppel-like factor 12 (Transcriptional repressor AP-2rep) || Number of peptides = 2 || unambiguous || 73.8% Confident
Q9UEF7 - (Q9UEF7) Klotho protein || Number of peptides = 2 || unambiguous || 73.7% Confident
Q8TF52 - (Q8TF52) Hypothetical protein KIAA1949 (Fragment) || Number of peptides = 4 || unambiguous || 73.7% Confident
Q92888 - (Q92888) Guanine nucleotide exchange factor p115-RhoGEF || Number of peptides = 1 || unambiguous || 73.4% Confident
Q9BXT5 - (Q9BXT5) TEX15 || Number of peptides = 9 || unambiguous || 73.1% Confident
K1CJ_MOUSE - (P02535) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (56 kDa cytokeratin) (Keratin, type I cytoskeletal 59 kDa) || Number of peptides = 1 || ambiguous || 73.1% Confident
Q99JN6 - (Q99JN6) Similar to KIAA0663 gene product || Number of peptides = 7 || unambiguous || 72.9% Confident
Q92946 - (Q92946) FUSE binding protein 3 (Fragment) || Number of peptides = 6 || ambiguous || 72.9% Confident
UBPD_HUMAN - (Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15) (Ubiquitin thiolesterase 13) (Ubiquitin-specific processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) || Number of peptides = 5 || unambiguous || 72.8% Confident
Q9D7J2 - (Q9D7J2) 2310006I24Rik protein || Number of peptides = 1 || ambiguous || 71.9% Confident
HH1R_HUMAN - (P35367) Histamine H1 receptor || Number of peptides = 1 || unambiguous || 71.3% Confident
AP1_MOUSE - (P05627) Transcription factor AP-1 (Activator protein 1) (AP1) (Proto-oncogene c-jun) (V-jun avian sarcoma virus 17 oncogene homolog) (Jun A) (AH119) || Number of peptides = 2 || ambiguous || 70.9% Confident
Q91YJ3 - (Q91YJ3) Similar to HSPC144 protein || Number of peptides = 1 || unambiguous || 70.8% Confident
Q9D3E2 - (Q9D3E2) 5830446M03Rik protein || Number of peptides = 2 || ambiguous || 70.4% Confident
Q9H6N8 - (Q9H6N8) Hypothetical protein FLJ22032 || Number of peptides = 1 || ambiguous || 70.2% Confident
CH60_MOUSE - (P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65) || Number of peptides = 3 || unambiguous || 70.0% Confident
Q9BYE2 - (Q9BYE2) Membrane-type mosaic serine protease || Number of peptides = 2 || unambiguous || 69.1% Confident
O15054 - (O15054) Hypothetical protein KIAA0346 (Fragment) || Number of peptides = 3 || unambiguous || 69.1% Confident
Q99M33 - (Q99M33) Src associated in mitosis, 68 kDa || Number of peptides = 1 || unambiguous || 69.0% Confident
SOA2_MOUSE - (O88908) Sterol O-acyltransferase 2 (EC 2.3.1.26) (Cholesterol acyltransferase 2) (Acyl coenzyme A:cholesterol acyltransferase 2) (ACAT-2) || Number of peptides = 3 || unambiguous || 68.3% Confident
Q9JL35 - (Q9JL35) Nucleosome binding protein 1 (Nucleosome binding protein 45) (NBP-45) (GARP45 protein) || Number of peptides = 5 || ambiguous || 68.3% Confident
ACHG_MOUSE - (P04760) Acetylcholine receptor protein, gamma chain precursor || Number of peptides = 1 || unambiguous || 68.1% Confident
Q14748 - (Q14748) LFA-3(delta D2) (Fragment) || Number of peptides = 1 || unambiguous || 68.0% Confident
Q9Y4F4 - (Q9Y4F4) Hypothetical protein KIAA0423 (Fragment) || Number of peptides = 4 || unambiguous || 67.9% Confident
Q9CWV1 - (Q9CWV1) 5730432L01Rik protein || Number of peptides = 3 || unambiguous || 67.9% Confident
ATPB_MOUSE - (P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 5 || ambiguous || 67.8% Confident
Q9H1B7 - (Q9H1B7) Polyglutamine-containing protein || Number of peptides = 3 || unambiguous || 67.8% Confident
MCM6_MOUSE - (P97311) DNA replication licensing factor MCM6 (Mis5 homolog) || Number of peptides = 4 || unambiguous || 67.7% Confident
Q920D3 - (Q920D3) FKSG20 || Number of peptides = 3 || ambiguous || 67.1% Confident
Q9CT41 - (Q9CT41) 2600017A12Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 67.1% Confident
Q9EPV8 - (Q9EPV8) Ubiquitin-like 5 (Beacon) (1110030M22Rik protein) || Number of peptides = 2 || ambiguous || 67.1% Confident
Q8WYK1 - (Q8WYK1) Caspr5 || Number of peptides = 6 || unambiguous || 67.1% Confident
BRC2_MOUSE - (P97929) Breast cancer type 2 susceptibility protein || Number of peptides = 10 || unambiguous || 67.1% Confident
Q9NVE3 - (Q9NVE3) Hypothetical protein FLJ10787 (Fragment) || Number of peptides = 4 || unambiguous || 67.1% Confident
OPA1_MOUSE - (P58281) Dynamin-like 120 kDa protein, mitochondrial precursor (Large GTP binding protein) (LargeG) || Number of peptides = 2 || ambiguous || 67.1% Confident
EAA2_MOUSE - (P43006) Excitatory amino acid transporter 2 (Sodium-dependent glutamate/aspartate transporter 2) (GLT-1) || Number of peptides = 4 || unambiguous || 67.1% Confident
Z148_MOUSE - (Q61624) Zinc finger protein 148 (Zinc finger DNA binding protein 89) (Transcription factor ZBP-89) (G-rich box-binding protein) (Beta enolase repressor factor 1) (Transcription factor BFCOL1) || Number of peptides = 3 || ambiguous || 67.1% Confident
Q8TDZ0 - (Q8TDZ0) SKP2-like protein type gamma || Number of peptides = 3 || unambiguous || 67.1% Confident
Q8VE36 - (Q8VE36) Similar to hypothetical protein DKFZp586J1119 (Fragment) || Number of peptides = 1 || ambiguous || 67.0% Confident
Q9D0D4 - (Q9D0D4) 1500031M22Rik protein (RIKEN cDNA 1500031M22 gene) || Number of peptides = 4 || unambiguous || 67.0% Confident
Q9R1C7 - (Q9R1C7) Formin binding protein 11 || Number of peptides = 5 || unambiguous || 66.8% Confident
GBB3_HUMAN - (P16520) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain 3) || Number of peptides = 2 || unambiguous || 66.8% Confident
Q8TEV0 - (Q8TEV0) BRG1-binding protein ELD/OSA1 || Number of peptides = 2 || unambiguous || 66.5% Confident
Q9CS92 - (Q9CS92) 5730406M06Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 66.5% Confident
O94851 - (O94851) Hypothetical protein KIAA0750 || Number of peptides = 7 || unambiguous || 66.2% Confident
Q8R409 - (Q8R409) Cardiac lineage protein 1 || Number of peptides = 4 || unambiguous || 66.1% Confident
A2A2_HUMAN - (O94973) Adapter-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) (Huntingtin-interacting protein HYPJ) || Number of peptides = 8 || unambiguous || 66.0% Confident
Q8WUN3 - (Q8WUN3) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 65.9% Confident
O15031 - (O15031) Hypothetical protein KIAA0315 (Fragment) || Number of peptides = 7 || unambiguous || 65.9% Confident
Q8R068 - (Q8R068) Similar to cyclin K || Number of peptides = 2 || unambiguous || 65.8% Confident
Q8VI92 - (Q8VI92) 2',5'-oligoadenylate synthetase-like 11 || Number of peptides = 3 || unambiguous || 65.8% Confident
P70388 - (P70388) RAD50 || Number of peptides = 5 || unambiguous || 65.6% Confident
Q9ES86 - (Q9ES86) snRNP core protein SMX5a || Number of peptides = 1 || ambiguous || 65.5% Confident
Q9QYC2 - (Q9QYC2) RRM-type RNA-binding protein BRPTB (PTB-like protein) || Number of peptides = 1 || ambiguous || 65.5% Confident
Q64028 - (Q64028) Early development regulator protein 1 (RAE-28) (Polyhomeotic protein homolog) (MPH1) || Number of peptides = 3 || unambiguous || 65.5% Confident
O94888 - (O94888) Hypothetical protein KIAA0794 (Fragment) || Number of peptides = 3 || unambiguous || 65.4% Confident
ELV2_MOUSE - (Q60899) ELAV-like protein 2 (Hu-antigen B) (HuB) (ELAV-like neuronal protein 1) (Nervous system-specific RNA binding protein Mel-N1) || Number of peptides = 2 || ambiguous || 65.3% Confident
Q9ERM5 - (Q9ERM5) Protein tyrosine phosphatase BK || Number of peptides = 2 || unambiguous || 65.0% Confident
Q9CW79 - (Q9CW79) 0710001G09Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 64.9% Confident
Q9D578 - (Q9D578) 4930505H01Rik protein || Number of peptides = 2 || unambiguous || 64.7% Confident
Q9NYU2 - (Q9NYU2) UDP-glucose:glycoprotein glucosyltransferase 1 precursor || Number of peptides = 6 || unambiguous || 64.6% Confident
KLC2_MOUSE - (O88448) Kinesin light chain 2 (KLC 2) || Number of peptides = 2 || unambiguous || 64.1% Confident
ADT1_MOUSE - (P48962) ADP,ATP carrier protein, heart/skeletal muscle isoform T1 (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) (mANC1) || Number of peptides = 1 || ambiguous || 64.1% Confident
Q9BTA9 - (Q9BTA9) Hypothetical protein || Number of peptides = 4 || ambiguous || 64.1% Confident
Q91ZA5 - (Q91ZA5) Nuclear pore complex-associated intranuclear protein TPR (Fragment) || Number of peptides = 5 || ambiguous || 64.1% Confident
O43149 - (O43149) Hypothetical protein KIAA0399 (Fragment) || Number of peptides = 5 || unambiguous || 64.0% Confident
Q9DA15 - (Q9DA15) 1700023E05Rik protein || Number of peptides = 6 || unambiguous || 63.9% Confident
Q8VG39 - (Q8VG39) Olfactory receptor MOR172-3 || Number of peptides = 1 || unambiguous || 63.6% Confident
Q91WN1 - (Q91WN1) Hypothetical 32.8 kDa protein (Fragment) || Number of peptides = 2 || unambiguous || 63.5% Confident
Q9CWI5 - (Q9CWI5) Ribosomal protein L15 || Number of peptides = 1 || ambiguous || 63.4% Confident
Q9Y363 - (Q9Y363) CGI-49 protein || Number of peptides = 1 || ambiguous || 63.4% Confident
Q9D5K3 - (Q9D5K3) 4930429H24Rik protein (RIKEN cDNA 4930429H24 gene) || Number of peptides = 2 || ambiguous || 63.4% Confident
RS19_HUMAN - (P39019) 40S ribosomal protein S19 || Number of peptides = 1 || unambiguous || 63.1% Confident
TPM4_HUMAN - (P07226) Tropomyosin alpha 4 chain (Tropomyosin 4) (TM30p1) || Number of peptides = 4 || unambiguous || 63.1% Confident
Q96FI7 - (Q96FI7) Hypothetical protein || Number of peptides = 2 || unambiguous || 62.6% Confident
R13A_MOUSE - (P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen) || Number of peptides = 2 || ambiguous || 62.4% Confident
Q9D5X5 - (Q9D5X5) 4921509B22Rik protein || Number of peptides = 3 || unambiguous || 62.1% Confident
Q9Y6U6 - (Q9Y6U6) WUGSC:H_RG015P03.1 protein (Fragment) || Number of peptides = 15 || unambiguous || 62.1% Confident
CXAR_MOUSE - (P97792) Coxsackievirus and adenovirus receptor homolog precursor (mCAR) || Number of peptides = 6 || ambiguous || 61.9% Confident
SMF1_HUMAN - (O14497) SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 (SWI-SNF complex protein p270) (B120) || Number of peptides = 2 || ambiguous || 61.9% Confident
Z341_HUMAN - (Q9BYN7) Zinc finger protein 341 || Number of peptides = 1 || unambiguous || 61.9% Confident
H2AO_HUMAN - (P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615) (P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615) || Number of peptides = 2 || ambiguous || 61.7% Confident
O08995 - (O08995) Myelin transcription factor 1 || Number of peptides = 6 || unambiguous || 61.6% Confident
Q8VH51 - (Q8VH51) Transcription coactivator CAPER || Number of peptides = 1 || ambiguous || 61.6% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 4 || ambiguous || 61.6% Confident
Q9H5U9 - (Q9H5U9) Hypothetical protein FLJ23017 || Number of peptides = 1 || unambiguous || 61.5% Confident
O15000 - (O15000) Match: multiple proteins (Fragment) || Number of peptides = 1 || unambiguous || 61.5% Confident
FHR2_HUMAN - (P36980) Complement factor H-related protein 2 precursor (FHR-2) (H factor-like protein 2) (H factor-like 3) (DDESK59) || Number of peptides = 3 || unambiguous || 61.4% Confident
Q91X03 - (Q91X03) Tyrosine phosphatase isoform A || Number of peptides = 1 || unambiguous || 61.3% Confident
RN23_MOUSE - (Q9ESN2) RING finger protein 23 (Testis-abundant finger protein) (Tripartite motif-containing protein 39) || Number of peptides = 3 || ambiguous || 61.3% Confident
ATDA_HUMAN - (P21673) Diamine acetyltransferase (EC 2.3.1.57) (Spermidine/spermine N(1)-acetyltransferase) (SSAT) (Putrescine acetyltransferase) || Number of peptides = 4 || ambiguous || 61.3% Confident
Q8VCC5 - (Q8VCC5) Hypothetical 45.4 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 61.1% Confident
Q9BSK2 - (Q9BSK2) Mitochondrial carrier protein || Number of peptides = 1 || unambiguous || 61.1% Confident
Q9BUK0 - (Q9BUK0) Hypothetical protein || Number of peptides = 1 || unambiguous || 61.1% Confident
Q9D990 - (Q9D990) 4632415H16Rik protein || Number of peptides = 1 || unambiguous || 61.0% Confident
Q9NPF4 - (Q9NPF4) Putative sialoglycoprotease (EC 3.4.24.57) (Hypothetical protein FLJ20411) (Putative metalloglycoprotease) (PRSMG1/GCPL1 protein) || Number of peptides = 1 || unambiguous || 61.0% Confident
ZN41_HUMAN - (P51814) Zinc finger protein 41 || Number of peptides = 2 || unambiguous || 60.6% Confident
CALX_MOUSE - (P35564) Calnexin precursor || Number of peptides = 3 || unambiguous || 60.5% Confident
Q9DA87 - (Q9DA87) 1700017G21Rik protein || Number of peptides = 2 || unambiguous || 60.3% Confident
Q9UKI8 - (Q9UKI8) Tousled-like kinase 1 || Number of peptides = 1 || ambiguous || 60.2% Confident
CNG1_MOUSE - (P29974) cGMP-gated cation channel alpha 1 (CNG channel alpha 1) (CNG-1) (CNG1) (Cyclic nucleotide gated channel alpha 1) (Cyclic nucleotide gated channel, photoreceptor) (Cyclic-nucleotide-gated cation channel 1) (Rod photoreceptor cGMP-gated channel alpha subunit) || Number of peptides = 3 || unambiguous || 60.2% Confident
MCM2_MOUSE - (P97310) DNA replication licensing factor MCM2 || Number of peptides = 4 || unambiguous || 60.1% Confident
Q9C0F2 - (Q9C0F2) Hypothetical protein KIAA1711 (Fragment) || Number of peptides = 3 || ambiguous || 59.8% Confident
EPPL_HUMAN - (P58107) Epiplakin (450 kDa epidermal antigen) || Number of peptides = 5 || unambiguous || 59.8% Confident
KICH_HUMAN - (P35790) Choline kinase (EC 2.7.1.32) (CK) (CHETK-alpha) || Number of peptides = 2 || unambiguous || 59.8% Confident
DCC_MOUSE - (P70211) Tumor suppressor protein DCC precursor || Number of peptides = 3 || unambiguous || 59.2% Confident
NFIA_MOUSE - (Q02780) Nuclear factor 1 A-type (Nuclear factor 1/A) (NF1-A) (NFI-A) (NF-I/A) (CCAAT-box binding transcription factor) (CTF) (TGGCA-binding protein) || Number of peptides = 3 || unambiguous || 58.7% Confident
H15_HUMAN - (P16401) Histone H1.5 (Histone H1a) || Number of peptides = 6 || unambiguous || 58.6% Confident
Q9P2M7 - (Q9P2M7) Hypothetical protein KIAA1319 (Cingulin) (Fragment) || Number of peptides = 3 || unambiguous || 58.2% Confident
BAF_MOUSE - (O54962) Barrier-to-autointegration factor (Breakpoint cluster region protein 1) (LAP2 binding protein 1) || Number of peptides = 1 || unambiguous || 58.1% Confident
Q9D5C9 - (Q9D5C9) 4930463F05Rik protein || Number of peptides = 6 || ambiguous || 58.0% Confident
RL30_HUMAN - (P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 || Number of peptides = 1 || ambiguous || 57.4% Confident
Q9CQR1 - (Q9CQR1) DNA segment, Chr 6, Wayne state University 157, expressed || Number of peptides = 3 || ambiguous || 57.1% Confident
CDK1_MOUSE - (O35207) Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Putative oral cancer suppressor) (Deleted in oral cancer-1) (DOC-1) (Fragment) || Number of peptides = 2 || ambiguous || 57.1% Confident
Q9D2F8 - (Q9D2F8) 4930547C10Rik protein || Number of peptides = 2 || unambiguous || 57.0% Confident
O88528 - (O88528) Citron-K kinase (Fragment) || Number of peptides = 2 || unambiguous || 57.0% Confident
O15463 - (O15463) PTPL1-associated RhoGAP || Number of peptides = 6 || unambiguous || 57.0% Confident
Q9EPF1 - (Q9EPF1) L-gicerin/MUC18 || Number of peptides = 1 || unambiguous || 56.7% Confident
Q91WJ8 - (Q91WJ8) Similar to far upstream element (FUSE) binding protein 1 || Number of peptides = 4 || ambiguous || 56.5% Confident
Q8VHM5 - (Q8VHM5) Heterogeneous nuclear ribonucleoprotein R || Number of peptides = 4 || ambiguous || 56.4% Confident
K1M2_MOUSE - (Q62168) Keratin, type I cuticular HA2 (Hair keratin, type I HA2) || Number of peptides = 12 || unambiguous || 56.2% Confident
Q96KR8 - (Q96KR8) Myosin heavy chain || Number of peptides = 6 || unambiguous || 56.1% Confident
BE16_MOUSE - (P28657) Brain protein 14 (Brain protein E161) || Number of peptides = 7 || unambiguous || 56.0% Confident
CATF_MOUSE - (Q9R013) Cathepsin F precursor (EC 3.4.22.41) || Number of peptides = 1 || unambiguous || 56.0% Confident
O35243 - (O35243) Antigen containing epitope to monoclonal antibody MMS-85/12 (Fragment) || Number of peptides = 1 || unambiguous || 55.6% Confident
RL7_MOUSE - (P14148) 60S ribosomal protein L7 || Number of peptides = 3 || ambiguous || 55.6% Confident
SSXT_MOUSE - (Q62280) SSXT protein (SYT protein) (Synovial sarcoma associated Ss18-alpha) || Number of peptides = 1 || ambiguous || 55.3% Confident
Q14710 - (Q14710) Pot. ORF I (Fragment) || Number of peptides = 1 || unambiguous || 55.2% Confident
Q91Y03 - (Q91Y03) Protocadherin beta 16 || Number of peptides = 1 || unambiguous || 55.0% Confident
RL12_MOUSE - (P35979) 60S ribosomal protein L12 || Number of peptides = 2 || ambiguous || 54.9% Confident
CTA4_HUMAN - (Q9C0A0) Contactin associated protein-like 4 precursor (Cell recognition molecule Caspr4) || Number of peptides = 8 || unambiguous || 54.8% Confident
Q99PC3 - (Q99PC3) CGI-74-like SR-rich protein || Number of peptides = 4 || ambiguous || 54.7% Confident
PIN1_MOUSE - (Q9QUR7) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (EC 5.2.1.8) (Rotamase Pin1) (PPIase Pin1) || Number of peptides = 2 || ambiguous || 54.4% Confident
Q91Y58 - (Q91Y58) DNA-dependent ATPase SNF2L || Number of peptides = 3 || unambiguous || 54.2% Confident
Q61344 - (Q61344) Beta-tropomyosin || Number of peptides = 1 || unambiguous || 54.2% Confident
Q9R218 - (Q9R218) Dachshund variant 1 || Number of peptides = 1 || ambiguous || 54.2% Confident
Q9CZA5 - (Q9CZA5) 2810028A01Rik protein || Number of peptides = 4 || unambiguous || 54.2% Confident
CTA1_HUMAN - (P78357) Contactin associated protein 1 precursor (Caspr) (Caspr1) (Neurexin 4) (Neurexin IV) (p190) || Number of peptides = 1 || unambiguous || 54.1% Confident
Q9UI92 - (Q9UI92) Putative WHSC1 protein || Number of peptides = 1 || ambiguous || 54.1% Confident
T2FB_HUMAN - (P13984) Transcription initiation factor IIF, beta subunit (TFIIF-beta) (Transcription initiation factor RAP30) || Number of peptides = 3 || unambiguous || 54.1% Confident
O35255 - (O35255) Nucleolar protein || Number of peptides = 1 || ambiguous || 54.0% Confident
Q91XM9 - (Q91XM9) Chapsyn-110 || Number of peptides = 1 || ambiguous || 53.9% Confident
Q8TEQ3 - (Q8TEQ3) FLJ00140 protein (Fragment) || Number of peptides = 3 || unambiguous || 53.9% Confident
Q9D3U0 - (Q9D3U0) 4933435A13Rik protein (RIKEN cDNA 4933435A13 gene) || Number of peptides = 1 || ambiguous || 53.9% Confident
Q9Y4F9 - (Q9Y4F9) Hypothetical protein KIAA0386 || Number of peptides = 2 || unambiguous || 53.7% Confident
Q96JM7 - (Q96JM7) Hypothetical protein KIAA1798 (Fragment) || Number of peptides = 3 || unambiguous || 53.7% Confident
CA21_MOUSE - (Q01149) Collagen alpha 2(I) chain precursor || Number of peptides = 4 || unambiguous || 53.6% Confident
TCP2_MOUSE - (P11983) T-complex protein 1, alpha subunit B (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1B) (TCP-1-B) || Number of peptides = 1 || ambiguous || 53.5% Confident
Q8R4U0 - (Q8R4U0) Stabilin-2 || Number of peptides = 4 || unambiguous || 53.5% Confident
O60494 - (O60494) Intrinsic factor-B12 receptor precursor (Intrinsic factor-vitamin B12 receptor) || Number of peptides = 4 || unambiguous || 53.5% Confident
SL53_HUMAN - (P53794) Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter) || Number of peptides = 2 || unambiguous || 53.3% Confident
Q96DL1 - (Q96DL1) Hypothetical protein FLJ25224 || Number of peptides = 2 || unambiguous || 53.3% Confident
Q9P008 - (Q9P008) HSPC156 || Number of peptides = 2 || ambiguous || 53.0% Confident
Q9BZE5 - (Q9BZE5) PGC-1 related co-activator (Hypothetical protein KIAA0595) || Number of peptides = 3 || unambiguous || 53.0% Confident
Q923C3 - (Q923C3) Similar to regulator of differentiation (In S. pombe) 1 || Number of peptides = 2 || unambiguous || 52.8% Confident
O35935 - (O35935) Poly(A) binding protein II || Number of peptides = 7 || unambiguous || 52.8% Confident
Q91WM6 - (Q91WM6) Similar to hypothetical protein FLJ13391 (Hypothetical 17.8 kDa protein) || Number of peptides = 1 || unambiguous || 52.7% Confident
Q9NXE2 - (Q9NXE2) Hypothetical protein FLJ20300 || Number of peptides = 1 || ambiguous || 52.7% Confident
CN8A_MOUSE - (O88502) High-affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (EC 3.1.4.17) (MMPDE8) || Number of peptides = 4 || unambiguous || 52.6% Confident
Q922J3 - (Q922J3) Similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) || Number of peptides = 7 || unambiguous || 52.4% Confident
Q9H3Y6 - (Q9H3Y6) DJ697K14.1 (Novel tyrosine kinase) || Number of peptides = 1 || unambiguous || 52.4% Confident
ABC2_MOUSE - (P41234) ATP-binding cassette, sub-family A, member 2 (ATP-binding cassette transporter 2) (ATP-binding cassette 2) || Number of peptides = 6 || unambiguous || 52.4% Confident
Q8WYY1 - (Q8WYY1) Hypothetical protein || Number of peptides = 1 || unambiguous || 52.3% Confident
Q16563 - (Q16563) PANTOPHYSIN || Number of peptides = 2 || unambiguous || 52.2% Confident
Q99JR8 - (Q99JR8) Similar to SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 || Number of peptides = 1 || unambiguous || 52.2% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 2 || ambiguous || 52.1% Confident
SSF1_MOUSE - (Q91YU8) Suppressor of SWI4 1 homolog (Ssf-1) (Peter Pan homolog) || Number of peptides = 1 || unambiguous || 52.1% Confident
SP41_HUMAN - (Q16550) Transcription initiation protein SPT4 homolog 1 (Q16550) Transcription initiation protein SPT4 homolog 1 || Number of peptides = 2 || ambiguous || 51.9% Confident
Q96L09 - (Q96L09) Similar to RIKEN cDNA 6720467C03 gene || Number of peptides = 1 || unambiguous || 51.9% Confident
Q8VGM0 - (Q8VGM0) Olfactory receptor MOR253-3 || Number of peptides = 1 || ambiguous || 51.8% Confident
OXRP_HUMAN - (Q9Y4L1) 150 kDa oxygen-regulated protein precursor (Orp150) (Hypoxia up-regulated 1) || Number of peptides = 3 || unambiguous || 51.7% Confident
LEG1_MOUSE - (P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) || Number of peptides = 3 || unambiguous || 51.6% Confident
PYR5_MOUSE - (P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] || Number of peptides = 2 || unambiguous || 51.4% Confident
Q9H0X1 - (Q9H0X1) Hypothetical protein || Number of peptides = 2 || unambiguous || 51.0% Confident
VGR3_HUMAN - (P35916) Vascular endothelial growth factor receptor 3 precursor (EC 2.7.1.112) (VEGFR-3) (Tyrosine-protein kinase receptor FLT4) || Number of peptides = 3 || unambiguous || 51.0% Confident
UBAL_HUMAN - (P41226) Ubiquitin-activating enzyme E1 homolog (D8) || Number of peptides = 4 || unambiguous || 51.0% Confident
Q9NXZ1 - (Q9NXZ1) Putative tumor antigen || Number of peptides = 4 || unambiguous || 50.9% Confident
Q96QW3 - (Q96QW3) BA74P14.2 (Novel protein) || Number of peptides = 1 || ambiguous || 50.9% Confident
TR1A_HUMAN - (P19438) Tumor necrosis factor receptor superfamily member 1A precursor (p60) (TNF-R1) (TNF-RI) (p55) (CD120a) [Contains: Tumor necrosis factor binding protein 1 (TBPI)] || Number of peptides = 2 || unambiguous || 50.7% Confident
E4L2_MOUSE - (O70318) Band 4.1-like protein 2 (Generally expressed protein 4.1) (4.1G) || Number of peptides = 3 || unambiguous || 50.7% Confident
Q9NS87 - (Q9NS87) Kinesin-like protein 2 || Number of peptides = 5 || unambiguous || 50.4% Confident
NO56_HUMAN - (O00567) Nucleolar protein Nop56 (Nucleolar protein 5A) || Number of peptides = 1 || unambiguous || 50.2% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/data/search/2002-TK-LungDevo/lung_E16_NE_1
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
UQ91X9499.6%4517139.7%257292839.3(Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD)
	TK_050702_lung_E16_NE_2D_step04.2959.2959.2	4.4231	0.3554	1618.81	1	8570.0%	3	K.KIFVGGLSPDTPEEK.I
	TK_050702_lung_E16_NE_2D_step01.3474.3474.2	3.4994	0.4727	1358.03	1	9090.0%	1	-.MFIGGLSWDTTK.K
	TK_050702_lung_E16_NE_2D_step10.3930.3930.2	1.7463	0.2209	2431.84	1	3500.0%	3	K.IREYFGGFGEVESIELPMDNK.T
	TK_050702_lung_E16_NE_2D_step01.4018.4018.2	1.6766	0.3047	2164.16	1	3610.0%	6	R.EYFGGFGEVESIELPMDNK.T
	TK_050702_lung_E16_NE_2D_step01.2578.2578.1	2.3059	0.4117	1169.61	1	7220.0%	2	K.FGEVVDCTLK.L
	TK_050702_lung_E16_NE_2D_step03.2412.2412.1	2.0546	0.3246	919.81	1	7140.0%	4	K.YHNVGLSK.C
	TK_050702_lung_E16_NE_2D_step01.0188.0188.1	0.9206	0.1358	620.74	28	5000.0%	1	K.VMDQK.E
	TK_050702_lung_E16_NE_2D_step01.2787.2787.1	3.6849	0.5011	1491.06	1	6540.0%	2	K.IFVGGLSPDTPEEK.I
	TK_050702_lung_E16_NE_2D_step01.3633.3633.2	1.6725	0.029	1690.58	1	4640.0%	1	R.GFGFVLFKESESVDK.V
	TK_050702_lung_E16_NE_2D_step02.3493.3493.2	1.2702	0.0613	1732.94	9	3080.0%	7	R.GFCFITFKEEEPVK.K
	TK_050702_lung_E16_NE_2D_step12.1853.1853.1	1.3566	0.0381	1047.84	1	5000.0%	3	K.KYHNVGLSK.C
	TK_050702_lung_E16_NE_2D_step01.3525.3525.1	1.1	0.1948	1019.74	1	6430.0%	1	R.GFCFITFK.E
	TK_050702_lung_E16_NE_2D_step03.3580.3580.2	2.7284	0.478	1485.42	1	6250.0%	4	-.MFIGGLSWDTTKK.D
USR19_MOUSE99.6%3520.1%1441619110.0(Q9D7A6) Signal recognition particle 19 kDa protein (SRP19)
	TK_050702_lung_E16_NE_2D_step09.4917.4917.1	0.2434	0.0	559.53	1	1670.0%	1	K.MYSR.E
*	TK_050702_lung_E16_NE_2D_step02.3859.3859.2	2.8147	0.5933	2678.26	1	3330.0%	2	K.AVENPTATEIQDVCSAVGLNAFLEK.N
URU1C_MOUSE99.6%4424.5%159173649.7(Q62241) U1 small nuclear ribonucleoprotein C (U1-C)
	TK_050702_lung_E16_NE_2D_step01.2858.2858.2	3.5569	0.5446	2300.75	1	5290.0%	1	K.FYCDYCDTYLTHDSPSVR.K
	TK_050702_lung_E16_NE_2D_step01.2929.2929.1	2.5416	0.157	1480.05	1	6820.0%	1	K.WMEEQAQSLIDK.T
	TK_050702_lung_E16_NE_2D_step01.1966.1966.1	1.6606	0.3586	952.03	1	6880.0%	1	K.TTAAFQQGK.I
UQ9D7E799.6%3511.4%271314369.0(Q9D7E7) 2310011G05Rik protein
	TK_050702_lung_E16_NE_2D_step08.3179.3179.2	0.8246	0.0248	1700.73	10	2920.0%	1	R.FFHMPRFQHQAPR.Q
	TK_050702_lung_E16_NE_2D_step06.3161.3161.2	4.5992	0.7037	2110.41	1	6470.0%	2	K.RPDFAQQQAMQQLTFDGK.R
UO0030199.6%9276.9%711731617.3(O00301) KSRP
*	TK_050702_lung_E16_NE_2D_step06.3351.3351.2	2.0372	0.4605	2099.51	1	3420.0%	3	R.GQGNWGPPGGEMTFSIPTHK.C
*	TK_050702_lung_E16_NE_2D_step08.2735.2735.2	2.0511	0.3968	1108.4	1	5000.0%	1	K.IAHIMGPPDR.C
*	TK_050702_lung_E16_NE_2D_step08.2282.2282.2	3.4196	0.5871	2112.89	1	4720.0%	4	K.KIGQQPQQPGAPPQQDYTK.A
UH2AG_HUMAN99.6%3426262.8%1291397610.9(P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3)
	TK_050702_lung_E16_NE_2D_step02.2952.2952.2	1.4254	0.2756	945.08	1	5000.0%	1	R.AGLQFPVGR.V
	TK_050702_lung_E16_NE_2D_step02.0102.0102.1	1.1111	0.1214	498.6	4	8330.0%	4	R.IIPR.H
	TK_050702_lung_E16_NE_2D_step04.4304.4304.3	3.1399	0.5091	2917.82	1	2410.0%	3	R.VGAGAPVYLAAVLEYLTAEILELAGNAAR.D
	TK_050702_lung_E16_NE_2D_step12.1500.1500.1	0.722	0.0395	795.55	5	3000.0%	1	R.VHRLLR.K
	TK_050702_lung_E16_NE_2D_step02.3857.3857.2	1.4725	0.1311	1935.2	1	3330.0%	7	K.VTIAQGGVLPNIQAVLLPK.K
	TK_050702_lung_E16_NE_2D_step09.3285.3285.2	1.3819	0.0832	1694.34	8	3850.0%	1	R.HLQLAIRNDEELNK.L
	TK_050702_lung_E16_NE_2D_step08.2987.2987.2	2.6467	0.2741	851.97	1	10000.0%	4	R.HLQLAIR.N
UQ9QZQ899.6%174933.1%372397359.8(Q9QZQ8) Histone macroH2A1.2 variant
	TK_050702_lung_E16_NE_2D_step06.3623.3623.2	3.8861	0.5485	1988.71	1	5260.0%	5	K.GVTIASGGVLPNIHPELLAK.K
	TK_050702_lung_E16_NE_2D_step02.3784.3784.2	4.2203	0.061	1935.01	1	7190.0%	2	R.HILLAVANDEELNQLLK.G
	TK_050702_lung_E16_NE_2D_step06.3359.3359.2	2.9826	0.5642	1831.35	1	5000.0%	3	K.NGPLEVAGAAISAGHGLPAK.F
	TK_050702_lung_E16_NE_2D_step06.3207.3207.2	3.6172	0.5062	1631.91	1	7310.0%	2	K.FVIHCNSPVWGADK.C
	TK_050702_lung_E16_NE_2D_step08.3446.3446.2	2.9097	0.4694	2532.72	1	3250.0%	2	K.FVIHCNSPVWGADKCEELLEK.T
	TK_050702_lung_E16_NE_2D_step02.4299.4299.3	3.0057	0.293	2977.14	1	3210.0%	1	R.IGVGAPVYMAAVLEYLTAEILELAGNAAR.D
	TK_050702_lung_E16_NE_2D_step11.4785.4785.3	1.9167	0.1732	3331.94	5	1690.0%	1	R.IGVGAPVYMAAVLEYLTAEILELAGNAARDNK.K
	TK_050702_lung_E16_NE_2D_step07.3027.3027.2	1.9458	0.4478	1336.5	1	4580.0%	1	K.GKLEAIITPPPAK.K
UH33_HUMAN99.6%63623.7%1351519711.3(P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q) (P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q)
	TK_050702_lung_E16_NE_2D_step12.4148.4148.3	1.6507	0.0933	3440.58	1	1690.0%	6	R.FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK.R
UHMG1_MOUSE99.6%127161347.7%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30)
	TK_050702_lung_E16_NE_2D_step04.3307.3307.2	2.4024	0.4713	1499.29	1	6360.0%	7	K.MSSYAFFVQTCR.E
	TK_050702_lung_E16_NE_2D_step01.2066.2066.1	1.6051	0.1614	708.99	1	8000.0%	2	K.DIAAYR.A
	TK_050702_lung_E16_NE_2D_step06.3612.3612.3	1.2203	0.084	2624.68	20	1900.0%	1	K.DPNAPKRPPSAFFLFCSEYRPK.I
	TK_050702_lung_E16_NE_2D_step09.3093.3093.2	3.248	0.4917	1523.69	1	6430.0%	19	K.IKGEHPGLSIGDVAK.K
	TK_050702_lung_E16_NE_2D_step02.0054.0054.1	2.0876	0.4537	1281.96	1	4170.0%	7	K.GEHPGLSIGDVAK.K
	TK_050702_lung_E16_NE_2D_step08.2971.2971.2	1.7167	0.27	1595.07	1	4620.0%	2	K.HPDASVNFSEFSKK.C
	TK_050702_lung_E16_NE_2D_step13.5347.5347.2	2.2296	0.4107	2004.33	1	5330.0%	1	K.RPPSAFFLFCSEYRPK.I
	TK_050702_lung_E16_NE_2D_step03.2384.2384.2	1.4612	0.2912	1135.36	2	5560.0%	7	K.TYIPPKGETK.K
	TK_050702_lung_E16_NE_2D_step08.3047.3047.2	2.0978	0.2523	1595.22	1	6540.0%	3	K.KHPDASVNFSEFSK.K
	TK_050702_lung_E16_NE_2D_step02.2795.2795.2	3.4616	0.4924	1594.99	1	6920.0%	20	K.KLGEMWNNTAADDK.Q
	TK_050702_lung_E16_NE_2D_step06.2925.2925.2	1.471	0.0225	1468.48	17	3750.0%	19	K.HPDASVNFSEFSK.K
	TK_050702_lung_E16_NE_2D_step03.2448.2448.1	1.7793	0.0444	927.78	2	5710.0%	2	K.GKFEDMAK.A
UQ9QYS999.6%144635.5%341376718.5(Q9QYS9) QKI-5 protein
	TK_050702_lung_E16_NE_2D_step03.3732.3732.2	1.3061	0.0751	1655.79	10	3460.0%	1	K.MQLMELAILNGTYR.D
	TK_050702_lung_E16_NE_2D_step07.2448.2448.2	1.0781	0.1082	1470.34	34	2690.0%	1	K.KLLVPAAEGEDSLK.K
	TK_050702_lung_E16_NE_2D_step07.3737.3737.3	1.2221	0.0027	3484.96	4	1520.0%	1	K.EEQNRGKPNWEHLNEDLHVLITVEDAQNR.A
	TK_050702_lung_E16_NE_2D_step03.3542.3542.2	1.3176	0.235	1466.41	5	3460.0%	1	R.TPTPAGPTIMPLIR.Q
	TK_050702_lung_E16_NE_2D_step09.4180.4180.2	1.8042	0.3484	2039.08	1	3750.0%	6	K.LMSSLPNFCGIFNHLER.L
	TK_050702_lung_E16_NE_2D_step03.3390.3390.2	1.5686	0.1881	1487.49	7	3570.0%	1	R.IITGPAPVLPPAALR.T
	TK_050702_lung_E16_NE_2D_step05.3314.3314.2	4.1375	0.5734	1951.03	1	6470.0%	2	K.RSAELPDAVGPIVQLQEK.L
UPP1A_HUMAN99.6%4109.1%330375126.3(P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A)
	TK_050702_lung_E16_NE_2D_step05.3356.3356.2	1.5361	0.0115	2250.8	2	2780.0%	3	K.IFCCHGGLSPDLQSMEQIR.R
	TK_050702_lung_E16_NE_2D_step05.2546.2546.2	2.7454	0.2416	1185.43	1	6500.0%	1	R.LLEVQGSRPGK.N
UQ9WVK299.6%4619.0%226245309.6(Q9WVK2) Ring1 interactor RYBP
	TK_050702_lung_E16_NE_2D_step08.2958.2958.2	3.4862	0.5623	2407.31	1	4520.0%	1	R.INSQLVAQQVAQQYATPPPPKK.E
	TK_050702_lung_E16_NE_2D_step02.2893.2893.2	2.6827	0.5825	2279.42	1	3750.0%	1	R.INSQLVAQQVAQQYATPPPPK.K
	TK_050702_lung_E16_NE_2D_step08.4178.4178.2	0.803	0.092	2207.6	1	2250.0%	2	R.STAQQLAVTVGNVTVIITDFK.E
UQ9JI2599.6%11319.9%726797469.4(Q9JI25) Bromodomain-containing FSH-like protein FSRG2
	TK_050702_lung_E16_NE_2D_step03.2317.2317.2	1.7348	0.4119	1622.94	1	4330.0%	1	R.KADTTTPTTSAITASR.S
	TK_050702_lung_E16_NE_2D_step10.3102.3102.2	1.2576	0.3975	1320.55	2	2270.0%	1	R.RESGGRPIKPPK.K
	TK_050702_lung_E16_NE_2D_step05.2316.2316.1	0.7845	0.0047	754.82	20	4000.0%	1	K.LSEHLR.H
	TK_050702_lung_E16_NE_2D_step13.3509.3509.2	1.1844	0.0768	1525.98	26	3460.0%	1	K.DLEDGEVPQHAGKK.G
	TK_050702_lung_E16_NE_2D_step05.3295.3295.2	2.5532	0.4143	1167.85	1	8750.0%	1	R.KLQDVFEMR.F
	TK_050702_lung_E16_NE_2D_step10.3978.3978.2	1.4418	0.2793	1849.86	4	3210.0%	5	K.HQFAWPFYQPVDAIK.L
UCIRP_MOUSE99.6%63612.2%172186079.6(Q61413) Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) (A18 hnRNP)
*	TK_050702_lung_E16_NE_2D_step01.4229.4229.2	1.5141	0.2476	2332.88	1	3500.0%	6	K.LFVGGLSFDTNEQALEQVFSK.Y
UG3P_MOUSE99.6%41011.7%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH)
*	TK_050702_lung_E16_NE_2D_step01.2334.2334.1	1.7453	0.3393	1369.99	1	5000.0%	1	R.GAAQNIIPASTGAAK.A
	TK_050702_lung_E16_NE_2D_step13.4649.4649.2	4.8056	0.6555	2598.58	1	4350.0%	3	K.VIHDNFGIVEGLMTTVHAITATQK.T
UQ9JHS999.6%2215.7%229266245.7(Q9JHS9) Hypothetical 26.6 kDa protein (0610040D20Rik protein) (RIKEN cDNA 0610040D20 gene)
	TK_050702_lung_E16_NE_2D_step01.3850.3850.2	3.7096	0.6292	2585.66	1	3910.0%	1	R.MENILSGNPLLNLTGPSQPQANFK.V
	TK_050702_lung_E16_NE_2D_step02.2359.2359.2	1.8359	0.295	1219.44	1	5910.0%	1	R.GKGEGDLSQLSK.Q
UQ6102999.6%2613239.2%451501639.4(Q61029) Thymopoietin beta
	TK_050702_lung_E16_NE_2D_step04.3859.3859.2	2.1671	0.4857	2704.71	1	2500.0%	2	R.LEDKDDLDVTELSNEELLDQLVR.Y
	TK_050702_lung_E16_NE_2D_step06.3763.3763.2	2.5597	0.5926	1789.26	1	5330.0%	6	K.HASSILPITEFSDITR.R
	TK_050702_lung_E16_NE_2D_step01.2997.2997.2	2.1147	0.3935	1744.95	1	4380.0%	1	R.IDGAVISESTPIAETIK.A
	TK_050702_lung_E16_NE_2D_step05.3158.3158.2	1.145	0.1065	1390.38	31	2920.0%	2	K.GAAGRPLELSDFR.M
*	TK_050702_lung_E16_NE_2D_step10.5129.5129.3	1.4381	0.0145	3539.41	6	1640.0%	1	R.RTEHNQSYSQAGVTETEWTSGSSTGGPLQALTR.E
	TK_050702_lung_E16_NE_2D_step09.2398.2398.2	1.3339	0.1343	1196.47	4	4550.0%	1	R.NRPPLAAGANSK.G
	TK_050702_lung_E16_NE_2D_step04.3692.3692.2	1.4366	0.2851	1721.9	1	3850.0%	9	K.DVYVQLYLQHLTAR.N
	TK_050702_lung_E16_NE_2D_step04.0485.0485.1	0.5062	0.0116	1222.33	6	1000.0%	1	K.YAPLADVKSEK.T
	TK_050702_lung_E16_NE_2D_step05.2872.2872.2	1.8522	0.3279	1940.38	1	3820.0%	1	K.LKSELVANNVTLPAGEQR.K
	TK_050702_lung_E16_NE_2D_step03.1902.1902.1	0.212	0.0	943.07	10	710.0%	1	R.MEESFSSK.Y
	TK_050702_lung_E16_NE_2D_step01.3082.3082.1	1.7633	0.2751	1375.99	17	3640.0%	1	-.PEFLEDPSVLTK.D
UQ99NB899.6%352.5%596635065.0(Q99NB8) UBIN (Ataxin-1 ubiquitin-like interacting protein)
	TK_050702_lung_E16_NE_2D_step06.3332.3332.2	1.5185	0.3083	1797.38	2	3930.0%	2	R.NPEISHMLNNPELMR.Q
UQ9CT3799.6%143622.3%381425946.0(Q9CT37) 2610003J05Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step03.3754.3754.2	1.8659	0.3819	1942.34	1	3120.0%	1	K.VTEGLVDVILYHQPDDK.K
	TK_050702_lung_E16_NE_2D_step03.3294.3294.2	1.776	0.0857	1339.23	2	5500.0%	1	K.TKENILEEFSK.V
	TK_050702_lung_E16_NE_2D_step01.3282.3282.1	1.3408	0.1323	1110.25	2	5620.0%	1	K.ENILEEFSK.V
	TK_050702_lung_E16_NE_2D_step01.3021.3021.1	1.2101	0.3379	1012.83	1	6250.0%	1	K.SAFLCGVMK.T
	TK_050702_lung_E16_NE_2D_step03.3394.3394.2	1.9697	0.4695	1447.19	1	6000.0%	1	R.GFCFLEYEDHK.S
	TK_050702_lung_E16_NE_2D_step02.2500.2500.2	2.6555	0.4303	1339.01	1	7500.0%	1	K.LCDSYEIRPGK.H
	TK_050702_lung_E16_NE_2D_step07.3367.3367.2	2.8376	0.5119	2638.66	1	3400.0%	5	R.KYGGPPPDSVYSGVQPGIGTEVFVGK.I
UQ8WXA999.6%4611.4%5085938010.4(Q8WXA9) Splicing factor, arginine/serine-rich 12
*	TK_050702_lung_E16_NE_2D_step12.2240.2240.2	1.7071	0.3783	2232.74	3	2250.0%	1	K.INHSNNAIVKPPEMTPQAAAK.E
*	TK_050702_lung_E16_NE_2D_step01.4091.4091.2	3.9922	0.5641	2491.64	1	4520.0%	1	R.TVYVGNLNSQTTTADQLLEFFK.Q
*	TK_050702_lung_E16_NE_2D_step05.3616.3616.2	1.5214	0.2472	1638.17	1	3930.0%	2	R.ALAFNGVMFGDRPLK.I
UQ6181899.6%778.4%18401960418.8(Q61818) Hypothetical 196.0 kDa protein
*	TK_050702_lung_E16_NE_2D_step13.5278.5278.3	1.2872	0.0254	4452.39	14	1050.0%	1	K.EDLEAEEEYSSLCELLGSPEQRPSLQDPLSPKAPLMCTK.E
*	TK_050702_lung_E16_NE_2D_step09.3637.3637.3	1.7136	0.0258	2402.51	10	2500.0%	1	K.QQEAEGVKEEVGGLLQCPEVAK.A
*	TK_050702_lung_E16_NE_2D_step04.2479.2479.2	3.3352	0.229	2226.19	1	5830.0%	1	K.YQHYGQQGQGYCPPDTAVR.T
	TK_050702_lung_E16_NE_2D_step07.2351.2351.1	0.7396	0.0334	757.63	45	4000.0%	1	K.YISSCK.R
*	TK_050702_lung_E16_NE_2D_step08.2363.2363.3	0.8762	0.042	2682.81	28	830.0%	1	K.TSWSQPGEPETLPEPLQLDKGGSTK.D
*	TK_050702_lung_E16_NE_2D_step10.3113.3113.3	1.1149	0.04	3492.92	5	1140.0%	1	R.RPGGSPAGAEEGLGGMGQMLPAASGADPLCRNPASR.S
*	TK_050702_lung_E16_NE_2D_step13.4222.4222.1	0.191	0.417	849.91	2	710.0%	1	K.VAVDMVRG.-
UQ9DBI699.6%8208.1%669694859.7(Q9DBI6) 1300007E16Rik protein
	TK_050702_lung_E16_NE_2D_step03.3130.3130.2	0.8529	0.0891	1047.59	36	3750.0%	1	R.QPTPPFFGR.D
	TK_050702_lung_E16_NE_2D_step01.2491.2491.1	1.5702	0.3816	1237.97	1	6110.0%	1	R.YSGSYNDYLR.A
	TK_050702_lung_E16_NE_2D_step05.0118.0118.2	2.1587	0.457	2468.55	1	3040.0%	4	R.TQSSASLAASYAAQQHPQAAASYR.G
	TK_050702_lung_E16_NE_2D_step07.2605.2605.2	1.3441	0.3108	1302.96	2	4000.0%	1	R.RLPDAHSDYAR.Y
UH13_MOUSE99.6%1514713.6%2202196811.0(P43277) Histone H1.3 (H1 VAR.4) (H1D)
	TK_050702_lung_E16_NE_2D_step08.2660.2660.1	1.404	0.0767	913.96	6	6110.0%	1	K.KPAAAAGAKK.V
	TK_050702_lung_E16_NE_2D_step01.0972.0972.1	0.485	0.0011	447.5	7	3330.0%	1	K.TPVK.K
	TK_050702_lung_E16_NE_2D_step08.0458.0458.1	1.3116	0.1268	786.77	1	5000.0%	12	K.KPAAAAGAK.K
*	TK_050702_lung_E16_NE_2D_step01.2091.2091.1	2.4483	0.5011	1507.91	1	5000.0%	1	-.SETAPAAPAAPAPVEK.T
UQ8R50999.6%102222.2%528567549.2(Q8R509) Polypirimidine tract binding protein
	TK_050702_lung_E16_NE_2D_step13.5147.5147.3	1.1075	0.0378	4641.85	37	800.0%	1	K.TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR.I
*	TK_050702_lung_E16_NE_2D_step01.4805.4805.3	1.2846	0.188	3152.09	3	1670.0%	1	K.NQAFIEMNTEEAASTMVNYYTSVAPVLR.G
	TK_050702_lung_E16_NE_2D_step02.2159.2159.2	1.4135	0.1744	1032.46	1	6880.0%	1	K.DYGSSPLHR.F
	TK_050702_lung_E16_NE_2D_step08.2547.2547.2	1.1784	0.2757	965.36	1	5000.0%	1	K.HQSVQLPR.E
	TK_050702_lung_E16_NE_2D_step07.3471.3471.2	3.5882	0.6419	2554.78	1	3040.0%	4	K.ENALVQMADGSQAQLAMSHLNGHK.L
UK1CI_HUMAN99.6%61214.1%622619875.2(P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9)
*	TK_050702_lung_E16_NE_2D_step09.3776.3776.3	1.6039	0.201	3265.62	11	1610.0%	1	K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E
*	TK_050702_lung_E16_NE_2D_step08.3591.3591.2	2.2779	0.3839	1839.78	1	5000.0%	3	R.HGVQELEIELQSQLSK.K
*	TK_050702_lung_E16_NE_2D_step01.4089.4089.2	2.4523	0.5018	2904.15	1	3330.0%	1	K.NYSPYYNTIDDLKDQIVDLTVGNNK.T
*	TK_050702_lung_E16_NE_2D_step01.4035.4035.2	2.7072	0.5219	2172.64	1	6470.0%	1	K.SDLEMQYETLQEELMALK.K
UQ99JF899.6%3526923.9%528596979.1(Q99JF8) Lens epithelium-derived growth factor
	TK_050702_lung_E16_NE_2D_step01.2182.2182.1	1.5707	0.2754	845.64	1	6430.0%	3	K.AVDITTPK.A
*	TK_050702_lung_E16_NE_2D_step01.2481.2481.2	4.176	0.68	1924.38	1	6110.0%	2	K.QVDTEEAGMVTAATASNVK.A
	TK_050702_lung_E16_NE_2D_step02.3813.3813.2	4.2283	0.6424	2278.02	1	6050.0%	4	R.CIEALDELASLQVTMQQAQK.H
	TK_050702_lung_E16_NE_2D_step04.3309.3309.2	1.8166	0.2653	1762.34	1	5710.0%	1	R.KGFNEGLWEIDNNPK.V
	TK_050702_lung_E16_NE_2D_step05.2324.2324.1	1.5286	0.0427	710.79	3	8000.0%	1	R.IHAEIK.N
	TK_050702_lung_E16_NE_2D_step09.2480.2480.1	0.9964	0.0027	728.65	4	5000.0%	1	K.KPEVKK.V
	TK_050702_lung_E16_NE_2D_step11.4398.4398.3	1.1823	0.0081	3332.0	47	1430.0%	1	R.CIEALDELASLQVTMQQAQKHTEMITTLK.K
	TK_050702_lung_E16_NE_2D_step01.3175.3175.2	4.2683	0.5083	1635.91	1	6920.0%	1	K.GFNEGLWEIDNNPK.V
	TK_050702_lung_E16_NE_2D_step02.3964.3964.2	2.5005	0.3283	1966.85	1	5290.0%	2	K.NMFLVGEGDSVITQVLNK.S
	TK_050702_lung_E16_NE_2D_step04.2755.2755.1	1.7062	0.2246	1075.87	1	6250.0%	2	K.HTEMITTLK.K
	TK_050702_lung_E16_NE_2D_step01.0155.0155.1	0.7492	0.0206	933.74	32	3570.0%	1	K.VSQVIMEK.S
	TK_050702_lung_E16_NE_2D_step06.4164.4164.2	2.5472	0.3176	1925.61	1	4690.0%	15	K.LPIFFFGTHETAFLGPK.D
UQ9CQ9999.6%1110.4%115116514.5(Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene)
*	TK_050702_lung_E16_NE_2D_step01.3049.3049.1	2.5728	0.4857	1243.03	1	6820.0%	1	K.NIEDVIAQGVGK.L
UTRPS_MOUSE99.6%10149.4%12811410347.6(Q925H1) Zinc finger transcription factor TRPS1
*	TK_050702_lung_E16_NE_2D_step09.3325.3325.3	1.6201	0.1047	2939.86	1	1920.0%	1	K.YEAQGSLTKSHSAQQPVLVSQALDIHK.R
*	TK_050702_lung_E16_NE_2D_step04.2361.2361.2	1.2432	0.0146	1566.37	14	3330.0%	2	K.DKIWTESSTDDLR.G
*	TK_050702_lung_E16_NE_2D_step05.3320.3320.2	1.3308	0.1233	1526.79	218	3080.0%	1	K.LPRGSVINQNDLAK.S
	TK_050702_lung_E16_NE_2D_step08.2444.2444.1	0.7946	0.017	501.46	5	6670.0%	1	K.EEPK.I
*	TK_050702_lung_E16_NE_2D_step05.3174.3174.3	1.6639	0.0175	2832.57	1	2390.0%	1	K.YQYPLFGVPFVHNDFQSEADWLR.F
	TK_050702_lung_E16_NE_2D_step07.4532.4532.2	0.7114	0.0091	1591.84	34	1670.0%	1	K.HLGEITYPFACRK.S
*	TK_050702_lung_E16_NE_2D_step09.3325.3325.2	2.9823	0.5724	1960.25	1	5290.0%	2	K.SHSAQQPVLVSQALDIHK.R
*	TK_050702_lung_E16_NE_2D_step11.3482.3482.3	1.0842	0.0533	2950.29	4	1150.0%	1	R.LSKPKGDLLVNDNPDPAPLSPELQDFK.C
UAPE1_MOUSE99.6%71328.5%316353597.9(P28352) DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP endonuclease 1) (APEX nuclease) (APEN)
*	TK_050702_lung_E16_NE_2D_step08.3687.3687.3	3.1734	0.3958	3101.14	1	2210.0%	3	K.CSENKLPAELQELPGLTHQYWSAPSDK.E
	TK_050702_lung_E16_NE_2D_step01.3589.3589.2	2.1188	0.3957	2246.33	1	4170.0%	1	K.GLDWVKEEAPDILCLQETK.C
*	TK_050702_lung_E16_NE_2D_step01.3770.3770.3	1.3568	0.1318	2706.05	5	1980.0%	1	R.VIVAEFESFVLVTAYVPNAGRGLVR.L
	TK_050702_lung_E16_NE_2D_step10.3658.3658.2	1.2633	0.3196	2194.46	1	2780.0%	1	R.KPLVLCGDLNVAHEEIDLR.N
*	TK_050702_lung_E16_NE_2D_step04.3681.3681.2	1.9442	0.4093	2481.1	1	3100.0%	1	K.LPAELQELPGLTHQYWSAPSDK.E
UQ9P25899.6%112518.8%564604828.7(Q9P258) Hypothetical protein KIAA1470 (Fragment)
*	TK_050702_lung_E16_NE_2D_step06.3344.3344.2	2.3859	0.3089	1636.3	1	5000.0%	1	K.TKDGQILPVPNVVVR.D
*	TK_050702_lung_E16_NE_2D_step02.2655.2655.2	2.2843	0.1299	1483.44	20	3930.0%	2	K.AGGAAVVITEPEHTK.E
*	TK_050702_lung_E16_NE_2D_step09.3269.3269.2	1.7976	0.3528	1292.53	1	5000.0%	1	R.NLGQNLWGPHR.Y
*	TK_050702_lung_E16_NE_2D_step04.2647.2647.2	3.4558	0.5669	1886.22	1	5000.0%	1	R.DVACGANHTLVLDSQKR.V
*	TK_050702_lung_E16_NE_2D_step04.3072.3072.2	3.0511	0.4625	1933.35	1	4720.0%	4	R.TVVSGSCAAHSLLITTEGK.L
*	TK_050702_lung_E16_NE_2D_step01.1855.1855.1	0.6785	0.0728	822.57	183	3330.0%	1	K.LEGSKCK.G
*	TK_050702_lung_E16_NE_2D_step03.3906.3906.2	1.5156	0.3113	2398.3	1	2620.0%	1	K.TLDGIFSEQVAMGYSHSLVIAR.D
UQ9DBI199.6%3115720.6%554608689.7(Q9DBI1) Heterochromatin protein 2, binding protein 3
*	TK_050702_lung_E16_NE_2D_step01.3166.3166.1	0.82	0.2424	1555.92	4	1920.0%	1	R.AQRQTPMASSPRPK.M
	TK_050702_lung_E16_NE_2D_step06.2129.2129.1	0.3012	0.0062	572.03	10	2500.0%	1	R.ETPPK.S
	TK_050702_lung_E16_NE_2D_step11.3663.3663.2	0.9322	0.2211	1986.68	2	1940.0%	1	K.ALPLIVGAQLIHADKLGEK.A
*	TK_050702_lung_E16_NE_2D_step10.5183.5183.2	1.2838	0.0169	2231.09	12	2500.0%	10	K.YVLENHPGANSNYQMHLLK.K
*	TK_050702_lung_E16_NE_2D_step01.2363.2363.1	2.1623	0.1299	1080.23	4	6000.0%	1	K.GASGSFVVVQK.S
	TK_050702_lung_E16_NE_2D_step06.2592.2592.2	1.0912	0.1809	1178.33	3	4380.0%	1	R.KYVSQYYPK.L
	TK_050702_lung_E16_NE_2D_step05.1694.1694.1	0.4267	0.0078	538.09	1	3750.0%	1	K.KAPPK.A
*	TK_050702_lung_E16_NE_2D_step09.2540.2540.2	1.9891	0.1679	955.13	27	5000.0%	1	K.ARPSPSVIK.K
	TK_050702_lung_E16_NE_2D_step05.3774.3774.2	4.0798	0.5711	1561.27	1	8210.0%	6	K.ALPLIVGAQLIHADK.L
*	TK_050702_lung_E16_NE_2D_step01.3630.3630.1	1.8472	0.2236	1276.37	1	6000.0%	2	K.LEDVLPLAFTR.L
*	TK_050702_lung_E16_NE_2D_step02.2253.2253.1	0.9226	0.0147	1267.86	182	1820.0%	1	K.KGSALDPEPQVK.L
URBB4_MOUSE99.6%354.1%461517715.1(Q60972) Chromatin assembly factor 1 subunit C (CAF-1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF-I 48 kDa subunit) (CAF-Ip48) (Retinoblastoma binding protein p48) (Retinoblastoma-binding protein 4) (RBBP-4)
	TK_050702_lung_E16_NE_2D_step01.3107.3107.1	2.1837	0.4616	1473.96	1	5830.0%	2	K.TPSSDVLVFDYTK.H
	TK_050702_lung_E16_NE_2D_step02.4436.4436.1	0.8522	0.0072	738.95	1	4000.0%	1	R.LRGHQK.E
UQ9CX8699.6%112408436.7%305305309.3(Q9CX86) 3010025E17Rik protein
	TK_050702_lung_E16_NE_2D_step04.3473.3473.3	1.5256	0.0359	3995.72	5	1460.0%	1	K.LFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTK.R
	TK_050702_lung_E16_NE_2D_step11.4495.4495.2	4.9377	0.6507	2323.48	1	6250.0%	59	R.GHFEAFGTLTDCVVVVNPQTK.R
*	TK_050702_lung_E16_NE_2D_step02.3348.3348.2	2.6872	0.5373	1692.04	1	6430.0%	10	R.GFGFVYFQSHDAADK.A
	TK_050702_lung_E16_NE_2D_step02.3425.3425.2	2.4885	0.3316	1693.74	1	5670.0%	4	K.LFIGGLNVQTSESGLR.G
	TK_050702_lung_E16_NE_2D_step08.3662.3662.3	3.1518	0.5423	3405.11	1	2100.0%	14	R.CFGFVTYSNVEEADAAMAASPHAVDGNTVELK.R
*	TK_050702_lung_E16_NE_2D_step02.3203.3203.2	2.3223	0.4759	2152.1	1	3680.0%	11	K.GDVAEGDLIEHFSQFGAVEK.A
	TK_050702_lung_E16_NE_2D_step08.3146.3146.1	1.928	0.1856	863.87	1	6430.0%	13	K.KLFVGGLK.G
UQ9CYQ199.6%112.4%546597459.3(Q9CYQ1) 3930401K13Rik protein
	TK_050702_lung_E16_NE_2D_step01.3742.3742.1	1.9479	0.4367	1553.19	1	6250.0%	1	R.FQQAVDAVEEFLR.R
URL4_MOUSE99.6%122021.5%4194715411.0(Q9D8E6) 60S ribosomal protein L4 (L1)
	TK_050702_lung_E16_NE_2D_step07.3147.3147.2	2.1889	0.3493	1763.38	1	5000.0%	1	R.RGPCIIYNEDNGIIK.A
	TK_050702_lung_E16_NE_2D_step05.2534.2534.2	2.4537	0.3142	1105.15	1	7500.0%	1	K.SNYNLPMHK.M
	TK_050702_lung_E16_NE_2D_step01.3593.3593.2	2.7892	0.5573	2186.3	1	5830.0%	1	R.IEEVPELPLVVEDKVEGYK.K
	TK_050702_lung_E16_NE_2D_step03.3182.3182.2	1.0655	0.023	1280.6	14	4440.0%	1	R.KLDELYGTWR.K
	TK_050702_lung_E16_NE_2D_step01.3165.3165.1	1.377	0.2982	990.11	4	5000.0%	1	K.NVTLPAVFK.A
	TK_050702_lung_E16_NE_2D_step04.2681.2681.1	2.5984	0.4731	1189.93	1	6820.0%	3	K.KLEAAATALATK.S
	TK_050702_lung_E16_NE_2D_step12.4129.4129.2	1.2733	0.0671	1864.23	1	3330.0%	1	K.APIRPDIVNFVHTNLR.K
UEVI1_MOUSE99.6%5135.2%10421168486.7(P14404) Ecotropic virus integration 1 site protein
*	TK_050702_lung_E16_NE_2D_step05.3343.3343.2	2.9622	0.5293	2285.19	1	4250.0%	2	K.TSMVNMSHANPGLADYFGTNR.H
*	TK_050702_lung_E16_NE_2D_step08.3286.3286.3	1.5091	0.1048	3490.12	6	1560.0%	3	K.DSLHPTSHSSSNVWHSMARAAAESSAIQSISHV.-
URU17_MOUSE99.6%8815.1%3784372310.1(Q62376) U1 small nuclear ribonucleoprotein 70 kDa (U1 SNRNP 70 kDa) (snRNP70) (Fragment)
	TK_050702_lung_E16_NE_2D_step07.2640.2640.1	1.6956	0.4749	877.77	1	7500.0%	1	R.IHMVYSK.R
	TK_050702_lung_E16_NE_2D_step01.1001.1001.1	0.5402	0.0089	560.44	3	3750.0%	1	R.GRTVK.G
	TK_050702_lung_E16_NE_2D_step05.2711.2711.1	1.6841	0.2997	985.93	8	5000.0%	1	R.RVLVDVER.G
	TK_050702_lung_E16_NE_2D_step04.2088.2088.1	0.2434	0.0	1239.57	8	560.0%	1	R.REFEVYGPIK.R
	TK_050702_lung_E16_NE_2D_step04.3028.3028.2	2.3723	0.4581	1414.88	1	8000.0%	1	R.GYAFIEYEHER.D
	TK_050702_lung_E16_NE_2D_step01.2853.2853.1	1.8164	0.2375	1081.93	1	6880.0%	1	R.EFEVYGPIK.R
	TK_050702_lung_E16_NE_2D_step01.2591.2591.2	2.5889	0.4239	1844.32	1	6330.0%	1	K.MWDPHNDPNAQGDAFK.T
URS3A_MOUSE99.6%61019.8%263297549.7(P97351) 40S ribosomal protein S3a
	TK_050702_lung_E16_NE_2D_step04.3799.3799.2	1.5446	0.2154	1954.31	4	3440.0%	1	R.VFEVSLADLQNDEVAFR.K
	TK_050702_lung_E16_NE_2D_step05.3166.3166.2	3.909	0.4801	1579.89	1	8330.0%	2	K.NCLTNFHGMDLTR.D
	TK_050702_lung_E16_NE_2D_step11.2318.2318.1	0.2403	0.0	1040.68	3	710.0%	1	K.KMMEIMTR.E
	TK_050702_lung_E16_NE_2D_step03.3516.3516.2	3.1327	0.4264	1707.21	1	6150.0%	2	K.ACQSIYPLHDVFVR.K
UQ9CRB299.6%3346.4%153172478.4(Q9CRB2) 2410130M07Rik protein (RIKEN cDNA 2410130M07 gene)
*	TK_050702_lung_E16_NE_2D_step01.3586.3586.2	3.2073	0.5732	1749.42	1	6670.0%	1	K.ELLVNLNPIAQPLASR.R
*	TK_050702_lung_E16_NE_2D_step12.2361.2361.2	1.9108	0.3603	2524.86	1	3160.0%	1	K.RPTCVIMVKPHEEYQETYDK.C
*	TK_050702_lung_E16_NE_2D_step11.4125.4125.3	4.8814	0.5883	4019.54	1	2210.0%	1	K.GIMVLAGDTLPIEVYCHLPVLCEDQNLPYVYIPSK.T
UQ1498099.6%333.3%21152382725.8(Q14980) NuMA protein
	TK_050702_lung_E16_NE_2D_step13.3897.3897.2	1.3047	0.1101	2530.61	2	2140.0%	1	K.TCYPLESRPSLSLGTITDEEMK.T
	TK_050702_lung_E16_NE_2D_step05.2539.2539.2	4.6714	0.6083	1725.91	1	7860.0%	1	K.HLCQQLQAEQAAAEK.R
	TK_050702_lung_E16_NE_2D_step05.3402.3402.3	1.7768	0.1865	3341.35	5	1690.0%	1	R.ATSSTQSLARLGSPDYGNSALLSLPGYRPTTR.S
UQ9CY4099.6%115924.6%122131848.8(Q9CY40) Hemoglobin, beta adult major chain
	TK_050702_lung_E16_NE_2D_step12.4725.4725.3	5.6474	0.562	2995.18	1	3710.0%	1	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK_050702_lung_E16_NE_2D_step10.5148.5148.3	5.6014	0.5774	2866.14	1	3480.0%	7	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UHBB1_MOUSE99.6%3518762.3%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major)
	TK_050702_lung_E16_NE_2D_step06.2837.2837.1	1.95	0.0093	1138.8	6	5450.0%	3	K.VVAGVATALAHK.Y
	TK_050702_lung_E16_NE_2D_step02.2839.2839.2	1.0015	0.0537	1465.92	4	5000.0%	1	K.GTFASLSELHCDK.L
*	TK_050702_lung_E16_NE_2D_step01.2729.2729.1	1.7204	0.1696	994.05	14	5620.0%	2	K.AAVSCLWGK.V
	TK_050702_lung_E16_NE_2D_step01.3385.3385.1	1.3354	0.0623	1129.17	2	5620.0%	1	K.LHVDPENFR.L
	TK_050702_lung_E16_NE_2D_step01.2498.2498.1	3.096	0.4596	1298.08	1	6360.0%	2	K.DFTPAAQAAFQK.V
	TK_050702_lung_E16_NE_2D_step11.4594.4594.2	1.7916	0.2705	2573.26	3	2380.0%	1	K.GTFASLSELHCDKLHVDPENFR.L
	TK_050702_lung_E16_NE_2D_step02.3487.3487.2	1.4781	0.1268	1984.33	1	3890.0%	6	R.YFDSFGDLSSASAIMGNAK.V
	TK_050702_lung_E16_NE_2D_step10.3610.3610.2	3.0719	0.5061	1887.94	1	5000.0%	10	K.KVITAFNDGLNHLDSLK.G
UQ8QZY999.6%92924.5%424443568.6(Q8QZY9) Splicing factor 3b, subunit 4, 49kD (Hypothetical 44.4 kDa protein)
	TK_050702_lung_E16_NE_2D_step01.0432.0432.2	1.1337	0.0992	1915.85	39	1880.0%	1	K.LLYDTFSAFGVILQTPK.I
	TK_050702_lung_E16_NE_2D_step02.3780.3780.2	3.1675	0.5006	2186.88	1	5000.0%	1	K.NLDVGANIFIGNLDPEIDEK.L
	TK_050702_lung_E16_NE_2D_step13.3470.3470.3	0.8987	0.0126	3436.86	46	1210.0%	1	R.VTGQHQGYGFVEFLSEEDADYAIKIMNMIK.L
	TK_050702_lung_E16_NE_2D_step01.2455.2455.1	1.1765	0.0889	1509.86	1	4230.0%	1	R.NQDATVYVGGLDEK.V
	TK_050702_lung_E16_NE_2D_step11.4345.4345.2	3.1869	0.6002	2608.75	1	4090.0%	5	K.VSEPLLWELFLQAGPVVNTHMPK.D
UQ99KG399.6%112911.4%9301034945.9(Q99KG3) Similar to RNA binding motif protein 10
	TK_050702_lung_E16_NE_2D_step06.3361.3361.2	2.2534	0.2841	1771.3	1	5000.0%	3	R.WMEANQHSLNILGQK.V
*	TK_050702_lung_E16_NE_2D_step04.3448.3448.3	1.9685	0.1953	3223.35	5	1440.0%	4	K.GPGMTGTKGDPAGTGPEASLEAGADSVSLQAFSR.A
	TK_050702_lung_E16_NE_2D_step11.4127.4127.2	4.7679	0.5789	2830.67	1	4810.0%	1	R.NLNPHSTMDSILGALAPYAVLSSSNVR.V
	TK_050702_lung_E16_NE_2D_step01.0434.0434.1	0.4691	0.0071	967.23	8	2140.0%	1	R.MLQAMGWK.E
	TK_050702_lung_E16_NE_2D_step02.2348.2348.1	0.9496	0.1569	656.71	36	5000.0%	1	K.LPLGTR.L
	TK_050702_lung_E16_NE_2D_step13.2289.2289.2	0.7608	0.0264	1729.22	423	1330.0%	1	K.YGGISTASVDFEQPTR.D
UQ9CWK399.6%4614.9%342376944.6(Q9CWK3) 2410024K20Rik protein (RIKEN cDNA 2410024K20 gene)
*	TK_050702_lung_E16_NE_2D_step03.3850.3850.3	3.0246	0.4742	3537.11	1	1950.0%	2	R.AQGSHDPTPPPSLDMFAEEVAEGELETPTPTQR.E
	TK_050702_lung_E16_NE_2D_step06.2767.2767.2	1.3055	0.0398	1450.92	9	3750.0%	1	R.KLDPPGGQFYNSK.R
*	TK_050702_lung_E16_NE_2D_step08.0692.0692.1	0.479	0.0196	495.0	2	2500.0%	1	K.GSNSK.G
UFUS_MOUSE99.6%58145621.2%518526739.4(P56959) RNA-binding protein FUS (Pigpen protein)
	TK_050702_lung_E16_NE_2D_step01.2097.2097.1	1.3403	0.1463	892.76	3	5710.0%	2	K.EFSGNPIK.V
	TK_050702_lung_E16_NE_2D_step03.4072.4072.3	4.3732	0.5837	3590.41	1	2500.0%	37	R.HDSEQDNSDNNTIFVQGLGENVTIESVADYFK.Q
	TK_050702_lung_E16_NE_2D_step10.2563.2563.2	3.136	0.5221	2256.87	1	3040.0%	4	K.APKPDGPGGGPGGSHMGGNYGDDR.R
	TK_050702_lung_E16_NE_2D_step07.2676.2676.1	0.731	0.1457	739.0	6	4290.0%	1	R.GGMGGSDR.G
	TK_050702_lung_E16_NE_2D_step04.2692.2692.2	2.543	0.3573	1663.65	1	6000.0%	7	K.LKGEATVSFDDPPSAK.A
	TK_050702_lung_E16_NE_2D_step05.3024.3024.1	1.7341	0.1763	1539.01	1	5420.0%	3	K.KTGQPMINLYTDR.E
	TK_050702_lung_E16_NE_2D_step01.3161.3161.1	1.3697	0.092	1025.27	5	5620.0%	2	K.AAIDWFDGK.E
UUBF1_MOUSE99.6%132512.8%765895095.8(P25976) Nucleolar transcription factor 1 (Upstream binding factor 1) (UBF-1)
	TK_050702_lung_E16_NE_2D_step06.2848.2848.2	2.5785	0.3399	1583.79	1	5830.0%	1	R.FREDHPDLIQNAK.K
	TK_050702_lung_E16_NE_2D_step01.4057.4057.2	3.6763	0.4745	1785.32	1	6540.0%	1	R.WSQEDMLTLLECMK.N
	TK_050702_lung_E16_NE_2D_step05.2908.2908.2	2.7529	0.5154	1432.15	1	7000.0%	1	K.TPQQLWYTHEK.K
	TK_050702_lung_E16_NE_2D_step12.3269.3269.2	1.4358	0.1744	1541.74	2	3750.0%	1	K.RPVSAMFIFSEEK.R
	TK_050702_lung_E16_NE_2D_step04.2808.2808.1	1.3519	0.2457	1468.88	4	3750.0%	1	K.HPELNISEEGITK.S
	TK_050702_lung_E16_NE_2D_step01.0584.0584.1	0.4745	0.0886	704.19	7	2500.0%	1	K.EHYKK.L
	TK_050702_lung_E16_NE_2D_step03.1405.1405.1	0.2434	0.0	821.66	1	1000.0%	1	K.LMWIKK.A
	TK_050702_lung_E16_NE_2D_step09.3842.3842.2	1.3989	0.2616	2037.83	1	4060.0%	4	K.RAEEIWQQSVIGDYLAR.F
	TK_050702_lung_E16_NE_2D_step06.2480.2480.1	0.937	0.4071	740.57	1	4000.0%	1	K.HPDFPK.K
UQ8VHR599.6%174721.7%594654119.7(Q8VHR5) Transcription repressor p66
	TK_050702_lung_E16_NE_2D_step01.2986.2986.2	1.5331	0.1033	1575.28	1	5000.0%	1	K.DLANLEVPHELPTK.Q
*	TK_050702_lung_E16_NE_2D_step12.2091.2091.2	1.2089	0.2337	1751.56	2	3670.0%	1	K.LPSRPGAQGIEPQNMR.T
	TK_050702_lung_E16_NE_2D_step02.2469.2469.2	1.6915	0.3187	1394.49	1	4170.0%	1	R.VIAPNPAQLQGQR.G
	TK_050702_lung_E16_NE_2D_step03.0745.0745.1	0.5681	0.0058	627.94	2	2500.0%	1	K.GYEEK.L
	TK_050702_lung_E16_NE_2D_step08.2894.2894.3	2.6515	0.2746	2517.64	1	3120.0%	2	K.TPVVQNAASIVQPSPAHVGQQGLSK.L
	TK_050702_lung_E16_NE_2D_step05.2696.2696.3	1.4359	0.0469	1987.63	1	2760.0%	1	R.LQQQAALSPTTAPAVSSVSK.Q
	TK_050702_lung_E16_NE_2D_step08.3423.3423.2	3.8252	0.5505	2265.5	1	4000.0%	5	R.TTSSAIYMNLASHIQPGTVNR.V
	TK_050702_lung_E16_NE_2D_step08.3198.3198.2	1.4293	0.2987	1689.47	2	3570.0%	2	R.SATNTTLPHMLMSQR.V
UQ99LI499.6%134522.3%399413499.2(Q99LI4) Similar to nucleolar phosphoprotein p130
*	TK_050702_lung_E16_NE_2D_step12.2455.2455.2	1.1516	0.2413	1722.97	1	2810.0%	2	K.KAGPYSSVPPPSVPLPK.K
	TK_050702_lung_E16_NE_2D_step06.1679.1679.1	0.9988	0.0491	572.43	8	6250.0%	1	K.KTVPK.K
	TK_050702_lung_E16_NE_2D_step01.0837.0837.1	1.0407	0.1315	534.32	2	7500.0%	1	K.TVVSK.T
*	TK_050702_lung_E16_NE_2D_step01.3605.3605.1	1.2403	0.2092	1371.39	1	5450.0%	1	R.VVPSDLYPLVLR.F
*	TK_050702_lung_E16_NE_2D_step11.3402.3402.2	0.791	0.0356	1528.26	8	2500.0%	1	R.RVVPSDLYPLVLR.F
	TK_050702_lung_E16_NE_2D_step01.4155.4155.2	5.3185	0.5841	2501.88	1	5450.0%	6	K.ATGATQQDANASSLLDIYSFWLK.S
*	TK_050702_lung_E16_NE_2D_step10.3705.3705.2	1.073	0.1398	2491.65	1	2200.0%	1	K.VANGKAAASSSSSSSSSSSDDSEEEK.K
UQ9JII599.6%133327.7%405430808.7(Q9JII5) DAZ-associated protein 1
	TK_050702_lung_E16_NE_2D_step11.4013.4013.3	1.7734	0.2519	3102.67	3	1440.0%	1	R.GFGFITFEDEQSVDQAVNMHFHDIMGK.K
	TK_050702_lung_E16_NE_2D_step01.3037.3037.2	1.1202	0.0941	1700.34	1	3570.0%	1	K.FGVVTEVVMIYDAEK.Q
	TK_050702_lung_E16_NE_2D_step05.3764.3764.2	1.6	0.2865	1928.17	5	2670.0%	4	R.SYFSQYGEVVDCVIMK.D
	TK_050702_lung_E16_NE_2D_step04.2220.2220.2	1.0381	0.0119	1198.88	36	2780.0%	1	R.NIDPKPCTPR.G
	TK_050702_lung_E16_NE_2D_step05.3076.3076.2	2.7267	0.4057	1800.93	1	7000.0%	3	K.IFVGGIPHNCGETELR.E
*	TK_050702_lung_E16_NE_2D_step02.2144.2144.2	2.5306	0.501	1544.36	1	5360.0%	2	K.NQAPGQPGASQWGSR.V
	TK_050702_lung_E16_NE_2D_step12.2113.2113.2	1.5992	0.0982	1553.35	1	5000.0%	1	R.GQNHNVQGFHPYR.R
UQ922M799.6%103031.5%232260319.5(Q922M7) Similar to hypothetical protein MGC5509
*	TK_050702_lung_E16_NE_2D_step08.3563.3563.2	2.2922	0.5088	1764.34	1	6000.0%	4	R.LKPLAQIGSTSDAFWK.S
	TK_050702_lung_E16_NE_2D_step07.3293.3293.2	2.5317	0.5572	1709.89	1	5670.0%	3	K.RPLIVFDGSSTSTSIK.V
*	TK_050702_lung_E16_NE_2D_step11.4154.4154.2	1.4223	0.2271	3041.81	2	2000.0%	1	R.SCTDAELLLHPELLSQEFLLLTLEQK.N
*	TK_050702_lung_E16_NE_2D_step11.3829.3829.2	1.9423	0.4471	1680.03	1	4290.0%	2	R.ISPLVLFSNLPVNHK.M
UQ9D1A599.6%3522.1%154182249.0(Q9D1A5) DNA segment, Chr 13, Wayne state University 177, expressed
	TK_050702_lung_E16_NE_2D_step11.3929.3929.2	1.7605	0.3985	2119.03	1	4060.0%	1	K.RFYPTEWQAFIDSLQSK.K
	TK_050702_lung_E16_NE_2D_step04.3112.3112.2	3.4633	0.5039	1903.55	1	5310.0%	2	R.KPYVVNDLEAEASLPEK.K
USP18_MOUSE99.6%83422.9%153175959.4(O55128) Sin3 associated polypeptide p18
	TK_050702_lung_E16_NE_2D_step01.3847.3847.2	3.711	0.5151	1835.62	1	6330.0%	3	K.FQIGDYLDIAITPPNR.A
	TK_050702_lung_E16_NE_2D_step05.4012.4012.2	2.78	0.5891	2155.97	1	3890.0%	5	R.GNVPSSELQIYTWMDATLK.E
UCABA_MOUSE99.6%88140834.4%285308317.9(Q99020) CARG-binding factor-A (CBF-A)
*	TK_050702_lung_E16_NE_2D_step12.3340.3340.2	1.5485	0.292	1659.87	1	3080.0%	19	R.GFVFITFKEEDPVK.K
	TK_050702_lung_E16_NE_2D_step01.1557.1557.1	0.5516	0.0484	573.02	16	3750.0%	1	R.VIDPK.K
	TK_050702_lung_E16_NE_2D_step01.2846.2846.2	2.9438	0.2503	1506.54	3	6150.0%	1	K.IFVGGLNPEATEEK.I
	TK_050702_lung_E16_NE_2D_step05.3390.3390.2	2.5503	0.3576	1458.17	1	6250.0%	3	K.MFVGGLSWDTSKK.D
	TK_050702_lung_E16_NE_2D_step02.3952.3952.1	1.5217	0.0829	931.16	1	5710.0%	6	R.GFGFILFK.D
	TK_050702_lung_E16_NE_2D_step03.3881.3881.1	1.2722	0.0606	960.94	3	6430.0%	5	R.GFVFITFK.E
	TK_050702_lung_E16_NE_2D_step06.2227.2227.1	1.1138	0.1122	864.72	1	5000.0%	6	K.FHTVSGSK.C
*	TK_050702_lung_E16_NE_2D_step02.3916.3916.2	5.5811	0.5913	2199.23	1	6670.0%	30	R.EYFGQFGEIEAIELPIDPK.L
	TK_050702_lung_E16_NE_2D_step05.3068.3068.3	3.3376	0.3958	1634.45	3	4460.0%	2	K.KIFVGGLNPEATEEK.I
	TK_050702_lung_E16_NE_2D_step01.0700.0700.1	0.8864	0.1335	674.17	3	6250.0%	1	K.DYFTK.F
	TK_050702_lung_E16_NE_2D_step01.3289.3289.1	2.1296	0.0805	1330.13	1	5000.0%	2	K.MFVGGLSWDTSK.K
	TK_050702_lung_E16_NE_2D_step12.1668.1668.1	1.8873	0.3489	992.51	1	6250.0%	2	K.KFHTVSGSK.C
	TK_050702_lung_E16_NE_2D_step01.2578.2578.1	2.3059	0.4117	1169.61	1	7220.0%	2	K.FGEVVDCTIK.M
UU2AF_MOUSE99.6%51119.2%475535179.1(P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit)
	TK_050702_lung_E16_NE_2D_step04.3716.3716.2	1.752	0.0036	2388.21	1	4050.0%	3	R.SVDETTQAMAFDGIIFQGQSLK.I
	TK_050702_lung_E16_NE_2D_step12.4720.4720.3	2.9247	0.4346	3562.63	1	2110.0%	1	R.RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK.L
	TK_050702_lung_E16_NE_2D_step02.3531.3531.3	1.5772	0.0708	3825.6	2	1360.0%	1	K.DSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDK.K
UCUG1_MOUSE99.6%113.7%486521078.5(P28659) CUG triplet repeat RNA-binding protein 1 (CUG-BP1) (RNA-binding protein BRUNOL-2) (Deadenylation factor CUG-BP) (Deadenylation factor EDEN-BP) (Brain protein F41)
	TK_050702_lung_E16_NE_2D_step05.2682.2682.2	4.2213	0.5547	1993.79	1	6180.0%	1	K.AMHQAQTMEGCSSPMVVK.F
URS12_MOUSE99.6%82229.0%131143947.2(P09388) 40S ribosomal protein S12
	TK_050702_lung_E16_NE_2D_step04.2748.2748.2	1.9025	0.3908	1067.67	1	7780.0%	2	K.TALIHDGLAR.G
	TK_050702_lung_E16_NE_2D_step07.3277.3277.2	1.9075	0.4154	1191.53	1	5000.0%	1	K.KLGEWVGLCK.I
*	TK_050702_lung_E16_NE_2D_step07.3131.3131.2	1.1499	0.229	2138.17	4	2940.0%	4	R.QAHLCVLASNCDEPMYVK.L
UQ9CVL799.6%174328.4%282321459.5(Q9CVL7) 1810019E15Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step01.3195.3195.1	1.2952	0.0733	1235.49	2	5560.0%	2	K.SICEVLDLER.S
	TK_050702_lung_E16_NE_2D_step07.2959.2959.2	2.344	0.2398	1449.28	1	5830.0%	2	K.LLYNRPGTVSSLK.K
	TK_050702_lung_E16_NE_2D_step08.3406.3406.2	1.9427	0.362	1486.4	1	5420.0%	2	K.KNVGQFSGFPFEK.G
	TK_050702_lung_E16_NE_2D_step03.1497.1497.1	0.1138	0.0291	464.02	1	1670.0%	1	K.ELIS.-
*	TK_050702_lung_E16_NE_2D_step01.2746.2746.2	2.0619	0.3631	1763.76	1	6920.0%	1	K.EVYENYPAYDLTER.K
	TK_050702_lung_E16_NE_2D_step11.2697.2697.1	0.927	0.0748	880.46	1	5000.0%	1	K.FRNAMLK.S
	TK_050702_lung_E16_NE_2D_step04.2420.2420.1	1.1477	0.0123	650.85	18	6250.0%	1	R.KDFIK.T
*	TK_050702_lung_E16_NE_2D_step04.3215.3215.2	4.3859	0.5969	1577.77	1	8460.0%	5	K.KLLADANLEEVTMK.Q
URL6_MOUSE99.6%122620.2%2873261210.8(P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107)
*	TK_050702_lung_E16_NE_2D_step05.4110.4110.2	2.3198	0.3983	1530.15	1	5360.0%	3	R.SSITPGTVLIILTGR.H
*	TK_050702_lung_E16_NE_2D_step03.3058.3058.2	1.8433	0.4235	1512.18	1	5830.0%	3	R.SQFSLTNGMYPHK.L
*	TK_050702_lung_E16_NE_2D_step01.2117.2117.1	1.5855	0.1851	731.79	1	8330.0%	1	K.VLATVTK.T
	TK_050702_lung_E16_NE_2D_step04.2840.2840.1	2.0257	0.3703	994.85	1	7860.0%	2	K.HLTDAYFK.K
*	TK_050702_lung_E16_NE_2D_step08.0466.0466.1	1.3766	0.1259	643.67	2	6000.0%	1	K.KPAAKK.A
*	TK_050702_lung_E16_NE_2D_step01.3045.3045.1	1.8172	0.1752	997.11	7	5620.0%	1	K.AVDLQILPK.I
UQ9CT1799.6%82214.2%3653983311.8(Q9CT17) 2610019N13Rik protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.3463.3463.2	2.111	0.4135	1816.6	1	3120.0%	1	R.ALIVVPYAEGVIPDETK.A
	TK_050702_lung_E16_NE_2D_step08.3059.3059.2	3.6423	0.5907	1407.41	1	7690.0%	2	K.LNHVAAGLVSPSLK.S
	TK_050702_lung_E16_NE_2D_step07.3477.3477.2	3.1826	0.5693	2371.06	1	4250.0%	4	K.FHDPDSAVVAQHLTNTVFVDR.A
UQ9Z2N899.6%4616.1%429474305.6(Q9Z2N8) BAF53a
	TK_050702_lung_E16_NE_2D_step04.3532.3532.3	2.1367	0.1916	3094.28	1	2410.0%	2	R.STGLILDSGATHTTAIPVHDGYVLQQGIVK.S
	TK_050702_lung_E16_NE_2D_step02.4439.4439.3	0.8268	0.0702	1921.17	1	1560.0%	1	K.QGGPTYYIDTNALRVPR.E
	TK_050702_lung_E16_NE_2D_step05.3148.3148.3	1.3142	0.0119	2523.53	1	2500.0%	1	K.MHVKSEASLHPVLMSEAPWNTR.A
UHMG2_MOUSE99.6%7366350.2%209240317.3(P30681) High mobility group protein 2 (HMG-2)
*	TK_050702_lung_E16_NE_2D_step13.5342.5342.2	2.6365	0.3657	1955.12	1	4670.0%	1	K.RPPSAFFLFCSENRPK.I
	TK_050702_lung_E16_NE_2D_step01.0428.0428.1	1.2387	0.1331	1106.67	2	5620.0%	1	R.EMKNYVPPK.G
	TK_050702_lung_E16_NE_2D_step04.2320.2320.2	1.6633	2.0E-4	1466.84	2	5830.0%	13	K.HPDSSVNFAEFSK.K
*	TK_050702_lung_E16_NE_2D_step03.2560.2560.1	1.9426	0.2738	938.87	1	6430.0%	2	K.SKFEDLAK.S
*	TK_050702_lung_E16_NE_2D_step02.2688.2688.1	2.3707	0.1767	1339.99	1	5830.0%	7	K.IEHPGLSIGDTAK.K
*	TK_050702_lung_E16_NE_2D_step10.3273.3273.2	3.1144	0.4554	1582.6	1	6430.0%	17	K.IKIEHPGLSIGDTAK.K
*	TK_050702_lung_E16_NE_2D_step05.4810.4810.3	1.3346	0.1291	3403.88	35	1440.0%	2	K.KNEPEDEEEEEEEEEEEDDEEEEEDEE.-
	TK_050702_lung_E16_NE_2D_step03.2045.2045.2	0.8972	0.0428	1018.73	43	2500.0%	2	K.NYVPPKGDK.K
	TK_050702_lung_E16_NE_2D_step04.2871.2871.2	4.4125	0.581	1396.0	1	8640.0%	2	K.KLGEMWSEQSAK.D
	TK_050702_lung_E16_NE_2D_step06.3145.3145.2	1.9405	0.0249	1595.01	1	4620.0%	2	K.HPDSSVNFAEFSKK.C
	TK_050702_lung_E16_NE_2D_step08.3191.3191.2	0.8975	0.0052	1593.49	46	2690.0%	1	K.KHPDSSVNFAEFSK.K
UPL10_MOUSE99.6%4103.6%660731417.2(P16381) Putative ATP-dependent RNA helicase PL10
	TK_050702_lung_E16_NE_2D_step09.3969.3969.2	3.419	0.5924	2084.2	1	5940.0%	3	K.HVINFDLPSDIEEYVHR.I
	TK_050702_lung_E16_NE_2D_step08.2876.2876.1	1.5889	0.0272	791.85	3	5830.0%	1	K.HAIPIIK.E
UQ9D8Q199.6%116.9%2172359411.0(Q9D8Q1) 3100001N19Rik protein
	TK_050702_lung_E16_NE_2D_step01.2627.2627.1	1.7068	0.4349	1241.18	1	5710.0%	1	K.AAIAAAAAAAAAKAK.V
UPTB_MOUSE99.6%2711729.4%527564788.3(P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)
	TK_050702_lung_E16_NE_2D_step02.4036.4036.3	1.9842	0.1719	3180.88	1	2410.0%	5	K.NQAFIEMNTEEAANTMVNYYTSVAPVLR.G
	TK_050702_lung_E16_NE_2D_step07.3745.3745.2	2.0209	0.3578	2245.02	1	3160.0%	6	K.NNQFQALLQYADPVSAQHAK.L
	TK_050702_lung_E16_NE_2D_step13.4817.4817.3	1.9904	0.3491	3507.45	1	1750.0%	1	K.MALIQMGSVEEAVQALIELHNHDLGENHHLR.V
*	TK_050702_lung_E16_NE_2D_step05.2767.2767.3	2.0462	0.1025	1853.06	9	2810.0%	1	R.EVSAHYTVQASECAAAR.E
	TK_050702_lung_E16_NE_2D_step07.3852.3852.3	1.1169	0.1295	2983.44	21	1060.0%	1	K.NFQNIFPPSATLHLSNIPPSVSEDDLK.S
	TK_050702_lung_E16_NE_2D_step03.3866.3866.2	2.3345	0.4493	2087.95	1	3680.0%	6	R.KLPSDVTEGEVISLGLPFGK.V
	TK_050702_lung_E16_NE_2D_step05.3002.3002.2	2.8342	0.0746	1433.88	1	7730.0%	3	R.GQPIYIQFSNHK.E
UQ91V8699.6%4108.2%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence)
*	TK_050702_lung_E16_NE_2D_step07.2947.2947.2	2.5097	0.5566	1108.24	1	7270.0%	3	K.VVAGVAAALAHK.Y
UBUB3_MOUSE99.6%62618.1%326369856.7(Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5)
	TK_050702_lung_E16_NE_2D_step02.4063.4063.3	6.1374	0.736	4432.98	1	2950.0%	5	R.YPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIR.Q
	TK_050702_lung_E16_NE_2D_step02.3805.3805.2	1.5114	0.15	2172.94	1	3890.0%	1	K.FSPNTSQFLLVSSWDTSVR.L
UQ9QUS399.6%6124.4%12171415557.2(Q9QUS3) BAMACAN
	TK_050702_lung_E16_NE_2D_step07.3128.3128.2	3.9795	0.4546	1989.19	1	7330.0%	1	R.LHTLEEEKEELAQYQK.W
	TK_050702_lung_E16_NE_2D_step05.2219.2219.1	0.686	0.176	701.55	10	5000.0%	1	K.YYEVK.N
	TK_050702_lung_E16_NE_2D_step07.3717.3717.2	2.5094	0.5169	1763.32	1	5000.0%	3	R.SLQSLEASLHAMESTR.E
	TK_050702_lung_E16_NE_2D_step02.3609.3609.2	1.0321	0.1394	1860.29	12	2810.0%	1	K.AELGTDLLSQLSLEDQK.R
UACTA_HUMAN99.6%71114.3%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2)
	TK_050702_lung_E16_NE_2D_step01.3155.3155.2	1.8611	0.4266	1791.66	1	4670.0%	1	K.SYELPDGQVITIGNER.F
	TK_050702_lung_E16_NE_2D_step01.2589.2589.1	1.2647	0.0332	1164.14	1	6000.0%	1	K.EITALAPSTMK.I
	TK_050702_lung_E16_NE_2D_step04.3339.3339.2	3.5934	0.4654	1962.15	1	6330.0%	1	K.YPIEHGIITNWDDMEK.I
	TK_050702_lung_E16_NE_2D_step07.2649.2649.2	2.4771	0.4733	1172.89	1	8000.0%	2	R.HQGVMVGMGQK.D
UQ6073599.6%146412.6%443483558.7(Q60735) P62 ras-GAP associated phosphoprotein
	TK_050702_lung_E16_NE_2D_step03.4118.4118.2	3.9711	0.619	2262.98	1	5530.0%	7	K.DSLDPSFTHAMQLLSVEIEK.I
	TK_050702_lung_E16_NE_2D_step02.2415.2415.1	1.1643	0.0035	1042.77	13	4440.0%	3	K.ILGPQGNTIK.R
	TK_050702_lung_E16_NE_2D_step06.0889.0889.1	0.2428	0.0	582.88	3	1000.0%	1	R.GVGPPR.G
	TK_050702_lung_E16_NE_2D_step01.2415.2415.1	1.4567	0.0857	617.0	1	8000.0%	1	K.ISVLGK.G
	TK_050702_lung_E16_NE_2D_step04.3421.3421.2	3.043	0.493	1754.5	1	6540.0%	2	K.KDDEENYLDLFSHK.N
UTR2B_HUMAN99.6%72512.2%2883366611.2(Q15815) Arginine/serine-rich splicing factor 10 (Transformer-2-beta) (HTRA2-beta) (Transformer 2 protein homolog) (Silica-induced protein 41) (RA301) (Q15815) Arginine/serine-rich splicing factor 10 (Transformer-2-beta) (HTRA2-beta) (Transformer 2 protein homolog) (Silica-induced protein 41) (RA301)
	TK_050702_lung_E16_NE_2D_step03.3830.3830.2	2.575	0.4317	2386.5	1	5500.0%	3	R.ANPDPNCCLGVFGLSLYTTER.D
	TK_050702_lung_E16_NE_2D_step02.3676.3676.2	2.744	0.5001	1623.39	1	6920.0%	4	R.GFAFVYFENVDDAK.E
UQ9Z1N599.6%5512.9%428490355.7(Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1)
	TK_050702_lung_E16_NE_2D_step08.2607.2607.1	1.1063	0.0362	1308.94	5	3180.0%	1	K.NCPHIVVGTPGR.I
	TK_050702_lung_E16_NE_2D_step12.2088.2088.2	1.6266	0.477	1434.97	1	4580.0%	1	K.KNCPHIVVGTPGR.I
	TK_050702_lung_E16_NE_2D_step01.4015.4015.2	3.5477	0.4583	2600.84	1	5240.0%	1	R.FEVNISELPDEIDISSYIEQTR.-
	TK_050702_lung_E16_NE_2D_step11.4082.4082.2	2.4831	0.4645	2277.99	1	3950.0%	1	R.CIALAQLLVEQNFPAIAIHR.G
UROK_MOUSE99.6%4938141.2%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein)
	TK_050702_lung_E16_NE_2D_step02.4069.4069.2	2.865	0.5126	1846.74	1	4690.0%	1	R.ILSISADIETIGEILKK.I
	TK_050702_lung_E16_NE_2D_step01.3202.3202.2	3.9142	0.566	1918.11	1	5830.0%	1	R.GSYGDLGGPIITTQVTIPK.D
	TK_050702_lung_E16_NE_2D_step01.3738.3738.1	2.5531	0.3913	1343.09	1	5910.0%	2	K.IILDLISESPIK.G
	TK_050702_lung_E16_NE_2D_step06.2215.2215.3	1.2374	0.1335	2585.58	3	1430.0%	1	K.LFQECCPHSTDRVVLIGGKPDR.V
	TK_050702_lung_E16_NE_2D_step10.2024.2024.3	0.6618	0.0177	1414.99	18	960.0%	1	R.ILLQSKNAGAVIGK.G
	TK_050702_lung_E16_NE_2D_step12.0710.0710.1	0.2401	0.0103	559.33	4	1250.0%	1	R.MPPGR.G
	TK_050702_lung_E16_NE_2D_step01.3581.3581.2	5.4672	0.6144	2593.82	1	5000.0%	7	R.IITITGTQDQIQNAQYLLQNSVK.Q
	TK_050702_lung_E16_NE_2D_step01.2354.2354.1	1.6507	0.114	701.83	2	8000.0%	1	R.ILLQSK.N
	TK_050702_lung_E16_NE_2D_step05.2712.2712.1	1.68	0.0058	1055.89	2	6670.0%	2	R.VVLIGGKPDR.V
	TK_050702_lung_E16_NE_2D_step03.4012.4012.2	2.1235	0.467	3062.87	1	3120.0%	16	R.AQPYDPNFYDETYDYGGFTMMFDDR.R
	TK_050702_lung_E16_NE_2D_step11.2487.2487.2	0.9928	0.0375	1198.22	3	3500.0%	7	R.NLPLPPPPPPR.G
	TK_050702_lung_E16_NE_2D_step11.4907.4907.3	0.8918	0.0519	3980.11	102	760.0%	1	-.METEQPEETFPNTETNGEFGKRPAEDMEEEQAFK.R
	TK_050702_lung_E16_NE_2D_step02.2453.2453.2	2.8577	0.3764	1550.71	1	7270.0%	1	K.LFQECCPHSTDR.V
	TK_050702_lung_E16_NE_2D_step01.2695.2695.1	1.3264	0.2485	873.8	1	6250.0%	1	K.DLAGSIIGK.G
	TK_050702_lung_E16_NE_2D_step04.4147.4147.2	1.3612	0.2192	1716.28	1	4000.0%	2	R.ILSISADIETIGEILK.K
ULA_MOUSE99.6%82211.6%415477569.8(P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog)
	TK_050702_lung_E16_NE_2D_step10.3905.3905.2	4.3243	0.596	2073.55	1	6670.0%	4	K.ICHQIEYYFGDFNLPR.D
	TK_050702_lung_E16_NE_2D_step05.2827.2827.2	3.1376	0.6098	2075.29	1	5000.0%	2	R.SPSRPLPEVTDEYKNDVK.N
	TK_050702_lung_E16_NE_2D_step09.3605.3605.2	1.36	0.1647	1687.91	2	3460.0%	1	R.EDLHFLFSNHGEIK.W
	TK_050702_lung_E16_NE_2D_step04.2707.2707.2	3.7006	0.493	1618.99	1	6540.0%	1	R.SPSRPLPEVTDEYK.N
URSMB_MOUSE99.6%3225632.9%2312365610.9(P27048) Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB)
	TK_050702_lung_E16_NE_2D_step05.2651.2651.2	2.1039	0.3669	1078.52	1	7860.0%	2	K.MLQHIDYR.M
	TK_050702_lung_E16_NE_2D_step07.3457.3457.2	3.0063	0.5239	1725.0	1	6670.0%	6	K.HMNLILCDCDEFR.K
	TK_050702_lung_E16_NE_2D_step01.2766.2766.1	1.6383	0.2594	1555.95	1	3930.0%	1	R.GENLVSMTVEGPPPK.D
	TK_050702_lung_E16_NE_2D_step03.3880.3880.1	1.2387	0.0976	883.5	40	4290.0%	2	R.VLGLVLLR.G
	TK_050702_lung_E16_NE_2D_step04.1859.1859.1	0.9109	0.2917	614.54	1	6250.0%	3	R.KIKPK.N
	TK_050702_lung_E16_NE_2D_step01.4898.4898.1	1.0533	0.0179	826.29	23	5000.0%	1	R.IFIGTFK.A
	TK_050702_lung_E16_NE_2D_step04.3277.3277.2	1.7229	0.1255	1857.6	1	3950.0%	1	R.GIPAGVPMPQAPAGLAGPVR.G
	TK_050702_lung_E16_NE_2D_step09.3552.3552.2	2.9565	0.5358	1855.04	1	7310.0%	14	K.HMNLILCDCDEFRK.I
UQ6119199.6%173710.4%20452105357.3(Q61191) Transcription factor C1 (HCF)
	TK_050702_lung_E16_NE_2D_step04.2941.2941.2	1.3704	0.1703	1869.5	1	3530.0%	1	K.SPDGAHLTWEPPSVTSGK.I
	TK_050702_lung_E16_NE_2D_step06.2380.2380.1	0.7339	0.1284	1128.58	4	3000.0%	1	R.SLHSATTIGNK.M
	TK_050702_lung_E16_NE_2D_step04.2304.2304.2	1.6508	0.2356	1263.92	3	4500.0%	1	K.KQELQPGTAYK.F
	TK_050702_lung_E16_NE_2D_step12.3556.3556.2	0.6259	0.1865	2357.53	2	1360.0%	1	K.IITAVPKIATGHGQQGVTQVVLK.G
	TK_050702_lung_E16_NE_2D_step08.4072.4072.3	1.1529	0.0056	2934.73	31	980.0%	4	K.MQAAATLTEVANGIESLGVKPDLPPPPSK.A
	TK_050702_lung_E16_NE_2D_step06.3204.3204.3	2.8097	0.4342	3187.42	1	2330.0%	3	K.VMSVVQTKPVQTSAVTGQASTGPVTQIIQTK.G
	TK_050702_lung_E16_NE_2D_step03.2532.2532.3	1.0484	0.1076	2976.07	480	1090.0%	1	K.AWNNQVCCKDLWYLETEKPPPPAR.V
	TK_050702_lung_E16_NE_2D_step07.2899.2899.2	2.4518	0.4478	2270.29	1	3640.0%	1	K.VTGPQATTGTPLVTMRPASQAGK.A
	TK_050702_lung_E16_NE_2D_step07.2808.2808.2	1.8771	0.3267	1638.21	1	5000.0%	1	K.IATGHGQQGVTQVVLK.G
	TK_050702_lung_E16_NE_2D_step02.2487.2487.1	1.5248	0.1563	1067.09	1	5500.0%	1	K.GAPGQPGTILR.T
	TK_050702_lung_E16_NE_2D_step11.3385.3385.3	1.6613	0.2872	3570.2	1	1450.0%	2	R.VYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFR.I
URL32_HUMAN99.6%111739.6%1341572911.3(P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32
	TK_050702_lung_E16_NE_2D_step12.2229.2229.2	0.9657	0.1228	1092.82	77	2220.0%	1	-.AALRPLVKPK.I
	TK_050702_lung_E16_NE_2D_step03.2513.2513.2	3.2638	0.5186	1467.16	1	7920.0%	2	K.SYCAEIAHNVSSK.N
	TK_050702_lung_E16_NE_2D_step09.3035.3035.1	1.4291	0.1182	944.79	3	5710.0%	1	K.HMLPSGFR.K
	TK_050702_lung_E16_NE_2D_step06.3183.3183.2	2.5654	0.3709	1621.46	1	6070.0%	2	K.GQILMPNIGYGSNKK.T
	TK_050702_lung_E16_NE_2D_step08.2778.2778.1	1.3087	0.1237	857.82	1	6670.0%	1	K.FLVHNVK.E
	TK_050702_lung_E16_NE_2D_step01.1862.1862.1	1.1142	0.0364	1492.92	1	5000.0%	1	K.GQILMPNIGYGSNK.K
UQ9CSA999.6%2239.9%163173008.6(Q9CSA9) 5830433M19Rik protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step04.3424.3424.3	3.53	0.5691	4249.8	1	1790.0%	1	K.RSGQEAAASLAAPDLVPVLSGSAGGCGSGGCCGVAGGGTSVAGGAER.S
*	TK_050702_lung_E16_NE_2D_step02.2909.2909.2	0.8575	0.0070	1883.39	1	2650.0%	1	R.RSTDSSSSVSGSLQQETK.Y
UO5494199.6%599.0%411466384.9(O54941) BAF57
	TK_050702_lung_E16_NE_2D_step05.3348.3348.2	3.0593	0.4154	1473.32	1	8180.0%	2	R.KLEAELLQIEER.H
	TK_050702_lung_E16_NE_2D_step10.3346.3346.2	1.6448	0.1303	1697.71	1	5000.0%	2	K.AYHNSPAYLAYINAK.S
	TK_050702_lung_E16_NE_2D_step07.2681.2681.2	1.7238	0.3369	1227.09	1	5000.0%	1	R.QVQSLMVHQR.K
UQ99K7699.6%132324.0%296311699.4(Q99K76) Hypothetical 31.2 kDa protein
	TK_050702_lung_E16_NE_2D_step01.2905.2905.1	1.4465	0.282	959.08	1	6250.0%	1	K.SNIDALLGR.L
	TK_050702_lung_E16_NE_2D_step01.3047.3047.1	1.4624	0.0905	1275.19	3	4550.0%	1	R.VFIGNLNTAVVK.K
	TK_050702_lung_E16_NE_2D_step02.2595.2595.2	1.171	0.2846	865.65	38	3570.0%	1	R.LSPVPVPR.A
	TK_050702_lung_E16_NE_2D_step02.2932.2932.1	2.0173	0.3087	1155.61	1	7220.0%	2	K.KSDVETIFSK.Y
	TK_050702_lung_E16_NE_2D_step10.3316.3316.2	2.4642	0.2554	2253.32	2	3000.0%	3	R.VLAGQTLDINMAGEPKPNRPK.G
	TK_050702_lung_E16_NE_2D_step12.2493.2493.1	0.2419	0.0	1320.85	2	500.0%	1	K.GYAFVQYANER.H
UH14_MOUSE99.6%71113.3%2182184611.1(P43274) Histone H1.4 (H1 VAR.2) (H1E)
	TK_050702_lung_E16_NE_2D_step08.1874.1874.2	1.1484	0.1665	1482.3	138	2670.0%	1	-.SETAPAAPAAPAPAEK.T
*	TK_050702_lung_E16_NE_2D_step06.2959.2959.2	3.0813	0.4257	1358.28	1	6670.0%	2	R.KTSGPPVSELITK.A
*	TK_050702_lung_E16_NE_2D_step01.2654.2654.1	2.1468	0.4113	1230.97	1	5450.0%	2	K.TSGPPVSELITK.A
UQ99LF499.6%5710.3%505552497.2(Q99LF4) Hypothetical 55.2 kDa protein
	TK_050702_lung_E16_NE_2D_step06.0532.0532.1	0.4735	0.0070	561.78	6	2500.0%	1	R.QAFAK.V
	TK_050702_lung_E16_NE_2D_step05.3358.3358.2	2.7482	0.5355	1641.72	1	6000.0%	2	R.GLGHQVATDALVAMEK.A
	TK_050702_lung_E16_NE_2D_step04.2600.2600.2	2.507	0.4197	1859.33	1	5310.0%	1	K.NVTDVVNTCHDAGISKK.A
	TK_050702_lung_E16_NE_2D_step08.3212.3212.2	2.0984	0.2909	1445.79	1	5770.0%	1	K.QIGNVAALPGIVHR.S
UMEC2_MOUSE99.6%557.9%4845230810.0(Q9Z2D6) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2)
*	TK_050702_lung_E16_NE_2D_step04.2960.2960.2	2.3578	0.5231	1124.06	1	7780.0%	1	R.SVHETVLPIK.K
	TK_050702_lung_E16_NE_2D_step07.2684.2684.2	3.0163	0.4059	1272.49	1	7310.0%	1	R.KPGSVVAAAAAEAK.K
	TK_050702_lung_E16_NE_2D_step03.3393.3393.2	1.9072	0.2052	1512.95	1	5770.0%	1	K.EVVKPLLVSTLGEK.S
UTOP1_MOUSE99.6%11179.0%767907909.3(Q04750) DNA topoisomerase I (EC 5.99.1.2)
	TK_050702_lung_E16_NE_2D_step07.2729.2729.1	1.3451	0.0717	1183.83	23	3890.0%	1	R.AVAILCNHQR.A
	TK_050702_lung_E16_NE_2D_step03.3448.3448.2	1.7038	0.1985	1359.25	1	5450.0%	3	K.HLQDLMEGLTAK.V
	TK_050702_lung_E16_NE_2D_step01.3077.3077.2	2.148	0.3734	1434.63	1	6820.0%	1	R.IMPEDIIINCSK.D
	TK_050702_lung_E16_NE_2D_step01.3207.3207.1	1.6349	0.2539	1455.95	1	5500.0%	1	K.CDFTQMSQYFK.A
*	TK_050702_lung_E16_NE_2D_step11.2843.2843.2	0.7267	0.0092	2098.73	27	1560.0%	1	K.CDFTQMSQYFKAQSEAR.K
	TK_050702_lung_E16_NE_2D_step01.2990.2990.1	1.6443	0.4366	1113.41	2	5560.0%	1	K.AEEVATFFAK.M
	TK_050702_lung_E16_NE_2D_step06.2973.2973.1	1.6096	0.1725	956.69	1	7140.0%	1	K.KWGVPIEK.I
UTP2B_MOUSE99.6%9136.6%16121818648.3(Q64511) DNA topoisomerase II, beta isozyme (EC 5.99.1.3)
*	TK_050702_lung_E16_NE_2D_step13.2557.2557.1	0.4853	0.0017	1270.91	2	1360.0%	1	R.AYDLAGSCKGVK.V
	TK_050702_lung_E16_NE_2D_step02.3147.3147.2	2.4958	0.5292	1775.78	1	4670.0%	2	K.HSLECTLILTEGDSAK.S
	TK_050702_lung_E16_NE_2D_step06.3349.3349.2	1.3227	0.1504	1501.92	1	4230.0%	1	R.SIPSLVDGFKPGQR.K
*	TK_050702_lung_E16_NE_2D_step01.3885.3885.2	2.9621	0.383	2092.39	1	5880.0%	1	K.EDLAAFVEELDKVEAQER.E
	TK_050702_lung_E16_NE_2D_step01.4161.4161.2	4.8906	0.4765	2488.92	1	5710.0%	1	K.VYVPALIFGQLLTSSNYDDDEK.K
	TK_050702_lung_E16_NE_2D_step01.3462.3462.1	1.1233	0.1232	1304.84	72	3500.0%	1	R.YIFTMLSSLAR.L
	TK_050702_lung_E16_NE_2D_step06.3103.3103.2	3.1727	0.5517	1650.18	1	6540.0%	2	K.KLQLEETMPSPYGR.R
UQ9DC5499.6%61025.4%2242385012.3(Q9DC54) 2500003M10Rik protein
	TK_050702_lung_E16_NE_2D_step05.2694.2694.2	4.3625	0.4219	1785.26	1	6000.0%	2	R.LAQQMENRPSVQAALK.L
	TK_050702_lung_E16_NE_2D_step02.3068.3068.2	4.268	0.62	2209.36	1	5260.0%	2	K.GHLDAELDAYMAQTDPETND.-
	TK_050702_lung_E16_NE_2D_step01.0082.0082.2	3.1718	0.3522	1448.14	1	7080.0%	1	R.ASMQQQQQLASAR.N
*	TK_050702_lung_E16_NE_2D_step02.2539.2539.1	1.0272	0.0291	954.82	33	5000.0%	1	K.QPMPVNIR.A
UCBX1_HUMAN99.6%72720.5%185214184.9(P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25) (P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25)
	TK_050702_lung_E16_NE_2D_step02.3731.3731.2	4.0898	0.6316	1714.67	1	6670.0%	5	R.IIGATDSSGELMFLMK.W
	TK_050702_lung_E16_NE_2D_step04.2809.2809.2	0.9898	0.0787	1724.25	1	3460.0%	1	R.LTWHSYPSEDDDKK.D
	TK_050702_lung_E16_NE_2D_step05.2940.2940.1	1.2637	0.0634	950.82	7	5710.0%	1	K.GKVEYLLK.W
UBRD3_HUMAN99.6%392.5%726795429.4(Q15059) Bromodomain-containing protein 3 (RING3-like protein)
*	TK_050702_lung_E16_NE_2D_step03.2710.2710.2	0.628	0.0308	1905.09	15	1470.0%	3	K.AVHEQLAALSQAPVNKPK.K
URL3_MOUSE99.6%5715.2%4024599310.2(P27659) 60S ribosomal protein L3 (J1 protein)
	TK_050702_lung_E16_NE_2D_step08.2911.2911.2	2.3996	0.5356	1238.92	1	6500.0%	1	K.VACIGAWHPAR.V
	TK_050702_lung_E16_NE_2D_step02.3655.3655.2	2.1589	0.5318	2689.05	1	3700.0%	1	R.LEQQVPVNQVFGQDEMIDVIGVTK.G
	TK_050702_lung_E16_NE_2D_step07.2221.2221.1	0.7604	0.0044	551.5	2	5000.0%	1	K.KIYK.I
*	TK_050702_lung_E16_NE_2D_step11.3961.3961.2	2.686	0.436	2454.8	1	3810.0%	2	K.SINPLGGFVHYGEVTNDFIMLK.G
UPDI_MOUSE99.6%6188.3%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59)
	TK_050702_lung_E16_NE_2D_step08.2912.2912.1	1.2305	0.206	928.89	1	5710.0%	1	K.VHSFPTLK.F
	TK_050702_lung_E16_NE_2D_step11.2294.2294.2	0.9275	0.0585	1931.72	31	2190.0%	1	K.THILLFLPKSVSDYDGK.L
	TK_050702_lung_E16_NE_2D_step09.3865.3865.2	2.1495	0.4267	1967.36	1	4380.0%	4	K.HNQLPLVIEFTEQTAPK.I
UACTB_HUMAN99.6%61222.1%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin)
	TK_050702_lung_E16_NE_2D_step12.4429.4429.2	0.9831	0.0814	1517.32	1	4500.0%	1	K.IWHHTFYNELR.V
	TK_050702_lung_E16_NE_2D_step04.3713.3713.3	1.7918	0.1751	2871.87	11	1670.0%	1	-.MDDDIAALVVDNGSGMCKAGFAGDDAPR.A
	TK_050702_lung_E16_NE_2D_step03.3976.3976.2	3.9647	0.5778	2552.12	1	5230.0%	3	K.LCYVALDFEQEMATAASSSSLEK.S
	TK_050702_lung_E16_NE_2D_step02.3300.3300.2	1.8932	0.2389	2216.5	1	3500.0%	1	K.DLYANTVLSGGTTMYPGIADR.M
UO7593799.6%61015.2%264309879.2(O75937) SPF31
*	TK_050702_lung_E16_NE_2D_step10.4298.4298.3	5.3575	0.5603	3482.42	1	3020.0%	1	R.LTRPGSSYFNLNPFEVLQIDPEVTDEEIKK.R
*	TK_050702_lung_E16_NE_2D_step10.4315.4315.3	1.8581	0.1368	3354.26	1	1790.0%	2	R.LTRPGSSYFNLNPFEVLQIDPEVTDEEIK.K
*	TK_050702_lung_E16_NE_2D_step04.3052.3052.2	1.0824	0.1901	1151.85	4	5560.0%	1	R.QLSILVHPDK.N
UQ922Z799.6%1120.7%111122479.9(Q922Z7) Similar to DNA polymerase beta
*	TK_050702_lung_E16_NE_2D_step11.4137.4137.2	3.418	0.4142	2520.69	1	4320.0%	1	R.KAPQETLNGGITDMLVELANFEK.N
UQ8R14999.6%354.7%637721399.9(Q8R149) Similar to hypothetical protein MGC13125
*	TK_050702_lung_E16_NE_2D_step06.3873.3873.2	0.8241	0.0206	1828.23	118	1110.0%	2	K.AASQSGLGPSHPSLSTNSK.Y
*	TK_050702_lung_E16_NE_2D_step03.2289.2289.2	2.0516	0.3603	1216.09	3	5000.0%	1	R.TLDSSGTQHLR.R
UQ9JIX899.6%777.1%13381506845.9(Q9JIX8) AcinusL protein
*	TK_050702_lung_E16_NE_2D_step08.2191.2191.1	1.086	0.1334	739.55	24	5000.0%	1	R.RSHLAR.Q
*	TK_050702_lung_E16_NE_2D_step11.3238.3238.3	1.0586	0.0388	2876.21	338	860.0%	1	R.SSSPSSSSSPSRSPSPDSAASRPQSSPGSK.Q
*	TK_050702_lung_E16_NE_2D_step04.2988.2988.2	1.9954	0.5027	1307.41	1	4550.0%	1	R.ASHALFPEYSGK.Q
*	TK_050702_lung_E16_NE_2D_step01.2113.2113.1	1.1315	0.0924	1004.15	22	5620.0%	1	R.LKGALMLEK.F
*	TK_050702_lung_E16_NE_2D_step01.3433.3433.2	3.8333	0.509	2517.07	1	3860.0%	1	K.APVVLQPEQIVSEEETPPPLLTK.E
*	TK_050702_lung_E16_NE_2D_step12.1933.1933.2	1.6438	0.2083	1836.84	2	3210.0%	1	R.HLSHPEPEQQHVIQR.L
UQ9CXX799.6%123022.3%287322669.9(Q9CXX7) Small nuclear ribonucleoprotein polypeptide A
	TK_050702_lung_E16_NE_2D_step05.4198.4198.2	1.2898	0.2462	2300.98	4	2890.0%	2	K.KSLYAIFSQFGQILDILVSR.I
	TK_050702_lung_E16_NE_2D_step03.3376.3376.2	2.9879	0.5454	1990.96	1	5290.0%	3	R.HDIAFVEFDNEVQAGAAR.D
	TK_050702_lung_E16_NE_2D_step06.3424.3424.2	2.1337	0.4134	1605.15	1	7080.0%	3	R.SMQGFPFYDKPMR.I
	TK_050702_lung_E16_NE_2D_step05.2743.2743.1	3.0554	0.3636	1546.39	1	5830.0%	2	R.ANHTIYINNLNEK.I
UQ9DAB499.6%356.9%391428906.7(Q9DAB4) 1700015E05Rik protein
	TK_050702_lung_E16_NE_2D_step08.3219.3219.2	2.791	0.6549	1819.32	1	4690.0%	2	K.HQSLGGQYGVQGFPTIK.I
	TK_050702_lung_E16_NE_2D_step01.2755.2755.1	1.0282	0.0481	1125.13	11	5000.0%	1	R.YGIKGFPTIK.I
UYB1_MOUSE99.6%61224.2%322357309.9(P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB)
	TK_050702_lung_E16_NE_2D_step06.2092.2092.1	1.2309	0.137	659.47	1	6000.0%	1	K.KVIATK.V
	TK_050702_lung_E16_NE_2D_step03.3324.3324.3	1.2832	0.0165	2627.86	33	1700.0%	1	R.EDGNEEDKENQGDETQGQQPPQR.R
	TK_050702_lung_E16_NE_2D_step01.2137.2137.2	2.6904	0.5081	1697.85	1	5830.0%	1	K.GAEAANVTGPGGVPVQGSK.Y
	TK_050702_lung_E16_NE_2D_step09.2861.2861.3	2.013	0.331	3226.83	3	1810.0%	3	R.RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.Q
URU2A_MOUSE99.6%3514.6%254282288.6(P57784) U2 small nuclear ribonucleoprotein A' (U2 snRNP-A')
	TK_050702_lung_E16_NE_2D_step02.4060.4060.2	3.6085	0.6578	2807.91	1	4380.0%	2	K.IPVIENLGATLDQFDAIDFSDNEIR.K
	TK_050702_lung_E16_NE_2D_step01.2514.2514.1	1.037	0.0806	1218.28	1	5000.0%	1	K.TFNPGAGLPTDK.K
UQ9EQC899.6%6189.0%491523024.9(Q9EQC8) Papillary renal cell carcinoma-associated protein
*	TK_050702_lung_E16_NE_2D_step08.3491.3491.2	3.2689	0.5937	2080.35	1	5500.0%	1	K.KVVLQGSGEGTGLSALLPQPK.N
*	TK_050702_lung_E16_NE_2D_step09.3253.3253.2	2.1592	0.47	2242.72	1	3410.0%	4	K.TKPASLAPVLGTTTTTPSPSAIK.A
UHDA1_MOUSE99.6%226.8%482550755.5(O09106) Histone deacetylase 1 (HD1)
	TK_050702_lung_E16_NE_2D_step12.4247.4247.2	0.8248	0.0846	2356.4	1	1750.0%	1	K.SEASGFCYVNDIVLAILELLK.Y
	TK_050702_lung_E16_NE_2D_step03.2436.2436.2	3.2265	0.5226	1428.55	1	7730.0%	1	R.SIRPDNMSEYSK.Q
USEP7_MOUSE99.6%226.2%436505508.6(O55131) Septin 7 (CDC10 protein homolog)
	TK_050702_lung_E16_NE_2D_step02.4029.4029.2	3.2702	0.5459	2610.18	1	3860.0%	1	K.STLINSLFLTDLYSPEYPGPSHR.I
	TK_050702_lung_E16_NE_2D_step01.1653.1653.1	0.2243	0.0036	464.1	10	1670.0%	1	K.GKIF.-
USFR5_MOUSE99.6%6818.9%2703094511.4(O35326) Splicing factor, arginine/serine-rich 5 (Pre-mRNA splicing factor SRP40) (Delayed-early protein HRS)
	TK_050702_lung_E16_NE_2D_step02.3271.3271.2	3.3353	0.4523	1642.83	1	6430.0%	1	K.LNEGVVEFASYGDLK.N
	TK_050702_lung_E16_NE_2D_step01.0563.0563.1	1.579	0.0559	603.49	2	7500.0%	2	R.DIDLK.R
	TK_050702_lung_E16_NE_2D_step01.1825.1825.1	1.4378	0.1128	646.73	1	6000.0%	1	K.LIEGSK.R
	TK_050702_lung_E16_NE_2D_step06.3167.3167.2	1.3179	0.0678	1302.21	32	4000.0%	1	R.GFGFVEFEDPR.D
	TK_050702_lung_E16_NE_2D_step06.2663.2663.2	2.3044	0.4548	1528.17	1	5770.0%	1	R.QAGEVTFADAHRPK.L
UQ91VI899.6%113.4%435467604.7(Q91VI8) Similar to ubiquilin 2 (Fragment)
	TK_050702_lung_E16_NE_2D_step04.3228.3228.2	3.158	0.6206	1783.04	1	6070.0%	1	R.NPEISHMLNNPDIMR.Q
UO8856899.6%6335733.0%798878926.3(O88568) Heterogenous nuclear ribonucleoprotein U
	TK_050702_lung_E16_NE_2D_step07.2347.2347.1	1.1725	0.1287	900.64	258	3570.0%	1	R.KAVVVCPK.D
	TK_050702_lung_E16_NE_2D_step09.4278.4278.2	3.2269	0.6509	2606.84	1	4050.0%	12	K.GNFTLPEVAECFDEITYVELQK.E
*	TK_050702_lung_E16_NE_2D_step12.4520.4520.3	1.5703	0.1801	3099.97	25	1600.0%	3	K.EVLADRPLFPHVLCHNCAVEFNFGQK.E
	TK_050702_lung_E16_NE_2D_step08.3303.3303.2	1.3505	0.1733	2188.15	1	3420.0%	3	K.HAAENPGKYNILGTNTIMDK.M
	TK_050702_lung_E16_NE_2D_step01.2102.2102.1	1.8069	0.1987	773.01	6	6670.0%	1	K.AVVVCPK.D
	TK_050702_lung_E16_NE_2D_step07.2839.2839.1	1.1817	0.0418	911.76	7	5710.0%	1	K.MMVAGFKK.Q
	TK_050702_lung_E16_NE_2D_step05.4127.4127.2	3.7558	0.5047	2033.31	1	5830.0%	8	R.LSASSLTMESFAFLWAGGR.A
	TK_050702_lung_E16_NE_2D_step01.2970.2970.1	2.4197	0.3012	1293.96	3	5560.0%	2	R.GYFEYIEENK.Y
	TK_050702_lung_E16_NE_2D_step01.2299.2299.1	1.8452	0.0657	794.12	10	8000.0%	1	K.LLEQYK.E
	TK_050702_lung_E16_NE_2D_step09.4264.4264.3	2.0831	0.3581	3192.4	1	2310.0%	2	K.GNFTLPEVAECFDEITYVELQKEEAQK.L
	TK_050702_lung_E16_NE_2D_step01.3074.3074.1	2.1012	0.2911	1384.9	1	5000.0%	2	K.YNILGTNTIMDK.M
*	TK_050702_lung_E16_NE_2D_step01.2850.2850.2	1.1809	0.2061	2984.3	2	2000.0%	1	R.LQAALDNEAGGRPAMEPGNGSLDLGGDAAGR.S
	TK_050702_lung_E16_NE_2D_step07.2206.2206.1	1.3724	0.1415	661.38	1	7500.0%	1	R.HLYTK.D
	TK_050702_lung_E16_NE_2D_step06.3077.3077.2	2.8361	0.4792	1805.51	1	5330.0%	1	K.RNFILDQTNVSAAAQR.R
*	TK_050702_lung_E16_NE_2D_step08.4074.4074.3	3.4984	0.5941	4346.56	1	1860.0%	2	K.TCNCETEDYGEKFDENDVITCFANFETDEVELSYAK.N
	TK_050702_lung_E16_NE_2D_step01.2639.2639.1	2.076	0.2215	820.85	1	8330.0%	1	K.FIEIAAR.K
	TK_050702_lung_E16_NE_2D_step08.3510.3510.2	3.3543	0.4094	1708.91	1	6000.0%	7	K.KDCEVVMMIGLPGAGK.T
*	TK_050702_lung_E16_NE_2D_step03.3725.3725.3	2.4138	0.2113	2710.18	1	2860.0%	1	K.EKPYFPIPEDCTFIQNVPLEDR.V
	TK_050702_lung_E16_NE_2D_step01.0103.0103.1	1.5111	0.1025	735.91	1	7000.0%	1	K.TTWVTK.H
*	TK_050702_lung_E16_NE_2D_step05.4091.4091.2	2.6131	0.5972	2858.73	1	2610.0%	2	K.FDENDVITCFANFETDEVELSYAK.N
UZF37_MOUSE99.6%335.9%594672548.8(P17141) Zinc finger protein 37 (Zfp-37) (Male germ cell specific zinc finger protein)
	TK_050702_lung_E16_NE_2D_step04.4732.4732.1	0.2401	0.0	586.68	2	1250.0%	1	K.LPNNK.L
	TK_050702_lung_E16_NE_2D_step04.2456.2456.2	1.8492	0.4508	1207.83	1	5560.0%	1	R.YNSSLTEHVR.T
*	TK_050702_lung_E16_NE_2D_step05.2826.2826.2	3.6027	0.2949	2357.54	2	4470.0%	1	R.THTGEKPYECNECGIAFSQK.S
UQ9Z17299.6%1110.9%110124305.9(Q9Z172) SMT3A protein (2810014B19RIK protein)
	TK_050702_lung_E16_NE_2D_step01.2402.2402.1	2.1252	0.4716	1235.98	1	6360.0%	1	K.VAGQDGSVVQFK.I
UQ9997499.6%557.7%802922518.2(Q99974) POMBE CDC5-related protein (KIAA0432) (CDC5 (Cell division cycle 5, S. POMBE, homolog)-like)
*	TK_050702_lung_E16_NE_2D_step04.3496.3496.2	2.7105	0.5113	2552.63	1	4050.0%	1	K.KPALGFYDTSEENYQALDADFR.K
*	TK_050702_lung_E16_NE_2D_step08.3479.3479.2	2.3796	0.5586	2678.57	1	2950.0%	1	K.KPALGFYDTSEENYQALDADFRK.L
*	TK_050702_lung_E16_NE_2D_step09.2954.2954.1	1.0029	0.1778	694.79	34	4000.0%	1	K.LLHLAK.L
*	TK_050702_lung_E16_NE_2D_step01.3530.3530.2	2.9172	0.5668	1952.33	1	5290.0%	1	K.LVLPAPQISDAELQEVVK.V
*	TK_050702_lung_E16_NE_2D_step04.3568.3568.2	1.8483	0.2479	1839.25	1	3930.0%	1	R.TAAQCLEHYEFLLDK.A
UQ6139999.6%242.9%783914425.4(Q61399) Cyclin-dependent protein kinase
	TK_050702_lung_E16_NE_2D_step03.3257.3257.2	2.833	0.5832	2294.14	1	4550.0%	2	K.ETGFHLTTTNQGASAAGPGFSLK.F
UHS47_MOUSE99.6%195137.9%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6)
	TK_050702_lung_E16_NE_2D_step06.3217.3217.3	1.3789	0.0678	2646.08	16	1900.0%	1	R.SYTVGVTMMHRTGLYNYYDDEK.E
*	TK_050702_lung_E16_NE_2D_step04.4195.4195.2	2.1209	0.3712	2581.51	1	3000.0%	4	K.DQAVENILLSPLVVASSLGLVSLGGK.A
*	TK_050702_lung_E16_NE_2D_step04.4133.4133.3	1.6328	0.3676	3379.62	2	1520.0%	1	K.DLYLASVFHATAFEWDTEGNPFDQDIYGR.E
	TK_050702_lung_E16_NE_2D_step07.3309.3309.2	2.7817	0.4153	1339.37	1	7500.0%	4	K.HLAGLGLTEAIDK.N
*	TK_050702_lung_E16_NE_2D_step01.3914.3914.2	1.2855	0.1634	2506.92	3	2270.0%	1	R.SALQSINEWASQTTDGKLPEVTK.D
*	TK_050702_lung_E16_NE_2D_step08.3443.3443.2	1.5707	0.2902	1738.57	2	4290.0%	3	K.LRDEEVHTGLGELLR.S
	TK_050702_lung_E16_NE_2D_step01.1023.1023.1	0.4039	0.012	537.4	27	3330.0%	1	K.MQKK.A
*	TK_050702_lung_E16_NE_2D_step05.3198.3198.2	2.2019	0.376	1297.91	5	5000.0%	1	K.LQMVEMPLAHK.L
	TK_050702_lung_E16_NE_2D_step01.3415.3415.2	3.1549	0.6215	1662.02	1	6790.0%	1	R.LYGPSSVSFADDFVR.S
UQ9CVU599.6%3542.6%6167538.1(Q9CVU5) Adult male testis cDNA, RIKEN full-length enriched library, clone:1700029B05, full insert sequence (Fragment)
	TK_050702_lung_E16_NE_2D_step01.2335.2335.1	1.7928	0.4141	1123.95	1	5000.0%	2	K.LCFSTAQHAS.-
	TK_050702_lung_E16_NE_2D_step04.3741.3741.2	1.7924	0.3585	1868.36	1	3670.0%	1	K.SDALETLGFLNHYQMK.N
UEF11_MOUSE99.6%4632033.5%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu)
	TK_050702_lung_E16_NE_2D_step06.4199.4199.3	2.4638	0.2304	2912.66	2	2050.0%	2	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK_050702_lung_E16_NE_2D_step02.0020.0020.2	2.4371	0.396	2519.69	1	3910.0%	10	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK_050702_lung_E16_NE_2D_step01.2446.2446.1	1.22	0.0781	916.12	6	5620.0%	1	R.QTVAVGVIK.A
	TK_050702_lung_E16_NE_2D_step05.2603.2603.1	1.6946	0.1792	1122.79	2	5000.0%	2	K.STTTGHLIYK.C
	TK_050702_lung_E16_NE_2D_step06.3153.3153.2	2.3756	0.5265	1407.38	1	5450.0%	3	K.YYVTIIDAPGHR.D
	TK_050702_lung_E16_NE_2D_step12.3869.3869.3	0.7955	0.0292	4390.51	1	880.0%	7	K.NDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK.F
	TK_050702_lung_E16_NE_2D_step06.4531.4531.2	1.0025	0.0517	1592.13	2	2500.0%	11	K.THINIVVIGHVDSGK.S
	TK_050702_lung_E16_NE_2D_step01.2701.2701.1	1.8064	0.1077	976.06	1	7860.0%	1	R.LPLQDVYK.I
	TK_050702_lung_E16_NE_2D_step03.2422.2422.1	1.9731	0.0787	894.86	5	6670.0%	1	R.TIEKFEK.E
UUSF2_MOUSE99.6%114.6%346369545.2(Q64705) Upstream stimulatory factor 2 (Upstream transcription factor 2) (Major late transcription factor 2)
*	TK_050702_lung_E16_NE_2D_step04.2704.2704.2	4.0892	0.5835	1842.79	1	6330.0%	1	R.AQLQQHNLEMVGESTR.Q
URL8_HUMAN99.6%91729.6%2572802511.0(P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8
	TK_050702_lung_E16_NE_2D_step12.4032.4032.3	1.6514	0.0715	3455.5	10	1610.0%	2	K.AQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGK.L
	TK_050702_lung_E16_NE_2D_step07.2688.2688.1	0.6267	0.0064	803.57	54	4170.0%	1	K.AGRAYHK.Y
	TK_050702_lung_E16_NE_2D_step08.3816.3816.3	2.1831	0.2343	3399.12	1	2170.0%	2	K.KAQLNIGNVLPVGTMPEGTIVCCLEEKPGDR.G
	TK_050702_lung_E16_NE_2D_step02.2491.2491.2	3.2572	0.5514	1690.29	1	4670.0%	2	R.ASGNYATVISHNPETK.K
	TK_050702_lung_E16_NE_2D_step09.3721.3721.2	1.5305	0.2842	2242.36	1	3420.0%	2	R.TELFIAAEGIHTGQFVYCGK.K
UIF5A_HUMAN99.6%51727.5%153167015.2(P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor)
	TK_050702_lung_E16_NE_2D_step03.4221.4221.2	3.1104	0.5223	2628.82	1	3480.0%	4	K.YDCGEEILITVLSAMTEEAAVAIK.A
	TK_050702_lung_E16_NE_2D_step05.2931.2931.2	3.1618	0.467	2163.04	1	4710.0%	1	K.KYEDICPSTHNMDVPNIK.R
UQ9CQI799.6%118.0%225253239.7(Q9CQI7) 2810052G09Rik protein (U2 small nuclear ribonucleoprotein B)
	TK_050702_lung_E16_NE_2D_step03.3212.3212.2	2.8605	0.6199	1948.13	1	4410.0%	1	R.HDIAFVEFENDGQAGAAR.D
UHBA_MOUSE99.6%5160970.9%141149548.2(P01942) Hemoglobin alpha chain
*	TK_050702_lung_E16_NE_2D_step01.0283.0283.1	1.3719	0.0864	747.72	18	5830.0%	1	-.VLSGEDK.S
	TK_050702_lung_E16_NE_2D_step01.3230.3230.2	3.1222	0.3806	1255.64	1	8180.0%	3	K.FLASVSTVLTSK.Y
	TK_050702_lung_E16_NE_2D_step01.2790.2790.1	1.7243	0.1639	1032.02	1	6250.0%	2	R.MFASFPTTK.T
	TK_050702_lung_E16_NE_2D_step05.2980.2980.2	2.0559	0.2613	1088.8	1	8120.0%	2	K.LRVDPVNFK.L
	TK_050702_lung_E16_NE_2D_step07.3331.3331.2	3.1852	0.4753	1823.04	1	5330.0%	23	K.TYFPHFDVSHGSAQVK.G
	TK_050702_lung_E16_NE_2D_step04.2677.2677.1	2.8274	0.0196	1531.86	1	5710.0%	2	K.IGGHGAEYGAEALER.M
	TK_050702_lung_E16_NE_2D_step13.4969.4969.3	2.2311	0.4069	3054.25	1	2310.0%	4	K.LLSHCLLVTLASHHPADFTPAVHASLDK.F
	TK_050702_lung_E16_NE_2D_step04.2036.2036.3	1.062	0.1538	2197.49	24	1050.0%	1	K.TYFPHFDVSHGSAQVKGHGK.K
UTCPE_MOUSE99.6%3313.7%541596246.0(P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon)
	TK_050702_lung_E16_NE_2D_step02.4184.4184.2	3.3465	0.5253	3115.54	1	3450.0%	1	K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
*	TK_050702_lung_E16_NE_2D_step03.2682.2682.3	1.4579	0.1273	3265.06	12	1210.0%	1	K.MMVDKDGDVTITNDGATILSMMDVDHQIAK.L
	TK_050702_lung_E16_NE_2D_step08.3450.3450.2	1.5397	0.3996	1612.66	1	4230.0%	1	K.IAILTCPFEPPKPK.T
UQ8VEK799.6%7917.7%2372729410.3(Q8VEK7) Hypothetical 27.3 kDa protein
	TK_050702_lung_E16_NE_2D_step12.2133.2133.2	1.1869	0.1538	1627.95	2	3330.0%	1	R.CFSQSSHLIQHQR.T
*	TK_050702_lung_E16_NE_2D_step05.2878.2878.2	3.1666	0.5618	1400.29	1	5910.0%	1	K.SFSQSSTLFQHK.K
	TK_050702_lung_E16_NE_2D_step06.3240.3240.2	2.9945	0.506	1465.43	1	7730.0%	2	K.SFFQSSNLIQHR.R
	TK_050702_lung_E16_NE_2D_step07.0613.0613.1	0.7592	0.0171	542.58	11	5000.0%	1	R.LGKPK.G
UQ9R04799.6%183219.6%581671277.9(Q9R047) AcinusS
	TK_050702_lung_E16_NE_2D_step03.3062.3062.2	1.7753	0.393	2046.55	1	4670.0%	3	K.FLCADYAEQDELDYHR.G
	TK_050702_lung_E16_NE_2D_step06.2504.2504.1	1.6566	0.3697	932.75	1	6250.0%	1	R.KISVVSATK.G
	TK_050702_lung_E16_NE_2D_step01.3490.3490.1	1.6509	0.3388	892.05	3	7500.0%	1	K.LLDDLFR.K
	TK_050702_lung_E16_NE_2D_step06.2897.2897.2	3.1231	0.5029	1305.45	1	7730.0%	2	K.KPSISITTESLK.S
	TK_050702_lung_E16_NE_2D_step05.2751.2751.2	2.7826	0.3725	1105.27	1	7220.0%	1	K.KVTLGDTLTR.R
	TK_050702_lung_E16_NE_2D_step06.2319.2319.1	1.2611	0.0218	725.49	2	5830.0%	1	R.TALHGVK.W
	TK_050702_lung_E16_NE_2D_step12.4047.4047.2	0.5613	0.0417	2817.01	49	620.0%	1	K.ISNIVHISNLVRPFTLGQLKELLGR.T
	TK_050702_lung_E16_NE_2D_step07.3297.3297.2	2.405	0.507	1959.35	1	5310.0%	2	K.SHCFVTYSTVEEAVATR.T
	TK_050702_lung_E16_NE_2D_step03.2796.2796.2	2.163	0.361	1215.74	1	5500.0%	2	R.GLLVDRPSETK.A
UELV1_HUMAN99.6%4815.0%326360929.2(Q15717) ELAV-like protein 1 (Hu-antigen R) (HuR)
*	TK_050702_lung_E16_NE_2D_step05.3083.3083.3	2.96	0.4256	2616.15	1	2710.0%	2	R.SEAEEAITSFNGHKPPGSSEPITVK.F
*	TK_050702_lung_E16_NE_2D_step08.4179.4179.2	2.9947	0.6047	2616.2	1	3700.0%	2	K.GFGFVTMTNYEEAAMAIASLNGYR.L
UELV1_MOUSE99.6%133139.0%326360699.2(P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG)
*	TK_050702_lung_E16_NE_2D_step06.3100.3100.2	2.368	0.0847	2614.34	1	3540.0%	1	R.SEAEEAITSFIGHKPPGSSEPITVK.F
	TK_050702_lung_E16_NE_2D_step11.3173.3173.2	2.3385	0.4538	1784.63	1	4380.0%	4	K.VAGHSLGYGFVNYVTAK.D
	TK_050702_lung_E16_NE_2D_step12.1803.1803.2	1.5584	0.0665	1234.49	1	4500.0%	1	R.FGGPVHHQAQR.F
*	TK_050702_lung_E16_NE_2D_step08.3532.3532.2	3.52	0.4972	1602.9	1	8460.0%	3	K.NMALLSQLYHSPAR.R
	TK_050702_lung_E16_NE_2D_step01.2362.2362.1	1.2635	0.1227	1189.09	1	5000.0%	1	R.VLVDQTTGLSR.G
*	TK_050702_lung_E16_NE_2D_step02.4065.4065.2	1.084	0.1482	2920.16	2	1800.0%	1	K.CKGFGFVTMTNYEESAMAIASLNGYR.L
*	TK_050702_lung_E16_NE_2D_step01.4414.4414.3	1.36	0.0267	2677.87	20	2050.0%	1	R.GDIGRTNLIVNYLPQNMTQEELR.S
*	TK_050702_lung_E16_NE_2D_step01.3451.3451.2	3.7486	0.4871	2179.2	1	5590.0%	1	R.TNLIVNYLPQNMTQEELR.S
UQ9ESU699.6%12346.7%14001559239.2(Q9ESU6) Cell proliferation related protein CAP
	TK_050702_lung_E16_NE_2D_step07.3667.3667.2	3.245	0.5174	1799.71	1	5710.0%	5	K.HQFAWPFQQPVDAVK.L
*	TK_050702_lung_E16_NE_2D_step04.2836.2836.2	2.6049	0.2917	1572.87	1	5380.0%	1	R.SEPFSTSLRPEPPK.H
	TK_050702_lung_E16_NE_2D_step01.1589.1589.1	0.3605	0.0311	871.08	3	1670.0%	1	R.AHEEARR.R
	TK_050702_lung_E16_NE_2D_step04.2584.2584.1	1.4864	0.2158	1060.81	2	6250.0%	1	K.HPMDMSTIK.S
*	TK_050702_lung_E16_NE_2D_step12.1189.1189.2	0.7429	0.0663	1025.59	13	2780.0%	1	-.MSTESGPGTR.L
	TK_050702_lung_E16_NE_2D_step10.2948.2948.2	1.2691	0.2848	1987.62	1	2940.0%	2	K.AVHEQLAALSQPQQNKPK.K
	TK_050702_lung_E16_NE_2D_step10.2468.2468.3	0.7568	0.1381	2230.93	90	620.0%	1	K.NMGSWASLVQKHPTTPSSTAK.S
UO0858399.6%3324941.6%2552694011.2(O08583) ALY
	TK_050702_lung_E16_NE_2D_step01.3355.3355.3	2.1866	0.3928	2846.83	1	2810.0%	1	K.QYNGVPLDGRPMNIQLVTSQIDTQR.R
	TK_050702_lung_E16_NE_2D_step09.3638.3638.3	3.2304	0.5477	2707.12	1	2300.0%	4	K.QLPDKWQHDLFDSGFGGGAGVETGGK.L
	TK_050702_lung_E16_NE_2D_step01.2949.2949.2	4.8654	0.6929	2037.31	1	6470.0%	2	K.QQLSAEELDAQLDAYNAR.M
	TK_050702_lung_E16_NE_2D_step01.3362.3362.1	1.8875	0.1072	1182.94	2	6110.0%	2	K.MDMSLDDIIK.L
	TK_050702_lung_E16_NE_2D_step02.3317.3317.2	2.859	0.6276	2123.92	1	4750.0%	3	K.WQHDLFDSGFGGGAGVETGGK.L
	TK_050702_lung_E16_NE_2D_step12.4075.4075.2	1.0163	0.1254	2970.56	4	1730.0%	1	K.LLVSNLDFGVSDADIQELFAEFGTLKK.A
	TK_050702_lung_E16_NE_2D_step05.4151.4151.3	2.2858	0.3533	2844.55	1	2700.0%	4	K.LLVSNLDFGVSDADIQELFAEFGTLK.K
UH2AX_MOUSE99.6%3916.2%1421501110.7(P27661) Histone H2A.X
	TK_050702_lung_E16_NE_2D_step06.4169.4169.2	2.0657	0.2557	2275.67	4	2500.0%	3	K.LLGGVTIAQGGVLPNIQAVLLPK.K
UQ924L899.6%93515.0%1071154210.4(Q924L8) High mobility group protein isoform I
	TK_050702_lung_E16_NE_2D_step09.2829.2829.2	1.3021	0.2526	1597.75	1	3000.0%	5	R.KQPPVSPGTALVGSQK.E
	TK_050702_lung_E16_NE_2D_step02.2523.2523.2	1.5659	0.3345	1466.69	1	4290.0%	1	K.QPPVSPGTALVGSQK.E
UQ9CZH599.6%3515.1%166188908.1(Q9CZH5) 2700094L05Rik protein
	TK_050702_lung_E16_NE_2D_step07.3661.3661.3	3.5515	0.5912	2761.38	1	3230.0%	1	K.VKEQLEAAKPEPVIEEVDLANLAPR.K
UHS7C_MOUSE99.6%123012.4%646708715.5(P08109) Heat shock cognate 71 kDa protein
	TK_050702_lung_E16_NE_2D_step06.3060.3060.2	4.0043	0.6067	1483.45	1	7310.0%	4	K.SQIHDIVLVGGSTR.I
	TK_050702_lung_E16_NE_2D_step08.3371.3371.2	1.93	0.2762	1237.61	1	6110.0%	1	R.MVNHFIAEFK.R
	TK_050702_lung_E16_NE_2D_step01.3835.3835.2	2.3374	0.5549	2262.59	1	3640.0%	2	K.SINPDEAVAYGAAVQAAILSGDK.S
	TK_050702_lung_E16_NE_2D_step09.3544.3544.2	3.331	0.1282	2266.55	1	4050.0%	2	K.GPAVGIDLGTTYSCVGVFQHGK.V
	TK_050702_lung_E16_NE_2D_step01.3007.3007.1	1.9786	0.4274	1304.93	1	5500.0%	1	K.NSLESYAFNMK.A
ULAM1_MOUSE99.6%101618.9%587666545.2(P14733) Lamin B1
*	TK_050702_lung_E16_NE_2D_step09.3484.3484.2	2.1441	0.2613	1690.54	1	6540.0%	1	K.FKAEHDQLLLNYAK.K
	TK_050702_lung_E16_NE_2D_step02.2853.2853.2	1.5103	0.372	1820.68	2	4000.0%	1	R.SLETENSALQLQVTER.E
	TK_050702_lung_E16_NE_2D_step04.2555.2555.2	2.7333	0.2994	1295.42	1	7500.0%	1	K.LREYEAALNSK.D
*	TK_050702_lung_E16_NE_2D_step01.3031.3031.1	1.6166	0.1139	1189.98	2	6110.0%	1	R.IQELEDMLAK.E
	TK_050702_lung_E16_NE_2D_step05.2630.2630.2	2.219	0.4503	1070.13	1	8120.0%	1	K.LAQALHEMR.E
	TK_050702_lung_E16_NE_2D_step05.2731.2731.2	3.794	0.4954	1652.88	1	7920.0%	1	R.LYKEELEQTYHAK.L
	TK_050702_lung_E16_NE_2D_step01.0182.0182.2	2.0999	0.3182	1496.97	1	5000.0%	1	R.LSSEMNTSTVNSAR.E
*	TK_050702_lung_E16_NE_2D_step11.4151.4151.2	1.355	0.0277	2546.73	10	1960.0%	3	K.SLEGDLEDLKDQIAQLEASLSAAK.K
UHXA5_MOUSE99.6%3318.1%270292379.4(P09021) Homeobox protein Hox-A5 (Hox-1.3) (M2)
*	TK_050702_lung_E16_NE_2D_step05.2671.2671.1	0.5479	0.1565	1321.76	27	1150.0%	1	R.SYAAGASAAPAEPR.Y
*	TK_050702_lung_E16_NE_2D_step04.2152.2152.2	2.7967	0.5543	1976.94	1	4250.0%	1	K.NSLGNSSGASANAGSTHISSR.E
	TK_050702_lung_E16_NE_2D_step09.2869.2869.2	2.2649	0.499	1476.15	1	5380.0%	1	K.LHISHDNIGGPEGK.R
UQ91W3999.6%5710.7%579653199.8(Q91W39) Similar to coactivator independent of AF-2
	TK_050702_lung_E16_NE_2D_step06.3185.3185.2	1.8824	0.4189	1780.33	1	4290.0%	2	R.SCTVNIMFGTPQEHR.N
*	TK_050702_lung_E16_NE_2D_step05.2990.2990.3	3.5857	0.4787	2806.79	1	3170.0%	1	R.LAPASTMASQRPVSSTGINFDNPSVQK.A
*	TK_050702_lung_E16_NE_2D_step12.2531.2531.2	1.8792	0.4502	2042.44	1	3950.0%	1	R.NMGPRPGAPSQGLFGQPSSR.L
UTDBP_MOUSE99.6%101631.4%414445486.7(Q921F2) TAR DNA-binding protein-43 (TDP-43)
	TK_050702_lung_E16_NE_2D_step05.2679.2679.2	2.3042	0.2374	1254.23	1	5910.0%	2	K.GISVHISNAEPK.H
	TK_050702_lung_E16_NE_2D_step01.3954.3954.3	2.984	0.5742	3877.36	1	2140.0%	2	R.VTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLR.Y
	TK_050702_lung_E16_NE_2D_step02.2679.2679.2	2.698	0.28	1729.24	1	5290.0%	1	R.FGGNPGGFGNQGGFGNSR.G
	TK_050702_lung_E16_NE_2D_step12.4099.4099.3	4.9893	0.6479	3688.01	1	2760.0%	2	R.CTEDMTAEELQQFFCQYGEVVDVFIPKPFR.A
	TK_050702_lung_E16_NE_2D_step08.2562.2562.2	1.9783	0.2882	1312.62	1	6670.0%	1	R.YRNPVSQCMR.G
	TK_050702_lung_E16_NE_2D_step10.4190.4190.2	2.2684	0.4438	2626.23	1	2830.0%	1	R.LVEGILHAPDAGWGNLVYVVNYPK.D
UO3554099.6%6811.1%669742918.7(O35540) Hepatoma-derived growth factor
	TK_050702_lung_E16_NE_2D_step03.1902.1902.1	0.212	0.0	943.07	9	830.0%	1	R.QDHERTR.L
	TK_050702_lung_E16_NE_2D_step03.2401.2401.1	0.6273	0.0186	1089.79	7	2860.0%	1	R.REQEEELR.R
	TK_050702_lung_E16_NE_2D_step12.4700.4700.3	1.315	0.0035	3410.67	5	1290.0%	1	K.EEPVVTAQPSPSSSSSSSSSSSSDSDVSVKKPPR.G
	TK_050702_lung_E16_NE_2D_step02.3953.3953.2	3.5663	0.2374	2232.77	1	6050.0%	1	K.CLSALEELGTLQVTSQILQK.N
	TK_050702_lung_E16_NE_2D_step07.1955.1955.1	0.5417	0.0061	570.59	1	3750.0%	2	R.ARPVK.V
UO3584599.6%4810.1%288291969.5(O35845) Brg1 protein (Fragment)
	TK_050702_lung_E16_NE_2D_step11.2554.2554.2	2.4137	0.4667	1653.39	1	5000.0%	2	R.GPTPFNQNQLHQLR.A
	TK_050702_lung_E16_NE_2D_step05.2883.2883.2	2.6605	0.6089	1619.83	1	5360.0%	2	R.GQPLPDHLQMAVQGK.R
UROG_MOUSE99.6%163621.4%3884223410.0(O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)
	TK_050702_lung_E16_NE_2D_step03.2069.2069.2	1.0447	0.3002	1613.85	2	2690.0%	2	R.DRDYSDHPSGGSYR.D
	TK_050702_lung_E16_NE_2D_step01.2987.2987.1	2.3327	0.3068	1438.01	1	5000.0%	2	K.LFIGGLNTETNEK.A
	TK_050702_lung_E16_NE_2D_step01.2266.2266.1	1.7039	0.2666	850.2	1	6670.0%	1	R.DVYLSPR.D
	TK_050702_lung_E16_NE_2D_step03.2408.2408.1	0.9985	0.343	610.69	1	5000.0%	1	R.GPLPVK.R
	TK_050702_lung_E16_NE_2D_step01.2767.2767.1	1.2713	0.0378	837.4	2	5000.0%	2	K.ALEAVFGK.Y
*	TK_050702_lung_E16_NE_2D_step02.2995.2995.2	3.0042	0.6122	2079.2	1	4440.0%	2	R.GGYMDDGGYSMNFNMSSSR.G
	TK_050702_lung_E16_NE_2D_step01.0467.0467.1	0.9716	0.2486	848.64	3	3570.0%	1	R.DSYGGPPR.R
*	TK_050702_lung_E16_NE_2D_step02.3564.3564.1	1.6406	0.1177	961.1	1	7140.0%	4	R.IVEIILMK.D
UTP2B_HUMAN99.6%5112.0%16261832668.0(Q02880) DNA topoisomerase II, beta isozyme (EC 5.99.1.3)
*	TK_050702_lung_E16_NE_2D_step05.2284.2284.2	0.6789	0.0072	1734.14	18	1670.0%	1	K.VESQEREDVLAGMSGK.A
*	TK_050702_lung_E16_NE_2D_step01.3603.3603.2	2.8753	0.5997	1854.04	1	6330.0%	1	K.SQDFGNLFSFPSYSQK.S
*	TK_050702_lung_E16_NE_2D_step05.3683.3683.2	1.8921	0.3482	1981.5	1	4060.0%	3	K.KSQDFGNLFSFPSYSQK.S
UATF2_MOUSE99.6%3312.9%487522987.2(P16951) Cyclic-AMP-dependent transcription factor ATF-2 (Activating transcription factor 2) (cAMP response element binding protein CRE-BP1) (MXBP protein)
*	TK_050702_lung_E16_NE_2D_step05.2351.2351.3	3.0241	0.4838	4040.93	1	1890.0%	1	R.TQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGR.R
	TK_050702_lung_E16_NE_2D_step04.2407.2407.2	1.8034	0.4109	1779.01	1	4380.0%	1	K.AALTQQHPPVTNGDTVK.G
	TK_050702_lung_E16_NE_2D_step01.3354.3354.3	2.0535	0.0502	2539.01	2	2190.0%	1	K.AALTQQHPPVTNGDTVKGHGSGLVR.T
UCU70_MOUSE99.6%2211.9%2192481411.0(P58468) Protein C21orf70 homolog
	TK_050702_lung_E16_NE_2D_step01.0908.0908.1	0.6006	0.0042	539.38	8	3750.0%	1	K.AILPK.K
*	TK_050702_lung_E16_NE_2D_step09.4256.4256.2	3.9838	0.551	2192.41	1	5000.0%	1	R.ASPLLAIGQQLAHQMQLEGGK.Q
UK1CJ_HUMAN99.6%5713.8%593595195.2(P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10)
*	TK_050702_lung_E16_NE_2D_step11.4161.4161.2	1.2174	0.0455	2354.64	7	2220.0%	1	R.AETECQNTEYQQLLDIKIR.L
*	TK_050702_lung_E16_NE_2D_step02.4085.4085.2	2.0793	0.3992	2097.92	1	3820.0%	1	K.ADLEMQIESLTEELAYLK.K
	TK_050702_lung_E16_NE_2D_step03.3900.3900.2	1.4877	0.3599	2369.14	1	3250.0%	2	K.NQILNLTTDNANILLQIDNAR.L
	TK_050702_lung_E16_NE_2D_step05.3082.3082.2	1.2377	0.0083	2210.5	23	1960.0%	1	R.ISSSKGSLGGGFSSGGFSGGSFSR.G
UQ9CZ2199.6%2414.1%149167639.0(Q9CZ21) 2810416I22Rik protein
	TK_050702_lung_E16_NE_2D_step06.3673.3673.2	1.7208	0.311	2231.29	1	3000.0%	2	R.NLVQCGDFPHLLVYGPSGAGK.K
ULSM4_MOUSE99.6%5138.8%1371507610.1(Q9QXA5) U6 snRNA-associated Sm-like protein LSm4
	TK_050702_lung_E16_NE_2D_step05.3050.3050.2	3.6772	0.3523	1383.4	1	8180.0%	2	K.TAQNHPMLVELK.N
UIF41_HUMAN99.6%243.9%406461545.5(P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I)
	TK_050702_lung_E16_NE_2D_step06.3152.3152.2	3.815	0.4275	1830.4	1	5670.0%	2	R.GIYAYGFEKPSAIQQR.A
UQ9D2M799.6%7498.4%202224318.4(Q9D2M7) Hepatoma-derived growth factor, related protein 3
	TK_050702_lung_E16_NE_2D_step02.3605.3605.2	1.256	0.22	1974.46	1	3440.0%	7	K.YPIFFFGTHETAFLGPK.D
UQ9NPL899.6%2410.9%285321938.2(Q9NPL8) C3orf1 hypothetical protein
	TK_050702_lung_E16_NE_2D_step11.4810.4810.3	3.8605	0.4974	3008.49	1	2330.0%	2	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
USMD1_HUMAN99.6%155154.6%1191328211.6(P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen)
	TK_050702_lung_E16_NE_2D_step07.3092.3092.2	2.298	0.5375	2210.62	1	4000.0%	1	K.NGTQVHGTITGVDVSMNTHLK.A
	TK_050702_lung_E16_NE_2D_step06.2999.2999.1	1.8808	0.1934	1270.87	1	6000.0%	4	K.LSHETVTIELK.N
	TK_050702_lung_E16_NE_2D_step06.3211.3211.2	3.6188	0.5477	1556.42	1	7920.0%	2	K.NREPVQLETLSIR.G
	TK_050702_lung_E16_NE_2D_step01.4186.4186.2	4.9907	0.5982	2290.11	1	6840.0%	5	R.YFILPDSLPLDTLLVDVEPK.V
UQ99K4899.6%3927529.0%473545418.9(Q99K48) Non-POU-domain-containing, octamer-binding protein
*	TK_050702_lung_E16_NE_2D_step10.3496.3496.3	2.5898	0.3598	3246.88	1	2580.0%	8	R.FGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNK.R
	TK_050702_lung_E16_NE_2D_step04.2769.2769.2	2.6147	0.5053	1232.92	1	6820.0%	2	K.GIVEFSGKPAAR.K
	TK_050702_lung_E16_NE_2D_step06.2479.2479.2	2.7217	0.393	1541.81	1	6360.0%	1	R.RMEELHNQEVQK.R
	TK_050702_lung_E16_NE_2D_step01.4829.4829.3	3.1472	0.424	3640.5	1	2260.0%	5	R.CSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEK.L
	TK_050702_lung_E16_NE_2D_step01.3025.3025.2	3.3146	0.4969	1697.28	1	7690.0%	1	R.FAQPGSFEYEYAMR.W
	TK_050702_lung_E16_NE_2D_step08.0091.0091.2	1.1992	0.1528	1251.23	2	4000.0%	3	R.FACHSASLTVR.N
	TK_050702_lung_E16_NE_2D_step02.4112.4112.3	2.232	0.3928	2672.0	1	2500.0%	5	R.NLPQYVSNELLEEAFSVFGQVER.A
UNUCL_MOUSE99.6%4712128.5%706765924.8(P09405) Nucleolin (Protein C23)
*	TK_050702_lung_E16_NE_2D_step12.4059.4059.2	4.8782	0.6376	2644.11	1	4760.0%	2	K.NLSFNITEDELKEVFEDAMEIR.L
*	TK_050702_lung_E16_NE_2D_step05.4010.4010.3	1.4278	0.0691	2547.6	5	1820.0%	3	K.QKVEGSEPTTPFNLFIGNLNPNK.S
*	TK_050702_lung_E16_NE_2D_step07.2333.2333.1	1.131	0.2383	839.64	1	6430.0%	1	K.VIPTPGKK.G
*	TK_050702_lung_E16_NE_2D_step02.2073.2073.1	0.9232	0.2007	710.37	1	4170.0%	1	K.VIPTPGK.K
	TK_050702_lung_E16_NE_2D_step01.2791.2791.1	1.7154	0.2445	845.88	1	7140.0%	1	K.ALELTGLK.V
*	TK_050702_lung_E16_NE_2D_step01.1753.1753.1	1.5069	0.1744	760.78	1	6670.0%	1	K.VVVSQTK.K
*	TK_050702_lung_E16_NE_2D_step01.3198.3198.2	2.017	0.2033	1423.78	1	7270.0%	1	K.NLSFNITEDELK.E
*	TK_050702_lung_E16_NE_2D_step01.3103.3103.2	3.0916	0.5798	2216.62	1	4210.0%	2	K.GLSEDTTEETLKESFEGSVR.A
*	TK_050702_lung_E16_NE_2D_step01.1554.1554.1	0.9177	0.134	657.76	3	5000.0%	1	K.AVATPAK.K
	TK_050702_lung_E16_NE_2D_step01.3275.3275.2	4.219	0.5629	1564.11	1	8080.0%	1	K.GFGFVDFNSEEDAK.A
*	TK_050702_lung_E16_NE_2D_step07.2170.2170.1	1.0712	0.1336	882.6	1	4380.0%	1	K.KAAVPTPAK.K
*	TK_050702_lung_E16_NE_2D_step06.2073.2073.1	1.0074	0.0786	890.64	1	5000.0%	2	K.KVVVSQTK.K
	TK_050702_lung_E16_NE_2D_step03.3301.3301.2	1.6673	0.2422	1780.45	1	5710.0%	3	R.KFGYVDFESAEDLEK.A
*	TK_050702_lung_E16_NE_2D_step08.2552.2552.1	1.3953	0.0258	910.74	7	4380.0%	1	K.ALVPTPGKK.G
*	TK_050702_lung_E16_NE_2D_step01.4055.4055.2	2.1098	0.5219	2291.15	1	4000.0%	2	K.VEGSEPTTPFNLFIGNLNPNK.S
	TK_050702_lung_E16_NE_2D_step04.2887.2887.2	2.5937	0.2936	1059.97	1	8750.0%	3	K.VTLDWAKPK.G
*	TK_050702_lung_E16_NE_2D_step01.3023.3023.2	3.2323	0.4878	1399.66	1	7080.0%	1	K.TLVLSNLSYSATK.E
	TK_050702_lung_E16_NE_2D_step01.3050.3050.1	1.728	0.1596	940.97	4	7140.0%	1	K.GIAYIEFK.S
	TK_050702_lung_E16_NE_2D_step01.1462.1462.1	0.608	0.0919	545.44	3	5000.0%	2	R.SQPSK.T
*	TK_050702_lung_E16_NE_2D_step01.3683.3683.1	1.7107	0.0439	1028.24	1	6880.0%	2	K.FAISELFAK.N
	TK_050702_lung_E16_NE_2D_step03.3876.3876.2	3.2254	0.5675	1596.63	1	7690.0%	6	K.GYAFIEFASFEDAK.E
UROC_MOUSE99.6%235531.6%313343855.0(Q9Z204) Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1 / hnRNP C2)
*	TK_050702_lung_E16_NE_2D_step09.3954.3954.3	1.9084	0.2814	3432.47	1	1920.0%	3	R.SAAEMYGSVPEHPSPSPLLSSSFDLDYDFQR.D
*	TK_050702_lung_E16_NE_2D_step03.3397.3397.2	2.4037	0.4369	1390.91	1	6360.0%	4	K.QKVDSLLESLEK.I
	TK_050702_lung_E16_NE_2D_step02.2547.2547.1	2.0776	0.2803	1102.88	4	6110.0%	2	K.LKGDDLQAIK.K
*	TK_050702_lung_E16_NE_2D_step01.2878.2878.2	1.9024	0.3316	1441.17	4	4170.0%	1	K.QADLSFSSPVEMK.N
*	TK_050702_lung_E16_NE_2D_step10.3950.3950.3	2.8783	0.4911	3588.94	1	1850.0%	2	K.RSAAEMYGSVPEHPSPSPLLSSSFDLDYDFQR.D
	TK_050702_lung_E16_NE_2D_step12.1475.1475.1	0.4055	0.0072	639.5	8	2000.0%	1	K.SGFNSK.S
	TK_050702_lung_E16_NE_2D_step03.3557.3557.2	1.4838	0.2116	1686.13	1	3670.0%	2	R.MIAGQVLDINLAAEPK.V
	TK_050702_lung_E16_NE_2D_step02.2969.2969.1	2.1394	0.4274	1125.85	1	5000.0%	3	K.KSDVEAIFSK.Y
*	TK_050702_lung_E16_NE_2D_step01.3223.3223.1	1.3155	0.1408	1133.14	4	5000.0%	1	K.VDSLLESLEK.I
UCUT1_MOUSE99.6%7118.6%13951518026.1(P53564) CCAAT displacement protein (CDP) (Cut-like 1) (Homeobox protein Cux) (Fragment)
*	TK_050702_lung_E16_NE_2D_step06.2792.2792.2	1.63	0.3394	1924.57	1	3420.0%	1	K.TPAAPETSTAALPSAPALKK.E
*	TK_050702_lung_E16_NE_2D_step07.3655.3655.3	2.3628	0.453	3245.85	1	2070.0%	2	R.REMEAQQAALDPALKPAPLSQPDLTILTPK.H
*	TK_050702_lung_E16_NE_2D_step10.3798.3798.2	2.841	0.5657	2204.26	1	4500.0%	2	K.HLSASPMSTVSTYPPLAISLK.K
	TK_050702_lung_E16_NE_2D_step06.3232.3232.2	3.2981	0.5243	2158.4	1	5280.0%	1	K.LRENSASQISQLEQQLNAK.N
*	TK_050702_lung_E16_NE_2D_step12.4765.4765.2	0.9373	0.0033	3150.56	6	1550.0%	1	K.EAQDVPTLDPPGSADAAQGVLRPMKSELVR.G
UO7039699.6%4411.8%473531128.5(O70396) SIK similar protein
	TK_050702_lung_E16_NE_2D_step05.2800.2800.2	2.9772	0.5855	1325.87	1	8330.0%	1	K.HAASTVQILGAEK.A
	TK_050702_lung_E16_NE_2D_step07.3665.3665.2	1.6187	0.3022	1884.43	2	3330.0%	1	K.LNLSCIHSPVVNELMR.G
*	TK_050702_lung_E16_NE_2D_step12.2045.2045.3	0.9042	0.0854	2503.96	8	1020.0%	1	K.TVLAIRYDAFGEDSSSAMGIENR.A
*	TK_050702_lung_E16_NE_2D_step01.0475.0475.1	0.4633	0.268	450.77	1	3330.0%	1	K.DAED.-
UXRC1_MOUSE99.6%356.2%631690046.4(Q60596) DNA-repair protein XRCC1
*	TK_050702_lung_E16_NE_2D_step06.3517.3517.2	3.3194	0.5571	2212.11	1	4470.0%	2	R.VKEEDDSANSLKPGALFFSR.I
	TK_050702_lung_E16_NE_2D_step06.2896.2896.2	2.9788	0.6064	2173.54	1	5000.0%	1	R.HVVSCSSQDSTHCAENLLK.A
USODC_MOUSE99.6%3320.3%153158116.5(P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1)
*	TK_050702_lung_E16_NE_2D_step05.3108.3108.2	2.9417	0.5934	1370.34	1	7080.0%	1	R.VISLSGEHSIIGR.T
	TK_050702_lung_E16_NE_2D_step04.0748.0748.1	0.3509	0.0022	687.59	18	2000.0%	1	K.AVCVLK.G
*	TK_050702_lung_E16_NE_2D_step04.2468.2468.2	1.9281	0.452	1168.74	1	6360.0%	1	R.HVGDLGNVTAGK.D
UQ9QYY299.6%2222.1%263306026.1(Q9QYY2) Poly-glutamine tract-binding protein
*	TK_050702_lung_E16_NE_2D_step11.4165.4165.3	3.0941	0.4962	3885.29	1	2110.0%	1	K.VFDPSCGLPYYWNVETDLVSWLSPHDPNFVVTK.S
	TK_050702_lung_E16_NE_2D_step06.3404.3404.2	1.1431	0.1	2572.4	273	1250.0%	1	K.TGADTTAAGPLFQQRPYPSPGAVLR.A
UU186_MOUSE99.6%71338.4%86101196.4(Q923D4) Hypothetical protein MGC11596
	TK_050702_lung_E16_NE_2D_step08.2922.2922.2	3.0976	0.4943	1586.58	1	6670.0%	2	R.YTIHSQLEHLQSK.Y
	TK_050702_lung_E16_NE_2D_step06.3447.3447.2	2.0217	0.2324	1268.98	1	8120.0%	2	K.WEWLVNQHR.D
	TK_050702_lung_E16_NE_2D_step03.2108.2108.2	1.2019	0.1987	1165.07	1	4000.0%	1	K.YIGTGHADTTK.W
UQ9Z0H499.6%4415.0%508542718.8(Q9Z0H4) Apoptosis-related RNA binding protein (CUG triplet repeat,RNA binding protein 2)
	TK_050702_lung_E16_NE_2D_step02.3409.3409.3	1.5307	0.0677	3208.36	9	1430.0%	1	K.CFGFVSYDNPVSAQAAIQAMNGFQIGMKR.L
	TK_050702_lung_E16_NE_2D_step05.2704.2704.2	4.2693	0.6056	1990.74	1	6760.0%	1	K.AMHQSQTMEGCSSPIVVK.F
	TK_050702_lung_E16_NE_2D_step04.2800.2800.2	2.823	0.4594	1395.23	1	6670.0%	1	K.AALEAQNALHNIK.T
	TK_050702_lung_E16_NE_2D_step12.4381.4381.2	1.0207	0.038	1913.76	127	1670.0%	1	K.ELFEPYGAVYQINVLR.D
UR10A_MOUSE99.6%51116.1%2172491610.0(P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6)
	TK_050702_lung_E16_NE_2D_step05.3460.3460.2	3.2479	0.5566	1486.03	1	7920.0%	3	K.KYDAFLASESLIK.Q
	TK_050702_lung_E16_NE_2D_step05.3352.3352.2	1.4565	0.375	1580.77	1	5380.0%	1	K.AVDIPHMDIEALKK.L
	TK_050702_lung_E16_NE_2D_step02.2495.2495.1	1.382	0.2484	811.69	1	5710.0%	1	R.ILGPGLNK.A
UQ9D6U599.6%105418.5%173197596.2(Q9D6U5) 2310057C03Rik protein
	TK_050702_lung_E16_NE_2D_step06.2929.2929.2	1.6905	0.1796	995.88	1	7860.0%	1	K.NIHLNLDR.R
	TK_050702_lung_E16_NE_2D_step05.4103.4103.3	3.6403	0.4966	2742.72	1	3260.0%	2	R.SVEGWILFVTGVHEEATEEDIHDK.F
UDNM1_MOUSE99.6%18508.8%16201831887.7(P13864) DNA (cytosine-5)-methyltransferase 1 (EC 2.1.1.37) (Dnmt1) (DNA methyltransferase MmuI) (DNA MTase MmuI) (MCMT) (M.MmuI) (Met-1)
	TK_050702_lung_E16_NE_2D_step03.2258.2258.2	0.766	0.0354	2167.93	167	1320.0%	1	K.GDVEMLCGGPPCQGFSGMNR.F
	TK_050702_lung_E16_NE_2D_step02.3955.3955.2	3.1432	0.4905	1599.27	1	7080.0%	6	K.LNLLHEFLQTEIK.S
*	TK_050702_lung_E16_NE_2D_step13.2918.2918.1	0.2434	0.0	959.98	5	710.0%	1	R.RCPNLAVK.E
*	TK_050702_lung_E16_NE_2D_step02.4747.4747.2	1.5952	0.1447	2114.98	7	2780.0%	1	K.SLLNKDLSLENGTHTLTQK.A
*	TK_050702_lung_E16_NE_2D_step08.0058.0058.2	3.8993	0.6569	1588.32	1	7000.0%	2	R.VPALASPAGSLPDHVR.R
*	TK_050702_lung_E16_NE_2D_step03.2841.2841.2	1.8644	0.2966	1151.4	2	6250.0%	1	K.LQYTFHDVK.N
*	TK_050702_lung_E16_NE_2D_step07.2823.2823.2	1.46	0.3173	1071.58	4	4380.0%	1	R.GSHYQPILR.D
*	TK_050702_lung_E16_NE_2D_step09.2559.2559.2	1.5204	0.2248	1381.99	1	5450.0%	1	K.KLESHTVPVQSR.S
*	TK_050702_lung_E16_NE_2D_step11.3213.3213.2	1.7401	0.4337	1336.36	1	5000.0%	1	R.ALIHLAGVSLGQR.R
*	TK_050702_lung_E16_NE_2D_step05.2854.2854.2	3.3091	0.1239	1763.93	2	6150.0%	1	K.KDPVNETLYPEHYR.K
*	TK_050702_lung_E16_NE_2D_step05.2642.2642.2	1.0956	0.1523	1148.37	5	3890.0%	1	R.QTTITAHFTK.G
USMD2_HUMAN99.6%124031.4%118135279.9(P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) (P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2)
	TK_050702_lung_E16_NE_2D_step01.2630.2630.1	1.2696	0.0052	1020.0	8	5710.0%	1	K.EMWTEVPK.S
	TK_050702_lung_E16_NE_2D_step03.3808.3808.2	2.1737	0.0423	2165.56	7	3610.0%	5	K.REEEEFNTGPLSVLTQSVK.N
	TK_050702_lung_E16_NE_2D_step05.2756.2756.1	2.6695	0.2667	1246.83	1	6670.0%	3	R.HCNMVLENVK.E
	TK_050702_lung_E16_NE_2D_step01.3645.3645.2	4.4726	0.6211	2007.53	1	6760.0%	1	R.EEEEFNTGPLSVLTQSVK.N
UQ9D7J599.6%3322.4%192217239.1(Q9D7J5) 2310005N01Rik protein
	TK_050702_lung_E16_NE_2D_step03.3578.3578.2	2.0359	0.2647	2146.98	1	3570.0%	1	K.SSVTSAAAVSALAGVQDQLIEK.R
	TK_050702_lung_E16_NE_2D_step04.2540.2540.1	1.448	0.0989	960.82	5	5710.0%	1	R.ELAELVKR.K
	TK_050702_lung_E16_NE_2D_step04.3283.3283.2	3.8108	0.5018	1516.01	1	8750.0%	1	R.KQELAETLANLER.Q
URS14_HUMAN99.6%102441.1%1511627310.1(P06366) 40S ribosomal protein S14 (PRO2640) (P06366) 40S ribosomal protein S14 (PRO2640)
	TK_050702_lung_E16_NE_2D_step13.4613.4613.3	1.9798	0.4318	4506.51	1	1440.0%	1	K.KEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK.E
	TK_050702_lung_E16_NE_2D_step04.3303.3303.2	1.8545	0.4263	1096.0	1	7220.0%	2	K.ELGITALHIK.L
	TK_050702_lung_E16_NE_2D_step11.4790.4790.3	1.352	0.2494	4381.07	1	1280.0%	4	K.EEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK.E
	TK_050702_lung_E16_NE_2D_step03.2184.2184.2	1.6259	0.414	1056.68	1	6000.0%	1	K.TPGPGAQSALR.A
UQ9CSF999.6%3510.9%368413859.9(Q9CSF9) 2410005K20Rik protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step07.2961.2961.2	2.7717	0.4639	1732.97	1	5000.0%	2	K.KATSLLTQSGLASSAPAK.S
*	TK_050702_lung_E16_NE_2D_step01.4063.4063.2	2.9282	0.5998	2385.1	1	4290.0%	1	K.SVSLPIFSSFVTSQDENAVSLR.S
UQ9D94599.6%3912.3%1301539110.4(Q9D945) 1190005P17Rik protein
*	TK_050702_lung_E16_NE_2D_step05.3367.3367.2	2.9803	0.5374	1987.91	1	5000.0%	3	K.TLLDQHGQYPVWMNQR.Q
UQ9DBY699.6%5711.1%407446548.5(Q9DBY6) 1200009K13Rik protein
	TK_050702_lung_E16_NE_2D_step01.3805.3805.2	3.1449	0.4624	1945.23	1	6330.0%	1	R.FDQLFDDESDPFEVLK.A
	TK_050702_lung_E16_NE_2D_step05.2688.2688.1	2.0233	0.4235	1112.76	1	6110.0%	2	R.SSFSHYSGLK.H
	TK_050702_lung_E16_NE_2D_step06.2749.2749.1	1.1304	0.1124	700.66	9	6000.0%	1	K.GFVLHK.S
	TK_050702_lung_E16_NE_2D_step06.2575.2575.2	1.7063	0.3604	1322.56	2	4580.0%	1	K.NPLPPSVGVADKK.E
UQ8VIJ699.6%160530828.2%699754429.4(Q8VIJ6) PTB-associated splicing factor
	TK_050702_lung_E16_NE_2D_step04.2319.2319.2	0.9591	0.2462	1271.05	23	3640.0%	3	R.SPPPGMGLNQNR.G
	TK_050702_lung_E16_NE_2D_step02.2163.2163.2	1.7605	0.3809	1121.1	1	5000.0%	1	R.GMGPGTPAGYGR.G
	TK_050702_lung_E16_NE_2D_step01.3599.3599.2	3.1016	0.3206	1808.24	1	6670.0%	1	R.LFVGNLPADITEDEFK.R
	TK_050702_lung_E16_NE_2D_step01.0142.0142.1	1.2389	0.0114	715.69	2	5830.0%	2	R.ALAEIAK.A
	TK_050702_lung_E16_NE_2D_step10.4199.4199.3	1.1659	0.0436	4039.73	23	1210.0%	1	R.CSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQK.N
	TK_050702_lung_E16_NE_2D_step07.2799.2799.2	2.8718	0.5831	1766.69	1	6920.0%	51	R.FAQHGTFEYEYSQR.W
	TK_050702_lung_E16_NE_2D_step03.4078.4078.3	4.2145	0.5823	3600.48	1	2580.0%	7	R.CSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEK.L
	TK_050702_lung_E16_NE_2D_step05.3895.3895.2	4.1913	0.5371	2432.45	1	5260.0%	46	K.DKLESEMEDAYHEHQANLLR.Q
	TK_050702_lung_E16_NE_2D_step04.2839.2839.2	3.0098	0.4558	1247.1	1	7730.0%	1	K.GIVEFASKPAAR.K
*	TK_050702_lung_E16_NE_2D_step06.2571.2571.2	2.915	0.4496	1548.66	1	6820.0%	2	R.RMEELHSQEMQK.R
	TK_050702_lung_E16_NE_2D_step08.2786.2786.2	2.9805	0.5533	1146.43	1	8000.0%	4	R.FATHAAALSVR.N
	TK_050702_lung_E16_NE_2D_step03.3644.3644.2	2.0913	0.1349	1966.31	2	4060.0%	3	R.LFVGNLPADITEDEFKR.L
	TK_050702_lung_E16_NE_2D_step01.1961.1961.1	1.8278	0.1697	780.83	1	7000.0%	1	K.NPMYQK.E
	TK_050702_lung_E16_NE_2D_step01.4146.4146.2	4.6796	0.6722	2643.6	1	5230.0%	20	R.NLSPYVSNELLEEAFSQFGPIER.A
	TK_050702_lung_E16_NE_2D_step04.2232.2232.2	1.3018	0.3496	1343.24	1	3570.0%	2	R.FGQGGAGPVGGQGPR.G
UQ9R0U599.6%113725.5%306341046.9(Q9R0U5) Matrin3
	TK_050702_lung_E16_NE_2D_step13.2414.2414.1	0.4712	0.26	855.98	3	1430.0%	1	R.GPGPLQER.S
	TK_050702_lung_E16_NE_2D_step08.2638.2638.2	1.0472	0.0853	1092.94	5	3330.0%	1	R.GPLPLSSQHR.G
*	TK_050702_lung_E16_NE_2D_step01.3691.3691.2	4.064	0.5514	1825.4	1	6470.0%	1	R.GDTDQASNILASFGLSAR.D
	TK_050702_lung_E16_NE_2D_step01.4165.4165.2	3.5587	0.5511	2372.79	1	4170.0%	3	R.DLSAAGIGLLAAATQSLSMPASLGR.M
	TK_050702_lung_E16_NE_2D_step11.2929.2929.2	2.774	0.5033	2000.89	1	5310.0%	5	K.GYPHLCSICDLPVHSNK.V
UQ9CRI099.6%4440266.9%139160025.7(Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment)
	TK_050702_lung_E16_NE_2D_step01.3098.3098.1	1.4357	0.1531	1339.99	1	4000.0%	2	K.WGTLTDCVVMR.D
	TK_050702_lung_E16_NE_2D_step01.2399.2399.1	2.15	0.069	1051.91	1	7140.0%	2	R.DYFEKYGK.I
	TK_050702_lung_E16_NE_2D_step11.4801.4801.2	3.3707	0.5585	2634.1	1	3640.0%	4	R.GFGFVTYSCVEEVDAAMCARPHK.V
	TK_050702_lung_E16_NE_2D_step10.3850.3850.2	2.3645	0.2261	1901.44	1	4690.0%	4	R.KLFIGGLSFETTDDSLR.E
	TK_050702_lung_E16_NE_2D_step01.3899.3899.2	3.5662	0.5256	1773.41	1	7670.0%	18	K.LFIGGLSFETTDDSLR.E
	TK_050702_lung_E16_NE_2D_step10.3996.3996.2	2.0358	0.4819	2441.95	1	3500.0%	1	K.LFIGGLSFETTDDSLREHFEK.W
	TK_050702_lung_E16_NE_2D_step05.2519.2519.2	2.575	0.4156	1381.71	1	7500.0%	2	R.EDSVKPGAHLTVK.K
	TK_050702_lung_E16_NE_2D_step02.3489.3489.2	3.3589	0.6226	2010.68	1	5670.0%	1	R.EHFEKWGTLTDCVVMR.D
	TK_050702_lung_E16_NE_2D_step01.4915.4915.2	1.9831	0.2724	1886.53	2	3670.0%	5	K.IFVGGIKEDTEEYNLR.D
	TK_050702_lung_E16_NE_2D_step01.0327.0327.1	1.0621	0.1294	701.56	1	7500.0%	2	R.DYFEK.Y
UO0878499.6%213317.4%13201350019.3(O08784) Treacle protein (Treacher collins syndrome protein) (Putative nucleolar trafficking phosphoprotein)
*	TK_050702_lung_E16_NE_2D_step09.2132.2132.1	0.4478	0.0303	723.32	6	2000.0%	1	K.EQPVPR.A
*	TK_050702_lung_E16_NE_2D_step05.1907.1907.2	0.7993	0.1278	1170.58	13	2270.0%	1	K.TVNSVSHPGSGK.T
*	TK_050702_lung_E16_NE_2D_step09.2446.2446.2	0.8744	0.1096	1292.19	11	2080.0%	1	K.LGNVAPTPAKPAR.A
*	TK_050702_lung_E16_NE_2D_step01.3471.3471.2	1.8406	0.4869	2099.25	1	4170.0%	1	R.LLEQAWPLSEAQVQASVVK.V
*	TK_050702_lung_E16_NE_2D_step11.4142.4142.2	1.5814	0.3655	2934.63	1	2920.0%	1	K.SFLTQPVTLLDIYTHWQQTSELGQK.Q
*	TK_050702_lung_E16_NE_2D_step06.2653.2653.2	3.709	0.5924	2102.72	1	5530.0%	1	K.KSTSSSPAPTQTLPNSITQR.L
*	TK_050702_lung_E16_NE_2D_step02.2405.2405.1	0.6865	0.0346	853.63	5	3750.0%	1	K.GPILATPGK.T
*	TK_050702_lung_E16_NE_2D_step05.2294.2294.2	2.7943	0.3613	1674.97	1	5310.0%	2	K.SSQVRPVSTVTPGSSGK.G
*	TK_050702_lung_E16_NE_2D_step01.2765.2765.2	0.8566	0.1041	2140.17	5	2370.0%	1	K.APRSSEDSSDTSSEDEEDAK.R
*	TK_050702_lung_E16_NE_2D_step05.2468.2468.2	1.2184	0.1175	1780.98	2	3820.0%	2	K.ATPRPTPVNSATAALPSK.V
*	TK_050702_lung_E16_NE_2D_step06.3035.3035.2	2.0457	0.5459	954.41	2	6250.0%	1	K.TVVHLLSGK.S
*	TK_050702_lung_E16_NE_2D_step03.2285.2285.2	1.5152	0.224	1774.91	1	3820.0%	3	K.ATPRPDSNSLASSAPATK.D
*	TK_050702_lung_E16_NE_2D_step06.2532.2532.1	1.3857	0.0255	1378.88	2	3460.0%	1	K.AALGQGVAPVHTQK.T
*	TK_050702_lung_E16_NE_2D_step04.3231.3231.3	1.0536	0.0933	3218.33	175	860.0%	1	K.DSETSSEDDSDSEDEMPVTVNTPQARTSGK.S
UQ9Z1H699.6%164017.1%782883048.3(Q9Z1H6) Nuclear protein np95 (Nuclear zinc finger protein Np95)
*	TK_050702_lung_E16_NE_2D_step06.2805.2805.2	2.1616	0.3279	1468.96	1	5830.0%	1	R.ALALNCHSPINEK.G
*	TK_050702_lung_E16_NE_2D_step11.2877.2877.3	0.8586	0.061	3375.48	126	430.0%	1	R.FELDHSSPTRVNQPLQTILNQLFPGYGSGR.-
*	TK_050702_lung_E16_NE_2D_step12.3588.3588.2	0.9505	0.0524	1674.64	208	1790.0%	1	R.TMDGKETHTVNSLSR.L
*	TK_050702_lung_E16_NE_2D_step12.2379.2379.2	0.8697	0.0164	1755.25	16	2690.0%	1	K.KIEEVFHVEPQLQR.L
*	TK_050702_lung_E16_NE_2D_step08.3843.3843.2	1.2163	0.1189	2741.31	1	2500.0%	3	R.TTECTIVPANHFGPIPGVPVGTMWR.F
*	TK_050702_lung_E16_NE_2D_step04.4140.4140.2	1.9678	0.2602	2205.94	4	2630.0%	4	R.VNQPLQTILNQLFPGYGSGR.-
*	TK_050702_lung_E16_NE_2D_step11.4357.4357.2	0.9968	0.0624	2356.49	3	2380.0%	1	K.ERDSELSDSDSGYGVGHSESDK.S
*	TK_050702_lung_E16_NE_2D_step13.2850.2850.2	1.2023	0.3247	1602.71	2	3210.0%	1	R.RPLIASPSQPPPALR.N
UCYPB_MOUSE99.6%153135.1%208227139.5(P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1)
	TK_050702_lung_E16_NE_2D_step04.3349.3349.2	2.3626	0.4588	1629.38	1	5770.0%	2	R.VIKDFMIQGGDFTR.G
*	TK_050702_lung_E16_NE_2D_step01.4929.4929.1	0.9965	0.0494	866.81	2	6430.0%	1	R.VVFGLFGK.T
	TK_050702_lung_E16_NE_2D_step08.3086.3086.2	2.9826	0.4464	1476.89	1	6150.0%	4	K.HYGPGWVSMANAGK.D
	TK_050702_lung_E16_NE_2D_step04.2977.2977.2	1.9158	0.3194	1245.87	3	5500.0%	2	K.IEVEKPFAIAK.E
	TK_050702_lung_E16_NE_2D_step01.2999.2999.1	2.1119	0.3408	1460.12	1	5000.0%	1	K.DTNGSQFFITTVK.T
	TK_050702_lung_E16_NE_2D_step01.2967.2967.1	1.6875	0.2744	1287.04	1	6500.0%	1	K.DFMIQGGDFTR.G
	TK_050702_lung_E16_NE_2D_step01.3201.3201.1	1.632	0.3372	1366.03	2	3750.0%	1	K.TVDNFVALATGEK.G
US3B1_MOUSE99.6%81011.6%13041458167.1(Q99NB9) Splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit)
	TK_050702_lung_E16_NE_2D_step05.2710.2710.2	3.3274	0.5885	1833.09	1	6760.0%	1	K.IWDPTPSHTPAGAATPGR.G
	TK_050702_lung_E16_NE_2D_step04.3412.3412.2	4.2258	0.6726	2113.42	1	6180.0%	1	R.NRPLSDEELDAMFPEGYK.V
	TK_050702_lung_E16_NE_2D_step05.0138.0138.3	1.3465	0.0231	3549.57	97	900.0%	1	K.IWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSAR.K
	TK_050702_lung_E16_NE_2D_step11.3526.3526.3	2.6926	0.3037	3269.78	1	2330.0%	1	K.TPIGTPAMNMATPTPGHIMSMTPEQLQAWR.W
	TK_050702_lung_E16_NE_2D_step04.3377.3377.2	2.2716	0.4555	2262.39	1	4000.0%	2	K.LTATPTPLGGMTGFHMQTEDR.T
	TK_050702_lung_E16_NE_2D_step04.2859.2859.2	4.0961	0.6488	2303.94	1	5480.0%	1	K.SRWDETPASQMGGSTPVLTPGK.T
	TK_050702_lung_E16_NE_2D_step01.3539.3539.2	2.3634	0.2767	2639.11	1	2730.0%	1	K.SVNDQPSGNLPFLKPDDIQYFDK.L
UROA2_MOUSE99.6%190593448.1%341359938.6(O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1)
	TK_050702_lung_E16_NE_2D_step06.2516.2516.2	1.7934	0.3269	1413.32	1	6360.0%	13	K.YHTINGHNAEVR.K
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	3	K.IVLQK.Y
	TK_050702_lung_E16_NE_2D_step03.2632.2632.3	1.5738	0.0298	1990.43	70	2340.0%	1	K.IVLQKYHTINGHNAEVR.K
	TK_050702_lung_E16_NE_2D_step11.3486.3486.2	1.8764	0.3436	1929.81	1	4690.0%	9	R.KLFIGGLSFETTEESLR.N
	TK_050702_lung_E16_NE_2D_step01.2433.2433.1	2.673	0.2256	1090.17	1	7140.0%	2	R.NYYEQWGK.L
	TK_050702_lung_E16_NE_2D_step02.3823.3823.2	2.9033	0.3937	1802.92	1	6330.0%	42	K.LFIGGLSFETTEESLR.N
	TK_050702_lung_E16_NE_2D_step06.3560.3560.2	1.5252	0.4068	1854.51	2	3000.0%	4	K.RGFGFVTFDDHDPVDK.I
	TK_050702_lung_E16_NE_2D_step01.3317.3317.2	3.967	0.5456	1698.28	1	7860.0%	3	R.GFGFVTFDDHDPVDK.I
	TK_050702_lung_E16_NE_2D_step04.3672.3672.2	4.2828	0.4947	2224.36	1	5590.0%	56	R.DYFEEYGKIDTIEIITDR.Q
	TK_050702_lung_E16_NE_2D_step08.3146.3146.1	1.928	0.1856	863.87	1	6430.0%	13	K.KLFVGGIK.E
	TK_050702_lung_E16_NE_2D_step09.0031.0031.2	4.6348	0.5678	1882.33	1	6670.0%	22	K.LFVGGIKEDTEEHHLR.D
	TK_050702_lung_E16_NE_2D_step02.2467.2467.2	1.445	0.2139	1380.64	1	4290.0%	6	R.GGGGNFGPGPGSNFR.G
	TK_050702_lung_E16_NE_2D_step01.3053.3053.2	3.0936	0.2244	1191.12	1	9440.0%	1	K.IDTIEIITDR.Q
	TK_050702_lung_E16_NE_2D_step05.2308.2308.1	0.8459	0.0757	1338.61	4	2920.0%	1	R.EESGKPGAHVTVK.K
	TK_050702_lung_E16_NE_2D_step01.2333.2333.1	1.4539	0.0875	995.93	1	5710.0%	3	K.LTDCVVMR.D
	TK_050702_lung_E16_NE_2D_step01.2461.2461.1	1.2671	0.1139	1014.11	2	6670.0%	1	R.GGNFGFGDSR.G
	TK_050702_lung_E16_NE_2D_step02.0023.0023.2	1.2395	0.2244	2192.96	4	2290.0%	6	R.NMGGPYGGGNYGPGGSGGSGGYGGR.S
UH12_MOUSE99.6%4517936.5%2112113511.0(P15864) Histone H1.2 (H1 VAR.1) (H1C)
	TK_050702_lung_E16_NE_2D_step08.0534.0534.1	1.5516	0.1104	643.6	3	5830.0%	1	K.KPAGAAK.K
	TK_050702_lung_E16_NE_2D_step03.2526.2526.1	1.4559	0.1102	1239.39	1	5000.0%	6	K.KALAAAGYDVEK.N
*	TK_050702_lung_E16_NE_2D_step01.4923.4923.1	1.7149	0.1454	759.11	2	6670.0%	3	K.GILVQTK.G
	TK_050702_lung_E16_NE_2D_step06.2955.2955.2	3.1042	0.5363	1328.15	1	7080.0%	1	R.KASGPPVSELITK.A
*	TK_050702_lung_E16_NE_2D_step09.0664.0664.1	1.1339	0.1375	627.71	2	6000.0%	1	K.KPAGVR.R
	TK_050702_lung_E16_NE_2D_step01.2289.2289.1	2.9052	0.4528	1110.0	1	7000.0%	3	K.ALAAAGYDVEK.N
*	TK_050702_lung_E16_NE_2D_step07.1943.1943.1	2.1013	0.45	857.69	1	6250.0%	7	K.KPAAAAVTK.K
	TK_050702_lung_E16_NE_2D_step01.1965.1965.1	1.5657	0.1822	533.93	2	7500.0%	2	K.SLVSK.G
	TK_050702_lung_E16_NE_2D_step01.2645.2645.1	1.8903	0.1798	1201.08	6	4550.0%	3	K.ASGPPVSELITK.A
	TK_050702_lung_E16_NE_2D_step06.0840.0840.2	1.4554	0.0883	845.77	1	6250.0%	1	K.KATGAATPK.K
	TK_050702_lung_E16_NE_2D_step01.1950.1950.1	0.9585	0.0561	812.03	3	5000.0%	2	K.GTGASGSFK.L
UH31_HUMAN99.6%2422649.6%1351527311.1(P16106) Histone H3.1 (H3/a) (H3/c) (H3/d) (H3/f) (H3/h) (H3/i) (H3/j) (H3/k) (H3/l) (P16106) Histone H3.1 (H3/a) (H3/c) (H3/d) (H3/f) (H3/h) (H3/i) (H3/j) (H3/k) (H3/l)
	TK_050702_lung_E16_NE_2D_step01.1954.1954.1	1.3956	0.2705	850.79	1	7500.0%	1	R.EIAQDFK.T
	TK_050702_lung_E16_NE_2D_step01.2190.2190.1	1.4741	0.0544	716.07	2	8000.0%	1	K.DIQLAR.R
	TK_050702_lung_E16_NE_2D_step01.2633.2633.1	1.4781	0.1558	832.09	1	6670.0%	1	K.STELLIR.K
	TK_050702_lung_E16_NE_2D_step06.1860.1860.1	0.8728	0.1289	688.42	3	5000.0%	1	R.KQLATK.A
	TK_050702_lung_E16_NE_2D_step11.4843.4843.3	1.9866	0.0268	3591.24	1	1690.0%	14	R.FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK.R
	TK_050702_lung_E16_NE_2D_step09.2717.2717.2	2.3885	0.3887	1034.84	2	7500.0%	5	R.YRPGTVALR.E
URED_MOUSE99.6%469.0%557655176.5(Q9Z1M8) Red protein (RER protein)
	TK_050702_lung_E16_NE_2D_step03.3908.3908.2	3.4514	0.2699	2469.48	1	4520.0%	2	K.KPPEADMNIFEDIGDYVPSTTK.T
	TK_050702_lung_E16_NE_2D_step06.2489.2489.3	2.472	0.183	2318.03	2	2500.0%	1	R.DGVNKDYEETELISTTANYR.A
	TK_050702_lung_E16_NE_2D_step06.2760.2760.1	1.5475	0.1317	901.82	3	6430.0%	1	K.KISAIIEK.R
UQ922Y799.6%115111.2%464510285.3(Q922Y7) Unknown (Protein for MGC:6388)
	TK_050702_lung_E16_NE_2D_step03.3974.3974.3	1.2686	0.2451	4057.25	2	860.0%	1	K.IIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYK.G
	TK_050702_lung_E16_NE_2D_step11.4523.4523.2	1.8676	0.3835	1521.27	1	5000.0%	5	R.LLIHQSLAGGIIGVK.G
	TK_050702_lung_E16_NE_2D_step08.3892.3892.3	1.9131	0.2802	4186.68	2	1460.0%	5	K.KIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYK.G
UPCB2_MOUSE99.6%3512.4%362382226.8(Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP)
	TK_050702_lung_E16_NE_2D_step13.4617.4617.3	3.6764	0.5613	3355.52	1	2250.0%	2	K.AFAMIIDKLEEDISSSMTNSTAASRPPVTLR.L
	TK_050702_lung_E16_NE_2D_step02.0603.0603.1	0.4548	0.0347	1481.26	16	770.0%	1	R.LLMHGKEVGSIIGK.K
UQ9ESX599.6%6613.4%509575029.2(Q9ESX5) DYSKERIN
*	TK_050702_lung_E16_NE_2D_step01.3858.3858.2	3.3391	0.5669	2282.03	1	5000.0%	1	K.NTLVTEAVQAPQLAAEAVNVIK.R
*	TK_050702_lung_E16_NE_2D_step12.2443.2443.2	1.7828	0.3307	1813.08	5	3000.0%	1	R.TAHYTPLPCGSNPLKR.E
	TK_050702_lung_E16_NE_2D_step08.4076.4076.2	1.6292	0.3736	2111.31	1	2890.0%	1	R.ALETLTGALFQRPPLIAAVK.R
*	TK_050702_lung_E16_NE_2D_step07.2931.2931.2	2.3353	0.3853	1657.6	1	6790.0%	1	R.TAHYTPLPCGSNPLK.R
	TK_050702_lung_E16_NE_2D_step01.0415.0415.1	0.8715	0.1236	698.58	1	6000.0%	1	K.LLTSHK.R
*	TK_050702_lung_E16_NE_2D_step01.2915.2915.2	1.1143	0.0073	2137.15	8	2220.0%	1	K.LNVRTAHYTPLPCGSNPLK.R
UQ9R0U099.6%61019.5%2623124511.2(Q9R0U0) Neural specific sr protein NSSR 1
	TK_050702_lung_E16_NE_2D_step01.4007.4007.2	3.0754	0.5374	1918.64	1	5330.0%	1	R.YGPIVDVYVPLDFYTR.R
	TK_050702_lung_E16_NE_2D_step04.2759.2759.2	1.7353	0.3111	1434.64	1	5000.0%	2	R.QIEIQFAQGDRK.T
	TK_050702_lung_E16_NE_2D_step01.3183.3183.1	1.5137	0.2271	1331.69	1	6000.0%	1	R.GFAYVQFEDVR.D
	TK_050702_lung_E16_NE_2D_step11.3057.3057.2	2.3487	0.3136	1466.25	1	5450.0%	2	R.YLRPPNTSLFVR.N
UH4_HUMAN99.6%5847663.7%1021123611.4(P02304) Histone H4 (P02304) Histone H4
	TK_050702_lung_E16_NE_2D_step01.3575.3575.1	1.7028	0.2641	1314.01	5	4550.0%	2	K.TVTAMDVVYALK.R
	TK_050702_lung_E16_NE_2D_step04.2431.2431.3	1.6011	0.0434	1697.18	2	3040.0%	1	K.VLRDNIQGITKPAIR.R
	TK_050702_lung_E16_NE_2D_step01.2037.2037.1	2.2593	0.4395	1134.91	1	6110.0%	1	R.DAVTYTEHAK.R
	TK_050702_lung_E16_NE_2D_step08.4163.4163.2	3.0127	0.5481	2106.86	1	4120.0%	3	K.VFLENVIRDAVTYTEHAK.R
	TK_050702_lung_E16_NE_2D_step01.2725.2725.1	1.3248	0.0871	716.57	1	5830.0%	2	R.TLYGFGG.-
	TK_050702_lung_E16_NE_2D_step06.3605.3605.2	3.1291	0.4469	1441.73	1	7080.0%	6	R.KTVTAMDVVYALK.R
	TK_050702_lung_E16_NE_2D_step09.3201.3201.2	2.6109	0.4443	1339.57	1	7500.0%	6	K.RISGLIYEETR.G
	TK_050702_lung_E16_NE_2D_step03.2564.2564.2	2.3742	0.2672	1328.38	1	6820.0%	12	R.DNIQGITKPAIR.R
	TK_050702_lung_E16_NE_2D_step04.3587.3587.2	2.9906	0.3776	1470.5	1	5830.0%	14	K.TVTAMDVVYALKR.Q
UMK_MOUSE99.6%1112.9%140154349.7(P12025) Midkine precursor (Retinoic acid-induced differentiation factor)
*	TK_050702_lung_E16_NE_2D_step04.3032.3032.2	3.3445	0.5173	2084.78	1	5290.0%	1	K.KGSECSEWTWGPCTPSSK.D
UQ9Z13099.6%2611626.6%301335597.3(Q9Z130) JKTBP (Heterogeneous nuclear ribonucleoprotein D-like)
	TK_050702_lung_E16_NE_2D_step01.2818.2818.1	1.5803	0.217	996.85	1	7140.0%	1	K.DLTEYLSR.F
	TK_050702_lung_E16_NE_2D_step03.3373.3373.2	1.9589	0.4324	1835.83	1	5360.0%	2	R.GFCFITYTDEEPVKK.L
	TK_050702_lung_E16_NE_2D_step04.3140.3140.2	1.5172	0.1667	1472.59	1	4580.0%	2	K.MFIGGLSWDTSKK.D
	TK_050702_lung_E16_NE_2D_step01.2782.2782.2	3.2631	0.3379	1708.32	1	6000.0%	1	K.VFVGGLSPDTSEEQIK.E
	TK_050702_lung_E16_NE_2D_step11.4301.4301.3	3.137	0.5288	3893.07	1	2280.0%	2	K.VFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTK.T
	TK_050702_lung_E16_NE_2D_step02.3891.3891.2	4.7322	0.5508	2205.36	1	5830.0%	5	K.EYFGAFGEIENIELPMDTK.T
	TK_050702_lung_E16_NE_2D_step06.2187.2187.1	1.8906	0.2749	891.61	1	7140.0%	8	R.YHQIGSGK.C
	TK_050702_lung_E16_NE_2D_step03.3060.3060.2	3.6775	0.5084	1836.42	1	6250.0%	3	K.KVFVGGLSPDTSEEQIK.E
	TK_050702_lung_E16_NE_2D_step11.0483.0483.1	0.6528	0.2113	1344.95	29	1360.0%	2	K.MFIGGLSWDTSK.K
UH32_BOVIN99.6%3190124.4%1351525711.3(P16105) Histone H3 (H3.2)
*	TK_050702_lung_E16_NE_2D_step12.4585.4585.3	1.4713	0.1891	3518.02	44	1050.0%	30	R.FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK.R
*	TK_050702_lung_E16_NE_2D_step12.4093.4093.3	1.9405	0.0693	3669.66	1	1800.0%	1	R.FQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR.V
UQ920B999.6%9197.9%10471197265.6(Q920B9) Chromatin-specific transcription elongation factor, 140 kDa subunit
	TK_050702_lung_E16_NE_2D_step02.3392.3392.3	1.5856	0.1134	1829.4	1	2810.0%	2	K.APGEQTVPALNLQNAFR.I
	TK_050702_lung_E16_NE_2D_step04.3423.3423.3	4.0153	0.5616	3090.82	1	3240.0%	3	K.KYLAGADPSTVEMCYPPIIQSGGNYNLK.F
*	TK_050702_lung_E16_NE_2D_step08.4128.4128.3	1.4518	0.16	3153.34	2	1920.0%	2	K.HALFQPCDGEMIIVLHFHLKNAVMFGK.K
	TK_050702_lung_E16_NE_2D_step01.3371.3371.1	1.5045	0.2828	1241.92	6	5000.0%	1	K.NLGFGMGIEFR.E
UQ8VCQ899.6%4411.1%530604537.4(Q8VCQ8) Similar to caldesmon 1
*	TK_050702_lung_E16_NE_2D_step03.3910.3910.2	0.7564	0.0026	1937.26	18	1470.0%	1	R.QKEFDPTITDGSLSGPSR.R
*	TK_050702_lung_E16_NE_2D_step11.2485.2485.2	2.5751	0.5343	2022.07	1	3950.0%	1	K.ASKPMKPAASDLPVPAEGVR.N
*	TK_050702_lung_E16_NE_2D_step12.3940.3940.1	0.2368	0.0	1580.13	32	420.0%	1	R.RCLATLSQIAYQR.N
	TK_050702_lung_E16_NE_2D_step01.0970.0970.2	0.4582	0.0036	1012.76	10	2860.0%	1	K.RLQEALER.Q
UPCB1_HUMAN99.6%248.7%356375267.1(Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3)
*	TK_050702_lung_E16_NE_2D_step13.4605.4605.3	3.3384	0.4265	3380.69	1	2670.0%	2	K.AFAMIIDKLEEDINSSMTNSTAASRPPVTLR.L
UNPM_MOUSE99.6%84103042.8%292325604.8(Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38)
	TK_050702_lung_E16_NE_2D_step08.3780.3780.2	5.419	0.6554	2934.18	1	3700.0%	13	R.TVSLGAGAKDELHIVEAEAMNYEGSPIK.V
	TK_050702_lung_E16_NE_2D_step01.2494.2494.1	1.7028	0.0998	784.8	4	8000.0%	1	K.FINYVK.N
	TK_050702_lung_E16_NE_2D_step06.3839.3839.2	1.3516	0.2014	2261.55	1	3530.0%	10	K.DYHFKVDNDENEHQLSLR.T
	TK_050702_lung_E16_NE_2D_step12.1159.1159.1	0.2401	0.0034	571.85	1	1250.0%	3	K.VPVKK.S
	TK_050702_lung_E16_NE_2D_step03.2033.2033.1	1.478	0.1833	915.76	7	5000.0%	2	K.DLKPSTPR.S
	TK_050702_lung_E16_NE_2D_step01.2121.2121.1	1.0282	0.1438	803.73	1	5620.0%	1	R.TVSLGAGAK.D
	TK_050702_lung_E16_NE_2D_step01.0096.0096.1	1.3147	0.1652	932.23	29	5000.0%	2	K.GPSSVEDIK.A
	TK_050702_lung_E16_NE_2D_step02.2589.2589.1	0.899	0.1401	705.71	77	4170.0%	1	K.LLGMSGK.R
	TK_050702_lung_E16_NE_2D_step03.3920.3920.2	2.4402	0.2307	1822.02	1	5770.0%	6	R.MTDQEAIQDLWQWR.K
	TK_050702_lung_E16_NE_2D_step06.2236.2236.2	0.84	0.0896	862.79	8	3570.0%	1	K.LLGMSGKR.S
	TK_050702_lung_E16_NE_2D_step06.3848.3848.2	1.9107	0.0152	1949.46	2	4640.0%	1	R.MTDQEAIQDLWQWRK.S
	TK_050702_lung_E16_NE_2D_step01.4857.4857.2	4.3131	0.6217	2229.84	1	5250.0%	4	K.MSVQPTVSLGGFEITPPVVLR.L
	TK_050702_lung_E16_NE_2D_step01.2537.2537.1	1.1615	0.3068	745.9	2	6670.0%	1	K.VTLATLK.M
	TK_050702_lung_E16_NE_2D_step04.3448.3448.2	4.1738	0.4793	2149.23	1	6670.0%	18	K.DELHIVEAEAMNYEGSPIK.V
URL17_MOUSE99.6%135726.1%1842142310.2(Q9CPR4) 60S ribosomal protein L17 (L23)
	TK_050702_lung_E16_NE_2D_step02.3704.3704.2	1.9279	0.38	1190.09	1	6670.0%	4	K.SAEFLLHMLK.N
	TK_050702_lung_E16_NE_2D_step01.0003.0003.1	0.6722	0.1278	443.38	1	5000.0%	1	R.AHGR.I
	TK_050702_lung_E16_NE_2D_step03.3614.3614.2	1.9065	0.4586	1782.22	1	4670.0%	6	K.GLDVDSLVIEHIQVNK.A
	TK_050702_lung_E16_NE_2D_step04.3628.3628.2	1.9789	0.2858	2165.18	1	5290.0%	2	R.INPYMSSPCHIEMILTEK.E
UQ925Q199.6%554.7%19022062836.7(Q925Q1) Osa1 nuclear protein
*	TK_050702_lung_E16_NE_2D_step02.2805.2805.3	3.0766	0.6176	4028.6	1	2130.0%	1	R.HDSYGNQFSTQGTPSSSPFPSQQTTMYQQQQQNYK.R
	TK_050702_lung_E16_NE_2D_step08.2844.2844.1	1.6846	0.2808	1003.74	1	6250.0%	1	K.SPFLHSGMK.M
*	TK_050702_lung_E16_NE_2D_step06.2203.2203.2	1.0675	0.1364	1759.72	1	3440.0%	1	R.QNTGSATQGPAYHGVNR.T
	TK_050702_lung_E16_NE_2D_step06.2387.2387.2	1.176	0.2607	1290.34	1	5000.0%	1	K.RPMDGTYGPPAK.R
*	TK_050702_lung_E16_NE_2D_step11.3069.3069.2	0.8806	0.1837	1993.26	1	2810.0%	1	K.IELLPSRPYVPCPTPPR.K
UFBRL_MOUSE99.6%175140.7%3273443910.3(P35550) Fibrillarin (Nucleolar protein 1)
	TK_050702_lung_E16_NE_2D_step07.3145.3145.2	3.8467	0.5376	2524.14	1	5000.0%	4	K.KMQQENMKPQEQLTLEPYER.D
	TK_050702_lung_E16_NE_2D_step03.3226.3226.2	2.0142	0.5246	1971.18	1	3610.0%	1	K.ANCIDSTASAEAVFASEVK.K
	TK_050702_lung_E16_NE_2D_step09.2898.2898.2	4.226	0.6815	1537.67	1	7690.0%	5	R.DHAVVVGVYRPPPK.V
	TK_050702_lung_E16_NE_2D_step02.3985.3985.3	1.4037	0.105	3419.69	1	1950.0%	1	K.VLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHR.S
	TK_050702_lung_E16_NE_2D_step05.2772.2772.1	1.9762	0.3995	1017.8	1	7860.0%	1	R.HEGVFICR.G
	TK_050702_lung_E16_NE_2D_step04.2341.2341.2	1.5142	0.3391	982.63	1	6430.0%	1	K.NVMVEPHR.H
	TK_050702_lung_E16_NE_2D_step11.4779.4779.2	4.6695	0.6212	1873.58	1	6110.0%	2	K.LAAAILGGVDQIHIKPGAK.V
	TK_050702_lung_E16_NE_2D_step01.2501.2501.1	1.2533	0.0764	1292.99	14	3640.0%	1	K.NLVPGESVYGEK.R
UHBB2_MOUSE99.6%132946.6%146157478.1(P02089) Hemoglobin beta-2 chain (B2) (Minor)
*	TK_050702_lung_E16_NE_2D_step06.3052.3052.1	2.4525	0.3887	1221.98	1	6500.0%	3	K.KVITAFNEGLK.N
*	TK_050702_lung_E16_NE_2D_step13.5025.5025.2	1.4947	0.1122	1656.7	1	4000.0%	2	R.LLGNAIVIVLGHHLGK.D
*	TK_050702_lung_E16_NE_2D_step01.2801.2801.1	1.5605	0.3147	1021.88	1	6250.0%	1	K.SAVSCLWAK.V
*	TK_050702_lung_E16_NE_2D_step01.2329.2329.1	1.759	0.1692	1313.23	2	5000.0%	1	K.VNPDEVGGEALGR.L
*	TK_050702_lung_E16_NE_2D_step01.2769.2769.1	1.841	0.2952	1092.95	1	6670.0%	1	K.VITAFNEGLK.N
*	TK_050702_lung_E16_NE_2D_step03.3618.3618.2	4.0117	0.5678	2010.07	1	6390.0%	3	R.YFDSFGDLSSASAIMGNPK.V
UQ91W1699.6%82616.6%499549759.9(Q91W16) Unknown (Protein for MGC:7184)
*	TK_050702_lung_E16_NE_2D_step11.3461.3461.3	2.0328	0.4399	3502.11	1	1210.0%	3	K.SREPQVKPQLDLSIDSLDLSLEEGTPCSVASK.L
*	TK_050702_lung_E16_NE_2D_step05.3218.3218.3	1.9104	0.0079	3292.27	13	1450.0%	1	R.ATSSTQSLARLGSPDDGNSALLSLPGYRPTTR.S
*	TK_050702_lung_E16_NE_2D_step09.3722.3722.2	4.3871	0.513	2148.48	1	5560.0%	4	R.LPPKVESLESLYFTPTPAR.G
UQ9D0M899.6%111323.4%487549276.4(Q9D0M8) 5730470C09Rik protein
	TK_050702_lung_E16_NE_2D_step05.2707.2707.1	1.4642	0.1788	905.83	5	5710.0%	1	K.SFLKPGEK.T
	TK_050702_lung_E16_NE_2D_step01.4093.4093.2	5.1337	0.6796	2533.64	1	5680.0%	1	K.NLSPVVSNELLEQAFSQFGPVEK.A
*	TK_050702_lung_E16_NE_2D_step09.2922.2922.2	1.1666	0.1656	1855.0	2	2860.0%	1	R.RQQEGGFKPNYMENR.E
	TK_050702_lung_E16_NE_2D_step01.2319.2319.1	1.6359	0.2126	745.94	1	7500.0%	1	R.TLAEIAK.A
	TK_050702_lung_E16_NE_2D_step04.2528.2528.1	0.8759	0.0972	816.19	7	5000.0%	1	R.RLEELR.N
	TK_050702_lung_E16_NE_2D_step07.2765.2765.2	1.3192	0.0534	1116.71	1	6500.0%	2	R.FATHGAALTVK.N
	TK_050702_lung_E16_NE_2D_step01.3541.3541.2	1.1222	0.1847	1838.4	1	3000.0%	1	R.LFVGNLPTDITEEDFK.R
*	TK_050702_lung_E16_NE_2D_step04.2669.2669.2	2.3353	0.3	1688.51	1	5000.0%	1	R.FPQGPPSQMGSPMGNR.T
	TK_050702_lung_E16_NE_2D_step06.3105.3105.2	2.3337	0.5096	1290.61	1	6820.0%	1	K.GFVEFAAKPPAR.K
UVIME_MOUSE99.6%599.9%465535575.1(P20152) Vimentin
	TK_050702_lung_E16_NE_2D_step05.3998.3998.2	1.8403	0.3828	2128.06	1	3330.0%	1	R.LLQDSVDFSLADAINTEFK.N
	TK_050702_lung_E16_NE_2D_step05.3590.3590.2	3.7634	0.5199	1535.39	1	7500.0%	2	R.KVESLQEEIAFLK.K
	TK_050702_lung_E16_NE_2D_step06.2953.2953.2	1.2727	0.0397	1497.13	56	3080.0%	2	R.TYSLGSALRPSTSR.S
UILF3_MOUSE99.6%256920.4%911980429.2(Q9Z1X4) Interleukin enhancer-binding factor 3
*	TK_050702_lung_E16_NE_2D_step04.0078.0078.3	6.0779	0.6084	3444.75	1	3170.0%	4	K.ASYSSGYQSHQGQQQPYNQSQYSSYGTPQGK.Q
*	TK_050702_lung_E16_NE_2D_step04.2339.2339.2	2.0476	0.4417	1443.75	1	6500.0%	1	R.NTEHSMNYQYR.-
	TK_050702_lung_E16_NE_2D_step01.2941.2941.1	1.6076	0.1153	1020.97	4	6670.0%	1	K.AYAALAALEK.L
*	TK_050702_lung_E16_NE_2D_step03.4228.4228.3	1.5659	0.0817	3227.73	33	1320.0%	2	R.SGGNSYGSSGSSSYNTGSHGGYGTGSGGSSSYQGK.Q
	TK_050702_lung_E16_NE_2D_step08.2758.2758.2	1.1487	0.2574	1303.15	5	4500.0%	2	R.LNQLKPGLQYK.L
	TK_050702_lung_E16_NE_2D_step08.3651.3651.2	1.3329	0.0891	1761.02	1	3330.0%	3	K.EPPLSLTIHLTSPVVR.E
	TK_050702_lung_E16_NE_2D_step07.2523.2523.1	1.3667	0.0319	666.63	2	7000.0%	1	K.LHVAVK.V
	TK_050702_lung_E16_NE_2D_step03.2202.2202.3	1.8318	0.115	2073.81	1	2500.0%	1	R.FVMEVEVDGQKFQGAGSNK.K
	TK_050702_lung_E16_NE_2D_step08.3670.3670.2	3.0952	0.5072	2675.54	1	4550.0%	5	K.HSSVYPTQEELEAVQNMVSHTER.A
	TK_050702_lung_E16_NE_2D_step06.2715.2715.2	1.2925	0.0377	1603.21	3	4000.0%	1	K.SIGTANRPMGAGEALR.R
	TK_050702_lung_E16_NE_2D_step02.3125.3125.1	1.2975	0.0867	925.9	37	5000.0%	1	R.VPTWGPLR.G
UQ91VR699.6%81615.6%499540295.3(Q91VR6) Similar to siah binding protein 1, FBP interacting repressor, pyrimidine tr
	TK_050702_lung_E16_NE_2D_step03.4020.4020.3	2.8922	0.5266	2797.88	1	2250.0%	3	K.AVTPPMPLLTPATPGGLPPAAAVAAAAATAK.I
	TK_050702_lung_E16_NE_2D_step07.2845.2845.2	2.3462	0.3261	2210.22	1	4440.0%	1	K.QTIAHQQQQLTNLQMAAQR.Q
	TK_050702_lung_E16_NE_2D_step01.3798.3798.2	4.3369	0.6528	2390.65	1	5710.0%	1	K.AQSSQDAVSSMNLFDLGGQYLR.V
	TK_050702_lung_E16_NE_2D_step07.2376.2376.1	0.9429	0.0957	773.43	2	4000.0%	1	R.HMVMQK.L
UQ9ERC299.6%101825.5%580613416.8(Q9ERC2) Polyadenylation protein CSTF64
	TK_050702_lung_E16_NE_2D_step02.3128.3128.2	2.6942	0.3735	2127.15	1	5290.0%	1	K.GYGFCEYQDQETALSAMR.N
*	TK_050702_lung_E16_NE_2D_step01.3026.3026.2	1.4342	0.2573	2819.34	1	2960.0%	1	K.SLGTGAPVIESPYGESISPEDAPESISK.A
*	TK_050702_lung_E16_NE_2D_step04.3148.3148.2	3.548	0.5759	2381.64	1	4130.0%	3	R.GPMPSGIQGPNPMNMGAVVPQGSR.Q
	TK_050702_lung_E16_NE_2D_step11.4174.4174.2	1.2141	0.1383	2552.32	1	2270.0%	1	K.AALIMQVLQLTADQIAMLPPEQR.Q
	TK_050702_lung_E16_NE_2D_step01.3189.3189.2	2.302	0.4222	1926.24	1	5310.0%	1	R.SVFVGNIPYEATEEQLK.D
*	TK_050702_lung_E16_NE_2D_step03.2866.2866.3	2.2922	0.442	3828.64	1	1690.0%	2	R.QVPVMQGAGMQGASMQGGSQPGGFSPGQSQVTPQDHEK.A
UQ9Z2D899.6%5516.1%285321685.8(Q9Z2D8) Methyl-CpG binding protein MBD3
*	TK_050702_lung_E16_NE_2D_step10.4276.4276.2	3.8268	0.5836	1749.12	1	7000.0%	1	K.KLSGLSAFDIAEELVR.T
	TK_050702_lung_E16_NE_2D_step03.1041.1041.2	0.5167	0.0017	1517.38	73	910.0%	1	K.AVDQPRQLFWEK.K
	TK_050702_lung_E16_NE_2D_step05.2818.2818.2	2.4316	0.3661	1283.0	1	6360.0%	1	K.GKPDLNTALPVR.Q
	TK_050702_lung_E16_NE_2D_step12.1424.1424.1	0.2414	0.0	682.79	2	1000.0%	1	K.AVDQPR.Q
*	TK_050702_lung_E16_NE_2D_step04.3121.3121.2	1.0346	0.2604	2306.24	8	1750.0%	1	K.LSGLSAFDIAEELVRTMDLPK.G
UHMGC_MOUSE99.6%4629.6%1081181910.6(P52927) High mobility group protein HMGI-C
*	TK_050702_lung_E16_NE_2D_step01.1957.1957.2	4.0429	0.6397	2064.8	1	5000.0%	1	R.GEGAGQPSTSAQGQPAAPVPQK.R
*	TK_050702_lung_E16_NE_2D_step10.4290.4290.2	1.8551	0.1355	2222.38	4	2500.0%	2	R.GEGAGQPSTSAQGQPAAPVPQKR.G
	TK_050702_lung_E16_NE_2D_step07.2675.2675.1	1.3392	0.1781	1140.78	6	3750.0%	1	R.KWPQQVVQK.K
UO0040599.6%334.3%940991069.1(O00405) FB19 protein
	TK_050702_lung_E16_NE_2D_step02.2767.2767.1	0.9112	0.1054	945.82	71	2500.0%	1	R.LLGPPPPPR.G
	TK_050702_lung_E16_NE_2D_step04.4104.4104.2	3.8129	0.4909	1558.22	1	7000.0%	1	K.LPPVLANLMGSMGAGK.G
	TK_050702_lung_E16_NE_2D_step06.2803.2803.2	1.8512	0.1507	1530.78	1	4640.0%	1	K.VLSPTAAKPSPFEGK.T
UQ9CQU099.6%4617.6%170190495.3(Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene)
	TK_050702_lung_E16_NE_2D_step01.2210.2210.1	0.4221	0.0117	1551.25	10	710.0%	1	K.EAAASGLPLMVIIHK.S
*	TK_050702_lung_E16_NE_2D_step04.2652.2652.2	2.7766	0.3683	1704.39	1	6070.0%	2	K.VRPEIINESGNPSYK.Y
URS17_MOUSE99.6%112749.3%134153939.8(P06584) 40S ribosomal protein S17
	TK_050702_lung_E16_NE_2D_step02.3556.3556.2	4.4277	0.6235	2493.36	1	5240.0%	4	R.DNYVPEVSALDQEIIEVDPDTK.E
	TK_050702_lung_E16_NE_2D_step01.3849.3849.2	3.9857	0.4217	2411.04	1	4520.0%	2	K.LLDFGSLSNLQVTQPTVGMNFK.T
	TK_050702_lung_E16_NE_2D_step07.3124.3124.1	1.3005	0.1456	1135.05	5	5000.0%	2	K.IAGYVTHLMK.R
	TK_050702_lung_E16_NE_2D_step05.3039.3039.1	1.3409	0.1691	1416.19	27	3180.0%	1	K.RVCEEIAIIPSK.K
UQ8WYU499.6%338.3%420457719.6(Q8WYU4) Hypothetical protein
*	TK_050702_lung_E16_NE_2D_step06.2701.2701.1	0.6501	0.0051	1159.01	2	1880.0%	1	R.QHNKDKPYK.C
*	TK_050702_lung_E16_NE_2D_step06.2887.2887.2	3.0035	0.545	1531.27	1	6670.0%	1	K.AFTQLSNLQSHQR.Q
*	TK_050702_lung_E16_NE_2D_step07.3325.3325.2	2.6975	0.6372	1480.06	1	7500.0%	1	K.SFANASYLAQHLR.I
URL5_MOUSE99.6%7914.2%296342699.8(P47962) 60S ribosomal protein L5
	TK_050702_lung_E16_NE_2D_step04.2520.2520.2	1.5495	0.2835	1187.4	3	5000.0%	1	K.RFPGYDSESK.E
	TK_050702_lung_E16_NE_2D_step02.3868.3868.2	1.0564	0.0050	1958.01	35	2110.0%	1	K.VFGALKGAVDGGLSIPHSTK.R
	TK_050702_lung_E16_NE_2D_step06.3069.3069.2	2.0952	0.2977	1437.04	1	5910.0%	2	K.HIMGQNVADYMR.Y
	TK_050702_lung_E16_NE_2D_step03.2708.2708.2	3.1152	0.5498	1340.11	1	6540.0%	1	K.GAVDGGLSIPHSTK.R
UQ9H9V199.6%63610.5%237261349.5(Q9H9V1) Hypothetical protein FLJ12529
*	TK_050702_lung_E16_NE_2D_step03.4197.4197.2	0.8849	0.0227	2438.41	1	2920.0%	6	K.AVSGASAGDYSDAIETLLTAIAVIK.Q
UH15_MOUSE99.6%3612826.1%2222244510.9(P43276) Histone H1.5 (H1 VAR.5) (H1B)
	TK_050702_lung_E16_NE_2D_step01.2705.2705.2	2.7929	0.5232	1216.37	1	7270.0%	2	K.ATGPPVSELITK.A
	TK_050702_lung_E16_NE_2D_step08.0672.0672.1	1.3894	0.1944	771.25	4	5000.0%	6	K.KPAGATPK.K
	TK_050702_lung_E16_NE_2D_step08.0454.0454.1	0.6813	0.0012	627.47	5	3000.0%	1	K.SPAKPK.A
*	TK_050702_lung_E16_NE_2D_step06.3012.3012.2	2.3932	0.3522	1128.77	1	6500.0%	2	K.ERGGVSLPALK.K
	TK_050702_lung_E16_NE_2D_step01.2245.2245.1	2.2718	0.2855	1096.92	2	5500.0%	5	K.ALAAGGYDVEK.N
	TK_050702_lung_E16_NE_2D_step08.0607.0607.1	1.5362	0.2106	743.62	4	5710.0%	5	K.KPAAAGVK.K
*	TK_050702_lung_E16_NE_2D_step02.0014.0014.1	0.8796	0.1082	841.98	3	3750.0%	3	R.GGVSLPALK.K
*	TK_050702_lung_E16_NE_2D_step06.2904.2904.2	1.7521	0.2683	970.96	4	6670.0%	1	R.GGVSLPALKK.A
	TK_050702_lung_E16_NE_2D_step06.3008.3008.1	1.7711	0.259	1342.98	4	4170.0%	2	R.KATGPPVSELITK.A
	TK_050702_lung_E16_NE_2D_step03.2486.2486.1	1.9029	0.1412	1223.82	1	5000.0%	3	K.KALAAGGYDVEK.N
UH2AZ_HUMAN99.6%1610855.1%1271342210.6(P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z)
	TK_050702_lung_E16_NE_2D_step12.0840.0840.1	0.3526	0.3274	662.5	2	2000.0%	1	K.GQQKTV.-
	TK_050702_lung_E16_NE_2D_step11.4367.4367.2	1.7653	0.1859	1952.05	1	4060.0%	1	R.HLQLAIRGDEELDSLIK.A
	TK_050702_lung_E16_NE_2D_step12.2867.2867.2	1.2321	0.3152	1372.65	1	3460.0%	10	K.ATIAGGGVIPHIHK.S
	TK_050702_lung_E16_NE_2D_step05.4462.4462.1	0.2352	0.0	486.23	5	1670.0%	1	R.ITPR.H
	TK_050702_lung_E16_NE_2D_step02.4173.4173.2	2.9433	0.5274	2897.94	1	2680.0%	1	R.VGATAAVYSAAILEYLTAEVLELAGNASK.D
UQ9D4J799.6%356.9%364411398.7(Q9D4J7) 4931428F02Rik protein
	TK_050702_lung_E16_NE_2D_step05.2898.2898.2	3.6252	0.5282	2080.25	1	6180.0%	2	K.LMCSLCHCPGATIGCDVK.T
	TK_050702_lung_E16_NE_2D_step08.2975.2975.1	2.0291	0.3402	842.89	3	7500.0%	1	K.LHIFNAK.K
UQ9DBR199.6%6810.2%9511086877.6(Q9DBR1) 5'-3' exoribonuclease 2
*	TK_050702_lung_E16_NE_2D_step02.3607.3607.3	1.4339	0.0839	3487.62	27	1340.0%	1	R.EEFKPNKPKPCALCNQFGHEVKDCEGLPR.E
	TK_050702_lung_E16_NE_2D_step08.3127.3127.2	1.1884	0.0219	1807.11	3	3210.0%	1	R.KYPSIIVNCVEEKPK.E
	TK_050702_lung_E16_NE_2D_step11.2543.2543.2	0.8813	0.0038	1469.96	1	3750.0%	1	R.KPATVLKPGDWEK.S
	TK_050702_lung_E16_NE_2D_step04.3371.3371.2	3.368	0.6126	1966.96	1	5560.0%	2	R.DQPAFTPSGILTPHALGSR.N
	TK_050702_lung_E16_NE_2D_step13.3698.3698.3	0.7824	0.0474	2406.54	14	620.0%	1	K.GKHDELADSLPCAEGEFIFLR.L
UNFIB_MOUSE99.6%133517.5%570635078.7(P97863) Nuclear factor 1 B-type (Nuclear factor 1/B) (NF1-B) (NFI-B) (NF-I/B) (CCAAT-box binding transcription factor) (CTF) (TGGCA-binding protein)
	TK_050702_lung_E16_NE_2D_step07.2860.2860.2	1.5288	0.0665	1422.95	1	5910.0%	1	R.YPPHLNPQDTLK.N
	TK_050702_lung_E16_NE_2D_step04.3160.3160.2	1.608	0.05	1600.89	3	4620.0%	2	R.AVKDELLSEKPEIK.Q
*	TK_050702_lung_E16_NE_2D_step10.3016.3016.2	2.2274	0.4082	1989.05	1	3820.0%	2	K.KPEKPLFSSTSPQDSSPR.L
	TK_050702_lung_E16_NE_2D_step13.5209.5209.3	2.1796	0.271	2479.01	1	2610.0%	4	R.LSTFPQHHHPGIPGVAHSVISTR.T
	TK_050702_lung_E16_NE_2D_step03.3597.3597.3	2.6705	0.4553	3634.02	1	2270.0%	1	R.TPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR.S
UQ6146499.6%664.3%19262144596.8(Q61464) Nuclear protein, NP220
*	TK_050702_lung_E16_NE_2D_step07.3261.3261.2	1.5692	0.3015	1683.4	1	3670.0%	1	K.MSGLHISGQSVLEPVK.S
*	TK_050702_lung_E16_NE_2D_step04.4631.4631.1	0.2318	0.0	654.79	10	1000.0%	1	R.AVDPKK.S
*	TK_050702_lung_E16_NE_2D_step06.2413.2413.1	0.6665	0.1245	878.66	30	2500.0%	1	K.IEHHTDK.K
*	TK_050702_lung_E16_NE_2D_step09.3401.3401.3	1.3367	0.0166	3810.05	1	1590.0%	1	K.ESEEMSVVFISNLPNKGYSTEEIYNLAKPFGALK.D
*	TK_050702_lung_E16_NE_2D_step05.0385.0385.1	0.3536	0.0	684.91	15	1000.0%	1	R.RAVDPK.K
*	TK_050702_lung_E16_NE_2D_step04.0090.0090.2	3.3954	0.5461	1996.65	1	5830.0%	1	K.SKLDSFSQVGPGSETVTQK.D
URL21_MOUSE99.6%5259.4%1591843110.5(O09167) 60S ribosomal protein L21
*	TK_050702_lung_E16_NE_2D_step05.3146.3146.2	4.6803	0.5023	1657.47	1	7140.0%	5	R.VYNVTQHAVGIIVNK.Q
UH2B1_MOUSE99.6%3928341.6%1251380510.3(P10853) Histone H2B F (H2B 291A)
	TK_050702_lung_E16_NE_2D_step07.2477.2477.1	0.9362	0.0177	822.68	113	4170.0%	5	K.RSTITSR.E
	TK_050702_lung_E16_NE_2D_step07.2031.2031.1	1.7975	0.0861	747.56	3	7000.0%	9	R.LAHYNK.R
	TK_050702_lung_E16_NE_2D_step12.1495.1495.1	1.0306	0.0316	901.53	16	5830.0%	1	R.LAHYNKR.S
	TK_050702_lung_E16_NE_2D_step01.2014.2014.1	1.3616	0.1096	817.96	1	7500.0%	1	R.EIQTAVR.L
	TK_050702_lung_E16_NE_2D_step01.3789.3789.2	3.0961	0.4035	1747.99	1	6070.0%	11	K.AMGIMNSFVNDIFER.I
	TK_050702_lung_E16_NE_2D_step01.0175.0175.1	1.0307	0.0495	735.64	5	5000.0%	1	R.IASEASR.L
	TK_050702_lung_E16_NE_2D_step01.2511.2511.2	1.4145	0.3702	1139.07	1	5620.0%	1	K.ESYSVYVYK.V
	TK_050702_lung_E16_NE_2D_step04.2719.2719.1	2.6765	0.3858	1267.87	1	6110.0%	6	R.KESYSVYVYK.V
UTYY1_MOUSE99.6%5710.9%414447176.3(Q00899) Transcriptional repressor protein YY1 (Yin and yang 1) (YY-1) (Delta transcription factor) (NF-E1) (UCR-motif DNA-binding protein)
	TK_050702_lung_E16_NE_2D_step07.2332.2332.1	1.0231	0.0062	615.64	3	6250.0%	2	K.QVQIK.T
	TK_050702_lung_E16_NE_2D_step08.3248.3248.2	1.3226	0.0852	1606.76	8	3330.0%	1	K.KLPPGGIPGIDLSDPK.Q
	TK_050702_lung_E16_NE_2D_step06.2025.2025.1	0.8733	0.1074	827.43	8	4170.0%	1	R.TIACPHK.G
	TK_050702_lung_E16_NE_2D_step08.2956.2956.2	2.5678	0.5958	2037.04	1	4380.0%	1	R.IHTGDRPYVCPFDGCNK.K
UTP2A_MOUSE99.6%204812.0%15281728768.7(Q01320) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3)
	TK_050702_lung_E16_NE_2D_step08.2007.2007.1	0.3528	0.0	687.31	16	2500.0%	1	R.QKEQR.S
*	TK_050702_lung_E16_NE_2D_step10.2958.2958.3	0.8573	0.0056	2416.79	7	1310.0%	1	K.NPWSDSESDVSSNESNVDVPPR.Q
*	TK_050702_lung_E16_NE_2D_step13.4658.4658.2	3.6618	0.4175	2648.33	1	4090.0%	5	K.SPSDLWKEDLAVFIEELEVVEAK.E
*	TK_050702_lung_E16_NE_2D_step07.3911.3911.2	2.8189	0.4989	2160.21	1	5310.0%	3	K.NKQEIAFYSLPEFEEWK.S
*	TK_050702_lung_E16_NE_2D_step08.3283.3283.1	0.9402	0.0627	1126.9	266	2500.0%	1	R.VSEKPAPAKAK.N
	TK_050702_lung_E16_NE_2D_step05.3071.3071.2	1.6667	0.1866	1486.1	2	4620.0%	1	R.SIPSMVDGLKPGQR.K
*	TK_050702_lung_E16_NE_2D_step12.2395.2395.2	2.7492	0.383	1287.9	1	6000.0%	1	K.KQTTLPFKPVK.K
*	TK_050702_lung_E16_NE_2D_step04.2336.2336.1	1.7828	0.3547	940.86	1	5710.0%	1	K.IVIENKPK.K
*	TK_050702_lung_E16_NE_2D_step06.4099.4099.3	2.1985	0.0462	3592.81	1	1720.0%	2	K.GTIEELASNQYVINGEVAILDSTTIEISELPIR.T
	TK_050702_lung_E16_NE_2D_step08.3258.3258.1	1.526	0.2875	1042.68	1	5000.0%	1	R.KVLFTCFK.R
*	TK_050702_lung_E16_NE_2D_step06.2825.2825.2	2.8431	0.3588	1474.78	1	6250.0%	1	K.KAQMCADVLPSPR.G
	TK_050702_lung_E16_NE_2D_step04.2472.2472.1	1.1483	0.1879	878.7	1	5000.0%	1	K.GIPVVEHK.V
	TK_050702_lung_E16_NE_2D_step05.3582.3582.2	2.3417	0.2695	1469.54	1	7500.0%	1	R.KEWLTNFMEDR.R
UQ9UEG499.6%558.5%9271027568.1(Q9UEG4) Hypothetical protein KIAA0326 (Fragment)
*	TK_050702_lung_E16_NE_2D_step09.2639.2639.3	0.9925	0.0658	2868.43	2	1350.0%	1	R.THTGEKPYECLECGKSFGHSSTLIK.H
*	TK_050702_lung_E16_NE_2D_step04.2813.2813.2	3.4545	0.5143	1562.25	1	6250.0%	1	K.SFIQSSELTQHQR.T
*	TK_050702_lung_E16_NE_2D_step13.4498.4498.2	0.6542	0.1284	2260.97	25	1110.0%	1	K.CPECKQSFGLSSELLLHQK.V
*	TK_050702_lung_E16_NE_2D_step07.3020.3020.2	1.2362	0.125	1490.66	6	3330.0%	1	K.SFSVSSNLINHQR.I
*	TK_050702_lung_E16_NE_2D_step05.2631.2631.1	1.3364	0.1166	1069.92	14	4380.0%	1	K.DSTEMSLER.S
UQ6218999.6%8349.8%287318359.8(Q62189) Small nuclear RNA (Small nuclear ribonucleoprotein polypeptide A)
*	TK_050702_lung_E16_NE_2D_step05.3219.3219.3	4.5994	0.5397	2653.67	1	3430.0%	3	K.AVQGGAAAPVVGAVQPVPGMPPMPQAPR.I
UENPL_MOUSE99.6%91315.6%802924764.8(P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96)
	TK_050702_lung_E16_NE_2D_step04.3101.3101.2	2.4995	0.4047	1516.03	1	6150.0%	2	K.NLLHVTDTGVGMTR.E
*	TK_050702_lung_E16_NE_2D_step07.3228.3228.2	3.5144	0.5912	2253.54	1	4720.0%	2	R.FQSSHHSTDITSLDQYVER.M
	TK_050702_lung_E16_NE_2D_step03.3022.3022.3	1.1566	0.0434	3342.38	12	1160.0%	1	K.VIVTSKHNNDTQHIWESDSNEFSVIADPR.G
	TK_050702_lung_E16_NE_2D_step02.3025.3025.1	0.2434	0.0	1549.19	6	450.0%	1	K.EFEPLLNWMKDK.A
	TK_050702_lung_E16_NE_2D_step08.2480.2480.1	0.3574	0.0	646.89	9	2500.0%	1	K.EKQDK.I
	TK_050702_lung_E16_NE_2D_step05.4118.4118.3	1.195	0.0399	3328.53	1	1670.0%	1	K.MTEAQEDGQSTSELIGQFGVGFYSAFLVADK.V
	TK_050702_lung_E16_NE_2D_step10.3096.3096.3	1.0128	0.0747	1882.96	92	1070.0%	1	K.YSQFINFPIYVWSSK.T
UQ8R08199.6%143222.5%555601237.1(Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L
	TK_050702_lung_E16_NE_2D_step09.2803.2803.1	1.3091	0.275	1078.88	2	3890.0%	3	K.TPASPVVHIR.G
	TK_050702_lung_E16_NE_2D_step02.3919.3919.3	2.4428	0.5952	4393.11	1	1790.0%	3	R.QALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQK.I
	TK_050702_lung_E16_NE_2D_step04.2163.2163.2	1.4572	0.2846	979.02	2	6430.0%	1	K.IEYAKPTR.L
	TK_050702_lung_E16_NE_2D_step02.4156.4156.3	1.8552	0.2588	3090.81	1	1790.0%	2	R.GLIDGVVEADLVEALQEFGPISYVVVMPK.K
	TK_050702_lung_E16_NE_2D_step13.4766.4766.3	1.3412	0.241	4179.38	5	1150.0%	1	R.QPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGR.R
US3B2_HUMAN99.6%163012.5%872976575.7(Q13435) Splicing factor 3B subunit 2 (Spliceosome associated protein 145) (SAP 145) (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa subunit)
*	TK_050702_lung_E16_NE_2D_step04.3417.3417.2	2.6818	0.5518	2406.85	1	3180.0%	3	R.TATVGGAMMGSTHIYDMSTVMSR.K
*	TK_050702_lung_E16_NE_2D_step08.3048.3048.2	2.2494	0.3225	1323.0	1	6250.0%	2	R.ISLGMPVGPNAHK.V
*	TK_050702_lung_E16_NE_2D_step07.4007.4007.3	1.7669	0.2782	3093.01	2	1790.0%	1	R.KGPAPELQGVEVALAPEELELDPMAMTQK.Y
*	TK_050702_lung_E16_NE_2D_step08.2986.2986.1	1.0212	0.0927	722.93	107	4000.0%	1	K.LLVHLK.A
*	TK_050702_lung_E16_NE_2D_step01.3986.3986.2	2.6314	0.2869	2965.17	1	2780.0%	1	K.GPAPELQGVEVALAPEELELDPMAMTQK.Y
*	TK_050702_lung_E16_NE_2D_step07.3211.3211.1	1.0298	0.1901	910.81	11	6670.0%	1	K.RIFEAFK.L
*	TK_050702_lung_E16_NE_2D_step05.2958.2958.2	3.3552	0.5118	2252.27	1	4210.0%	3	K.QLVARPDVVEMHDVTAQDPK.L
*	TK_050702_lung_E16_NE_2D_step05.3754.3754.2	0.8711	0.2206	1308.53	3	3000.0%	1	K.VPPPWLIAMQR.Y
UO0045599.6%449.6%385407707.7(O00455) TTF-I interacting peptide 20 (Fragment)
*	TK_050702_lung_E16_NE_2D_step11.2205.2205.2	1.1169	0.2103	1427.76	7	3180.0%	1	K.TFSQSSHLVQHR.R
*	TK_050702_lung_E16_NE_2D_step08.3254.3254.2	1.4958	0.2177	1521.89	1	4550.0%	1	R.FSWSSNLMQHQR.I
*	TK_050702_lung_E16_NE_2D_step07.2695.2695.2	1.1807	0.415	1277.06	5	2920.0%	1	R.LHPELSGPGVAAK.V
URS7_HUMAN99.6%82033.5%1942212710.1(P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8)
	TK_050702_lung_E16_NE_2D_step08.2896.2896.1	1.3312	0.05	969.81	3	5710.0%	1	K.HVVFIAQR.R
	TK_050702_lung_E16_NE_2D_step11.4091.4091.2	1.1888	0.2892	2369.47	2	2380.0%	3	R.TLTAVHDAILEDLVFPSEIVGK.R
	TK_050702_lung_E16_NE_2D_step11.3927.3927.3	2.6346	0.4425	3335.49	1	2240.0%	3	K.IVKPNGEKPDEFESGISQALLELEMNSDLK.A
	TK_050702_lung_E16_NE_2D_step12.1248.1248.1	0.2316	0.0	683.74	8	1250.0%	1	K.QKRPR.S
US3A2_MOUSE99.6%1711916.6%475499119.5(Q62203) Splicing factor 3A subunit 2 (Spliceosome associated protein 62) (SAP 62) (SF3a66)
	TK_050702_lung_E16_NE_2D_step13.2761.2761.2	0.8847	0.141	1770.51	7	2060.0%	1	K.MEKPPAPPSLPAGPPGVK.R
	TK_050702_lung_E16_NE_2D_step01.4099.4099.2	4.7028	0.6369	2076.02	1	7810.0%	1	R.WQYLLMAAEPYETIAFK.V
	TK_050702_lung_E16_NE_2D_step10.3332.3332.2	4.8711	0.6164	2159.89	1	5280.0%	10	K.LCLTLHNNEGSYLAHTQGK.K
*	TK_050702_lung_E16_NE_2D_step01.4105.4105.2	4.1774	0.527	2883.18	1	3960.0%	4	R.DTEMGQQSLLFQIDYPEIAEGIMPR.H
UQ9D6C699.6%122621.1%683774319.5(Q9D6C6) 3632413F13Rik protein
	TK_050702_lung_E16_NE_2D_step04.3524.3524.3	2.0781	0.0517	3330.63	1	2170.0%	1	K.TPSSSQPERLPIGNTIQPSQAATFMNDAIEK.A
	TK_050702_lung_E16_NE_2D_step01.1091.1091.1	0.2061	0.0	967.15	3	620.0%	1	K.AHEEANAAR.K
	TK_050702_lung_E16_NE_2D_step03.1221.1221.1	0.5062	0.0058	545.88	5	2500.0%	1	R.AQMAK.R
	TK_050702_lung_E16_NE_2D_step03.3097.3097.2	1.1355	0.0099	1411.28	6	3750.0%	2	K.QLSFISPPAPQPK.T
	TK_050702_lung_E16_NE_2D_step01.4906.4906.2	1.3973	0.1108	2178.52	1	3330.0%	1	K.VELKDQTKPTPLILDEQGR.T
	TK_050702_lung_E16_NE_2D_step10.3873.3873.2	1.9104	0.4596	2120.57	1	3950.0%	4	K.RVLGFSEPTVVTAALNCVGK.G
	TK_050702_lung_E16_NE_2D_step06.3363.3363.2	1.7418	0.2805	1700.04	1	4640.0%	1	K.AADHLKPFLDDSTLR.F
	TK_050702_lung_E16_NE_2D_step01.3573.3573.3	1.494	0.0554	3222.93	32	1450.0%	1	R.IQAQLALKPGLIGNANMVGLANLHAMGIAPPK.V
UFKB3_MOUSE99.6%124223.7%224251489.3(Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase)
	TK_050702_lung_E16_NE_2D_step01.3325.3325.1	1.9095	0.3785	1251.12	1	5500.0%	1	R.GWDEALLTMSK.G
*	TK_050702_lung_E16_NE_2D_step08.3266.3266.2	2.2028	0.3449	1688.61	1	6150.0%	4	K.DHLVNAYNHLFESK.R
	TK_050702_lung_E16_NE_2D_step04.3291.3291.2	3.5977	0.4838	1562.98	1	6670.0%	3	K.ARLEIEPEWAYGK.K
*	TK_050702_lung_E16_NE_2D_step04.3116.3116.2	3.7381	0.5318	1732.72	1	6790.0%	4	K.FLQDHGSDSFLAEHK.L
UQ9DAI099.6%71327.1%225261865.6(Q9DAI0) 6430539P16Rik protein
	TK_050702_lung_E16_NE_2D_step06.2101.2101.1	1.2599	0.1216	664.76	1	7500.0%	1	R.YRPTK.N
	TK_050702_lung_E16_NE_2D_step01.3934.3934.2	1.9784	0.4951	2373.0	1	4210.0%	1	K.NYLSYLTAPDYSAFETDIMR.N
	TK_050702_lung_E16_NE_2D_step08.3403.3403.2	3.6511	0.5695	1827.01	1	7140.0%	3	K.VYNENLVHMIEHAQK.E
	TK_050702_lung_E16_NE_2D_step05.2555.2555.2	2.7553	0.5028	1334.31	1	6820.0%	1	K.RYELPAPSSGQK.N
	TK_050702_lung_E16_NE_2D_step05.2860.2860.2	1.8367	0.0536	1211.16	1	6880.0%	1	K.HIQDLNWQR.K
UQ8R1K599.6%59106125.2%222216349.4(Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens)
	TK_050702_lung_E16_NE_2D_step12.1971.1971.2	0.6619	0.0159	2068.58	1	1820.0%	1	R.SSGSPYGGGYGSGGGSGGYGSRR.F
	TK_050702_lung_E16_NE_2D_step10.3620.3620.2	1.582	0.3034	1873.95	1	4670.0%	6	K.RGFAFVTFDDHDTVDK.I
	TK_050702_lung_E16_NE_2D_step01.0331.0331.2	3.4061	0.6728	1914.75	1	5000.0%	29	R.SSGSPYGGGYGSGGGSGGYGSR.R
	TK_050702_lung_E16_NE_2D_step02.3415.3415.2	3.8479	0.5654	1716.07	1	6790.0%	5	R.GFAFVTFDDHDTVDK.I
	TK_050702_lung_E16_NE_2D_step08.3667.3667.2	1.3391	0.0938	2282.19	3	2890.0%	1	R.GFAFVTFDDHDTVDKIVVQK.Y
	TK_050702_lung_E16_NE_2D_step04.2447.2447.2	1.2476	0.0291	1475.48	2	4550.0%	11	K.YHTINGHNCEVK.K
UQ9Z31599.6%156511.8%806908855.8(Q9Z315) MSART-1(806)
	TK_050702_lung_E16_NE_2D_step01.3461.3461.2	1.5276	0.1359	1702.75	1	4290.0%	1	R.DLQGLTVEHAIDSFR.E
	TK_050702_lung_E16_NE_2D_step06.4652.4652.1	0.2442	0.0034	429.94	2	1670.0%	7	K.APNK.S
	TK_050702_lung_E16_NE_2D_step01.3851.3851.2	2.7104	0.5142	2104.02	1	5290.0%	1	K.TLGEDDPWLDDTAAWIER.S
	TK_050702_lung_E16_NE_2D_step05.3442.3442.2	2.4288	0.5347	1906.95	1	4710.0%	3	K.KMSSSDTPLGTVALLQEK.Q
*	TK_050702_lung_E16_NE_2D_step05.4074.4074.2	1.5163	0.3092	2659.61	1	2860.0%	2	K.LLEEMDQEFGVSTLVEEEFEQR.R
*	TK_050702_lung_E16_NE_2D_step02.3552.3552.2	2.2745	0.4993	1945.91	1	3820.0%	1	K.GVLQDGEDVLVNVNMVDK.E
UQ6176999.6%355913.6%29383244289.7(Q61769) Ki-67 protein
	TK_050702_lung_E16_NE_2D_step01.2593.2593.2	1.3342	0.0086	2318.12	9	2140.0%	1	R.APGTPAPVQEENDSTAFMETPK.Q
*	TK_050702_lung_E16_NE_2D_step11.4113.4113.3	2.4703	0.3377	2904.18	1	2600.0%	1	K.KAQPLEDLTCFQELFISPVPTNIIK.K
*	TK_050702_lung_E16_NE_2D_step04.2176.2176.1	0.7815	0.1137	610.53	5	5000.0%	1	R.KVHVK.N
*	TK_050702_lung_E16_NE_2D_step08.3631.3631.3	1.5527	0.1687	4515.27	1	1310.0%	1	R.AQPLEDLDGFQELFQTPAGASDPVSVEESAKISLASSQAEPVR.T
*	TK_050702_lung_E16_NE_2D_step01.3395.3395.2	2.5693	0.5417	2384.38	1	4050.0%	1	R.QLQVTNSGDIPEPITTEILGEK.V
*	TK_050702_lung_E16_NE_2D_step06.3543.3543.2	1.4371	0.1252	2296.04	4	2370.0%	1	R.VHTTQEQEDNAIKAIMEIPK.E
*	TK_050702_lung_E16_NE_2D_step09.3264.3264.2	1.2032	0.3187	1903.41	1	2940.0%	3	K.IALQSPQPGHIINPASMK.R
*	TK_050702_lung_E16_NE_2D_step07.2719.2719.2	1.9683	0.2442	1111.54	1	6500.0%	1	K.SLGTHSPAVLK.T
*	TK_050702_lung_E16_NE_2D_step07.4215.4215.3	1.0957	0.0039	3403.38	29	1420.0%	1	R.RPSTPKKPTSNLHNQFTTGHANSPCTIVVGR.A
*	TK_050702_lung_E16_NE_2D_step04.2705.2705.2	2.1276	0.3761	1410.19	1	5910.0%	1	R.LVVTEEPIPQRK.T
*	TK_050702_lung_E16_NE_2D_step02.2791.2791.1	1.3516	0.0772	1188.93	21	3500.0%	1	K.LDFIGNSTGHK.R
*	TK_050702_lung_E16_NE_2D_step04.2632.2632.2	1.8099	0.3234	1368.76	1	5830.0%	1	K.QKIDPVASVPVSK.R
*	TK_050702_lung_E16_NE_2D_step03.3541.3541.2	2.259	0.4013	2022.64	1	4120.0%	2	K.IVSNKLESVEEQVSTVMK.T
*	TK_050702_lung_E16_NE_2D_step06.3215.3215.2	2.1382	0.4259	2432.16	1	3570.0%	1	K.RSQSPEDLSGVQEVFQTSGHNK.D
*	TK_050702_lung_E16_NE_2D_step08.3366.3366.2	2.2599	0.3638	1403.75	1	7270.0%	1	R.SQHGILQMICSK.R
*	TK_050702_lung_E16_NE_2D_step02.4707.4707.3	1.1198	0.1259	3294.12	11	1330.0%	1	R.SQPLEDLDGFQELFQTPAGASNPVSVEESAK.I
*	TK_050702_lung_E16_NE_2D_step04.2656.2656.1	1.6839	0.1268	999.76	4	5000.0%	3	K.LAHDTSILK.S
*	TK_050702_lung_E16_NE_2D_step01.2431.2431.2	1.9935	0.427	1872.55	1	3820.0%	1	K.LPSSSPPLEPTDTSVTSR.R
*	TK_050702_lung_E16_NE_2D_step05.3296.3296.2	2.3596	0.4618	1502.19	1	5830.0%	1	K.QKLESIENLTGLR.K
*	TK_050702_lung_E16_NE_2D_step02.2252.2252.3	1.4656	0.1963	2322.43	1	2260.0%	2	K.SPQVTTENITTNTKPQTSTSGK.K
*	TK_050702_lung_E16_NE_2D_step04.1944.1944.1	0.9164	0.0976	728.53	3	4000.0%	1	R.KQKPTK.D
*	TK_050702_lung_E16_NE_2D_step07.2997.2997.2	1.9087	0.4442	1783.37	1	4330.0%	3	K.TSKPAAEILIKPQEEK.G
URS24_HUMAN99.6%4428.6%1331542310.8(P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19)
	TK_050702_lung_E16_NE_2D_step02.4044.4044.2	2.3196	0.4129	1400.55	1	6360.0%	1	K.TTPDVIFVFGFR.T
	TK_050702_lung_E16_NE_2D_step01.3578.3578.2	3.1529	0.5511	1683.67	1	5360.0%	1	K.TTGFGMIYDSLDYAK.K
	TK_050702_lung_E16_NE_2D_step04.3244.3244.2	2.403	0.4122	1238.41	1	7500.0%	1	K.QMVIDVLHPGK.A
USMD3_HUMAN99.6%3374740.5%1261391610.3(P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3)
	TK_050702_lung_E16_NE_2D_step08.2826.2826.2	5.9308	0.6283	2418.36	1	6500.0%	27	K.VLHEAEGHIVTCETNTGEVYR.G
	TK_050702_lung_E16_NE_2D_step03.3088.3088.2	3.4351	0.5942	2406.4	1	5260.0%	4	K.LIEAEDNMNCQMSNITVTYR.D
	TK_050702_lung_E16_NE_2D_step01.2742.2742.1	1.5587	0.2078	1219.32	1	6110.0%	1	R.VAQLEQVYIR.G
UO5478999.6%60126248.2%199223987.4(O54789) Protein L (Fragment)
	TK_050702_lung_E16_NE_2D_step02.3808.3808.2	2.8373	0.4157	1589.63	1	6670.0%	1	R.VFNVFCLYGNVEK.V
	TK_050702_lung_E16_NE_2D_step05.3354.3354.2	3.249	0.417	1637.85	1	5770.0%	11	R.AITHLNNNFMFGQK.M
	TK_050702_lung_E16_NE_2D_step05.3354.3354.3	2.0063	0.2591	2456.27	1	2750.0%	4	R.AITHLNNNFMFGQKMNVCVSK.Q
	TK_050702_lung_E16_NE_2D_step06.4187.4187.3	5.2118	0.507	3777.42	1	2500.0%	33	R.IQHPSNVLHFFNAPLEVTEENFFEICDELGVK.R
	TK_050702_lung_E16_NE_2D_step01.2089.2089.1	1.6997	0.4164	837.82	2	8330.0%	2	K.MNVCVSK.Q
	TK_050702_lung_E16_NE_2D_step04.3053.3053.3	3.0614	0.487	1869.7	1	3820.0%	1	K.SKPGAAMVEMADGYAVDR.A
	TK_050702_lung_E16_NE_2D_step11.4835.4835.2	1.2006	0.0747	2274.64	29	2250.0%	2	K.FMKSKPGAAMVEMADGYAVDR.A
	TK_050702_lung_E16_NE_2D_step01.2070.2070.1	1.0952	0.0867	979.1	2	5000.0%	1	R.FSTPEQAAK.N
UO8828699.6%9116.7%15611712437.5(O88286) WizL
	TK_050702_lung_E16_NE_2D_step04.2896.2896.2	3.1721	0.531	1295.81	1	6820.0%	1	R.SPSDLHISPLTK.K
	TK_050702_lung_E16_NE_2D_step01.4157.4157.2	4.0727	0.5316	2320.8	1	5000.0%	1	R.QLGVAESESSGAPIDLLYELVK.Q
*	TK_050702_lung_E16_NE_2D_step07.2604.2604.1	1.0083	0.1036	856.67	210	4170.0%	1	K.YSPSHHK.F
	TK_050702_lung_E16_NE_2D_step07.2919.2919.1	1.4952	0.261	1236.83	1	4550.0%	1	K.GLTHPSSSPLLK.K
	TK_050702_lung_E16_NE_2D_step03.3420.3420.2	3.213	0.5598	2375.49	1	4350.0%	2	R.ELSLSPITGSKPSAASYLGPVATK.R
*	TK_050702_lung_E16_NE_2D_step04.2088.2088.1	0.2434	0.0	1239.57	10	500.0%	1	R.RVIVPVDNTPK.T
	TK_050702_lung_E16_NE_2D_step13.3782.3782.2	1.4031	0.3397	1560.62	1	3330.0%	1	K.RPPLGLAPGGLSLVGR.S
USNF5_MOUSE99.6%115.7%385441416.2(Q9Z0H3) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 1 (Integrase interactor 1 protein) (mSNF5)
	TK_050702_lung_E16_NE_2D_step01.4034.4034.2	3.3519	0.5587	2539.3	1	4520.0%	1	R.NTGDADQWCPLLETLTDAEMEK.K
UQ9NPI499.6%1111.7%145160846.4(Q9NPI4) hnRNP 2H9D
	TK_050702_lung_E16_NE_2D_step01.3910.3910.2	4.0984	0.5934	1921.95	1	5940.0%	1	R.ATENDIANFFSPLNPIR.V
UQ9Y3J299.6%61213.6%4284695710.1(Q9Y3J2) DJ222E13.3 (Novel protein) (Fragment)
	TK_050702_lung_E16_NE_2D_step02.3993.3993.2	1.0922	0.1088	1983.03	1	3120.0%	1	R.VTEEDIVELFCVCGALK.R
	TK_050702_lung_E16_NE_2D_step06.3440.3440.2	2.4626	0.4436	2196.69	1	3890.0%	3	K.CNLHMNGNVITSDQPILLR.L
	TK_050702_lung_E16_NE_2D_step07.2561.2561.2	1.4357	0.0094	1083.4	1	6250.0%	1	K.MTVNNLHPR.V
	TK_050702_lung_E16_NE_2D_step08.3402.3402.2	2.3644	0.5657	1395.28	1	5420.0%	1	R.LVHPGVAEVVFVK.K
UQ9EPU399.6%226.0%630658877.3(Q9EPU3) Variant polyadenylation protein CSTF-64
*	TK_050702_lung_E16_NE_2D_step08.2947.2947.2	2.9704	0.5546	2205.95	1	3910.0%	1	R.GPMTGGIQGPGPINMGAGGPQGPR.Q
*	TK_050702_lung_E16_NE_2D_step07.2769.2769.2	0.9931	0.0821	1611.22	12	2690.0%	1	R.GQMQISDPRPPMPR.G
UH10_MOUSE99.6%121822.3%1932073010.9(P10922) Histone H1' (H1.0) (H1(0))
*	TK_050702_lung_E16_NE_2D_step08.0507.0507.1	0.7765	0.0564	641.7	2	5000.0%	2	K.KAAKPK.K
*	TK_050702_lung_E16_NE_2D_step08.0475.0475.1	0.4834	0.0051	570.75	3	2500.0%	1	K.VKPVK.A
	TK_050702_lung_E16_NE_2D_step01.3254.3254.1	1.8064	0.1382	1442.0	5	4170.0%	2	K.YSDMIVAAIQAEK.N
	TK_050702_lung_E16_NE_2D_step01.2525.2525.1	1.4268	0.192	830.97	1	7860.0%	1	R.LVTTGVLK.Q
	TK_050702_lung_E16_NE_2D_step01.2175.2175.1	1.5238	0.1018	551.71	3	7500.0%	1	R.SVAFK.K
	TK_050702_lung_E16_NE_2D_step08.2883.2883.2	2.4498	0.2472	989.26	2	8750.0%	1	K.RLVTTGVLK.Q
	TK_050702_lung_E16_NE_2D_step06.0705.0705.1	0.4579	0.0089	530.81	8	2500.0%	1	K.ASKPK.K
UK2C1_HUMAN99.6%51110.4%643658868.1(P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein)
*	TK_050702_lung_E16_NE_2D_step04.2737.2737.2	3.9277	0.5717	1846.06	1	7000.0%	1	K.KQISNLQQSISDAEQR.G
*	TK_050702_lung_E16_NE_2D_step03.2376.2376.2	2.5814	0.4979	1342.27	1	6820.0%	1	K.SKAEAESLYQSK.Y
*	TK_050702_lung_E16_NE_2D_step03.2298.2298.3	3.3223	0.5559	3314.74	1	2110.0%	3	R.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G
UQ9D0T199.6%71140.6%128142028.5(Q9D0T1) Sperm specific antigen 1
	TK_050702_lung_E16_NE_2D_step02.4149.4149.2	3.4858	0.5285	3138.63	1	3330.0%	1	R.GISEFIVMAADAEPLEIILHLPLLCEDK.N
	TK_050702_lung_E16_NE_2D_step02.2763.2763.1	2.0472	0.4083	1201.79	1	5000.0%	2	R.AYPLADAHLTK.K
	TK_050702_lung_E16_NE_2D_step01.2947.2947.1	1.4512	0.1659	1482.18	1	5450.0%	1	K.LLDLVQQSCNYK.Q
	TK_050702_lung_E16_NE_2D_step07.3267.3267.2	3.353	0.3561	1610.43	1	7500.0%	2	K.KLLDLVQQSCNYK.Q
UQ9BW1899.6%9656.3%588634717.7(Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit
	TK_050702_lung_E16_NE_2D_step07.3055.3055.1	1.2643	0.1329	1529.9	8	3640.0%	1	K.QFLSQFEMQSRK.T
	TK_050702_lung_E16_NE_2D_step06.4231.4231.2	3.2042	0.5735	2454.51	1	4580.0%	8	R.AVSDASAGDYGSAIETLVTAISLIK.Q
UGR78_MOUSE99.6%122816.6%655724225.2(P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP)
	TK_050702_lung_E16_NE_2D_step05.2888.2888.2	2.1462	0.3765	1606.05	2	5360.0%	1	K.TKPYIQVDIGGGQTK.T
	TK_050702_lung_E16_NE_2D_step02.0102.0102.1	1.1111	0.1214	498.6	4	8330.0%	4	K.LIPR.N
	TK_050702_lung_E16_NE_2D_step05.3850.3850.2	0.9589	0.042	2315.85	80	1670.0%	1	K.EDVGTVVGIDLGTTYSCVGVFK.N
*	TK_050702_lung_E16_NE_2D_step06.4011.4011.2	1.7276	0.4312	2151.69	1	4120.0%	2	R.IEIESFFEGEDFSETLTR.A
	TK_050702_lung_E16_NE_2D_step03.3228.3228.2	1.2709	0.1196	1589.0	1	4290.0%	1	K.KSDIDEIVLVGGSTR.I
	TK_050702_lung_E16_NE_2D_step06.3220.3220.2	2.6873	0.4939	1889.04	1	4690.0%	2	K.VTHAVVTVPAYFNDAQR.Q
	TK_050702_lung_E16_NE_2D_step05.2899.2899.2	3.4949	0.5373	1966.68	1	5590.0%	1	K.KSQIFSTASDNQPTVTIK.V
UALBU_HUMAN99.6%4610.0%609693676.3(P02768) Serum albumin precursor
*	TK_050702_lung_E16_NE_2D_step12.4749.4749.3	1.2681	0.011	3572.54	4	1470.0%	1	K.DDNPNLPRLVRPEVDVMCTAFHDNEETFLK.K
*	TK_050702_lung_E16_NE_2D_step06.3348.3348.2	2.808	0.5578	1912.32	1	5670.0%	2	R.RPCFSALEVDETYVPK.E
*	TK_050702_lung_E16_NE_2D_step07.3064.3064.2	1.5829	0.4135	1640.81	1	4290.0%	1	K.KVPQVSTPTLVEVSR.N
UQ9D0E199.6%2317518.9%729776498.6(Q9D0E1) 2610023M21Rik protein
*	TK_050702_lung_E16_NE_2D_step13.3897.3897.3	3.5349	0.2702	3795.41	1	2080.0%	5	K.GDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLSK.G
	TK_050702_lung_E16_NE_2D_step12.1648.1648.3	0.9493	0.0258	2125.71	179	1030.0%	1	K.FNECGHVLYADIKMENGK.S
	TK_050702_lung_E16_NE_2D_step01.3725.3725.1	1.5422	0.3235	1168.98	1	5620.0%	1	R.NLPFDFTWK.M
	TK_050702_lung_E16_NE_2D_step01.3495.3495.1	1.8076	0.0854	1265.97	2	5500.0%	1	R.AFITNIPFDVK.W
	TK_050702_lung_E16_NE_2D_step01.2977.2977.1	1.7261	0.2106	1115.05	1	6670.0%	1	R.INEILSNALK.R
	TK_050702_lung_E16_NE_2D_step06.3201.3201.2	1.7211	0.3676	2037.98	1	2730.0%	12	R.GNFGGSFAGSFGGAGGHAPGVAR.K
	TK_050702_lung_E16_NE_2D_step08.2316.2316.1	0.8863	0.0211	806.76	76	4170.0%	1	R.MGPVMDR.M
*	TK_050702_lung_E16_NE_2D_step03.3842.3842.2	1.4884	0.155	2179.08	1	2270.0%	1	K.GIGMGNLGPAGMGMEGIGFGINK.I
UERH_HUMAN99.6%2416.3%104122595.9(Q14259) Enhancer of rudimentary homolog (Q14259) Enhancer of rudimentary homolog
	TK_050702_lung_E16_NE_2D_step01.2549.2549.2	5.4595	0.6378	2057.84	1	7810.0%	2	R.TYADYESVNECMEGVCK.M
URBM3_MOUSE99.6%179541.8%153166057.5(O89086) Putative RNA-binding protein 3 (RNA binding motif protein 3)
	TK_050702_lung_E16_NE_2D_step01.4839.4839.3	1.4892	0.2841	3499.84	2	1690.0%	5	K.LFVGGLNFNTDEQALEDHFSSFGPISEVVVVK.D
*	TK_050702_lung_E16_NE_2D_step02.3661.3661.2	3.8567	0.587	2001.93	1	5880.0%	8	R.GFGFITFTNPEHASDAMR.A
*	TK_050702_lung_E16_NE_2D_step03.2494.2494.1	1.0285	0.0668	1569.79	5	3080.0%	2	R.YDSRPGGYGYGYGR.S
UQ6201999.6%5119.8%573587349.6(Q62019) 16 kDa protein
	TK_050702_lung_E16_NE_2D_step08.3066.3066.2	1.0937	0.0018	1653.24	104	3080.0%	1	K.DYAFVHMEKEADAK.A
	TK_050702_lung_E16_NE_2D_step12.1415.1415.1	0.31	0.0069	677.35	2	2500.0%	1	R.GRCQR.Q
	TK_050702_lung_E16_NE_2D_step10.3680.3680.3	2.7395	0.4491	3689.31	1	1940.0%	3	K.KPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQAR.Q
UP9749699.6%248219.1%11001232775.8(P97496) SRG3
	TK_050702_lung_E16_NE_2D_step08.3866.3866.2	2.129	0.1276	2615.39	3	2620.0%	5	K.TLVQNNCLTRPNIYLIPDIDLK.L
	TK_050702_lung_E16_NE_2D_step07.3569.3569.2	1.3293	0.1512	1749.85	1	3570.0%	2	R.VREEVPLELVEAHVK.K
	TK_050702_lung_E16_NE_2D_step01.3473.3473.2	2.7813	0.5512	2023.82	1	4120.0%	1	K.DMEDPTPVPNIEEVVLPK.N
*	TK_050702_lung_E16_NE_2D_step10.4127.4127.3	1.4298	0.0418	4121.48	2	1100.0%	2	R.SVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIER.G
*	TK_050702_lung_E16_NE_2D_step12.1747.1747.3	1.0825	0.0923	2064.13	16	1580.0%	1	R.GPGQQVLGEPGHVSQLDSVR.V
	TK_050702_lung_E16_NE_2D_step11.4141.4141.2	3.6227	0.5487	2898.64	1	2950.0%	1	R.EWTEQETLLLLEALEMYKDDWNK.V
	TK_050702_lung_E16_NE_2D_step08.3672.3672.2	1.9826	0.3868	2411.22	1	2710.0%	2	K.KVEHEISEGNVATAAAAALASAATK.A
	TK_050702_lung_E16_NE_2D_step07.2508.2508.1	1.1161	0.2563	1014.59	64	3120.0%	1	K.HVTNPAFTK.L
*	TK_050702_lung_E16_NE_2D_step07.2443.2443.3	1.0492	0.0555	2258.9	15	920.0%	1	K.CFMDFKAGGTLCHILGAAYK.Y
*	TK_050702_lung_E16_NE_2D_step04.4120.4120.2	3.5315	0.5842	2962.75	1	4320.0%	6	K.WILDTDVFNEWMNEEDYEVDENR.K
UROA1_MOUSE99.6%170235458.3%319340659.2(P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed)
	TK_050702_lung_E16_NE_2D_step06.2699.2699.3	1.8594	0.2941	1632.32	1	3330.0%	1	R.SSGPYGGGGQYFAKPR.N
	TK_050702_lung_E16_NE_2D_step02.3392.3392.2	3.1607	0.5175	1219.94	1	8330.0%	3	K.IEVIEIMTDR.G
	TK_050702_lung_E16_NE_2D_step12.4176.4176.2	1.2926	0.0804	2514.64	1	2270.0%	16	R.GFGFVTYATVEEVDAAMNARPHK.V
	TK_050702_lung_E16_NE_2D_step03.3834.3834.2	2.0947	0.5031	1788.25	1	5670.0%	18	K.LFIGGLSFETTDESLR.S
	TK_050702_lung_E16_NE_2D_step02.3523.3523.2	1.8776	0.391	1916.91	1	4380.0%	10	R.KLFIGGLSFETTDESLR.S
	TK_050702_lung_E16_NE_2D_step08.3454.3454.2	5.1786	0.6278	2525.5	1	5500.0%	20	R.SHFEQWGTLTDCVVMRDPNTK.R
	TK_050702_lung_E16_NE_2D_step04.3459.3459.2	3.2196	0.4939	1701.83	1	6070.0%	4	R.GFAFVTFDDHDSVDK.I
	TK_050702_lung_E16_NE_2D_step01.1419.1419.1	0.5852	0.0466	572.87	21	3750.0%	3	R.VVEPK.R
	TK_050702_lung_E16_NE_2D_step01.2399.2399.1	2.15	0.069	1051.91	1	7140.0%	2	R.DYFEQYGK.I
	TK_050702_lung_E16_NE_2D_step03.0726.0726.1	0.5531	4.0E-4	543.95	14	2500.0%	1	R.KALSK.Q
	TK_050702_lung_E16_NE_2D_step10.5169.5169.2	3.3119	0.5784	1969.92	1	5670.0%	21	R.SHFEQWGTLTDCVVMR.D
	TK_050702_lung_E16_NE_2D_step06.2628.2628.2	1.2335	0.1234	1439.77	1	5420.0%	3	R.EDSQRPGAHLTVK.K
	TK_050702_lung_E16_NE_2D_step11.4806.4806.3	1.8028	0.2024	2941.13	1	1830.0%	1	R.GFGFVTYATVEEVDAAMNARPHKVDGR.V
	TK_050702_lung_E16_NE_2D_step08.3146.3146.1	1.928	0.1856	863.87	1	6430.0%	13	K.KIFVGGIK.E
	TK_050702_lung_E16_NE_2D_step07.2789.2789.3	1.8823	0.254	3307.59	4	1590.0%	1	R.SSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGR.R
	TK_050702_lung_E16_NE_2D_step06.2788.2788.3	1.2013	0.1101	1852.59	33	1530.0%	1	R.NQGGYGGSSSSSSYGSGRR.F
	TK_050702_lung_E16_NE_2D_step01.1821.1821.2	3.4512	0.5353	1696.39	1	5290.0%	1	R.NQGGYGGSSSSSSYGSGR.R
	TK_050702_lung_E16_NE_2D_step04.3917.3917.2	2.0582	0.4175	2250.02	1	2940.0%	3	R.DYFEQYGKIEVIEIMTDR.G
	TK_050702_lung_E16_NE_2D_step09.0031.0031.2	4.6348	0.5678	1882.33	1	6670.0%	22	K.IFVGGIKEDTEEHHLR.D
	TK_050702_lung_E16_NE_2D_step05.2418.2418.2	2.6526	0.4079	1487.78	1	7270.0%	7	K.YHTVNGHNCEVR.K
	TK_050702_lung_E16_NE_2D_step09.3597.3597.2	2.0625	0.4316	1858.62	1	5330.0%	3	K.RGFAFVTFDDHDSVDK.I
UQ9WTU199.6%101210.1%12331432157.4(Q9WTU1) Chromosome segregation protein SmcB
	TK_050702_lung_E16_NE_2D_step03.3068.3068.3	1.4645	0.0020	3251.13	4	1640.0%	1	R.NSSAQAFLGPENPEEPYLDGINYNCVAPGK.R
	TK_050702_lung_E16_NE_2D_step09.3632.3632.3	1.5674	0.0038	3411.89	21	1330.0%	1	R.NSSAQAFLGPENPEEPYLDGINYNCVAPGKR.F
	TK_050702_lung_E16_NE_2D_step06.2544.2544.1	1.2728	0.1628	950.63	1	5710.0%	1	K.KYQIAVTK.V
	TK_050702_lung_E16_NE_2D_step07.2964.2964.2	1.0757	0.0797	1066.96	1	5620.0%	1	R.HLALNLQEK.S
	TK_050702_lung_E16_NE_2D_step05.3270.3270.2	3.6636	0.5915	1449.7	1	7920.0%	2	K.SKLESELANFGPR.I
	TK_050702_lung_E16_NE_2D_step12.1459.1459.2	0.7282	0.0483	1232.07	30	2500.0%	1	K.RAATLAQELEK.F
	TK_050702_lung_E16_NE_2D_step06.2520.2520.2	1.6343	0.3475	1383.98	1	5450.0%	1	R.QVQSQAHGLQMR.L
	TK_050702_lung_E16_NE_2D_step11.4773.4773.2	1.2111	0.0028	2293.84	116	1840.0%	1	K.ALQYACGNALVCDNVEDARR.I
	TK_050702_lung_E16_NE_2D_step01.3751.3751.2	2.5994	0.2745	2321.35	1	4740.0%	1	R.GEPETFLPLDYLEVKPTDEK.L
UQ9WV0299.6%122212.3%3914230110.1(Q9WV02) Heterogeneous nuclear ribonucleoprotein G (RNA binding motif protein, X chromosome)
	TK_050702_lung_E16_NE_2D_step07.2783.2783.2	3.5045	0.5329	1749.2	1	6330.0%	1	K.AIKVEQATKPSFESGR.R
	TK_050702_lung_E16_NE_2D_step01.1805.1805.1	0.9966	0.2079	815.97	1	5000.0%	1	R.DYAPPPR.D
	TK_050702_lung_E16_NE_2D_step01.3181.3181.1	1.5438	0.1438	1320.78	7	4500.0%	1	K.YGRIVEVLLMK.D
	TK_050702_lung_E16_NE_2D_step03.3481.3481.1	1.3234	0.1072	946.08	3	5710.0%	3	R.IVEVLLMK.D
	TK_050702_lung_E16_NE_2D_step02.2256.2256.1	1.0951	0.0972	1437.82	3	3750.0%	1	K.VEQATKPSFESGR.R
	TK_050702_lung_E16_NE_2D_step01.3425.3425.1	1.8667	0.3226	1489.22	1	4230.0%	1	R.GFAFVTFESPADAK.D
UQ9DBT299.6%2111711.3%675757035.1(Q9DBT2) 1200014H24Rik protein
*	TK_050702_lung_E16_NE_2D_step02.3789.3789.2	2.2919	0.5161	2239.44	1	4000.0%	2	K.DSNSLAYYNMASGAVIHLALK.E
	TK_050702_lung_E16_NE_2D_step07.3349.3349.3	3.2823	0.573	2381.51	1	3300.0%	2	K.ASKPLPPAPAPDEYLVSPITGEK.I
	TK_050702_lung_E16_NE_2D_step03.3588.3588.3	1.4029	0.0395	3524.47	44	1450.0%	1	K.VTWDGHSGSMARTQQAAQANITLQEQIEAIHK.A
	TK_050702_lung_E16_NE_2D_step03.2540.2540.2	2.2507	0.4695	1305.29	1	6820.0%	1	K.VTWDGHSGSMAR.T
	TK_050702_lung_E16_NE_2D_step03.3072.3072.2	2.299	0.4737	2238.36	1	3160.0%	9	R.TQQAAQANITLQEQIEAIHK.A
UHN3B_MOUSE99.6%2212.2%459484748.7(P35583) Hepatocyte nuclear factor 3-beta (HNF-3B)
*	TK_050702_lung_E16_NE_2D_step04.2380.2380.3	3.1918	0.5616	3908.78	1	2120.0%	1	K.TAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHK.R
*	TK_050702_lung_E16_NE_2D_step12.1471.1471.3	1.4311	0.0091	1458.37	1	3670.0%	1	K.QLALKEAAGAASSGGK.K
UH11_MOUSE99.6%112378640.6%2122165410.9(P43275) Histone H1.1 (H1 VAR.3) (H1A)
*	TK_050702_lung_E16_NE_2D_step01.1981.1981.1	1.3665	0.4012	795.82	1	6250.0%	1	K.GTGAAGSFK.L
	TK_050702_lung_E16_NE_2D_step07.0541.0541.1	0.7807	0.0671	544.44	25	5000.0%	1	K.AVKPK.A
	TK_050702_lung_E16_NE_2D_step05.2788.2788.2	2.7212	0.2811	975.98	1	8890.0%	1	R.SGVSLAALKK.S
*	TK_050702_lung_E16_NE_2D_step13.3909.3909.2	1.2302	0.0386	2015.36	1	3160.0%	44	R.KKPAGPSVSELIVQAVSSSK.E
	TK_050702_lung_E16_NE_2D_step07.0734.0734.1	0.6285	0.196	631.6	26	3000.0%	6	K.KPAVSK.K
*	TK_050702_lung_E16_NE_2D_step07.1658.1658.1	0.9672	0.1322	641.46	3	5000.0%	1	K.TPAKPK.K
	TK_050702_lung_E16_NE_2D_step01.2642.2642.1	1.2824	0.3282	846.04	1	6880.0%	1	R.SGVSLAALK.K
*	TK_050702_lung_E16_NE_2D_step01.2274.2274.1	2.4334	0.397	1126.21	1	7000.0%	2	K.SLAAAGYDVEK.N
	TK_050702_lung_E16_NE_2D_step01.0252.0252.1	0.8633	5.0E-4	701.67	148	4170.0%	1	K.VAKSPAK.A
*	TK_050702_lung_E16_NE_2D_step11.4629.4629.2	3.3291	0.4437	1888.04	1	4440.0%	42	K.KPAGPSVSELIVQAVSSSK.E
	TK_050702_lung_E16_NE_2D_step01.1970.1970.1	1.4548	0.0727	560.72	2	7500.0%	1	K.SLVNK.G
	TK_050702_lung_E16_NE_2D_step01.2021.2021.1	1.5557	0.1616	749.08	2	5830.0%	3	K.GTLVQTK.G
UALFA_MOUSE99.6%94114.9%363392258.1(P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase)
	TK_050702_lung_E16_NE_2D_step07.3777.3777.2	1.4709	0.2814	2110.17	1	2890.0%	6	K.IGEHTPSALAIMENANVLAR.Y
*	TK_050702_lung_E16_NE_2D_step02.3139.3139.2	1.7366	0.3038	2259.9	1	3330.0%	1	K.YTPSGQSGAAASESLFISNHAY.-
*	TK_050702_lung_E16_NE_2D_step08.2710.2710.2	1.9869	0.3649	1379.1	1	5910.0%	2	-.PHPYPALTPEQK.K
UDDX9_MOUSE99.6%11157.5%13801495826.9(O70133) ATP-dependent RNA helicase A (Nuclear DNA helicase II) (NDH II) (DEAD-box protein 9) (mHEL-5)
*	TK_050702_lung_E16_NE_2D_step03.2941.2941.2	1.3232	0.0957	1303.3	7	4090.0%	1	R.KVFDPVPDGVTK.V
*	TK_050702_lung_E16_NE_2D_step06.2576.2576.1	1.5226	0.1606	1084.75	1	6250.0%	1	K.LAHFEPSQR.Q
	TK_050702_lung_E16_NE_2D_step04.2531.2531.1	1.1507	0.0456	826.9	37	5000.0%	1	R.ELLPVKK.F
	TK_050702_lung_E16_NE_2D_step04.2955.2955.3	1.2802	0.0065	1516.67	119	2290.0%	1	R.AAECNIVVTQPRR.I
*	TK_050702_lung_E16_NE_2D_step01.3670.3670.2	3.1364	0.5525	2068.09	1	6250.0%	1	K.TTQVPQYILDDFIQNDR.A
*	TK_050702_lung_E16_NE_2D_step03.3753.3753.2	1.6633	0.3309	2333.84	1	2630.0%	2	K.QPNIISQLDPVNEHMLNTIR.Q
	TK_050702_lung_E16_NE_2D_step08.2615.2615.1	1.0622	0.1009	786.55	8	5000.0%	1	R.KLEAGIR.G
*	TK_050702_lung_E16_NE_2D_step02.4475.4475.3	1.4569	0.1253	2700.86	58	1410.0%	1	R.GATGCGKTTQVPQYILDDFIQNDR.A
	TK_050702_lung_E16_NE_2D_step09.3414.3414.2	1.4576	0.0214	1466.5	6	4090.0%	2	R.YQILPLHSQIPR.E
URL22_MOUSE99.6%2226.0%127146289.2(P41104) 60S ribosomal protein L22 (Heparin binding protein HBp15)
	TK_050702_lung_E16_NE_2D_step07.2476.2476.1	0.9911	0.0209	928.71	17	4170.0%	1	R.YLKYLTK.K
	TK_050702_lung_E16_NE_2D_step01.4106.4106.3	3.5975	0.3582	3087.04	1	2500.0%	1	K.FTLDCTHPVEDGIMDAANFEQFLQER.I
UQ9D4M799.6%448.0%887999198.1(Q9D4M7) 4931400A14Rik protein
*	TK_050702_lung_E16_NE_2D_step12.3587.3587.3	1.9554	0.0911	3772.2	22	1290.0%	1	R.AAMVISWHLASDMDCVVTLTTDAARAIYDETQGR.Q
*	TK_050702_lung_E16_NE_2D_step02.2132.2132.1	0.4702	0.25	498.59	2	3750.0%	1	K.GDVPN.-
*	TK_050702_lung_E16_NE_2D_step01.3101.3101.1	0.8695	0.0822	1460.04	2	2500.0%	1	R.GEHTVQVKGVYNK.S
*	TK_050702_lung_E16_NE_2D_step05.2582.2582.2	3.45	0.5112	2055.27	1	5560.0%	1	K.LSSGMSRPPANAETFSCNK.I
UQ9CV7599.6%91916.5%333387739.6(Q9CV75) 2310008B08Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step01.3562.3562.2	4.8551	0.6058	2481.72	1	5710.0%	1	K.GMDSGFAGGEDEIYNVYDQAWR.G
	TK_050702_lung_E16_NE_2D_step01.3365.3365.1	2.3826	0.3088	1482.19	1	5000.0%	2	R.DISEVIALGVPNPR.T
*	TK_050702_lung_E16_NE_2D_step04.2327.2327.1	0.9273	0.0278	673.88	7	5000.0%	1	K.QHGGFK.R
	TK_050702_lung_E16_NE_2D_step05.2930.2930.2	3.2762	0.5719	1473.08	1	7080.0%	3	R.GLQTVHINENFAK.L
UQ9DBU499.6%5711.2%635720124.6(Q9DBU4) RAD21 homolog (S. pombe)
	TK_050702_lung_E16_NE_2D_step05.3216.3216.2	2.6958	0.2945	1731.42	1	5710.0%	1	K.MAFRPGVVDLPEENR.E
	TK_050702_lung_E16_NE_2D_step08.3200.3200.3	1.2412	0.054	2630.22	24	1590.0%	1	R.DVIDEPIIEEPSRLQDSVMEASR.T
	TK_050702_lung_E16_NE_2D_step07.2736.2736.2	1.8402	0.325	1212.78	2	6670.0%	1	R.TQQMLHGLQR.A
	TK_050702_lung_E16_NE_2D_step04.3255.3255.2	5.3183	0.5798	2586.48	1	4770.0%	2	K.KQQAIELTQEEPYSDIIATPGPR.F
UO3573799.6%122626.9%449491996.3(O35737) Heterogeneous nuclear ribonucleoprotein H
	TK_050702_lung_E16_NE_2D_step08.2751.2751.2	2.2205	0.4418	2099.7	1	4170.0%	3	R.YGDGGSTFQSTTGHCVHMR.G
	TK_050702_lung_E16_NE_2D_step09.4293.4293.2	1.0707	0.1672	2907.25	8	1000.0%	2	K.EEIVQFFSGLEIVPNGITLPVDFQGR.S
	TK_050702_lung_E16_NE_2D_step01.3406.3406.2	4.5143	0.5783	1844.17	1	7500.0%	3	R.STGEAFVQFASQEIAEK.A
	TK_050702_lung_E16_NE_2D_step09.3514.3514.2	1.7063	0.3101	2142.64	1	3420.0%	1	R.YVELFLNSTAGASGGAYEHR.Y
	TK_050702_lung_E16_NE_2D_step03.2524.2524.2	2.5209	0.5225	1685.79	1	6000.0%	1	K.HTGPNSPDTANDGFVR.L
	TK_050702_lung_E16_NE_2D_step01.3882.3882.2	4.4381	0.5855	1998.7	1	6560.0%	1	R.ATENDIYNFFSPLNPVR.V
	TK_050702_lung_E16_NE_2D_step01.2569.2569.1	1.7295	0.2914	784.98	2	8000.0%	1	R.YVEVFK.S
UO0881799.6%71310.3%653704088.8(O08817) CW17 protein
*	TK_050702_lung_E16_NE_2D_step05.3350.3350.2	1.1044	0.0201	2351.64	4	2380.0%	2	R.GSDGPSHESEDFPRPLVTLPGR.Q
	TK_050702_lung_E16_NE_2D_step04.2096.2096.2	1.6298	0.3815	1475.46	3	4170.0%	1	K.FQRPGDPQSAQDK.A
	TK_050702_lung_E16_NE_2D_step04.4143.4143.2	3.5862	0.575	2403.02	1	5250.0%	2	K.VMIPQDEYPEINFVGLLIGPR.G
	TK_050702_lung_E16_NE_2D_step08.2915.2915.2	1.493	0.1698	1374.53	6	4500.0%	2	R.ILRPWQSSETR.S
UHMG4_MOUSE99.6%92918.1%199228798.4(O54879) High mobility group protein 4 (HMG-4) (High mobility group protein 2a) (HMG-2a)
	TK_050702_lung_E16_NE_2D_step02.2381.2381.1	1.3387	0.0243	956.82	1	5000.0%	1	K.SKFDEMAK.A
*	TK_050702_lung_E16_NE_2D_step03.3112.3112.2	2.9853	0.2398	1680.24	1	6920.0%	5	K.KLGEMWNNLSDNEK.Q
	TK_050702_lung_E16_NE_2D_step01.3125.3125.2	2.4267	0.2668	1479.53	1	5420.0%	1	K.NPEVPVNFAEFSK.K
	TK_050702_lung_E16_NE_2D_step04.3201.3201.2	1.05	0.0722	1606.54	7	3460.0%	1	K.NPEVPVNFAEFSKK.C
UQ91VL299.6%166217.0%382443189.6(Q91VL2) Unknown (Protein for IMAGE:3669867) (Fragment)
	TK_050702_lung_E16_NE_2D_step01.3209.3209.2	1.3431	0.0401	2152.74	208	1670.0%	1	R.MDSFDEDLARPSGLLAQER.K
	TK_050702_lung_E16_NE_2D_step07.3149.3149.2	1.2133	0.1189	1532.81	2	3750.0%	5	R.SIFQHIQSAQSQR.S
	TK_050702_lung_E16_NE_2D_step12.4499.4499.2	1.5354	0.1806	2045.36	1	4120.0%	5	R.SPSELFAQHIVTIVHHVK.E
*	TK_050702_lung_E16_NE_2D_step04.2571.2571.1	1.5777	0.1079	957.75	4	5710.0%	1	K.WESLHTGK.E
*	TK_050702_lung_E16_NE_2D_step01.1609.1609.1	0.8699	0.1731	646.59	3	5830.0%	1	K.VIAGASK.N
UQ924H799.6%338.0%646706909.5(Q924H7) WAC
	TK_050702_lung_E16_NE_2D_step11.4453.4453.3	1.7487	0.1485	2280.86	5	2250.0%	1	R.QLLPALQATLQLNNSNVDISK.I
	TK_050702_lung_E16_NE_2D_step04.3343.3343.2	3.188	0.4551	2043.1	1	5560.0%	1	K.HSSDASSLLPQNILSQTSR.H
*	TK_050702_lung_E16_NE_2D_step02.2519.2519.2	2.0542	0.5737	1224.98	1	5910.0%	1	K.LPTPTASLPAQK.T
UCNBP_MOUSE99.6%3515.9%170187427.7(P53996) Cellular nucleic acid binding protein (CNBP)
	TK_050702_lung_E16_NE_2D_step09.2516.2516.2	1.1966	0.1169	1851.64	1	3210.0%	1	R.EQCCYNCGKPGHLAR.D
	TK_050702_lung_E16_NE_2D_step03.2678.2678.2	1.0444	0.1033	1486.59	2	4090.0%	2	K.CYSCGEFGHIQK.D
UCYC_MOUSE99.5%111961.5%104114749.6(P00009) Cytochrome c, somatic
*	TK_050702_lung_E16_NE_2D_step03.4014.4014.2	1.0921	0.257	2126.85	1	2650.0%	1	K.GITWGEDTLMEYLENPKK.Y
	TK_050702_lung_E16_NE_2D_step06.2371.2371.1	0.7232	0.1233	806.57	24	3330.0%	2	K.KYIPGTK.M
*	TK_050702_lung_E16_NE_2D_step02.3972.3972.2	2.4298	0.4509	1996.68	1	5000.0%	1	K.GITWGEDTLMEYLENPK.K
	TK_050702_lung_E16_NE_2D_step07.2600.2600.1	1.4342	0.1553	762.73	11	7000.0%	1	K.KIFVQK.C
*	TK_050702_lung_E16_NE_2D_step04.2452.2452.2	3.1859	0.439	1560.92	1	7140.0%	1	R.KTGQAAGFSYTDANK.N
	TK_050702_lung_E16_NE_2D_step01.3235.3235.1	1.2308	0.1456	906.91	2	6430.0%	1	R.ADLIAYLK.K
	TK_050702_lung_E16_NE_2D_step10.3469.3469.2	1.4374	0.2504	1171.56	5	4000.0%	3	K.TGPNLHGLFGR.K
USFR3_HUMAN99.5%206034.1%1641933011.6(P23152) Splicing factor, arginine/serine-rich 3 (Pre-mRNA splicing factor SRP20) (X16 protein) (P23152) Splicing factor, arginine/serine-rich 3 (Pre-mRNA splicing factor SRP20) (X16 protein)
	TK_050702_lung_E16_NE_2D_step03.3710.3710.2	1.3326	0.0854	2321.12	3	2750.0%	1	R.NPPGFAFVEFEDPRDAADAVR.E
	TK_050702_lung_E16_NE_2D_step01.2099.2099.2	3.0568	0.3935	1250.79	1	9090.0%	1	K.VYVGNLGNNGNK.T
	TK_050702_lung_E16_NE_2D_step02.2303.2303.2	1.6932	0.1535	1132.88	1	6670.0%	3	R.VRVELSNGEK.R
	TK_050702_lung_E16_NE_2D_step04.3651.3651.2	1.2972	0.0928	1623.27	1	4230.0%	2	R.NPPGFAFVEFEDPR.D
	TK_050702_lung_E16_NE_2D_step02.2337.2337.1	1.145	0.0244	855.74	100	4290.0%	5	R.GPPPSWGR.R
	TK_050702_lung_E16_NE_2D_step02.2651.2651.2	2.2914	0.2801	1878.95	1	5620.0%	3	K.VYVGNLGNNGNKTELER.A
UQ9D8X599.5%5138.6%292335744.8(Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene)
	TK_050702_lung_E16_NE_2D_step10.4274.4274.3	3.4841	0.2919	2881.25	1	3020.0%	3	K.FNLTEDMYSQDSIDLLANSGLQFQK.H
URS3_MOUSE99.5%4611.9%243266749.7(P17073) 40S ribosomal protein S3
	TK_050702_lung_E16_NE_2D_step05.2634.2634.2	2.6292	0.457	1576.52	1	4330.0%	2	K.GGKPEPPAMPQPVPTA.-
	TK_050702_lung_E16_NE_2D_step01.0716.0716.1	0.9314	0.1006	414.69	1	6670.0%	1	K.IGPK.K
	TK_050702_lung_E16_NE_2D_step03.1996.1996.1	0.6597	0.1219	941.55	2	3120.0%	1	R.QGVLGIKVK.I
URS10_MOUSE99.5%3314.5%1651891610.2(P09900) 40S ribosomal protein S10
	TK_050702_lung_E16_NE_2D_step04.2875.2875.1	0.8319	0.1709	1571.28	8	2140.0%	1	K.KAEAGAGSATEFQFR.G
	TK_050702_lung_E16_NE_2D_step07.2855.2855.1	1.3814	0.2357	1051.83	26	4380.0%	1	K.NVPNLHVMK.A
UQ9NYF899.5%10206.1%86910021610.0(Q9NYF8) Bcl-2-associated transcription factor short form
	TK_050702_lung_E16_NE_2D_step07.3251.3251.2	3.0226	0.512	1170.16	1	7500.0%	2	R.LLASTLVHSVK.K
	TK_050702_lung_E16_NE_2D_step02.2772.2772.2	1.839	0.487	1813.71	4	3120.0%	1	K.MAPVPLDDSNRPASLTK.D
	TK_050702_lung_E16_NE_2D_step05.3126.3126.1	1.2633	0.167	859.79	18	5000.0%	3	R.SIFDHIK.L
	TK_050702_lung_E16_NE_2D_step06.2488.2488.2	1.3336	0.1567	1370.6	1	5000.0%	1	K.MIASDSHRPEVK.L
	TK_050702_lung_E16_NE_2D_step01.0070.0070.1	1.0676	0.0662	816.92	11	6000.0%	1	K.EYKSYK.D
UQ9CQS299.5%41625.0%64770610.0(Q9CQS2) 1110036B12Rik protein (Nucleolar protein family A, member 3) (H/ACA small nucleolar RNPs)
	TK_050702_lung_E16_NE_2D_step09.2871.2871.2	2.0445	0.4181	1834.85	1	5000.0%	4	K.KFDPMGQQTCSAHPAR.F
UQ9D3V699.4%5914.1%382409519.9(Q9D3V6) 4933432H23Rik protein
*	TK_050702_lung_E16_NE_2D_step08.3984.3984.2	0.7644	0.0404	2233.88	49	1430.0%	1	R.KSQGPLEIAETAVSQSSGLEAK.F
	TK_050702_lung_E16_NE_2D_step02.3129.3129.2	1.6626	0.271	1645.32	5	3930.0%	2	K.LSLTQSDISHIGSMR.V
*	TK_050702_lung_E16_NE_2D_step09.3965.3965.2	2.9768	0.0037	1935.74	2	5000.0%	2	R.HILLAVANDQELNQLLK.G
UQ9CXT199.4%4106.7%372427945.4(Q9CXT1) 3110009E13Rik protein
	TK_050702_lung_E16_NE_2D_step02.3860.3860.2	2.5912	0.4991	2358.31	1	5000.0%	1	K.NFSLLSFGEEAEEEEEEVNR.V
	TK_050702_lung_E16_NE_2D_step04.1859.1859.1	0.9109	0.2917	614.54	1	6250.0%	3	K.KLKPK.G
UMAZ_MOUSE99.4%113.6%477487709.0(P56671) Myc-associated zinc finger protein (MAZI) (Purine-binding transcription factor) (Pur-1)
	TK_050702_lung_E16_NE_2D_step06.2453.2453.2	2.4577	0.4999	2133.93	1	5000.0%	1	K.LSHSDEKPYQCPVCQQR.F
UQ9CT4999.4%245.6%356412785.0(Q9CT49) 2600011C06Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step03.3454.3454.2	3.0614	0.4899	2324.6	1	4740.0%	2	K.LPVDSVFNKFEDEDSDDVPR.K
UQ8R0R699.4%5514.9%626697107.4(Q8R0R6) Hypothetical 69.7 kDa protein
	TK_050702_lung_E16_NE_2D_step05.2252.2252.3	0.9611	0.2009	1516.64	70	1250.0%	1	K.LLVATSVAARGLDVK.H
	TK_050702_lung_E16_NE_2D_step05.2391.2391.2	1.0059	0.0312	1638.79	6	2500.0%	1	K.TGSGKTIAFLLPMFR.H
	TK_050702_lung_E16_NE_2D_step10.3748.3748.2	0.901	0.1865	2349.76	1	2370.0%	1	R.IVDNVRPDRQTVMFSATFPR.A
	TK_050702_lung_E16_NE_2D_step05.3739.3739.3	1.0353	0.1372	2813.61	19	910.0%	1	K.HLILVVNYSCPNHYEDYVHRAGR.T
	TK_050702_lung_E16_NE_2D_step02.3844.3844.2	2.6418	0.5176	2201.6	1	3950.0%	1	K.NLGIESQVDVMQQATNAILR.G
UQ9D8D499.4%3513.7%1461660111.9(Q9D8D4) 2010005M05Rik protein
	TK_050702_lung_E16_NE_2D_step01.2430.2430.1	0.9887	0.028	822.73	24	4170.0%	1	R.SNENLDK.I
	TK_050702_lung_E16_NE_2D_step04.2275.2275.2	1.5729	0.2166	1246.84	1	4580.0%	2	R.LVGATATPPPPPK.A
UQ9R0R599.4%6182.9%10341159368.2(Q9R0R5) Transcription factor CA150b
	TK_050702_lung_E16_NE_2D_step01.3249.3249.1	1.0982	0.0363	827.08	2	6670.0%	1	K.FSSSDRK.K
*	TK_050702_lung_E16_NE_2D_step10.3866.3866.2	2.9182	0.5202	2542.59	1	3860.0%	4	K.AKPVATTPIPGTPWCVVWTGDER.V
UCBX3_MOUSE99.4%72713.1%183208555.2(P23198) Chromobox protein homolog 3 (Heterochromatin protein 1 homolog gamma) (HP1 gamma) (Modifier 2 protein) (M32)
	TK_050702_lung_E16_NE_2D_step04.3513.3513.2	1.9597	0.2844	1528.11	1	5910.0%	5	K.CPQIVIAFYEER.L
	TK_050702_lung_E16_NE_2D_step01.2395.2395.1	1.3972	0.3877	1472.98	1	4090.0%	1	R.LTWHSCPEDEAQ.-
UQ9Z12699.4%3323.8%105112439.3(Q9Z126) Platelet factor 4
*	TK_050702_lung_E16_NE_2D_step09.3521.3521.2	1.2914	0.3371	1351.95	3	4090.0%	1	R.HCAVPQLIATLK.N
*	TK_050702_lung_E16_NE_2D_step03.1497.1497.1	0.1138	0.0291	464.02	1	1670.0%	1	K.ILES.-
	TK_050702_lung_E16_NE_2D_step05.3008.3008.1	1.7326	0.3953	1039.87	1	6250.0%	1	K.HITSLEVIK.A
UQ923D599.4%81216.2%641698898.4(Q923D5) Similar to Npw38-binding protein NpwBP
	TK_050702_lung_E16_NE_2D_step06.3272.3272.2	2.7287	0.4633	1426.73	1	5910.0%	2	K.RAQLSQYFDAVK.N
	TK_050702_lung_E16_NE_2D_step02.2679.2679.3	1.3591	0.0231	2593.35	194	1700.0%	1	R.GHDDDMSSTSEDDGYPEDMDQDK.H
	TK_050702_lung_E16_NE_2D_step05.2444.2444.2	1.6028	0.2487	1541.62	1	3930.0%	1	K.ATATISAKPQITNPK.A
	TK_050702_lung_E16_NE_2D_step12.1947.1947.2	2.6136	0.5299	1670.17	1	5000.0%	2	K.KATATISAKPQITNPK.A
	TK_050702_lung_E16_NE_2D_step11.4781.4781.3	2.9128	0.5552	4179.28	1	1840.0%	1	K.NAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILK.K
	TK_050702_lung_E16_NE_2D_step11.3549.3549.2	1.6651	0.3739	1429.9	1	5000.0%	1	R.AVSILPLLGHGVPR.L
UQ8R3N699.4%469.4%657754365.0(Q8R3N6) Similar to nuclear matrix protein p84
	TK_050702_lung_E16_NE_2D_step12.1699.1699.3	1.2294	0.0038	2069.1	21	1910.0%	1	K.SVYQLLSENPPDGERFSK.M
	TK_050702_lung_E16_NE_2D_step06.4084.4084.3	1.3753	0.2105	3021.6	3	1250.0%	1	R.SPHFFQPTNQQFKSLPEYLENMVIK.L
*	TK_050702_lung_E16_NE_2D_step08.3751.3751.2	1.7686	0.481	2088.2	1	3330.0%	2	K.NIKPLLTAFSQLPGSENEK.K
UO3563899.4%6262.5%11621340395.3(O35638) SA2 nuclear protein
	TK_050702_lung_E16_NE_2D_step08.2642.2642.1	0.8509	0.0108	1032.84	1	4290.0%	1	K.GVFVHRYR.Y
	TK_050702_lung_E16_NE_2D_step03.3530.3530.2	2.0952	0.4118	2446.87	1	2750.0%	5	R.EQTLHTPVMMQTPQLTSTIMR.E
UQ9CXI599.4%4427.4%179203748.1(Q9CXI5) 3230402M22Rik protein
*	TK_050702_lung_E16_NE_2D_step01.2958.2958.1	1.7115	0.2906	1267.95	1	6110.0%	1	K.ILDDWGEMCK.G
*	TK_050702_lung_E16_NE_2D_step01.3703.3703.2	2.3887	0.5247	1964.17	1	5940.0%	1	K.DRDVTFSPATIEEELIK.F
	TK_050702_lung_E16_NE_2D_step08.3938.3938.2	0.8028	0.1505	1927.87	164	1560.0%	1	K.IINEVSKPLAHHIPVEK.I
*	TK_050702_lung_E16_NE_2D_step04.2060.2060.3	0.7368	0.0089	1810.4	1	1790.0%	1	K.ILDDWGEMCKGCAEK.S
UQ921T299.4%3313.5%520584157.1(Q921T2) Unknown (Protein for MGC:6357)
*	TK_050702_lung_E16_NE_2D_step13.0373.0373.3	0.9802	0.1016	2103.93	38	970.0%	1	K.VKFTSSSTASSYNHMDPDK.L
*	TK_050702_lung_E16_NE_2D_step07.4003.4003.3	1.3895	0.0155	3642.28	11	1360.0%	1	R.GTTFLEKHLNSSLPRPQPAILLLTAAQDAAEVLK.C
*	TK_050702_lung_E16_NE_2D_step04.2303.2303.2	2.4985	0.5244	1865.1	1	5620.0%	1	R.LEQHSQQPQLSPATSGR.G
UNED4_MOUSE99.4%446.2%9571099685.6(P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment)
*	TK_050702_lung_E16_NE_2D_step12.2420.2420.2	1.0865	0.0881	1935.77	2	2860.0%	1	R.MERPYTFKDFVLHPR.S
*	TK_050702_lung_E16_NE_2D_step05.2402.2402.2	2.4084	0.5024	2172.02	1	4000.0%	1	R.LAVCGNPATSQPVTSSNHSSR.G
	TK_050702_lung_E16_NE_2D_step03.2468.2468.3	1.9025	0.0198	2752.75	20	1820.0%	1	K.IFDENELELLMCGLGDVDVNDWR.E
UO5503999.4%6189.7%513569649.2(O55039) Pleiotropic regulator 1
	TK_050702_lung_E16_NE_2D_step03.3148.3148.2	0.9763	0.0274	1720.7	89	2500.0%	1	K.ASVHTLSGHTNAVATVR.C
*	TK_050702_lung_E16_NE_2D_step06.3856.3856.2	1.4308	0.1867	2145.83	1	2890.0%	4	R.AVVLHPLLYTFASGSPDNIK.Q
	TK_050702_lung_E16_NE_2D_step04.2976.2976.2	2.2984	0.4029	1474.4	1	5420.0%	1	R.NEYGPVLHMPTSK.E
UQ99LI799.4%111.7%717828778.1(Q99LI7) Hypothetical 82.9 kDa protein
	TK_050702_lung_E16_NE_2D_step05.2903.2903.2	2.4527	0.5082	1324.01	1	7270.0%	1	K.GAVVPPVHDIYR.A
UQ9CT3699.4%354.3%695800919.6(Q9CT36) 2610005B21Rik protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step09.3585.3585.2	2.553	0.5312	1744.41	1	4640.0%	1	K.ARPNTVIFQEPFVPK.K
*	TK_050702_lung_E16_NE_2D_step06.3525.3525.2	2.6182	0.4575	1693.29	1	6070.0%	2	K.ALPVPHFDTINLPEK.K
US3A3_MOUSE99.4%61214.8%501588425.3(Q9D554) Splicing factor 3A subunit 3 (Spliceosome associated protein 61) (SAP 61) (SF3a60)
	TK_050702_lung_E16_NE_2D_step02.4264.4264.2	0.9546	0.0605	2618.14	24	2140.0%	1	K.ASEKLDYITYLSIFDQLFDIPK.E
	TK_050702_lung_E16_NE_2D_step04.2967.2967.2	3.0784	0.4596	1517.04	1	6670.0%	1	R.VKPLQDQNELFGK.I
	TK_050702_lung_E16_NE_2D_step04.3411.3411.2	2.7523	0.5221	2229.64	1	4720.0%	1	R.KEELNAISGPNEFAEFYNR.L
	TK_050702_lung_E16_NE_2D_step05.4160.4160.2	1.2814	0.1976	2403.27	4	2110.0%	3	K.DIAFLEAQIYEYVEILGEQR.Q
UQ8R3E999.4%102429.4%2382737811.8(Q8R3E9) Similar to splicing factor, arginine/serine-rich 7 (35kD)
	TK_050702_lung_E16_NE_2D_step07.3359.3359.2	1.8238	0.1343	2382.43	5	2500.0%	4	R.NPPGFAFVEFEDPRDAEDAVR.G
	TK_050702_lung_E16_NE_2D_step05.2318.2318.2	1.3958	0.1315	1017.09	1	6430.0%	1	R.RPFDPNDR.C
	TK_050702_lung_E16_NE_2D_step01.2945.2945.1	0.9986	0.0045	1074.06	2	5620.0%	1	R.AFSYYGPLR.T
	TK_050702_lung_E16_NE_2D_step07.2904.2904.2	2.7816	0.5118	1246.16	1	7500.0%	1	R.VRVELSTGMPR.R
	TK_050702_lung_E16_NE_2D_step08.2394.2394.2	1.6169	0.409	1179.43	2	5620.0%	1	K.GHYAYDCHR.Y
	TK_050702_lung_E16_NE_2D_step01.2339.2339.1	1.7511	0.2858	1137.88	3	5000.0%	2	K.VYVGNLGTGAGK.G
UQ9CXY699.4%82822.1%390430625.3(Q9CXY6) 6230405A16Rik protein (Interleukin enhancer binding factor 2) (Similar to interleukin enhancer binding factor 2, 45kD)
	TK_050702_lung_E16_NE_2D_step01.4727.4727.3	2.0804	0.1251	3245.97	2	1960.0%	1	K.INNVIDNLIVAPGTFEVQIEEVRQVGSYK.K
	TK_050702_lung_E16_NE_2D_step04.3607.3607.2	2.815	0.5201	2255.84	1	4000.0%	1	K.RNQDLAPNSAEQASILSLVTK.I
	TK_050702_lung_E16_NE_2D_step04.3216.3216.2	2.127	0.3287	1735.93	1	4670.0%	5	R.VKPAPDETSFSEALLK.R
	TK_050702_lung_E16_NE_2D_step07.3851.3851.2	0.9079	0.0137	2093.7	272	1580.0%	1	K.ILPTLEAVAALGNKVVESLR.A
UQ8VCF499.4%7719.5%4765708810.8(Q8VCF4) Similar to hypothetical protein FLJ13213
	TK_050702_lung_E16_NE_2D_step07.2667.2667.2	1.6021	0.1937	1853.43	3	3000.0%	1	K.EWHGPPSQGPSYHDTR.R
*	TK_050702_lung_E16_NE_2D_step06.2492.2492.2	2.9344	0.5198	1785.35	1	5590.0%	1	R.AGAGMITQHSSTASPVNR.I
*	TK_050702_lung_E16_NE_2D_step04.2615.2615.2	1.9634	0.3107	1500.58	1	5830.0%	1	R.ETVPNPSRPTSWK.S
*	TK_050702_lung_E16_NE_2D_step05.2944.2944.2	2.4069	0.3538	1699.13	1	4640.0%	1	R.ARFPDTASVQSSFER.R
*	TK_050702_lung_E16_NE_2D_step03.3017.3017.1	1.0752	0.1132	921.94	35	5000.0%	1	R.FLDFSHR.E
*	TK_050702_lung_E16_NE_2D_step12.2143.2143.2	1.2466	0.0698	1640.75	2	3460.0%	1	R.TVILHDRPEVAHPR.H
*	TK_050702_lung_E16_NE_2D_step06.2811.2811.2	1.4319	0.1273	1042.97	3	5560.0%	1	R.GSSSGFKPFK.S
URBMS_MOUSE99.4%397.1%197217518.1(Q9WVB0) RNA-binding protein with multiple splicing (RBP-MS) (HEart, RRM Expressed Sequence) (Hermes)
	TK_050702_lung_E16_NE_2D_step05.3750.3750.2	1.2677	0.4145	1557.77	2	3460.0%	3	R.TLFVSGLPLDIKPR.E
UO3569199.4%444.7%725823486.9(O35691) Pinin
	TK_050702_lung_E16_NE_2D_step07.2467.2467.2	2.2998	0.4554	1316.8	1	5830.0%	1	K.KPALQSSVVATSK.E
	TK_050702_lung_E16_NE_2D_step04.2195.2195.2	1.1065	0.2336	1296.15	2	3500.0%	1	K.FKQESTVATER.Q
	TK_050702_lung_E16_NE_2D_step05.2847.2847.2	2.8485	0.2844	1249.21	1	7780.0%	1	R.RIEFAEQINK.M
UMCM7_MOUSE99.4%71310.8%719812116.4(Q61881) DNA replication licensing factor MCM7 (CDC47 homolog)
*	TK_050702_lung_E16_NE_2D_step08.4578.4578.1	0.5557	0.0118	1081.69	32	2140.0%	1	R.YIAMCHER.Q
*	TK_050702_lung_E16_NE_2D_step03.2333.2333.3	1.1749	0.2421	3017.57	179	700.0%	1	R.GFTPAQFQAALDEYEELNVWQVNTSR.T
*	TK_050702_lung_E16_NE_2D_step02.2593.2593.2	1.7512	0.426	1689.74	1	5000.0%	1	K.IQEHSDQVPVGNIPR.S
*	TK_050702_lung_E16_NE_2D_step07.4040.4040.2	1.6869	0.5535	2020.15	1	3060.0%	3	R.IAQPGDHVSVTGIFLPVLR.T
	TK_050702_lung_E16_NE_2D_step13.2817.2817.1	0.4804	0.0033	1262.37	6	1110.0%	1	K.DVLDVYIEHR.L
URL1X_MOUSE99.4%3312.5%1762073210.7(P11249) 60S ribosomal protein L18a
	TK_050702_lung_E16_NE_2D_step04.3107.3107.1	0.8167	0.0525	781.91	3	5000.0%	1	K.RPNTFF.-
	TK_050702_lung_E16_NE_2D_step08.2612.2612.2	1.0748	0.1236	1044.51	1	5000.0%	1	K.CHTPPLYR.M
	TK_050702_lung_E16_NE_2D_step07.2757.2757.1	1.9934	0.412	927.73	3	7140.0%	1	R.AHSIQIMK.V
UAC15_MOUSE99.4%334.1%11311259859.3(P35601) Activator 1 140 kDa subunit (Replication factor C large subunit) (A1 140 kDa subunit) (RF-C 140 kDa subunit) (Activator 1 large subunit) (A1-P145) (Differentiation specific element binding protein) (ISRE-binding protein)
*	TK_050702_lung_E16_NE_2D_step12.1213.1213.1	0.2242	0.0148	554.57	6	1250.0%	1	K.HGKGR.A
*	TK_050702_lung_E16_NE_2D_step10.2559.2559.2	0.9536	0.2475	1801.14	7	1670.0%	1	K.DDGSSFKAALLSGPPGVGK.T
*	TK_050702_lung_E16_NE_2D_step02.4168.4168.2	2.8892	0.5089	2409.36	1	3810.0%	1	K.GAENCLEGLTFVITGVLESIER.D
URS16_MOUSE99.4%5721.5%1441622510.2(P14131) 40S ribosomal protein S16
	TK_050702_lung_E16_NE_2D_step02.3109.3109.2	2.2378	0.5069	1189.51	1	6000.0%	2	K.GPLQSVQVFGR.K
	TK_050702_lung_E16_NE_2D_step07.2941.2941.1	0.9957	0.1385	1241.53	38	3180.0%	1	K.GGGHVAQIYAIR.Q
	TK_050702_lung_E16_NE_2D_step10.3072.3072.1	1.658	0.074	790.93	47	6430.0%	1	K.KFGGPGAR.A
UQ9CSM499.4%102632.9%851021110.6(Q9CSM4) 60S ribosomal protein L27 (Fragment)
	TK_050702_lung_E16_NE_2D_step01.2770.2770.1	2.0173	0.4022	1051.79	1	6250.0%	2	R.YSVDIPLDK.T
	TK_050702_lung_E16_NE_2D_step01.1811.1811.1	1.4863	0.2379	677.76	1	7500.0%	1	K.VTAAMGK.K
	TK_050702_lung_E16_NE_2D_step07.2945.2945.1	1.5469	0.2587	1409.71	1	5000.0%	2	K.VYNYNHLMPTR.Y
	TK_050702_lung_E16_NE_2D_step07.2116.2116.1	1.0455	0.1307	805.55	1	4290.0%	1	-.KVTAAMGK.K
UQ1542499.4%221.6%9151026405.5(Q15424) HSP27 ERE-TATA-binding protein (HET) (Scaffold attachment factor B)
*	TK_050702_lung_E16_NE_2D_step12.1895.1895.1	0.2375	0.0105	596.18	9	1250.0%	1	R.RPAVR.R
	TK_050702_lung_E16_NE_2D_step01.3162.3162.1	1.6906	0.4011	1162.13	1	6670.0%	1	K.ILDILGETCK.S
UO3585199.4%121413.8%13441519558.9(O35851) P160 myb-binding protein
*	TK_050702_lung_E16_NE_2D_step07.3873.3873.2	0.7769	0.1197	2382.51	2	1500.0%	1	K.IIPEISTYVGTFLEGCQDDPK.R
*	TK_050702_lung_E16_NE_2D_step11.2005.2005.1	0.4489	0.0074	723.39	4	2000.0%	1	R.HQDGHK.L
*	TK_050702_lung_E16_NE_2D_step05.2062.2062.2	2.6672	0.5019	1741.84	1	6330.0%	1	K.LQQSLQQGNHSSGSNR.L
*	TK_050702_lung_E16_NE_2D_step04.2861.2861.3	2.0334	0.068	2751.85	7	2040.0%	1	K.SEGTTPEKNAASQQDAVTEGAMPAATGK.D
*	TK_050702_lung_E16_NE_2D_step07.2925.2925.2	2.2365	0.5116	2127.67	1	5000.0%	1	R.YCHEVGPCAEALHAQVER.L
*	TK_050702_lung_E16_NE_2D_step07.3177.3177.2	1.1024	0.1576	2226.43	127	1390.0%	1	K.ATPQIPETKQHFSFPLDDR.N
*	TK_050702_lung_E16_NE_2D_step08.2780.2780.2	1.687	0.2974	1329.19	1	6500.0%	1	R.HQAQACLMLQK.T
*	TK_050702_lung_E16_NE_2D_step01.2134.2134.1	1.3708	0.1758	1331.14	4	3460.0%	1	K.ASTPSQVNGITGAK.S
*	TK_050702_lung_E16_NE_2D_step03.2696.2696.2	2.1234	0.478	1981.85	1	4440.0%	1	K.LSQVNGATPVSPIEPESKK.H
*	TK_050702_lung_E16_NE_2D_step08.4175.4175.2	1.8892	0.3323	2158.04	1	3750.0%	2	R.EFLDFFWDIAKPDQETR.L
*	TK_050702_lung_E16_NE_2D_step02.2120.2120.2	1.0522	0.2169	1552.84	1	3330.0%	1	K.SPAPSNPTLSPSTPAK.T
UO1518399.4%62613.2%167188209.0(O15183) P20-CGGBP
	TK_050702_lung_E16_NE_2D_step03.2492.2492.1	1.0621	0.1227	870.82	12	5000.0%	1	K.SAISDHLK.S
	TK_050702_lung_E16_NE_2D_step09.3320.3320.2	2.851	0.3703	1722.5	1	5770.0%	5	K.LFCTSCNVVLNHVR.K
UFBL5_MOUSE99.4%2213.6%448501934.7(Q9WVH9) Fibulin-5 precursor (FIBL-5) (Developmental arteries and neural crest EGF-like protein) (Dance)
*	TK_050702_lung_E16_NE_2D_step12.3063.3063.3	2.9835	0.5609	3959.66	1	2010.0%	1	R.GPYSNPYSTSYSGPYPAAAPPVPASNYPTISRPLVCR.F
*	TK_050702_lung_E16_NE_2D_step13.2970.2970.3	1.617	0.0365	2735.66	11	1850.0%	1	R.DIQLDLEMITVNTVINFRGSSVIR.L
UO1504299.4%222.2%10281181618.5(O15042) Hypothetical protein KIAA0332 (Fragment)
*	TK_050702_lung_E16_NE_2D_step04.2557.2557.2	1.3125	0.257	1177.31	10	3500.0%	1	K.NPNAPMLPPPK.N
*	TK_050702_lung_E16_NE_2D_step05.2643.2643.2	2.3717	0.4993	1402.52	1	7730.0%	1	R.TIQGHLQSENFK.Q
UQ9CYF399.4%357.9%403449019.4(Q9CYF3) 5730496N02Rik protein
*	TK_050702_lung_E16_NE_2D_step13.4969.4969.2	0.9783	0.0947	2036.5	3	3120.0%	1	R.ENQAFSFLYDPNSQGYR.Y
	TK_050702_lung_E16_NE_2D_step06.3369.3369.2	2.1638	0.3615	1814.21	1	4290.0%	2	K.MNMNILHQEELIAQK.K
UQ9CQF399.4%4429.5%227262408.8(Q9CQF3) 3110048P04Rik protein (RIKEN cDNA 3110048P04 gene)
	TK_050702_lung_E16_NE_2D_step05.2814.2814.2	3.0512	0.4735	1491.37	1	7270.0%	1	K.YIQQTKPLTLER.T
	TK_050702_lung_E16_NE_2D_step04.2044.2044.3	1.2416	0.3217	1728.37	15	1790.0%	1	R.LPHVLLLQLGTTFFK.L
	TK_050702_lung_E16_NE_2D_step06.0676.0676.3	0.6234	0.0871	3914.88	74	290.0%	1	K.LVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN.-
	TK_050702_lung_E16_NE_2D_step04.0729.0729.1	0.4285	0.0077	740.45	6	2500.0%	1	R.FQRMR.E
USFR1_HUMAN99.3%71125.1%2472761310.4(Q07955) Splicing factor, arginine/serine-rich 1 (pre-mRNA splicing factor SF2, P33 subunit) (Alternative splicing factor ASF-1)
*	TK_050702_lung_E16_NE_2D_step03.3821.3821.2	1.3234	0.2763	2542.4	1	2500.0%	1	R.GGPPFAFVEFEDPRDAEDAVYGR.D
*	TK_050702_lung_E16_NE_2D_step08.3383.3383.2	1.7499	0.3018	2209.19	1	3680.0%	1	R.VVVSGLPPSGSWQDLKDHMR.E
*	TK_050702_lung_E16_NE_2D_step01.3061.3061.2	2.6758	0.3433	1671.65	1	5330.0%	2	R.VVVSGLPPSGSWQDLK.D
*	TK_050702_lung_E16_NE_2D_step01.2965.2965.1	2.6031	0.2964	1031.14	1	7140.0%	2	K.DIEDVFYK.Y
*	TK_050702_lung_E16_NE_2D_step01.2917.2917.1	0.916	0.0189	1258.68	6	4000.0%	1	R.IYVGNLPPDIR.T
UCGB0_HUMAN99.3%3520.8%125145859.4(Q9Y3B4) Hypothetical protein CGI-110 (Protein HSPC175)
*	TK_050702_lung_E16_NE_2D_step03.2777.2777.2	2.9248	0.3806	1665.83	1	6540.0%	2	K.NACDHLSGFNVCNR.Y
*	TK_050702_lung_E16_NE_2D_step01.3499.3499.1	1.7403	0.3914	1417.95	1	5000.0%	1	K.ITAEEMYDIFGK.Y
UO8841199.3%446.3%798880649.1(O88411) Female sterile homeotic-related protein Frg-1
	TK_050702_lung_E16_NE_2D_step12.2935.2935.2	2.4518	0.492	2194.45	1	4090.0%	1	K.SLHSAGPPLLAVSAAPPAQPLAK.K
	TK_050702_lung_E16_NE_2D_step04.2587.2587.1	1.7377	0.2362	1027.85	1	6250.0%	1	K.HPMDLSTVK.R
	TK_050702_lung_E16_NE_2D_step08.2755.2755.1	1.5624	0.2041	935.74	12	5000.0%	1	R.VVHIIQAR.E
	TK_050702_lung_E16_NE_2D_step05.2660.2660.2	1.4529	0.1106	1244.83	9	4440.0%	1	R.VTNQLQYLHK.V
UQ9CZX899.3%7922.2%2122294010.8(Q9CZX8) Ribosomal protein S19
	TK_050702_lung_E16_NE_2D_step05.2462.2462.2	1.2609	0.0359	1546.01	4	3210.0%	1	R.HLYLRGGAGVGSMTK.I
	TK_050702_lung_E16_NE_2D_step01.2783.2783.1	1.7221	0.382	1073.07	1	6880.0%	1	K.VPEWVDTVK.L
	TK_050702_lung_E16_NE_2D_step07.3301.3301.2	2.2259	0.2734	1129.08	1	6110.0%	2	R.RVLQALEGLK.M
	TK_050702_lung_E16_NE_2D_step01.2993.2993.1	1.8855	0.2162	971.12	1	6880.0%	1	R.VLQALEGLK.M
	TK_050702_lung_E16_NE_2D_step08.2794.2794.1	1.2212	0.1149	701.81	20	7500.0%	1	R.HLYLR.G
	TK_050702_lung_E16_NE_2D_step01.3391.3391.2	2.7186	0.4461	1705.26	1	7500.0%	1	K.ELAPYDENWFYTR.A
UMCA1_MOUSE99.2%61223.2%310339978.4(P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)]
*	TK_050702_lung_E16_NE_2D_step02.2717.2717.2	0.889	0.0655	1359.36	20	3640.0%	1	R.LDLRIGCIVTAK.K
	TK_050702_lung_E16_NE_2D_step06.3376.3376.2	2.9378	0.4764	2023.09	1	3820.0%	3	R.TVVSGLVNHVPLEQMQNR.M
*	TK_050702_lung_E16_NE_2D_step10.3020.3020.2	1.1736	0.0451	2298.34	3	2500.0%	1	K.KHPDADSLYVEEVDVGEAAPR.T
*	TK_050702_lung_E16_NE_2D_step01.2551.2551.3	1.2481	0.0079	2548.82	17	2120.0%	1	K.KIWEQIQPDLHTNAECVATYK.G
UQ9CWL799.2%2213.5%244262639.9(Q9CWL7) 2410018M14Rik protein
*	TK_050702_lung_E16_NE_2D_step10.4299.4299.2	2.9332	0.4677	2633.71	1	3750.0%	1	R.SLIEKPPILGGSFNPITGTMLSGFR.L
	TK_050702_lung_E16_NE_2D_step11.2410.2410.1	1.0199	0.1534	963.85	9	3570.0%	1	R.LMHIQPPK.K
UQ9CQ5199.2%3910.3%330367216.2(Q9CQ51) DNA segment, Chr 16, Wayne state University 83, expressed
*	TK_050702_lung_E16_NE_2D_step08.3912.3912.3	1.4677	0.1107	3458.79	6	1060.0%	3	R.SQAASERPVAGQAGVLPCLELPSYAAACALVGSR.Y
UMAT3_HUMAN99.2%133111.0%847946236.3(P43243) Matrin 3
	TK_050702_lung_E16_NE_2D_step11.4766.4766.2	1.6173	0.2763	2038.73	1	3890.0%	4	R.VIHLSNLPHSGYSDSAVLK.L
	TK_050702_lung_E16_NE_2D_step11.2038.2038.2	1.3273	0.4192	1473.42	1	3640.0%	1	K.NTHCSSLPHYQK.L
*	TK_050702_lung_E16_NE_2D_step02.2119.2119.2	1.7136	0.4238	1325.5	1	4230.0%	1	R.GNLGAGNGNLQGPR.H
*	TK_050702_lung_E16_NE_2D_step05.2475.2475.2	2.1756	0.5198	1510.34	1	5420.0%	2	K.EWSQHINGASHSR.R
*	TK_050702_lung_E16_NE_2D_step02.4073.4073.2	3.1312	0.3899	2440.8	1	3250.0%	2	R.YQLLQLVEPFGVISNHLILNK.I
*	TK_050702_lung_E16_NE_2D_step06.3209.3209.3	1.9103	0.2525	1718.64	4	2310.0%	1	R.VETSRVVHIMDFQR.G
*	TK_050702_lung_E16_NE_2D_step06.3209.3209.2	2.0286	0.3253	1146.09	1	6880.0%	2	R.VVHIMDFQR.G
UQ9UQ3599.2%553.9%275229967612.1(Q9UQ35) RNA binding protein
	TK_050702_lung_E16_NE_2D_step07.0547.0547.1	0.2366	0.0035	670.2	4	1000.0%	1	R.TPLGQR.S
*	TK_050702_lung_E16_NE_2D_step02.2843.2843.2	2.84	0.4855	1415.79	1	6070.0%	1	R.IPAASAAAMNLASAR.T
	TK_050702_lung_E16_NE_2D_step05.4102.4102.3	1.7459	0.0043	4111.63	7	1350.0%	1	R.NSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMK.E
	TK_050702_lung_E16_NE_2D_step10.3490.3490.3	1.7722	0.0788	2276.86	8	2120.0%	1	R.SDTSSPEVRQSHSESPSLQSK.S
*	TK_050702_lung_E16_NE_2D_step03.3377.3377.2	1.839	0.2999	2561.55	1	2500.0%	1	R.TPAALAALSLTGSGTPPTAANYPSSSR.T
URL7A_MOUSE99.2%5716.6%2652984510.6(P12970) 60S ribosomal protein L7a (Surfeit locus protein 3)
	TK_050702_lung_E16_NE_2D_step02.2173.2173.1	1.4128	0.426	851.68	1	5620.0%	1	K.VAPAPAVVK.K
	TK_050702_lung_E16_NE_2D_step04.2623.2623.2	2.1839	0.2995	1831.13	1	5670.0%	1	R.KTCTTVAFTQVNSEDK.G
	TK_050702_lung_E16_NE_2D_step06.3148.3148.1	2.0277	0.209	1073.85	2	5000.0%	1	K.KVVNPLFEK.R
	TK_050702_lung_E16_NE_2D_step09.3034.3034.1	1.5038	0.3667	1064.92	1	5000.0%	2	R.HWGGNVLGPK.S
UCBX5_MOUSE99.2%6820.9%191221865.9(Q61686) Chromobox protein homolog 5 (Heterochromatin protein 1 homolog alpha) (HP1 alpha)
	TK_050702_lung_E16_NE_2D_step05.2940.2940.1	1.2637	0.0634	950.82	7	5710.0%	1	K.GQVEYLLK.W
	TK_050702_lung_E16_NE_2D_step01.3663.3663.1	2.322	0.3623	1598.02	1	5420.0%	2	K.NLDCPELISEFMK.K
	TK_050702_lung_E16_NE_2D_step02.2747.2747.1	0.4838	0.0083	435.68	6	3330.0%	1	K.ESAK.S
	TK_050702_lung_E16_NE_2D_step05.2932.2932.2	1.97	0.4178	1832.18	1	5000.0%	1	R.LTWHAYPEDAENKEK.E
UQ8VEC999.1%4419.0%1952112710.9(Q8VEC9) Similar to hypothetical protein FLJ20085
*	TK_050702_lung_E16_NE_2D_step07.2856.2856.2	1.5157	0.1935	1201.85	1	5000.0%	1	R.GVLHTFSQSPK.L
	TK_050702_lung_E16_NE_2D_step09.3593.3593.2	2.7518	0.4897	1984.81	1	3950.0%	1	K.TPLSTGGTLAFVSPSLAVHK.T
	TK_050702_lung_E16_NE_2D_step08.2544.2544.1	1.2757	0.0732	740.64	1	7000.0%	1	K.QVIKPR.R
UO5518199.1%3310.4%280318898.4(O55181) RBP associated molecule RAM14-1
*	TK_050702_lung_E16_NE_2D_step06.3081.3081.1	1.1528	0.227	1490.39	38	2080.0%	1	K.CLHPLASETFVSK.D
	TK_050702_lung_E16_NE_2D_step11.3391.3391.2	0.761	0.0597	1802.41	28	1330.0%	1	K.GCFKAIVAGDQNVEYK.G
UTF1B_MOUSE99.1%577.7%834888475.8(Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1)
	TK_050702_lung_E16_NE_2D_step08.3203.3203.1	0.9693	0.0563	871.86	7	5000.0%	1	R.KLLASLVK.R
*	TK_050702_lung_E16_NE_2D_step11.2161.2161.2	2.7225	0.4834	2009.03	1	6050.0%	2	K.IVAERPGTNSTGPGPMAPPR.A
	TK_050702_lung_E16_NE_2D_step12.1803.1803.3	1.5986	0.2478	1851.23	1	2500.0%	1	K.EEDGSLSLDGADSTGVVAK.L
	TK_050702_lung_E16_NE_2D_step02.3409.3409.2	2.4871	0.3765	2139.25	1	4060.0%	1	K.HEPLVLFCESCDTLTCR.D
UQ9Z2X199.1%114.1%415457305.5(Q9Z2X1) Ribonucleoprotein F
	TK_050702_lung_E16_NE_2D_step02.3749.3749.2	2.6755	0.4722	1869.77	1	5940.0%	1	K.ITGEAFVQFASQELAEK.A
UACF7_MOUSE99.1%16184.9%53276079845.5(Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF)
	TK_050702_lung_E16_NE_2D_step01.3038.3038.3	1.1387	0.0593	3462.02	147	1250.0%	1	K.QTVEAYSAAVQSQLQWMKQLCLCVEQHVK.E
	TK_050702_lung_E16_NE_2D_step04.2168.2168.2	2.7052	0.488	2643.4	1	3080.0%	2	R.SSSSASQSNHSCTSMPSSPATPASGTK.V
*	TK_050702_lung_E16_NE_2D_step13.3025.3025.3	1.2337	0.1011	2667.82	28	1430.0%	1	K.MSQNFHTSYVETLGKLETQYCK.L
*	TK_050702_lung_E16_NE_2D_step07.2827.2827.3	0.9525	0.058	3202.57	178	770.0%	1	R.EQQLQSTLQQAQGFHSEIEDFLLELNR.M
	TK_050702_lung_E16_NE_2D_step06.2393.2393.1	0.5848	0.0	682.66	7	2500.0%	1	K.EFMKK.V
*	TK_050702_lung_E16_NE_2D_step03.4854.4854.2	1.4761	0.0946	2817.75	9	2000.0%	1	K.GHFSSLELVPPSTLTTTHLKAEPLNK.T
	TK_050702_lung_E16_NE_2D_step03.4765.4765.3	1.1351	0.1895	3222.73	6	1020.0%	1	R.AASPTRSSSSASQSNHSCTSMPSSPATPASGTK.V
*	TK_050702_lung_E16_NE_2D_step04.2551.2551.3	1.4567	0.0544	2044.03	8	2240.0%	1	K.AIGQRLSGQSAISTQPEAVK.Q
*	TK_050702_lung_E16_NE_2D_step11.2606.2606.3	1.3163	0.0551	3451.29	13	1380.0%	1	R.SDLGQLDNEIKEAQTLCQELSLLIGEQYLK.D
	TK_050702_lung_E16_NE_2D_step01.0817.0817.1	0.8447	0.0943	532.18	2	5000.0%	1	K.LSVSK.Q
	TK_050702_lung_E16_NE_2D_step04.2348.2348.2	1.0701	0.0129	1705.59	5	3330.0%	1	K.EQLIQSKSSVASLVGR.S
	TK_050702_lung_E16_NE_2D_step02.0574.0574.1	0.6859	0.1509	1309.07	46	1360.0%	1	K.TETVKAQAESNK.A
	TK_050702_lung_E16_NE_2D_step03.2962.2962.2	1.0477	0.033	1434.12	10	3640.0%	1	R.ENLEQAFEVAER.L
*	TK_050702_lung_E16_NE_2D_step07.3685.3685.2	0.9823	0.0364	2055.92	12	2060.0%	1	R.GEIFSTCGEEQKAVLQEK.T
	TK_050702_lung_E16_NE_2D_step01.0930.0930.1	0.9955	0.1107	560.81	5	6250.0%	1	R.QLATK.F
UH1X_HUMAN99.1%359.9%2132248710.8(Q92522) Histone H1x
*	TK_050702_lung_E16_NE_2D_step03.3064.3064.2	1.6631	0.0504	2163.92	1	3000.0%	1	K.ALVQNDTLLQVKGTGANGSFK.L
*	TK_050702_lung_E16_NE_2D_step01.2931.2931.1	2.1718	0.1264	1343.35	3	5450.0%	2	K.ALVQNDTLLQVK.G
UO7049599.1%81410.1%89710116711.9(O70495) Plenty-of-prolines-101
	TK_050702_lung_E16_NE_2D_step05.3602.3602.2	2.5241	0.3469	1443.35	1	6820.0%	3	K.VNLEVIKPWITK.R
	TK_050702_lung_E16_NE_2D_step04.2552.2552.1	0.9936	0.0366	1220.78	29	3500.0%	1	K.RESPSPAPKPR.K
	TK_050702_lung_E16_NE_2D_step02.1872.1872.1	0.151	0.0	588.07	1	1250.0%	1	K.GTEKR.E
*	TK_050702_lung_E16_NE_2D_step07.3343.3343.3	1.7732	0.0482	3568.64	1	1360.0%	1	R.SVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPAK.K
	TK_050702_lung_E16_NE_2D_step11.4582.4582.3	1.425	0.1443	3237.91	18	1480.0%	1	R.VTEILGFEDDVVIEFIFNQLEVKNPDSK.M
UQ99KP699.1%6616.3%504552396.6(Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV)
	TK_050702_lung_E16_NE_2D_step01.2761.2761.2	2.1556	0.3666	1599.02	2	4620.0%	1	K.TVPEELVKPEELSK.Y
	TK_050702_lung_E16_NE_2D_step07.3495.3495.3	1.1757	0.1294	3917.71	14	1360.0%	1	R.VLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIK.I
	TK_050702_lung_E16_NE_2D_step05.2684.2684.2	2.1422	0.3428	1800.46	1	6430.0%	1	R.QELSHALYQHDAACR.V
	TK_050702_lung_E16_NE_2D_step01.1995.1995.1	1.1211	0.0843	776.12	7	5710.0%	1	K.ILTGGADK.N
	TK_050702_lung_E16_NE_2D_step12.1743.1743.2	0.4434	0.0075	1000.32	22	1880.0%	1	K.FIASTGMDR.S
UU5S1_MOUSE99.1%463.2%9711093615.0(O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa)
	TK_050702_lung_E16_NE_2D_step07.2619.2619.2	1.5158	0.4082	1307.66	2	4580.0%	1	R.VLSGTIHAGQPVK.V
	TK_050702_lung_E16_NE_2D_step05.3192.3192.2	2.7234	0.4319	1896.59	1	4710.0%	2	R.GHVTQDAPIPGSPLYTIK.A
UPAB1_MOUSE99.1%448.0%636706439.5(P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1)
	TK_050702_lung_E16_NE_2D_step08.2515.2515.1	1.1691	0.185	705.71	9	6000.0%	1	R.KVFVGR.F
	TK_050702_lung_E16_NE_2D_step11.3030.3030.2	0.541	0.1723	2005.84	1	1390.0%	1	K.VDEAVAVLQAHQAKEAAQK.A
	TK_050702_lung_E16_NE_2D_step08.3112.3112.2	2.3962	0.4798	1695.56	1	5330.0%	1	R.SKVDEAVAVLQAHQAK.E
	TK_050702_lung_E16_NE_2D_step11.4139.4139.2	1.0901	0.1052	2742.85	10	1740.0%	1	K.ITGMLLEIDNSELLHMLESPESLR.S
UCYPH_MOUSE99.1%91746.0%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18)
*	TK_050702_lung_E16_NE_2D_step01.3811.3811.2	1.3501	0.1388	2006.45	1	3530.0%	1	-.VNPTVFFDITADDEPLGR.V
	TK_050702_lung_E16_NE_2D_step09.3660.3660.3	2.1735	0.0565	2793.98	1	2210.0%	1	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
	TK_050702_lung_E16_NE_2D_step07.2651.2651.1	1.5208	0.3924	688.79	1	7000.0%	2	K.HVVFGK.V
	TK_050702_lung_E16_NE_2D_step03.3453.3453.2	1.5736	0.1918	1833.67	1	4640.0%	1	R.SIYGEKFEDENFILK.H
	TK_050702_lung_E16_NE_2D_step01.3339.3339.1	1.6016	0.2289	1056.9	2	6250.0%	1	R.VSFELFADK.V
UG3BP_MOUSE99.1%81421.5%465518295.6(P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1)
	TK_050702_lung_E16_NE_2D_step05.3822.3822.2	1.1785	0.4075	2497.05	1	2270.0%	1	R.INSGGKLPNFGFVVFDDSEPVQK.V
*	TK_050702_lung_E16_NE_2D_step10.0004.0004.2	2.3014	0.4889	1869.45	1	4440.0%	3	K.NLPPSGAVPVTGTPPHVVK.V
	TK_050702_lung_E16_NE_2D_step01.2830.2830.2	1.1078	0.0315	1989.06	6	3120.0%	1	-.MVMEKPSPLLVGREFVR.Q
	TK_050702_lung_E16_NE_2D_step12.0589.0589.1	0.7844	0.0097	543.44	5	4000.0%	1	R.GPGGPR.G
	TK_050702_lung_E16_NE_2D_step06.2444.2444.2	1.8607	0.2537	1467.84	1	5450.0%	1	K.VMSQNFTNCHTK.I
*	TK_050702_lung_E16_NE_2D_step04.2543.2543.2	2.2754	0.4344	2337.14	1	3410.0%	1	K.NSSYAHGGLDSNGKPADAVYGQK.E
UQ9CSK899.1%392.6%265301095.4(Q9CSK8) 1810019E15Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step11.3241.3241.1	1.7965	0.3631	892.62	1	6670.0%	3	R.IHFFLSK.K
UPDA3_MOUSE99.1%121826.4%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57)
*	TK_050702_lung_E16_NE_2D_step09.3745.3745.2	0.7991	0.0121	2283.01	17	2220.0%	2	K.KFIQDSIFGLCPHMTEDNK.D
	TK_050702_lung_E16_NE_2D_step03.2752.2752.1	1.8772	0.3695	1041.75	1	5560.0%	2	R.TADGIVSHLK.K
*	TK_050702_lung_E16_NE_2D_step10.3932.3932.2	0.9706	0.0030	2018.28	143	2060.0%	1	K.IVPLAKVDCTANTNTCNK.Y
*	TK_050702_lung_E16_NE_2D_step08.3583.3583.2	0.6489	6.0E-4	1818.27	88	1430.0%	1	K.ALEQFLQEYFDGNLK.R
*	TK_050702_lung_E16_NE_2D_step09.3345.3345.3	1.5663	0.016	2374.73	113	2120.0%	1	K.DASVVGFFRDLFSDGHSEFLK.A
*	TK_050702_lung_E16_NE_2D_step02.2133.2133.3	1.0416	0.037	2264.79	46	1250.0%	1	K.DLIQGKDLLTAYYDVDYEK.N
*	TK_050702_lung_E16_NE_2D_step07.3663.3663.2	1.8257	0.3887	2303.61	1	2630.0%	2	K.EYDDNGEGITIFRPLHLANK.F
*	TK_050702_lung_E16_NE_2D_step06.3173.3173.2	1.8871	0.4194	1260.36	1	7000.0%	1	R.FAHTNIESLVK.E
UO3572999.0%6624.5%339378336.8(O35729) Polycomb-M33 interacting protein Ring1B (Fragment)
	TK_050702_lung_E16_NE_2D_step04.2513.2513.2	2.6815	0.4541	1794.43	1	5000.0%	1	K.IYPSRDEYEAHQER.V
	TK_050702_lung_E16_NE_2D_step01.2443.2443.1	1.1076	0.0137	575.41	1	7500.0%	1	K.KLVSK.R
	TK_050702_lung_E16_NE_2D_step13.3443.3443.1	0.2434	0.0	1444.27	7	450.0%	1	K.YLAVRLALEELR.S
	TK_050702_lung_E16_NE_2D_step08.2966.2966.2	2.2679	0.3812	1806.02	1	5000.0%	1	K.HNNQQALSHSIEEGLK.I
*	TK_050702_lung_E16_NE_2D_step06.3491.3491.3	1.147	0.0534	2633.83	7	2260.0%	1	K.YWKVNKPMELYYAPFTASGNVR.-
	TK_050702_lung_E16_NE_2D_step04.3269.3269.2	3.0323	0.4468	1573.74	1	6150.0%	1	R.SLRPDPNFDALISK.I
URS20_HUMAN98.9%3336.1%119133739.9(P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20
	TK_050702_lung_E16_NE_2D_step03.4240.4240.3	1.3641	0.0233	3404.86	4	1450.0%	1	R.LIDLHSPSEIVKQITSISIEPGVEVEVTIADA.-
	TK_050702_lung_E16_NE_2D_step04.2581.2581.2	2.8911	0.4535	1250.46	1	8500.0%	1	K.TPVEPEVAIHR.I
UQ9JIY298.9%4105.5%491544448.5(Q9JIY2) E-cadherin binding protein E7
*	TK_050702_lung_E16_NE_2D_step04.2985.2985.2	2.8319	0.3972	2137.65	1	4740.0%	3	R.ASLENVHPPIAPPPTDIPDR.F
	TK_050702_lung_E16_NE_2D_step12.1423.1423.1	0.5767	0.0188	924.03	5	2500.0%	1	K.RTYLSQR.D
URL2B_HUMAN98.9%395.8%1561769510.4(P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a
	TK_050702_lung_E16_NE_2D_step03.2862.2862.1	2.5598	0.2758	1066.71	1	7500.0%	3	K.KLYDIDVAK.V
UTIAR_HUMAN98.8%395.3%375415917.8(Q01085) Nucleolysin TIAR (TIA-1 related protein)
	TK_050702_lung_E16_NE_2D_step07.3619.3619.2	1.2587	0.1313	2577.23	1	2890.0%	3	K.MITEHTSNDPYCFVEFYEHR.D
UTR2A_HUMAN98.8%117.4%2823268911.3(Q13595) Transformer-2 protein homolog (TRA-2 alpha)
*	TK_050702_lung_E16_NE_2D_step02.3748.3748.2	2.23	0.4874	2326.21	1	4750.0%	1	R.ANPDPNTCLGVFGLSLYTTER.D
UQ9D6F998.8%2210.8%444495284.9(Q9D6F9) Tubulin, beta 4
	TK_050702_lung_E16_NE_2D_step05.3642.3642.3	1.4286	0.0655	3415.92	1	1830.0%	1	R.INVYYNEATGGNYVPRAVLVDLEPGTMDSVR.S
	TK_050702_lung_E16_NE_2D_step04.2624.2624.2	2.6167	0.4631	1824.43	1	5310.0%	1	R.EIVHLQAGQCGNQIGAK.F
UTBBX_HUMAN98.8%5711.7%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain
	TK_050702_lung_E16_NE_2D_step10.4090.4090.2	1.3386	0.1211	2800.48	2	2200.0%	1	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK_050702_lung_E16_NE_2D_step04.2624.2624.2	2.6167	0.4631	1824.43	1	5310.0%	1	R.EIVHIQAGQCGNQIGAK.F
	TK_050702_lung_E16_NE_2D_step07.2190.2190.2	0.748	0.0623	1029.33	29	3750.0%	1	K.TAVCDIPPR.G
UQ9H7S098.7%462.0%18112071916.5(Q9H7S0) Hypothetical protein FLJ14329
*	TK_050702_lung_E16_NE_2D_step09.4234.4234.2	1.528	0.3513	2293.51	2	3680.0%	1	R.QVLDLEDLVFTQGSHFMANK.R
*	TK_050702_lung_E16_NE_2D_step08.3430.3430.2	1.6835	0.1089	1936.13	1	5000.0%	2	K.FLYQLHETEKEDLIR.E
*	TK_050702_lung_E16_NE_2D_step12.3824.3824.2	1.1358	0.3012	2449.37	6	1500.0%	1	R.QVLDLEDLVFTQGSHFMANKR.C
UDDX5_MOUSE98.6%557.8%614693208.9(Q61656) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5) (DEAD-box RNA helicase DEAD1) (mDEAD1)
	TK_050702_lung_E16_NE_2D_step09.3153.3153.1	0.6279	0.1099	1086.17	12	1880.0%	1	K.GPQIRDLER.G
	TK_050702_lung_E16_NE_2D_step01.2989.2989.2	2.3496	0.4734	1794.31	1	5710.0%	1	R.ELAQQVQQVAAEYCR.A
	TK_050702_lung_E16_NE_2D_step01.3337.3337.1	1.8782	0.3387	1050.83	2	6430.0%	1	R.DWVLNEFK.H
	TK_050702_lung_E16_NE_2D_step01.3090.3090.1	1.8267	0.1368	1016.31	1	7860.0%	1	K.WNLDELPK.F
	TK_050702_lung_E16_NE_2D_step01.2899.2899.1	1.6266	0.2057	985.92	1	6430.0%	1	K.LLQLVEDR.G
UDD21_MOUSE98.6%172515.3%851935829.1(Q9JIK5) Nucleolar RNA helicase II (Nucleolar RNA helicase Gu) (RH II/Gu) (DEAD-box protein 21)
*	TK_050702_lung_E16_NE_2D_step05.0122.0122.2	1.552	0.3217	2110.51	1	3610.0%	1	K.LKNGLSQPSEEEVDIPKPK.K
	TK_050702_lung_E16_NE_2D_step12.1931.1931.2	1.1508	0.2549	1077.01	6	4380.0%	1	K.TFHHVYSGK.D
*	TK_050702_lung_E16_NE_2D_step04.2696.2696.2	2.5777	0.29	2082.17	1	4170.0%	1	K.LKNGLSQPSEEEADIPKPK.K
	TK_050702_lung_E16_NE_2D_step02.3011.3011.2	2.2977	0.224	1165.93	1	6000.0%	1	R.APQVLVLAPTR.E
*	TK_050702_lung_E16_NE_2D_step08.3324.3324.2	2.3706	0.4568	2104.54	1	5000.0%	2	K.KLSVACFYGGTPYGGQIER.M
*	TK_050702_lung_E16_NE_2D_step13.3641.3641.2	1.2658	0.1067	2291.5	2	2890.0%	1	R.GVNFLFPIQAKTFHHVYSGK.D
	TK_050702_lung_E16_NE_2D_step11.2794.2794.2	0.9579	0.2274	1378.75	7	2920.0%	1	R.GRAPQVLVLAPTR.E
	TK_050702_lung_E16_NE_2D_step04.3239.3239.2	2.0594	0.282	1526.99	1	5770.0%	3	R.LLDSVPPTAISHFK.Q
*	TK_050702_lung_E16_NE_2D_step10.3008.3008.2	0.826	0.0177	1870.48	10	2500.0%	1	K.NGLSQPSEEEVDIPKPK.K
	TK_050702_lung_E16_NE_2D_step01.3867.3867.1	1.5917	0.2238	1267.17	1	6000.0%	1	K.TFSFAIPLIEK.L
	TK_050702_lung_E16_NE_2D_step04.2815.2815.2	1.1625	0.0115	1504.39	15	3210.0%	1	R.IGVPSATEIIKASSK.D
UO8832398.6%81010.0%15601655188.8(O88323) Peroxisome proliferator-activated receptor gamma binding protein
*	TK_050702_lung_E16_NE_2D_step05.0755.0755.2	0.6014	0.1377	2486.95	82	680.0%	1	K.WTPSFSAVTSANSVDLPACSFLK.F
	TK_050702_lung_E16_NE_2D_step13.3227.3227.3	1.3354	0.1719	2716.49	150	1060.0%	1	K.ADTEGKSPSHSSSNRPFTPPTSTGGSK.S
	TK_050702_lung_E16_NE_2D_step11.2243.2243.2	1.2136	0.0376	1593.29	18	2330.0%	1	K.LASPMKPVPGTPPSSK.A
	TK_050702_lung_E16_NE_2D_step07.2809.2809.2	2.0674	0.3779	2226.37	1	3810.0%	2	K.VTLQKPGESGGDGLRPQIASSK.N
	TK_050702_lung_E16_NE_2D_step01.3111.3111.1	1.4546	0.1188	1320.93	182	3330.0%	1	K.NYGSPLISGSTPK.H
	TK_050702_lung_E16_NE_2D_step04.2193.2193.3	2.5109	0.4594	3278.91	1	2270.0%	1	K.TPPASNSCTPSSSSFSSSGSSMSSSQNQHGSSK.G
	TK_050702_lung_E16_NE_2D_step04.2216.2216.2	3.0041	0.4395	2012.32	1	4520.0%	1	K.SPISSGSSGSHVSGTSSSSGMK.S
UQ9D11598.6%1115.8%76849810.0(Q9D115) 3110006P09Rik protein
	TK_050702_lung_E16_NE_2D_step01.2973.2973.1	2.0087	0.3424	1251.8	1	5450.0%	1	K.TPLPPELADVQA.-
UG3P1_HUMAN98.6%226.3%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12)
*	TK_050702_lung_E16_NE_2D_step01.2334.2334.1	1.7453	0.3393	1369.99	1	5000.0%	1	R.GAAQNLIPASTGAAK.A
	TK_050702_lung_E16_NE_2D_step11.1869.1869.1	0.245	0.0	690.13	2	2000.0%	1	K.FHGTVK.A
UNO56_MOUSE98.5%4104.8%580644499.1(Q9D6Z1) Nucleolar protein Nop56 (Nucleolar protein 5A)
*	TK_050702_lung_E16_NE_2D_step04.0096.0096.2	2.6286	0.4488	1882.51	1	4380.0%	3	K.LKPQENGMEDPPVSLPK.S
*	TK_050702_lung_E16_NE_2D_step05.3427.3427.2	1.5329	0.298	1306.21	1	5500.0%	1	R.LLLETYLPSKK.K
URS11_HUMAN98.5%51125.3%1581843110.3(P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11
	TK_050702_lung_E16_NE_2D_step01.3182.3182.2	1.4857	0.3992	1987.32	2	3530.0%	1	R.DVQIGDIVTVGECRPLSK.T
	TK_050702_lung_E16_NE_2D_step08.3147.3147.2	2.2099	0.4913	1349.35	1	6500.0%	3	K.NMSVHLSPCFR.D
	TK_050702_lung_E16_NE_2D_step08.2828.2828.2	1.4147	0.1938	1279.92	1	5500.0%	1	K.KCPFTGNVSIR.G
URS29_HUMAN98.5%1120.0%55654610.1(P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29
	TK_050702_lung_E16_NE_2D_step12.2351.2351.2	2.2693	0.4684	1409.84	1	6500.0%	1	-.GHQQLYWSHPR.K
URS26_HUMAN98.5%41613.0%1151301511.0(P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26
	TK_050702_lung_E16_NE_2D_step13.5354.5354.2	2.8593	0.4328	1591.14	1	6070.0%	4	R.FRPAGAAPRPPPKPM.-
UQ99JM098.4%223.7%829940215.2(Q99JM0) Hypothetical 94.0 kDa protein (Fragment)
	TK_050702_lung_E16_NE_2D_step06.3067.3067.2	2.465	0.4581	1886.49	1	5670.0%	1	R.FAEVECLAESHQHLSK.E
	TK_050702_lung_E16_NE_2D_step07.2587.2587.2	1.2173	0.0846	1567.64	84	2860.0%	1	K.ESMAGNKPANAVLHK.V
UO7056598.4%359.8%295329364.8(O70565) Cp27 protein
	TK_050702_lung_E16_NE_2D_step07.0084.0084.2	2.2613	0.3219	2064.13	1	3750.0%	2	R.EKPQALVTSPATPLPAGSGIK.R
	TK_050702_lung_E16_NE_2D_step05.2311.2311.1	0.5778	0.0018	963.7	3	2140.0%	1	K.QKMSTLEK.S
UNPM3_MOUSE98.4%3912.0%175190234.8(Q9CPP0) Nucleoplasmin 3
	TK_050702_lung_E16_NE_2D_step10.4116.4116.2	1.4346	0.4169	2358.4	1	2500.0%	3	R.VPAPVTMDSFFFGCELSGHTR.S
UQ9QYF498.3%5514.6%561625447.6(Q9QYF4) SYNCRIP protein
	TK_050702_lung_E16_NE_2D_step07.2335.2335.3	1.193	0.1279	1943.01	132	1880.0%	1	K.VTEGLTDVILYHQPDDK.K
	TK_050702_lung_E16_NE_2D_step02.3528.3528.2	1.0935	0.0339	2015.51	1	3530.0%	1	K.LDEIYVAGLVAHSDLDER.A
	TK_050702_lung_E16_NE_2D_step01.4101.4101.1	2.4962	0.275	1595.01	1	6250.0%	1	R.DLFEDELVPLFEK.A
	TK_050702_lung_E16_NE_2D_step06.3253.3253.3	2.7359	0.435	2698.05	1	3000.0%	1	R.KYGGPPPDSVYSGQQPSVGTEIFVGK.I
	TK_050702_lung_E16_NE_2D_step05.2408.2408.2	1.5976	0.3006	1059.78	2	6430.0%	1	K.LYNNHEIR.S
UQ9UDV198.2%2213.9%144170008.8(Q9UDV1) WUGSC:H_DJ0900K19.2 protein
*	TK_050702_lung_E16_NE_2D_step03.3892.3892.2	1.5443	0.2313	2295.95	1	3160.0%	1	R.KAPPDGWELIEPTLDELDQK.M
*	TK_050702_lung_E16_NE_2D_step01.3853.3853.2	3.0317	0.4081	2167.24	1	5000.0%	1	K.APPDGWELIEPTLDELDQK.M
UDD17_HUMAN98.2%121614.3%650723728.6(Q92841) Probable RNA-dependent helicase p72 (DEAD-box protein p72) (DEAD-box protein 17)
*	TK_050702_lung_E16_NE_2D_step12.4319.4319.2	1.9609	0.4633	2363.28	1	4210.0%	2	K.TLAYLLPAIVHINHQPYLER.G
*	TK_050702_lung_E16_NE_2D_step01.1046.1046.1	0.6812	0.1468	616.03	3	3750.0%	1	K.SQPER.D
*	TK_050702_lung_E16_NE_2D_step04.2801.2801.1	1.2327	0.0154	1013.57	19	5000.0%	2	K.LMQLVDHR.G
*	TK_050702_lung_E16_NE_2D_step01.2849.2849.2	1.5569	0.1228	1695.17	1	4640.0%	1	R.ELAQQVQQVADDYGK.C
	TK_050702_lung_E16_NE_2D_step08.4783.4783.2	0.7616	0.1849	2273.54	52	1390.0%	1	R.TTSSANNPNLMYQDECDRR.L
*	TK_050702_lung_E16_NE_2D_step04.3187.3187.2	1.7261	0.1112	1116.65	2	7500.0%	1	K.KWDLSELPK.F
*	TK_050702_lung_E16_NE_2D_step05.4784.4784.1	0.5165	0.0209	685.51	17	2860.0%	1	R.GGGGLPPK.K
*	TK_050702_lung_E16_NE_2D_step01.3242.3242.1	1.7365	0.3251	1023.05	1	6880.0%	1	R.LIDFLESGK.T
UQ9CSW798.1%6817.5%338382409.3(Q9CSW7) 2610101N10Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step06.3053.3053.2	1.0242	0.0013	1501.18	1	3750.0%	1	R.FGPLASVKIMWPR.T
	TK_050702_lung_E16_NE_2D_step12.1539.1539.1	0.4813	0.0055	848.91	5	1670.0%	1	K.IYKPSSR.F
	TK_050702_lung_E16_NE_2D_step05.3206.3206.3	1.5453	0.2044	2223.14	4	2240.0%	1	K.NPPNQSSNERPPSLLVIETK.K
	TK_050702_lung_E16_NE_2D_step05.2896.2896.2	1.6703	0.2219	2239.12	1	3890.0%	1	R.ESLCDSPHQNLSRPLLENK.L
UO8857498.0%245.5%220232319.1(O88574) SIN3-associated protein (Cyclin-dependent kinase 2)
*	TK_050702_lung_E16_NE_2D_step05.3330.3330.2	3.0617	0.2447	1402.56	1	7730.0%	2	K.AQLVEIVGCHFK.S
UATF7_HUMAN98.0%4104.5%494529678.6(P17544) Cyclic-AMP-dependent transcription factor ATF-7 (Activating transcription factor 7) (Transcription factor ATF-A)
	TK_050702_lung_E16_NE_2D_step04.3156.3156.2	2.9278	0.409	2400.89	1	3570.0%	3	R.TELSMPIQSHVIMTPQSQSAGR.-
UDP30_MOUSE97.9%2236.4%99112134.9(Q99LT0) Dpy-30-like protein
	TK_050702_lung_E16_NE_2D_step03.4040.4040.3	1.4355	0.0113	3996.6	22	1290.0%	1	R.AYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLK.N
	TK_050702_lung_E16_NE_2D_step11.4190.4190.2	2.1932	0.5367	1887.91	1	4670.0%	1	K.ERPPNPIEFLASYLLK.N
UQ922Q897.9%114.2%307348779.5(Q922Q8) Similar to hypothetical protein PRO1855
*	TK_050702_lung_E16_NE_2D_step07.3555.3555.2	2.9045	0.4293	1564.35	1	7500.0%	1	R.LVNLQHLDLLNNR.L
UEBP2_MOUSE97.9%226.5%3063470310.1(Q9D903) Probable rRNA processing protein EBP2
	TK_050702_lung_E16_NE_2D_step05.3134.3134.2	2.9036	0.4055	1330.37	1	7000.0%	1	K.RPTDYFAEMAK.S
*	TK_050702_lung_E16_NE_2D_step08.2634.2634.1	1.7446	0.31	1063.86	1	6880.0%	1	R.LHQLQVPTK.R
UEF2_MOUSE97.9%131092.8%857951836.8(P58252) Elongation factor 2 (EF-2)
	TK_050702_lung_E16_NE_2D_step09.4012.4012.2	2.1702	0.5011	2235.18	1	3950.0%	3	R.KIWCFGPDGTGPNILTDITK.G
	TK_050702_lung_E16_NE_2D_step08.0400.0400.1	0.2401	0.0103	447.4	3	1670.0%	10	K.SPNK.H
UQ9CYA697.8%61815.0%468504504.7(Q9CYA6) 5730565F05Rik protein
	TK_050702_lung_E16_NE_2D_step13.4585.4585.2	1.3004	0.1665	2334.77	1	2890.0%	1	K.LVNYPGFNISTPRGIPDEWR.M
	TK_050702_lung_E16_NE_2D_step04.3865.3865.3	1.1391	0.0222	3271.76	21	920.0%	1	K.AFQFQPPLPPGTPPPLPQGTPPPLFTPPLPK.G
	TK_050702_lung_E16_NE_2D_step07.3889.3889.2	2.5219	0.3387	2048.1	1	5560.0%	4	R.FKPGVISEELQDALGVTDK.S
UQ1667097.7%113.2%408473457.9(Q16670) SRE-ZBP protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step06.3379.3379.2	2.1751	0.4936	1484.92	1	5830.0%	1	K.VFSQNAGLLEHLR.I
UQ8VDM697.7%6612.7%859960026.6(Q8VDM6) Similar to E1B-55 kDa-associated protein 5
	TK_050702_lung_E16_NE_2D_step01.4179.4179.3	1.4435	0.0208	2795.66	140	1500.0%	1	R.IGWSLDSCSTQLGEEPFSYGYGGTGK.K
	TK_050702_lung_E16_NE_2D_step11.4475.4475.3	1.1156	0.0212	2830.41	65	1410.0%	1	R.AEPYCSVLPGFTFIQHLPLSERIR.G
	TK_050702_lung_E16_NE_2D_step06.3255.3255.2	1.2186	0.1195	1482.47	1	5420.0%	1	K.KYNILGTNAIMDK.M
*	TK_050702_lung_E16_NE_2D_step08.3034.3034.2	2.2985	0.438	2108.84	1	4060.0%	1	R.RPLDMEPQQQVYHPELK.T
	TK_050702_lung_E16_NE_2D_step03.3308.3308.2	1.494	0.2668	1596.31	1	4640.0%	1	K.EALGGQALYPHVLVK.N
	TK_050702_lung_E16_NE_2D_step03.4042.4042.1	0.4702	0.2447	1513.67	32	770.0%	1	K.TTWAIKHAASNPSK.K
UQ9CTD497.7%2212.0%259301634.7(Q9CTD4) 6030455P07Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step02.3788.3788.2	2.1974	0.4739	2717.51	1	3260.0%	1	K.AEILSNWNMFVGSQATNYGEDLTR.H
	TK_050702_lung_E16_NE_2D_step09.2677.2677.1	1.1695	0.19	827.6	4	4170.0%	1	R.LGRIVDR.M
UQ1282897.6%113.7%644675607.6(Q12828) FUSE binding protein
*	TK_050702_lung_E16_NE_2D_step02.2300.2300.2	2.8366	0.4114	2582.92	1	3910.0%	1	R.QQAAYYAQTSPQGMPQHPPAPQGQ.-
UFBN1_MOUSE97.6%221.3%28713122664.9(Q61554) Fibrillin 1 precursor
	TK_050702_lung_E16_NE_2D_step05.2560.2560.2	2.19	0.4828	2280.07	1	3500.0%	1	K.GYIGTHCGQPVCESGCLNGGR.C
	TK_050702_lung_E16_NE_2D_step08.2398.2398.2	1.1737	0.2798	1876.97	4	2500.0%	1	K.YQCACNPGYHPTHDR.L
UQ91YQ597.6%112.8%608685286.5(Q91YQ5) Similar to ribophorin I
*	TK_050702_lung_E16_NE_2D_step05.2851.2851.2	2.215	0.4481	1667.41	1	4060.0%	1	K.VTAEVVLVHPGGGSTSR.A
UQ8R2K097.5%1111.6%199211908.2(Q8R2K0) Similar to CG2974 gene product (H. sapiens) (Fragment)
*	TK_050702_lung_E16_NE_2D_step03.4380.4380.2	2.2017	0.459	2301.4	1	3180.0%	1	R.LSIPLVSLDVPSGWDAEAGGDAK.D
UHMGT_MOUSE97.3%229.5%199233849.7(P40630) Testis-specific high mobility group protein (TS-HMG)
	TK_050702_lung_E16_NE_2D_step01.0699.0699.1	0.7174	0.0451	431.28	1	5000.0%	1	K.ALVK.R
	TK_050702_lung_E16_NE_2D_step05.3187.3187.2	2.4911	0.4329	1783.69	1	5000.0%	1	K.YKEQLTPSQLMGMEK.E
UP7033397.2%3310.9%449492806.3(P70333) Heterogeneous nuclear ribonucleoprotein H' (hnRNP H') (FTP-3)
	TK_050702_lung_E16_NE_2D_step08.2695.2695.2	1.5613	0.3754	2083.81	2	3060.0%	1	R.YGDGGSSFQSTTGHCVHMR.G
	TK_050702_lung_E16_NE_2D_step01.3955.3955.2	2.2254	0.4388	2030.98	1	4690.0%	1	R.ATENDIYNFFSPLNPMR.V
	TK_050702_lung_E16_NE_2D_step01.3545.3545.3	1.267	0.0334	3667.79	34	1370.0%	1	R.DLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMR.G
UEBP2_HUMAN97.2%112.9%3063482010.1(Q99848) Probable rRNA processing protein EBP2 (EBNA1 binding protein 2) (Nucleolar protein p40)
*	TK_050702_lung_E16_NE_2D_step08.2634.2634.1	1.7446	0.31	1063.86	1	6880.0%	1	R.LHQLKVPTK.R
UQ9Z16297.1%227.7%518565419.6(Q9Z162) Vascular endothelial zinc finger 1
*	TK_050702_lung_E16_NE_2D_step05.2414.2414.3	1.9077	0.1672	2835.09	1	2610.0%	1	K.QQQQQQQQQQQQQQQHVTSWPGK.Q
	TK_050702_lung_E16_NE_2D_step06.2844.2844.2	2.1783	0.4636	2119.49	1	4380.0%	1	K.LSHSDEKPFECPICNQR.F
UQ9DBB297.0%61018.0%545610605.6(Q9DBB2) 1300019H17Rik protein
	TK_050702_lung_E16_NE_2D_step10.3991.3991.3	2.6528	0.3957	3482.97	1	2020.0%	1	R.LVELSGGTGGDEEEEWLYGGPWDVHVHSDLAK.D
	TK_050702_lung_E16_NE_2D_step08.4160.4160.2	2.004	0.5282	3156.49	1	2860.0%	1	K.GVDLDAPGSINGVPLLEVDLDSFEDKPWR.K
	TK_050702_lung_E16_NE_2D_step09.3789.3789.2	1.4574	0.2364	1811.59	1	4060.0%	2	R.RLPGAIDVIGQTITISR.V
	TK_050702_lung_E16_NE_2D_step07.3765.3765.2	1.3367	0.2881	2368.61	1	2630.0%	2	R.KPGADLSDYFNYGFNEDTWK.A
UQ8VDJ397.0%6125.8%12681417426.9(Q8VDJ3) Similar to lipoprotein-binding protein (Expressed sequence AA960365)
*	TK_050702_lung_E16_NE_2D_step05.3734.3734.2	1.1401	0.0872	1911.56	4	3240.0%	1	K.DIVARLQTQASATVPIPK.E
	TK_050702_lung_E16_NE_2D_step04.2764.2764.3	1.2895	0.0913	2404.17	35	2020.0%	1	K.ITLEGPTEDVNVAQEQIEGMVK.D
	TK_050702_lung_E16_NE_2D_step07.3671.3671.2	0.9882	0.1664	2123.53	46	2220.0%	1	K.IQIPRPDDPSNQIKITGTK.E
	TK_050702_lung_E16_NE_2D_step06.3769.3769.2	1.4568	0.0817	1726.8	1	3210.0%	3	K.ASVITQVFHVPLEER.K
UCOXG_MOUSE97.0%2217.6%8599408.7(P56391) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1) (AED)
	TK_050702_lung_E16_NE_2D_step04.4743.4743.1	0.2434	0.0	486.67	1	1670.0%	1	K.TKIK.N
	TK_050702_lung_E16_NE_2D_step06.3423.3423.2	2.7455	0.3971	1554.3	1	8500.0%	1	K.NCWQNYLDFHR.C
UTTF1_MOUSE97.0%3312.1%372385709.7(P50220) Thyroid transcription factor 1 (Thyroid nuclear factor 1) (TTF-1) (Homeobox protein NKX-2.1)
	TK_050702_lung_E16_NE_2D_step07.3247.3247.2	2.9935	0.3457	1648.38	1	5940.0%	1	K.KVGMEGGGLGAPLAAYR.Q
	TK_050702_lung_E16_NE_2D_step09.3230.3230.1	0.8914	0.0365	980.81	272	4380.0%	1	R.RVAVPVLVK.D
	TK_050702_lung_E16_NE_2D_step11.3778.3778.2	0.8393	0.0483	2279.16	23	1840.0%	1	K.HTTPFSVSDILSPLEESYKK.V
URL44_HUMAN96.9%117.6%1051231010.6(P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a)
	TK_050702_lung_E16_NE_2D_step03.2654.2654.1	1.9992	0.3073	902.78	2	7140.0%	1	K.HFELGGDK.K
UMPK4_MOUSE96.7%3516.6%397441148.1(P47809) Dual specificity mitogen-activated protein kinase kinase 4 (EC 2.7.1.-) (MAP kinase kinase 4) (MAPKK 4) (MAPK/ERK kinase 4) (JNK activating kinase 1) (C-JUN N-terminal kinase kinase 1) (JNK kinase 1) (JNKK 1) (SAPK/ERK kinase 1) (SEK1)
*	TK_050702_lung_E16_NE_2D_step11.0020.0020.3	0.8828	7.0E-4	3216.81	2	950.0%	1	-.MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGK.R
	TK_050702_lung_E16_NE_2D_step01.3358.3358.3	2.8921	0.2472	3225.08	2	1850.0%	2	K.GDPPQLSNSEEREFSPSFINFVNLCLTK.D
UDYL1_HUMAN96.5%2220.2%89103667.4(Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)
	TK_050702_lung_E16_NE_2D_step03.2386.2386.1	1.2924	0.2062	767.78	8	5830.0%	1	K.DIAAHIK.K
	TK_050702_lung_E16_NE_2D_step03.2718.2718.2	2.4545	0.4294	1283.97	1	6500.0%	1	R.NFGSYVTHETK.H
URL23_HUMAN96.5%3527.1%1401486510.5(P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17)
	TK_050702_lung_E16_NE_2D_step01.3447.3447.2	2.1211	0.4879	1972.08	1	4210.0%	1	R.ISLGLPVGAVINCADNTGAK.N
	TK_050702_lung_E16_NE_2D_step08.3596.3596.2	1.882	0.4082	1844.92	1	4410.0%	2	R.LNRLPAAGVGDMVMATVK.K
UQ9UJV196.5%223.4%643719176.3(Q9UJV1) MG81 protein (Fragment)
	TK_050702_lung_E16_NE_2D_step05.0696.0696.1	0.6497	0.0328	1480.15	56	1670.0%	1	R.YLLNVYPDGLTGR.E
	TK_050702_lung_E16_NE_2D_step01.4137.4137.1	2.4691	0.1279	1032.17	1	6880.0%	1	R.STVLKDVLR.T
UQ9BRZ196.4%111212.3%728820199.9(Q9BRZ1) Similar to RIKEN cDNA 2410015A15 gene
	TK_050702_lung_E16_NE_2D_step01.3338.3338.2	2.656	0.2306	2209.07	1	4380.0%	11	R.DQEFYIPYRPKDFDSER.G
UGTFI_MOUSE96.4%8167.7%9981123806.4(Q9ESZ8) General transcription factor II-I (GTFII-I) (TFII-I) (Bruton tyrosine kinase-associated protein-135) (BTK-associated protein-135) (BAP-135)
	TK_050702_lung_E16_NE_2D_step04.3407.3407.3	1.9058	0.0086	2089.24	48	2370.0%	1	K.ITINPGCVVVDGMPPGVSFK.A
	TK_050702_lung_E16_NE_2D_step08.3400.3400.2	2.4365	0.3898	1717.21	1	5670.0%	2	K.KPELVVSYLPPGMASK.I
	TK_050702_lung_E16_NE_2D_step04.2547.2547.2	1.7659	0.247	1646.6	1	4290.0%	3	R.TPTQTNGSNVPFKPR.G
	TK_050702_lung_E16_NE_2D_step11.2437.2437.2	0.9263	0.0943	1865.17	4	2670.0%	1	K.RPELLTHSTTEVTQPR.T
	TK_050702_lung_E16_NE_2D_step05.2983.2983.1	1.6254	0.0613	1194.85	2	6110.0%	1	K.KPEMFETAIK.E
UQ9BZB496.2%4413.7%584663878.5(Q9BZB4) IL-5 promoter REII-region-binding protein
	TK_050702_lung_E16_NE_2D_step05.3820.3820.3	1.3349	0.0267	3648.02	138	1130.0%	1	R.VGLFAVCDIPAGTELTFNYNLDCLGNEKTVCR.C
	TK_050702_lung_E16_NE_2D_step04.0140.0140.3	1.2612	0.0064	2390.6	89	1710.0%	1	K.GEFVNEYVGELIDEEECMAR.I
	TK_050702_lung_E16_NE_2D_step04.4084.4084.2	1.056	0.2439	1642.53	1	3460.0%	1	K.HEIGEFPVFFFGSK.D
	TK_050702_lung_E16_NE_2D_step06.2604.2604.2	2.4442	0.4142	1767.04	1	5380.0%	1	R.FMNHSCQPNCETLK.W
UQ9DCA596.2%3517.4%276324959.7(Q9DCA5) 1110064N10Rik protein
	TK_050702_lung_E16_NE_2D_step10.3995.3995.3	2.4545	0.2819	3525.69	1	2080.0%	2	K.TILPHDPTADVFVIPAEEKPVEIQWVKPEPK.V
	TK_050702_lung_E16_NE_2D_step04.3469.3469.2	1.3952	0.0229	1932.04	2	3750.0%	1	K.QDLYMWLSNSPHGPSAK.F
UQ9JJ8996.1%337.3%426464699.6(Q9JJ89) Brain cDNA, clone MNCb-4327 (Fragment)
*	TK_050702_lung_E16_NE_2D_step02.3163.3163.2	1.5752	0.0836	2233.17	3	3420.0%	1	R.RLEGLKPLSPENLPVPEVSR.A
*	TK_050702_lung_E16_NE_2D_step04.2645.2645.1	0.7491	0.0399	1351.6	8	2000.0%	1	R.FSQMVQDKPLR.T
UQ9BY4496.0%113.3%609678519.0(Q9BY44) CDA02
*	TK_050702_lung_E16_NE_2D_step04.3345.3345.2	2.1246	0.4685	2380.74	1	4210.0%	1	R.NVNNEVHFFENNNFNTIANK.L
UQ9D0K395.9%113.4%349388256.8(Q9D0K3) 2610008M13Rik protein
	TK_050702_lung_E16_NE_2D_step04.3348.3348.2	2.5603	0.3948	1430.81	1	5910.0%	1	K.TAGHYELPWVEK.Y
UQ8VCD295.9%333.5%9021022159.3(Q8VCD2) Similar to protein with polyglutamine repeat, calcium (ca2+) homeostasis endoplasmic reticulum protein
	TK_050702_lung_E16_NE_2D_step07.3643.3643.2	1.2725	0.0865	2483.0	4	2250.0%	1	K.NWMFSNAKSPPHCELMAGHLR.N
*	TK_050702_lung_E16_NE_2D_step03.2842.2842.2	2.5321	0.3951	1288.32	1	7500.0%	1	K.ARDEFSTFGTR.K
	TK_050702_lung_E16_NE_2D_step12.2320.2320.2	0.7508	0.1043	1505.93	2	2920.0%	1	K.SPPHCELMAGHLR.N
ULMA3_HUMAN95.9%442.7%17131893048.1(Q16787) Laminin alpha-3 chain precursor (Epiligrin 170 kDa subunit) (E170) (Nicein alpha subunit)
*	TK_050702_lung_E16_NE_2D_step05.2075.2075.3	1.6065	0.0694	2617.33	38	1740.0%	1	K.SQLQGLSASAGLLEQMRHMETQAK.D
*	TK_050702_lung_E16_NE_2D_step01.3214.3214.1	1.1056	0.0354	923.04	10	5000.0%	1	R.NQLLNYR.S
*	TK_050702_lung_E16_NE_2D_step01.4149.4149.2	2.9238	0.2823	1733.38	1	4330.0%	1	K.AQTLNNNVNRATQSAK.E
UQ9Z1R995.6%224.1%246261354.9(Q9Z1R9) Trypsinogen 16
	TK_050702_lung_E16_NE_2D_step01.3110.3110.1	2.0219	0.2176	1175.04	3	6670.0%	1	K.TLNNDIMLIK.L
URS5_MOUSE95.6%51321.6%204228899.7(P97461) 40S ribosomal protein S5
	TK_050702_lung_E16_NE_2D_step04.3683.3683.2	1.9368	0.3402	2326.18	1	3420.0%	3	K.WSTDDVQINDISLQDYIAVK.E
*	TK_050702_lung_E16_NE_2D_step12.2069.2069.3	0.7667	0.0496	2552.56	83	870.0%	2	K.NIAECLADELINAAKGSSNSYAIK.K
UQ8VE3795.5%358.6%421449318.1(Q8VE37) Similar to chromosome condensation 1
*	TK_050702_lung_E16_NE_2D_step05.4167.4167.2	1.4629	0.0578	1741.45	2	4000.0%	1	K.KSMVPVQVQLDAPVVK.V
	TK_050702_lung_E16_NE_2D_step10.3330.3330.2	2.0753	0.5078	2208.14	1	3680.0%	2	K.SWVGFSGGQHHTVCMDSEGK.A
UTRAB_HUMAN95.5%111.4%708809075.7(Q9UGI0) TRABID protein
*	TK_050702_lung_E16_NE_2D_step07.2721.2721.1	1.5129	0.3427	1181.88	2	5000.0%	1	R.REIAASLHQR.K
URS8_HUMAN95.4%2212.1%2072407410.3(P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8
	TK_050702_lung_E16_NE_2D_step09.2687.2687.2	2.2615	0.4187	1349.33	1	5450.0%	1	R.KYELGRPAANTK.I
	TK_050702_lung_E16_NE_2D_step05.3380.3380.2	1.5258	0.3701	1621.45	2	3750.0%	1	R.QWYESHYALPLGR.K
UQ9BVZ895.4%1127.1%5969638.2(Q9BVZ8) Similar to CG8054 gene product
*	TK_050702_lung_E16_NE_2D_step06.2772.2772.2	2.2734	0.4237	1809.52	1	4330.0%	1	K.DAHSIHGTNPQYLVEK.I
UQ922B895.4%334.9%740826137.3(Q922B8) Similar to DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1
	TK_050702_lung_E16_NE_2D_step06.2860.2860.2	1.2136	0.1928	1825.09	1	4230.0%	1	K.HYYEVSCHDQGLCR.V
	TK_050702_lung_E16_NE_2D_step11.4918.4918.2	0.8694	0.1874	2373.09	10	1430.0%	1	K.GEDSVPDTVHHVVVPVNPKTDK.L
	TK_050702_lung_E16_NE_2D_step05.2863.2863.2	2.0694	0.4869	2026.44	1	3890.0%	1	K.GEDSVPDTVHHVVVPVNPK.T
UQ96PV995.2%116.8%410450716.3(Q96PV9) Hypothetical protein KIAA1929 (Fragment)
*	TK_050702_lung_E16_NE_2D_step07.2652.2652.3	2.9724	0.3448	3040.55	1	2310.0%	1	R.ECPPHLPMVLPRPPRAGLTASLSPSSDR.G
UQ9BUT995.1%62620.3%2072240310.7(Q9BUT9) Hypothetical protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step07.0067.0067.2	1.782	0.1957	2141.6	1	2950.0%	5	R.SPLSASPGAGAGSGRGPAAVWER.R
*	TK_050702_lung_E16_NE_2D_step03.3545.3545.2	1.1808	0.1027	1989.25	9	2500.0%	1	R.AQPFAQPPGPWPLSSPGPR.L
UQ9D3U495.0%391.4%565625648.3(Q9D3U4) 4933434H11Rik protein
	TK_050702_lung_E16_NE_2D_step01.4922.4922.1	1.7125	0.0447	917.05	5	6430.0%	3	R.GFGFVLFK.D
UALBU_MOUSE95.0%445.1%608686936.1(P07724) Serum albumin precursor
*	TK_050702_lung_E16_NE_2D_step08.2570.2570.1	0.6475	0.0058	710.66	12	4000.0%	1	K.SEIAHR.Y
*	TK_050702_lung_E16_NE_2D_step01.3681.3681.2	0.942	0.0969	1879.56	7	2330.0%	1	R.VCLLHEKTPVSEHVTK.C
	TK_050702_lung_E16_NE_2D_step05.3186.3186.2	1.6509	0.4358	1019.01	1	6880.0%	1	K.SLHTLFGDK.L
UQ9CYI495.0%114.6%371439209.8(Q9CYI4) 2410018D03Rik protein
	TK_050702_lung_E16_NE_2D_step05.2939.2939.2	2.2767	0.4066	2065.13	1	4060.0%	1	R.VCEVCSAYLGLHDNDRR.L
UQ9DBC294.9%116.6%166197908.0(Q9DBC2) Adult male liver cDNA, RIKEN full-length enriched library, clone:1300018I14, full insert sequence
	TK_050702_lung_E16_NE_2D_step01.3241.3241.1	1.6966	0.2743	1282.25	1	6500.0%	1	R.DPIPYLPPLEK.L
UQ9DCX394.9%5515.9%370403828.0(Q9DCX3) 0610009C03Rik protein
	TK_050702_lung_E16_NE_2D_step07.2976.2976.2	1.775	0.4018	1578.03	1	4640.0%	1	K.FHPNGSTLASAGFDR.L
	TK_050702_lung_E16_NE_2D_step05.4838.4838.2	0.692	0.1871	2221.04	9	1320.0%	1	R.GPQLVCTGSDDGTVKLWDIR.K
	TK_050702_lung_E16_NE_2D_step07.2679.2679.2	1.5326	0.2603	1496.01	13	4580.0%	1	K.GHTSFVNSCYPAR.R
	TK_050702_lung_E16_NE_2D_step06.2804.2804.2	1.3883	0.2729	1334.3	2	6000.0%	1	K.IFQGNVHNFEK.N
UHDGF_MOUSE94.9%61025.3%237262694.8(P51859) Hepatoma-derived growth factor (HDGF)
	TK_050702_lung_E16_NE_2D_step11.3742.3742.2	1.8372	0.4897	1990.22	1	3120.0%	1	K.YQVFFFGTHETAFLGPK.D
	TK_050702_lung_E16_NE_2D_step08.2847.2847.2	1.6497	0.4036	985.23	1	6430.0%	2	K.GYPHWPAR.I
*	TK_050702_lung_E16_NE_2D_step07.3423.3423.3	1.759	0.014	3643.45	15	1180.0%	2	K.NSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVR.D
UO7593994.9%4411.9%405453045.8(O75939) 45kDa splicing factor
*	TK_050702_lung_E16_NE_2D_step04.2695.2695.2	2.1798	0.4022	1418.79	1	7310.0%	1	R.QIADTPPHVAAGLK.D
	TK_050702_lung_E16_NE_2D_step05.2215.2215.3	0.7726	0.0595	2510.87	2	1070.0%	1	R.NMVGAGEVDEDLEVETKEECEK.Y
	TK_050702_lung_E16_NE_2D_step03.3472.3472.2	1.2096	0.0145	1346.64	1	4550.0%	1	K.KSDSNPLTEILK.C
UQ9D5P994.9%1115.9%145160588.2(Q9D5P9) 4930402F02Rik protein
	TK_050702_lung_E16_NE_2D_step11.4121.4121.2	2.0849	0.4512	2587.34	1	2950.0%	1	K.EIDIDDVAAINPELLQLLPLRPK.D
UQ9CSV094.9%1110.1%1591929711.7(Q9CSV0) 2610209M04Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step04.0103.0103.2	2.4308	0.4023	1695.43	1	5000.0%	1	K.KVDGSVNAYAINVSQK.R
UXPC_MOUSE94.9%465.9%9001008778.9(P51612) DNA-repair protein complementing XP-C cells homolog (Xeroderma pigmentosum group C complementing protein homolog) (P125)
*	TK_050702_lung_E16_NE_2D_step05.1137.1137.1	0.5878	0.0	686.44	4	3000.0%	1	K.NSKVLK.E
	TK_050702_lung_E16_NE_2D_step05.3430.3430.2	1.4981	0.3371	2119.93	1	3820.0%	2	R.KPAGVDQWLEVYCEPQAK.W
*	TK_050702_lung_E16_NE_2D_step06.2172.2172.3	1.0517	0.2111	2786.82	2	1250.0%	1	K.SEAAAPHAAGGGLSSDEEEGTSSQAEAXR.V
UQ99PV094.8%775.2%23352735998.9(Q99PV0) Pre-mRNA processing 8 protein
	TK_050702_lung_E16_NE_2D_step07.2091.2091.1	0.7336	0.0468	920.53	117	2140.0%	1	K.RVYLGALK.Y
	TK_050702_lung_E16_NE_2D_step01.3994.3994.3	1.7741	0.0348	3441.1	1	1700.0%	1	R.VQMLLSDRFLGFFMVPAQSSWNYNFMGVR.H
	TK_050702_lung_E16_NE_2D_step13.4869.4869.3	1.0015	0.0593	3392.7	45	740.0%	1	K.EFYHEVHRPSHFLNFALLQEGEVYSADR.E
	TK_050702_lung_E16_NE_2D_step04.3473.3473.2	2.1996	0.4082	2664.15	1	3120.0%	1	R.GPGNPVPGPLAPLPDYMSEEKLQEK.A
*	TK_050702_lung_E16_NE_2D_step09.3822.3822.3	1.1322	0.1353	2292.07	21	1050.0%	1	R.KGMLDPLEVHLLDFPNIVIK.G
	TK_050702_lung_E16_NE_2D_step12.1423.1423.1	0.5767	0.0188	924.03	5	2500.0%	1	K.RHLLTQR.A
	TK_050702_lung_E16_NE_2D_step01.0195.0195.1	0.8442	0.081	589.66	7	5000.0%	1	K.KNLGR.L
UQ9CW4694.7%228.5%756801948.9(Q9CW46) 1300006N24Rik protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step11.2245.2245.2	0.949	0.1555	2259.08	7	1300.0%	1	R.RPAEPPLPSPAVPGGGSGSNNGNK.A
*	TK_050702_lung_E16_NE_2D_step11.3877.3877.3	2.7321	0.5853	3837.71	1	1470.0%	1	K.KPGILGDSPLGTLQAGAQPSNSLLGELSAGGGLAPELPPR.R
UFBN2_MOUSE94.5%12147.4%29073136294.9(Q61555) Fibrillin 2 precursor
	TK_050702_lung_E16_NE_2D_step04.3083.3083.2	0.6413	0.0129	2105.08	32	1110.0%	1	K.EIPGICANGVCINQIGSFR.C
*	TK_050702_lung_E16_NE_2D_step03.3224.3224.2	1.0598	0.0195	1957.07	5	3000.0%	1	R.VCVDTHMRSTCYGEIK.K
	TK_050702_lung_E16_NE_2D_step13.2157.2157.3	0.8074	0.0038	2403.61	386	660.0%	1	R.CIGPNRCACVYGFTGPQCER.D
	TK_050702_lung_E16_NE_2D_step02.3319.3319.3	1.9718	0.0474	2337.98	2	2500.0%	1	R.CECNEGFQSSSSGTECLDNR.Q
*	TK_050702_lung_E16_NE_2D_step05.2544.2544.3	1.1055	0.1179	2766.19	51	1590.0%	1	K.AQCCCEPGRCWSIGTIPEACPVR.G
	TK_050702_lung_E16_NE_2D_step07.3161.3161.2	2.1865	0.4168	2104.1	1	3820.0%	1	R.GWGHQCELCPLPGTAQYK.K
*	TK_050702_lung_E16_NE_2D_step07.3844.3844.3	1.305	0.2457	2923.26	1	1460.0%	1	R.DIDECKVMPSLCTNGQCVNTMGSFR.C
	TK_050702_lung_E16_NE_2D_step08.3516.3516.3	1.1423	0.0215	2622.98	4	1620.0%	1	R.NCIDIDECLVNRLLCDNGLCR.N
*	TK_050702_lung_E16_NE_2D_step06.3153.3153.3	1.3323	0.0623	2110.57	56	1910.0%	2	K.EHILELVPAIEPLNNHIR.Y
*	TK_050702_lung_E16_NE_2D_step02.3572.3572.3	1.4474	0.06	3424.89	56	1380.0%	1	R.LCLQPYFVWLGCVALWAQGTDGQPQPPPPK.T
*	TK_050702_lung_E16_NE_2D_step02.3809.3809.3	1.174	0.0064	2757.25	31	1360.0%	1	K.VMPSLCTNGQCVNTMGSFRCFCK.V
UU520_HUMAN94.5%222.1%17011944786.7(O75643) U5 small nuclear ribonucleoprotein 200 kDa helicase (U5 snRNP-specific 200 kDa protein) (U5-200KD) (Fragment)
	TK_050702_lung_E16_NE_2D_step07.3871.3871.2	1.2471	0.0594	2269.58	2	2630.0%	1	K.VRGLIEIISNAAEYENIPIR.H
	TK_050702_lung_E16_NE_2D_step05.2819.2819.2	2.1608	0.4152	1937.34	1	5000.0%	1	R.MTQNPNYYNLQGISHR.H
UQ9R12694.4%2225.2%155172568.3(Q9R126) Ribonuclease 7 precursor (Eosinophil-associated ribonuclease 7) (Fragment)
	TK_050702_lung_E16_NE_2D_step01.4021.4021.2	2.1257	0.4277	2188.1	1	3330.0%	1	R.VAWDCPIYPVVPVHLDGTF.-
	TK_050702_lung_E16_NE_2D_step08.3599.3599.2	1.5897	0.2251	2470.41	1	3420.0%	1	K.ANLQCNVEMQAINMHRPRCK.G
UQ9D79594.4%244.1%3624142710.0(Q9D795) C130020J04Rik protein
*	TK_050702_lung_E16_NE_2D_step06.3739.3739.2	2.3241	0.3981	1662.1	1	5710.0%	2	K.GIDYSFPSLVLPKPK.N
UQ925M994.4%8127.3%10511216478.1(Q925M9) DNA-dependent ATPase SNF2H
	TK_050702_lung_E16_NE_2D_step03.4405.4405.1	0.3618	0.0366	1597.82	21	830.0%	1	K.LGFDKENVYDELR.Q
	TK_050702_lung_E16_NE_2D_step05.3482.3482.2	2.0446	0.4746	1730.12	1	5360.0%	2	K.QTELFAHFIQPAAQK.T
	TK_050702_lung_E16_NE_2D_step06.3175.3175.1	0.9003	0.1215	1037.89	78	3570.0%	1	K.ENVYDELR.Q
	TK_050702_lung_E16_NE_2D_step05.3596.3596.2	1.7826	0.4505	1489.37	1	5000.0%	2	K.IAFTEWIEPPKR.E
	TK_050702_lung_E16_NE_2D_step06.4984.4984.3	1.1231	0.0811	3409.31	1	1550.0%	1	R.KCCNHPYLFDGAEPGPPYTTDMHLVTNSGK.M
	TK_050702_lung_E16_NE_2D_step10.2779.2779.1	0.9699	0.0474	868.54	2	5000.0%	1	K.APFHQLR.I
USAP_HUMAN94.4%8641.7%524581135.2(P07602) Proactivator polypeptide precursor [Contains: Saposin A (Protein A); Saposin B (Sphingolipid activator protein 1) (SAP-1) (Cerebroside sulfate activator) (CSAct) (Dispersin) (Sulfatide/GM1 activator); Saposin C (Co-beta-glucosidase) (A1 activator) (Glucosylceramidase activator) (Sphingolipid activator protein 2) (SAP-2); Saposin D (Protein C) (Component C)]
*	TK_050702_lung_E16_NE_2D_step02.2656.2656.1	1.4	0.1739	1015.65	12	4380.0%	8	K.QEILAALEK.G
UQ9Y2S694.2%3514.1%64706610.0(Q9Y2S6) HSPC016 protein (Hypothetical protein)
*	TK_050702_lung_E16_NE_2D_step02.2385.2385.2	1.6237	0.2299	814.7	7	4380.0%	1	K.GPLATGGIK.K
UU123_HUMAN94.1%3330.0%110124058.4(Q9UH06) Hypothetical protein BK223H9.2/MGC1346 (Q9UH06) Hypothetical protein BK223H9.2/MGC1346
	TK_050702_lung_E16_NE_2D_step01.2539.2539.2	2.1299	0.4112	1807.26	1	6670.0%	1	R.CVICGGPGVSDAYYCK.E
	TK_050702_lung_E16_NE_2D_step01.2194.2194.1	1.6941	0.1257	817.98	1	6430.0%	1	K.IVNLGSSK.T
	TK_050702_lung_E16_NE_2D_step12.2608.2608.2	1.0084	0.2022	1195.68	16	4380.0%	1	K.HHPDLIFCR.K
UQ8VDL093.9%114.5%489537545.1(Q8VDL0) Hypothetical 53.8 kDa protein
*	TK_050702_lung_E16_NE_2D_step07.2889.2889.2	2.3918	0.388	2418.93	1	3330.0%	1	K.NDSLTLTQLKSLLDHLHVGVGR.D
UPDX2_MOUSE93.9%249.1%198217795.4(Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA)
*	TK_050702_lung_E16_NE_2D_step08.4080.4080.2	2.245	0.3987	1836.3	1	4120.0%	2	R.KEGGLGPLNIPLLADVTK.S
UPR17_MOUSE93.9%223.1%579654617.1(Q9DC48) Pre-mRNA splicing factor PRP17
	TK_050702_lung_E16_NE_2D_step05.3374.3374.2	2.2515	0.3965	1555.13	1	5770.0%	1	R.CPLPAADSLMHLTK.S
	TK_050702_lung_E16_NE_2D_step08.0632.0632.1	0.3897	0.0179	471.29	4	3330.0%	1	K.AHDK.V
UCYPE_MOUSE93.8%247.0%298331615.6(Q9QZH3) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) (Fragment)
	TK_050702_lung_E16_NE_2D_step05.3208.3208.2	1.2868	0.1792	2281.59	1	2500.0%	2	R.IIPQFMCQGGDFTNHNGTGGK.S
UMCM3_MOUSE93.6%6812.4%812915465.6(P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3)
*	TK_050702_lung_E16_NE_2D_step13.4591.4591.2	1.9654	0.5134	2924.36	1	3000.0%	1	K.AALLEVFQEAHEQSVGMLHLTESINR.N
*	TK_050702_lung_E16_NE_2D_step09.4252.4252.2	1.1551	0.1236	2995.99	36	1600.0%	1	K.YIHVAKIIKPTLTQESAAYIAEEYSR.L
	TK_050702_lung_E16_NE_2D_step05.3812.3812.3	0.7553	0.1294	3783.92	6	650.0%	1	K.TPMENIGLQDSLLSRFDLLFIMLDQMDPEQDR.E
*	TK_050702_lung_E16_NE_2D_step07.3440.3440.2	2.2103	0.3983	2284.54	1	5000.0%	2	K.IIKPTLTQESAAYIAEEYSR.L
*	TK_050702_lung_E16_NE_2D_step03.0120.0120.3	1.0995	0.0987	2054.45	10	2030.0%	1	R.NREEPFSSEEIQACLSR.M
UTLR4_HUMAN93.4%113.6%839956806.3(O00206) Toll-like receptor 4 precursor (hToll)
*	TK_050702_lung_E16_NE_2D_step04.3039.3039.3	2.8862	0.3461	3375.02	2	1900.0%	1	R.NLIYLDISHTHTRVAFNGIFNGLSSLEVLK.M
UGBLP_HUMAN93.3%4419.6%317350777.7(P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase)
	TK_050702_lung_E16_NE_2D_step08.2802.2802.3	1.6096	0.066	2965.48	2	1850.0%	1	R.GHSHFVSDVVISSDGQFALSGSWDGTLR.L
	TK_050702_lung_E16_NE_2D_step11.1869.1869.1	0.245	0.0	690.13	2	2000.0%	1	R.FVGHTK.D
	TK_050702_lung_E16_NE_2D_step02.3088.3088.3	1.1418	0.0533	3029.52	11	1570.0%	1	R.GTLKGHNGWVTQIATTPQFPDMILSASR.D
	TK_050702_lung_E16_NE_2D_step10.4026.4026.2	2.3143	0.3868	2629.25	1	4350.0%	1	K.GHNGWVTQIATTPQFPDMILSASR.D
UQ96KM693.2%223.0%892972649.8(Q96KM6) DJ591C20.5 (Hypothetical protein KIAA1196)
*	TK_050702_lung_E16_NE_2D_step06.3288.3288.2	2.4677	0.3797	1697.86	1	5670.0%	1	K.KFTGEQPSISGTFGLK.G
*	TK_050702_lung_E16_NE_2D_step01.2142.2142.1	0.7848	0.0073	1293.62	106	2000.0%	1	-.MTDPFCVGGRR.L
UQ8VDW093.1%71315.7%427490675.7(Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family
	TK_050702_lung_E16_NE_2D_step10.3452.3452.2	0.8401	0.0557	1463.16	8	3180.0%	1	K.LTLHGLQQYYVK.L
	TK_050702_lung_E16_NE_2D_step08.2882.2882.1	0.5079	0.1361	1306.97	2	1500.0%	1	K.QCMMFSATLSK.E
	TK_050702_lung_E16_NE_2D_step06.2828.2828.2	1.9272	0.3593	1299.18	1	6360.0%	3	K.GSYVSIHSSGFR.D
	TK_050702_lung_E16_NE_2D_step03.3932.3932.3	2.2551	0.3404	3653.26	1	2180.0%	1	R.AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK.S
UO7598493.1%448.6%11141276439.0(O75984) DJ1189B24.4 (Novel putative protein similar to hypothetical proteins S. pombe C22F3.14C and C. elegans C16A3.8) (Fragment)
*	TK_050702_lung_E16_NE_2D_step12.0328.0328.3	1.2282	0.1837	4558.51	1	1280.0%	1	K.YDNLITPVVDSLKYLTSLNYDVLACILSNCIIEALANPEK.E
*	TK_050702_lung_E16_NE_2D_step12.3103.3103.3	1.3481	0.2605	3630.28	161	830.0%	1	K.TPNFSTLLCYDRVFSDIIYTVASCTENEASR.Y
*	TK_050702_lung_E16_NE_2D_step10.3785.3785.2	2.0941	0.4175	1783.35	1	5670.0%	1	K.RPDLYALAMGYSGQLK.S
*	TK_050702_lung_E16_NE_2D_step09.3805.3805.2	0.9503	0.1196	2599.18	21	2000.0%	1	R.FVELVHQQKTPNFSTLLCYDR.V
UQ9D2N092.6%1110.3%350369719.8(Q9D2N0) 4632409L19Rik protein
*	TK_050702_lung_E16_NE_2D_step07.3715.3715.3	2.6912	0.4518	3499.65	1	2140.0%	1	K.GISASSPLQTSIVRPAGLADFGPSSASSPLSSPLNK.G
UHXB4_MOUSE92.6%116.4%250275199.8(P10284) Homeobox protein Hox-B4 (Hox-2.6)
	TK_050702_lung_E16_NE_2D_step05.2467.2467.2	2.0241	0.45	1670.57	1	4330.0%	1	K.VHVSTVNPNYAGGEPK.R
UQ9D9X292.4%229.3%388437509.5(Q9D9X2) Ly1 antibody reactive clone
*	TK_050702_lung_E16_NE_2D_step12.3333.3333.2	0.8563	0.1891	2179.94	17	1430.0%	1	K.NQEAGHEAAGEEAAEASGPPEK.K
*	TK_050702_lung_E16_NE_2D_step01.3430.3430.2	2.7063	0.2448	1631.42	1	6150.0%	1	R.ELLQQISAFDNVPR.K
UQ925I692.3%228.1%372400929.7(Q925I6) MacroH2A2
	TK_050702_lung_E16_NE_2D_step06.2903.2903.1	1.6942	0.2584	921.98	1	6430.0%	1	R.IHPELLAK.K
	TK_050702_lung_E16_NE_2D_step08.3395.3395.2	0.9571	0.0255	2372.14	6	2380.0%	1	K.SLVLGQKLSLTQSDISHIGSMR.V
UQ9UPT892.3%8204.5%10321095725.7(Q9UPT8) Hypothetical protein KIAA1064 (Fragment)
*	TK_050702_lung_E16_NE_2D_step02.2663.2663.2	1.3304	0.3306	1222.22	2	4500.0%	1	K.DVTLSKPSFAR.T
*	TK_050702_lung_E16_NE_2D_step12.1545.1545.1	0.2276	0.0109	709.64	5	830.0%	1	K.GHPTGSR.L
*	TK_050702_lung_E16_NE_2D_step07.4067.4067.2	0.9053	0.1502	1999.01	49	2060.0%	4	K.IPSLFEIVVRPTGQLAEK.L
*	TK_050702_lung_E16_NE_2D_step06.2847.2847.2	2.058	0.4187	1217.1	1	6670.0%	1	R.SQLQQFSHIK.K
UGGT1_HUMAN92.2%112.8%569613827.1(P19440) Gamma-glutamyltranspeptidase 1 precursor (EC 2.3.2.2) (Gamma-glutamyltransferase 1) (CD224 antigen)
*	TK_050702_lung_E16_NE_2D_step05.2960.2960.2	2.7175	0.1133	1603.72	1	5000.0%	1	R.QGFPVGKGLAAALENK.R
UP2G4_MOUSE92.2%51112.9%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4)
	TK_050702_lung_E16_NE_2D_step01.3739.3739.3	0.7405	0.0343	2415.79	59	750.0%	1	K.EGEFVAQFKFTVLLMPNGPMR.I
	TK_050702_lung_E16_NE_2D_step06.3741.3741.2	2.1151	0.3945	1632.2	1	4580.0%	3	K.HELLQPFNVLYEK.E
	TK_050702_lung_E16_NE_2D_step07.2755.2755.2	1.5952	0.3923	1927.87	1	4690.0%	1	R.LVKPGNQNTQVTEAWNK.V
URL29_MOUSE92.2%61015.1%1591745611.8(P47915) 60S ribosomal protein L29
	TK_050702_lung_E16_NE_2D_step05.1397.1397.1	0.2317	0.017	540.68	6	1250.0%	2	K.GPKLK.R
*	TK_050702_lung_E16_NE_2D_step08.2939.2939.1	1.3993	0.0573	898.68	10	5710.0%	2	R.LAFIAHPK.L
*	TK_050702_lung_E16_NE_2D_step12.2083.2083.2	1.3532	0.1894	1193.55	5	4000.0%	1	K.ALVKPQAIKPK.M
UQ9D6B892.0%61026.0%154169709.4(Q9D6B8) 2410084F24Rik protein
	TK_050702_lung_E16_NE_2D_step04.2424.2424.2	2.3486	0.3824	1345.83	1	6820.0%	2	K.RLQDVSGQLNSK.K
	TK_050702_lung_E16_NE_2D_step08.2636.2636.1	1.6097	0.0898	953.73	4	6430.0%	2	R.VVHIIQSR.E
	TK_050702_lung_E16_NE_2D_step03.3645.3645.2	1.5006	0.3386	2334.11	1	2890.0%	1	R.DSNPDEIEIDFETLKPTTLR.E
UEWS_MOUSE92.0%335.3%655684189.3(Q61545) RNA-binding protein EWS
	TK_050702_lung_E16_NE_2D_step12.1069.1069.1	0.2294	0.0389	551.58	5	1670.0%	1	R.DRPY.-
	TK_050702_lung_E16_NE_2D_step01.2870.2870.2	1.4437	0.1546	2238.79	26	3330.0%	1	R.AGDWQCPNPGCGNQNFAWR.T
	TK_050702_lung_E16_NE_2D_step06.3289.3289.2	2.3393	0.377	1416.76	1	6360.0%	1	R.TGQPMIHIYLDK.E
UITB1_MOUSE91.8%334.1%798882315.9(P09055) Integrin beta-1 precursor (Fibronectin receptor beta subunit) (CD29 antigen) (Integrin VLA-4 beta subunit)
*	TK_050702_lung_E16_NE_2D_step07.2787.2787.2	2.1275	0.3897	1618.51	1	5770.0%	1	K.LPQPVQVDPVTHCK.E
*	TK_050702_lung_E16_NE_2D_step02.3537.3537.2	1.3688	0.0723	2035.64	3	3440.0%	1	K.LRPEDITQIQPQQLLLK.L
*	TK_050702_lung_E16_NE_2D_step12.4291.4291.2	1.2108	0.0412	2304.16	5	2500.0%	1	K.LRPEDITQIQPQQLLLKLR.S
UQ8R4A091.4%686.0%12031331554.7(Q8R4A0) Translocated promoter region protein (Fragment)
	TK_050702_lung_E16_NE_2D_step04.2667.2667.2	2.3929	0.3025	2366.31	1	2830.0%	1	R.GIASTSDPPTANIKPTPVVSTPSK.V
*	TK_050702_lung_E16_NE_2D_step03.3788.3788.2	0.8969	0.0661	2345.89	9	2250.0%	1	R.SNASLTNNQNLIQSLREDLSK.A
*	TK_050702_lung_E16_NE_2D_step07.2492.2492.1	1.7947	0.2385	854.73	1	6430.0%	1	K.ITHLSGVK.D
	TK_050702_lung_E16_NE_2D_step01.0934.0934.1	0.4293	0.2571	614.18	5	2000.0%	2	K.TLALAK.S
*	TK_050702_lung_E16_NE_2D_step03.2664.2664.2	1.3267	0.2164	1616.71	1	5830.0%	1	K.ERLEQNLQQMQAK.V
UQ9CYQ491.2%2210.3%203232939.5(Q9CYQ4) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810486E17, full insert sequence
	TK_050702_lung_E16_NE_2D_step01.1865.1865.1	1.0653	0.0171	653.01	11	6250.0%	1	K.TFTQR.T
	TK_050702_lung_E16_NE_2D_step01.3329.3329.2	2.0847	0.3966	1862.3	2	4670.0%	1	R.LFVGNLPPDITEEEMR.K
UQ9BT2391.1%118.7%127140709.0(Q9BT23) Hypothetical protein
*	TK_050702_lung_E16_NE_2D_step08.3128.3128.2	2.0161	0.4124	1486.8	1	6500.0%	1	K.LIFHNSCFCCK.H
UQ9258591.1%334.3%10161080548.3(Q92585) Hypothetical protein KIAA0200
*	TK_050702_lung_E16_NE_2D_step04.2119.2119.2	0.9329	0.0365	1856.87	45	2330.0%	1	K.QDFTNSKLLMMPSVNK.S
*	TK_050702_lung_E16_NE_2D_step04.2609.2609.1	1.7509	0.2391	1224.87	5	5560.0%	1	R.QQHLLAEQEK.Q
*	TK_050702_lung_E16_NE_2D_step04.4384.4384.2	0.5491	0.0013	2096.73	151	880.0%	1	K.NRTSEEWMSDLDDLLGSQ.-
URRS1_MOUSE91.0%339.3%3654155210.8(Q9CYH6) Ribosome biogenesis regulatory protein homolog
*	TK_050702_lung_E16_NE_2D_step12.2203.2203.2	2.0033	0.4504	1794.73	1	4060.0%	1	K.MQMPSSAGLHPTGHQSK.E
	TK_050702_lung_E16_NE_2D_step12.1787.1787.2	0.8169	0.2587	1458.54	15	2270.0%	1	R.EKPLPRPRPLTR.W
	TK_050702_lung_E16_NE_2D_step13.2209.2209.1	0.1012	0.0	598.08	6	1250.0%	1	K.EKAPR.G
UZF95_HUMAN90.9%6810.7%839969037.6(Q9Y2L8) Zinc finger protein Zfp-95
*	TK_050702_lung_E16_NE_2D_step02.1872.1872.1	0.151	0.0	588.07	1	1250.0%	1	K.GMVQR.W
*	TK_050702_lung_E16_NE_2D_step06.2799.2799.2	1.8379	0.1393	2125.59	1	4120.0%	2	K.QISDDSESHWVAPEHTER.S
*	TK_050702_lung_E16_NE_2D_step09.4360.4360.2	0.8387	0.1686	1967.29	8	1760.0%	1	R.SHERTDPINTLSVEGSLL.-
*	TK_050702_lung_E16_NE_2D_step01.4118.4118.2	2.6099	0.1821	1975.84	1	5000.0%	1	R.LLEENALPVLQVPSLPLK.D
*	TK_050702_lung_E16_NE_2D_step12.4493.4493.3	0.8602	0.0734	3385.0	173	420.0%	1	R.KMATPGAVQESCSPHPLTVDTQPEQAPQKPR.L
UQ9JHJ390.9%486.7%404438046.1(Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene)
*	TK_050702_lung_E16_NE_2D_step09.4240.4240.3	2.6842	0.0647	2880.09	13	2020.0%	2	R.LLEFDSTNASEGAQPPGKPYPPYSLAK.F
UO7594090.7%226.7%238267117.3(O75940) 30 kDa splicing factor (Similar to splicing factor 30, survival of motor neuron-related)
*	TK_050702_lung_E16_NE_2D_step12.1577.1577.1	0.331	0.0087	711.94	5	2000.0%	1	R.AYSKNK.K
*	TK_050702_lung_E16_NE_2D_step01.3265.3265.1	2.1315	0.1389	1188.87	1	6670.0%	1	K.DLQEVIELTK.D
UO8863590.6%354.8%416474789.1(O88635) Serine/threonine protein kinase 51PK(S)
	TK_050702_lung_E16_NE_2D_step04.2691.2691.1	1.416	0.2236	1062.84	1	6880.0%	2	K.YWGSGLHDK.N
	TK_050702_lung_E16_NE_2D_step04.2944.2944.2	2.507	0.3338	1310.69	1	7500.0%	1	R.YRDNVAALMEK.C
UHP28_HUMAN90.5%229.4%181206308.9(Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1)
*	TK_050702_lung_E16_NE_2D_step04.2709.2709.2	2.1127	0.3876	1214.92	1	6500.0%	1	K.KVTQLDLDGPK.E
*	TK_050702_lung_E16_NE_2D_step07.2355.2355.1	1.002	0.0942	656.45	5	5000.0%	1	K.MHLAGK.T
URL31_HUMAN90.4%2212.0%1251446310.5(P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31
	TK_050702_lung_E16_NE_2D_step02.2527.2527.1	1.4882	0.1543	1017.67	1	6430.0%	1	R.EYTINIHK.R
	TK_050702_lung_E16_NE_2D_step09.2749.2749.1	1.9448	0.225	757.8	1	8330.0%	1	R.IHGVGFK.K
UAHNK_HUMAN90.3%774.3%29603124936.7(Q09666) Neuroblast differentiation associated protein AHNAK (Desmoyokin) (Fragments)
*	TK_050702_lung_E16_NE_2D_step03.0889.0889.2	0.5659	0.117	1221.6	107	1360.0%	1	R.LGSPSGKTGTCR.I
*	TK_050702_lung_E16_NE_2D_step05.2622.2622.2	1.4473	0.0851	1924.91	26	2370.0%	1	K.GGLKGSEVGFHGAAPDISVK.G
*	TK_050702_lung_E16_NE_2D_step09.4336.4336.2	0.9755	0.0709	2325.66	6	2380.0%	1	K.GEIDASVPELEGDLRGPQVDVK.G
*	TK_050702_lung_E16_NE_2D_step12.1619.1619.3	0.7004	0.0483	2384.72	29	600.0%	1	K.GNVDISAPKIEGEMQVPDVDIR.G
	TK_050702_lung_E16_NE_2D_step04.3444.3444.2	2.0491	0.4001	2057.57	1	4710.0%	1	K.VDINTPDVDVHGPDWHLK.M
*	TK_050702_lung_E16_NE_2D_step07.3387.3387.3	1.7675	0.0126	3435.28	55	1250.0%	1	R.SNSFSDEREFSGPSTPTGTLEFEGGEVSLEGGK.V
UQ9D6J389.8%115.7%314359886.1(Q9D6J3) 2900016D05Rik protein
*	TK_050702_lung_E16_NE_2D_step07.3157.3157.2	2.3701	0.3689	1892.36	1	3820.0%	1	R.AAARPNPTAILNEVPQTK.R
UQ9NVE789.7%225.0%773859916.3(Q9NVE7) Hypothetical protein FLJ10782
*	TK_050702_lung_E16_NE_2D_step12.1707.1707.2	0.5232	0.026	1058.2	5	2500.0%	1	K.DHLVNTETK.V
*	TK_050702_lung_E16_NE_2D_step02.4055.4055.3	2.7518	0.3446	3413.19	5	1640.0%	1	R.FQTNHPHIFPYLLVNIGSGVSIVKVETEDR.F
UQ8R5C889.7%5175.0%562661518.2(Q8R5C8) Similar to adenovirus 5 E1A binding protein
	TK_050702_lung_E16_NE_2D_step01.3113.3113.1	2.1473	0.0996	1177.1	1	6880.0%	1	K.YTKIFNDFK.D
	TK_050702_lung_E16_NE_2D_step05.4786.4786.2	1.4429	0.0044	2066.54	1	3610.0%	4	R.LVHSAVDVPTIQEKVNEGK.Y
UNUKS_HUMAN89.6%113.7%243272965.1(Q9H1E3) Nuclear ubiquitous casein and cyclin-dependent kinases substrate
*	TK_050702_lung_E16_NE_2D_step01.2061.2061.1	1.6677	0.2348	900.06	1	6880.0%	1	K.ATVTPSPVK.G
UQ8TAQ289.5%573.1%12141328795.7(Q8TAQ2) Similar to SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
	TK_050702_lung_E16_NE_2D_step06.3652.3652.2	1.6446	0.3396	2630.35	1	2860.0%	2	K.SLVQNNCLSRPNIFLCPEIEPK.L
	TK_050702_lung_E16_NE_2D_step01.2937.2937.1	0.8926	0.0364	1451.14	196	2080.0%	1	K.EEVPTALVEAHVR.K
	TK_050702_lung_E16_NE_2D_step08.3208.3208.2	1.4197	0.2969	1711.08	3	3210.0%	1	K.MKEEVPTALVEAHVR.K
	TK_050702_lung_E16_NE_2D_step09.2778.2778.1	0.4749	0.0073	1576.64	6	1540.0%	1	K.EEVPTALVEAHVRK.V
UQ9CY6689.4%4414.7%2312347411.0(Q9CY66) C430047J18Rik protein
	TK_050702_lung_E16_NE_2D_step01.2802.2802.1	1.2849	0.1714	946.06	1	7500.0%	1	K.FYIDPYK.L
	TK_050702_lung_E16_NE_2D_step01.3034.3034.1	1.5872	0.2433	1076.98	2	6880.0%	1	K.VDEIFGQLR.D
	TK_050702_lung_E16_NE_2D_step01.3033.3033.1	1.3179	0.3572	905.98	1	6670.0%	1	R.DFYFSVK.L
*	TK_050702_lung_E16_NE_2D_step11.2578.2578.1	0.7154	0.0727	926.79	28	1500.0%	1	K.GPPRGGGGGGR.G
UQ99MQ088.8%4618.0%362414939.3(Q99MQ0) Histone acetylase complex subunit MRG15-2
	TK_050702_lung_E16_NE_2D_step03.2978.2978.2	0.8036	0.1178	1883.02	375	1390.0%	1	K.TPGNGDGGSTSETPQPPRK.K
*	TK_050702_lung_E16_NE_2D_step10.5124.5124.3	1.2716	0.0121	3697.89	3	1410.0%	1	R.EDIVALFPVPEGAPSVHHPLLTSSWDEWVPESR.V
	TK_050702_lung_E16_NE_2D_step07.3587.3587.2	2.5421	0.2937	1548.32	1	5420.0%	2	R.VLCFHGPLLYEAK.C
UQ8VE8788.6%6626.0%4504879810.2(Q8VE87) Similar to hypothetical protein FLJ11294 (Fragment)
*	TK_050702_lung_E16_NE_2D_step06.3437.3437.2	1.3194	0.1421	2241.79	1	3610.0%	1	R.GSHPDFPDDFRPDDFHPDK.R
	TK_050702_lung_E16_NE_2D_step06.2528.2528.2	1.9574	0.4373	1387.38	2	4230.0%	1	R.IPPLNPGQGPGPNK.G
	TK_050702_lung_E16_NE_2D_step12.2239.2239.2	1.0869	0.162	1646.31	2	3930.0%	1	R.GPHPSQGPIPFQQQK.A
	TK_050702_lung_E16_NE_2D_step03.3284.3284.2	1.2995	0.4486	2703.64	1	2120.0%	1	R.APFNQEGQSTGPPPLIPGLGQQGAQGR.I
*	TK_050702_lung_E16_NE_2D_step01.2309.2309.1	0.6884	0.1711	1404.52	23	1670.0%	1	R.HEQSGGPEHGPDR.G
*	TK_050702_lung_E16_NE_2D_step08.3344.3344.3	1.3276	0.0597	3029.29	39	1340.0%	1	R.SSSLDGDHHDGYHRDEPFGGPPGSSSSSR.G
UARS2_MOUSE88.2%664.9%8751004526.0(Q99MR6) Arsenite-resistance protein 2
	TK_050702_lung_E16_NE_2D_step12.2539.2539.2	1.4013	0.1896	1393.47	14	3500.0%	1	R.QQMQDFFLAHK.D
	TK_050702_lung_E16_NE_2D_step04.2925.2925.2	1.8497	0.14	1327.42	1	7000.0%	1	R.ISHGEVLEWQK.T
	TK_050702_lung_E16_NE_2D_step11.0667.0667.1	0.4814	9.0E-4	945.22	4	2140.0%	1	K.YHPDEVGK.R
	TK_050702_lung_E16_NE_2D_step08.2548.2548.1	1.3168	0.1331	658.54	1	7500.0%	1	K.HIFNK.H
	TK_050702_lung_E16_NE_2D_step07.2991.2991.1	1.289	0.1056	979.97	2	7140.0%	1	K.FKGPEFVR.K
UDDX3_MOUSE88.1%223.6%661729707.2(Q62167) DEAD-box protein 3 (DEAD-box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1PAS1 related sequence 2)
*	TK_050702_lung_E16_NE_2D_step08.3039.3039.2	2.3406	0.3423	1902.8	1	5000.0%	1	R.VRPCVVYGGAEIGQQIR.D
	TK_050702_lung_E16_NE_2D_step02.0158.0158.1	0.4768	0.0139	854.21	28	1670.0%	1	K.ENGRYGR.R
URB56_HUMAN87.9%6105.6%592618308.0(Q92804) TATA-binding protein associated factor 2N (RNA-binding protein 56) (TAFII68) (TAF(II)68)
*	TK_050702_lung_E16_NE_2D_step01.1435.1435.1	0.2334	0.0142	551.41	1	1670.0%	1	R.NRPY.-
*	TK_050702_lung_E16_NE_2D_step04.2655.2655.1	1.3767	0.0612	957.78	5	5710.0%	2	K.EFHGNIIK.V
*	TK_050702_lung_E16_NE_2D_step07.3760.3760.2	1.18	0.1754	1962.98	1	3440.0%	2	K.AAIDWFDGKEFHGNIIK.V
*	TK_050702_lung_E16_NE_2D_step05.2943.2943.2	2.0962	0.3732	1381.74	1	5910.0%	1	K.TGKPMINLYTDK.D
UQ96EL387.8%52515.2%112121078.8(Q96EL3) Similar to RIKEN cDNA 1110007K17 gene
*	TK_050702_lung_E16_NE_2D_step04.0110.0110.2	1.3925	0.0371	1900.34	2	3440.0%	5	R.HDGSEPCVDVLFGDGHR.L
USUI1_MOUSE87.8%1112.4%113127477.5(P48024) Protein translation factor SUI1 homolog
	TK_050702_lung_E16_NE_2D_step01.2738.2738.1	1.5363	0.2582	1540.77	1	5770.0%	1	K.TLTTVQGIADDYDK.K
UO3584187.8%447.7%504567715.8(O35841) Apoptosis inhibitory protein 5
	TK_050702_lung_E16_NE_2D_step01.3150.3150.1	1.9791	0.2133	1222.1	2	5500.0%	1	K.DAYQVILDGVK.G
	TK_050702_lung_E16_NE_2D_step06.3095.3095.2	1.2559	0.0601	1374.99	7	3640.0%	1	K.STVTLSWKPVQK.V
	TK_050702_lung_E16_NE_2D_step05.3782.3782.2	0.8045	0.0171	1041.46	37	2500.0%	1	K.RLAAQFIPK.F
	TK_050702_lung_E16_NE_2D_step10.3300.3300.1	1.355	0.078	872.75	7	5000.0%	1	K.LETNLRK.L
UQ96AE587.7%111.5%747833446.6(Q96AE5) HSPC049 protein
	TK_050702_lung_E16_NE_2D_step01.2282.2282.1	1.4383	0.3568	1244.81	1	6000.0%	1	K.SPLLSLEWATK.R
UQ9CQB387.7%3321.7%263294219.5(Q9CQB3) 1600025E09Rik protein
*	TK_050702_lung_E16_NE_2D_step05.4024.4024.1	0.4501	0.0	1349.5	7	910.0%	1	R.ETVFKNGSLLIK.S
*	TK_050702_lung_E16_NE_2D_step02.4055.4055.2	2.4215	0.3211	2275.8	2	3250.0%	1	K.SVPPIAVEGENVLLFVHNLPK.N
*	TK_050702_lung_E16_NE_2D_step03.3060.3060.3	1.9103	0.1326	2754.13	3	2170.0%	1	K.IASHSFLTNSTMLGHAYYDRLTVR.N
URS1A_HUMAN87.6%114.7%1291470810.1(P39027) 40S ribosomal protein S15a
*	TK_050702_lung_E16_NE_2D_step01.4207.4207.1	1.4363	0.3648	743.72	1	8000.0%	1	K.ILGFFF.-
UAPOH_MOUSE87.4%339.6%345386198.2(Q01339) Beta-2-glycoprotein I precursor (Apolipoprotein H) (Apo-H) (B2GPI) (Beta(2)GPI) (Activated protein C-binding protein) (APC inhibitor)
*	TK_050702_lung_E16_NE_2D_step04.2307.2307.2	1.1026	0.0904	1106.53	55	3330.0%	1	R.ITCPPPPVPK.F
*	TK_050702_lung_E16_NE_2D_step03.3768.3768.2	1.9825	0.4084	1911.85	1	3750.0%	1	R.ICPKPDDLPFATVVPLK.T
*	TK_050702_lung_E16_NE_2D_step08.2763.2763.1	1.4192	0.1801	867.74	1	8000.0%	1	K.IHFYCK.N
UQ9CT2787.1%358.5%295330128.8(Q9CT27) 2610015J01Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step04.3000.3000.2	1.0665	0.0134	1166.58	12	3890.0%	1	R.LLHDLQIGEK.K
	TK_050702_lung_E16_NE_2D_step12.3724.3724.2	2.0196	0.2633	1728.86	1	4290.0%	2	R.RFPVAPLIPYPLITK.E
UUBIQ_HUMAN86.8%82623.7%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin
	TK_050702_lung_E16_NE_2D_step01.2178.2178.1	1.2079	0.1128	1082.05	1	5620.0%	1	R.TLSDYNIQK.E
	TK_050702_lung_E16_NE_2D_step06.3236.3236.1	1.0784	0.0861	1070.09	1	5000.0%	3	K.ESTLHLVLR.L
UDM3A_MOUSE86.0%446.2%9081016726.7(O88508) DNA (cytosine-5)-methyltransferase 3A (EC 2.1.1.37) (Dnmt3a) (DNA methyltransferase MmuIIIA) (DNA MTase MmuIIIA) (M.MmuIIIA)
	TK_050702_lung_E16_NE_2D_step13.2723.2723.2	1.3294	0.1035	1530.17	8	3330.0%	1	K.GLEPPEEEKNPYK.E
*	TK_050702_lung_E16_NE_2D_step08.3779.3779.3	1.4046	0.0020	2834.53	12	1670.0%	1	K.GGAPAEGEGTETPPEASRAVENGCCVTK.E
	TK_050702_lung_E16_NE_2D_step08.3194.3194.1	1.8285	0.2152	825.88	2	7500.0%	1	R.HLFAPLK.E
	TK_050702_lung_E16_NE_2D_step13.2182.2182.1	0.1878	0.0	854.41	3	710.0%	1	K.GLYEGTGR.L
UO7020086.0%115.4%147169118.8(O70200) Allograft inflammatory factor-1 (Ionized calcium binding adapter molecule 1) (Allograft inflammatory factor 1)
*	TK_050702_lung_E16_NE_2D_step05.3226.3226.1	1.4978	0.2813	823.96	1	5710.0%	1	K.RPTGPPAK.K
UNU50_MOUSE85.9%61210.5%466494956.2(Q9JIH2) Nucleoporin 50 kDa (Nuclear pore-associated protein 60 kDa-like)
*	TK_050702_lung_E16_NE_2D_step05.2952.2952.3	2.0917	0.1659	2279.67	11	2630.0%	1	K.LQQESPFSFHGNKAEDTSEK.V
*	TK_050702_lung_E16_NE_2D_step12.2245.2245.2	1.9348	0.4394	1451.41	1	4230.0%	1	K.GVGTLHLKPTATQK.T
*	TK_050702_lung_E16_NE_2D_step05.2952.2952.2	2.209	0.2844	1520.12	1	6250.0%	1	K.LQQESPFSFHGNK.A
	TK_050702_lung_E16_NE_2D_step07.3840.3840.2	1.4813	0.069	1772.97	5	3210.0%	3	K.HVNTNPLCDLTPIFK.D
UCHD4_HUMAN85.5%685.6%19122179895.9(Q14839) Chromodomain helicase-DNA-binding protein 4 (CHD-4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta)
*	TK_050702_lung_E16_NE_2D_step03.3826.3826.2	1.8704	0.3599	2807.0	1	3180.0%	2	R.DLPYDQASWESEDVEIQDYDLFK.Q
*	TK_050702_lung_E16_NE_2D_step10.5119.5119.2	1.2251	0.0988	2300.12	143	1760.0%	1	K.MLDLLEDFLEHEGYKYER.I
*	TK_050702_lung_E16_NE_2D_step11.4835.4835.3	1.6723	0.1076	3411.46	1	1640.0%	1	K.CCNHPYLFPVAAMEAPKMPNGMYDGSALIR.A
*	TK_050702_lung_E16_NE_2D_step01.4113.4113.3	1.0264	0.0175	2871.45	46	1740.0%	1	K.SSAQLLEDWGMEDIDHVFSEEDYR.T
*	TK_050702_lung_E16_NE_2D_step05.0882.0882.2	0.8361	0.0563	1424.0	8	2500.0%	1	R.APEPTPQQVAQQQ.-
UQ8VHY285.0%9396.6%10351147266.5(Q8VHY2) H+,K+-ATPase alpha 2 subunit
*	TK_050702_lung_E16_NE_2D_step07.3187.3187.2	1.9293	0.1286	2015.69	2	3060.0%	6	K.SSADAFHTAYMELGGLGER.V
	TK_050702_lung_E16_NE_2D_step06.3140.3140.3	1.4335	0.133	2929.15	2	1850.0%	1	K.LIIVEGCQRQDAVVAVTGDGVNDSPALK.K
*	TK_050702_lung_E16_NE_2D_step04.2280.2280.3	0.8954	0.0538	2540.77	33	1000.0%	1	K.DMTPEQLDELLINYQEIVFAR.T
UPR4H_MOUSE84.8%243.0%496571756.8(Q61136) Serine/threonine-protein kinase PRP4 homolog (EC 2.7.1.37)
	TK_050702_lung_E16_NE_2D_step08.3627.3627.2	2.285	0.331	1742.18	1	4640.0%	2	R.ISINQALQHAFIQEK.I
UO9563984.8%114.5%269302558.3(O95639) No arches
	TK_050702_lung_E16_NE_2D_step07.2805.2805.2	2.3905	0.3123	1448.63	1	5910.0%	1	R.GPRPLEQVTCYK.C
UPPOL_MOUSE84.8%8123.9%10121129699.0(P11103) Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30) (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1) (Poly[ADP-ribose] synthetase-1) (msPARP)
	TK_050702_lung_E16_NE_2D_step12.0835.0835.1	0.2368	0.0070	506.62	14	1670.0%	1	R.SWGR.L
	TK_050702_lung_E16_NE_2D_step01.3030.3030.1	1.5137	0.1533	1066.84	1	6110.0%	1	K.GFSLLSAEDK.E
	TK_050702_lung_E16_NE_2D_step08.3188.3188.1	1.7573	0.2101	1239.74	1	6250.0%	2	R.WYHPTCFVK.K
	TK_050702_lung_E16_NE_2D_step12.1736.1736.1	1.2892	0.1792	971.7	1	5000.0%	1	K.KLTVKPGTK.S
	TK_050702_lung_E16_NE_2D_step09.3041.3041.1	1.2925	0.0851	868.93	5	5830.0%	1	R.LLWHGSR.T
UO8855884.4%352.2%12531452077.0(O88558) SHYC
	TK_050702_lung_E16_NE_2D_step12.4865.4865.1	0.2434	0.0	957.68	5	710.0%	2	R.EPLRQAIK.K
	TK_050702_lung_E16_NE_2D_step03.3876.3876.3	1.6713	0.2184	2394.44	3	2110.0%	1	K.YFKQLQVVPLFGDMQIELAR.Y
URFA2_MOUSE84.3%3512.6%270297186.1(Q62193) Replication protein A 32 kDa subunit (RP-A) (RF-A) (Replication factor-A protein 2)
	TK_050702_lung_E16_NE_2D_step04.3548.3548.2	1.4305	0.0623	2180.69	3	2630.0%	2	R.IGDVEISQVTIVGIIRHAEK.A
*	TK_050702_lung_E16_NE_2D_step05.3160.3160.2	2.2811	0.3283	1674.57	1	5770.0%	1	K.ACPRPEGLNFQDLR.S
UQ99KC384.2%4412.5%4324681610.0(Q99KC3) Hypothetical 46.8 kDa protein
	TK_050702_lung_E16_NE_2D_step04.1749.1749.1	0.4661	0.0071	586.47	2	2500.0%	1	K.QRGPK.W
	TK_050702_lung_E16_NE_2D_step07.2885.2885.3	2.2444	0.378	3120.72	1	2240.0%	1	K.FSNSIPQPHAGNSAAATPTEPDLKDQVTPK.S
	TK_050702_lung_E16_NE_2D_step13.2577.2577.2	1.8653	0.4034	1918.34	1	3890.0%	1	K.GPSAPFVSPHSSTRPPPAK.R
	TK_050702_lung_E16_NE_2D_step05.0130.0130.2	1.9279	0.4993	2451.57	1	3260.0%	1	K.FSNSIPQPHAGNSAAATPTEPDLK.D
UQ8R3G184.2%4415.7%351385287.4(Q8R3G1) Similar to protein phosphatase 1, regulatory (Inhibitor) subunit 8
	TK_050702_lung_E16_NE_2D_step05.2672.2672.2	2.2647	0.3294	1313.98	1	6360.0%	1	R.NMVQTAVVPVKK.K
	TK_050702_lung_E16_NE_2D_step05.3378.3378.1	1.0982	0.2217	869.08	10	4290.0%	1	K.KPTPSLLI.-
	TK_050702_lung_E16_NE_2D_step04.2423.2423.2	1.4566	0.0793	1198.89	8	4500.0%	1	R.EKPQTLPSAVK.G
	TK_050702_lung_E16_NE_2D_step03.3868.3868.2	1.5613	0.2494	2685.56	1	2830.0%	1	K.GLLGLPEEETELDNLTEFNTAHNK.R
UQ6052084.1%6186.6%12821461787.3(Q60520) Paired amphipathic helix protein SIN3A
	TK_050702_lung_E16_NE_2D_step09.4080.4080.2	1.3172	0.1449	2005.84	2	2940.0%	4	K.GHPDLIMGFNTFLPPGYK.I
	TK_050702_lung_E16_NE_2D_step06.3668.3668.3	1.1282	0.1017	2886.08	237	870.0%	1	K.VSKPSQLQAHTPASQQTPPLPPYASPR.S
*	TK_050702_lung_E16_NE_2D_step09.4316.4316.3	1.2055	0.0114	4263.08	2	1320.0%	1	R.SPPVQPHTPVTISLGTAPSLQNNQPVHFNHAINYVNKIK.N
URS15_HUMAN83.9%1115.3%1441690910.4(P11174) 40S ribosomal protein S15 (RIG protein) (P11174) 40S ribosomal protein S15 (RIG protein)
	TK_050702_lung_E16_NE_2D_step04.4161.4161.2	1.9281	0.4314	2590.37	1	3330.0%	1	R.GVDLDQLLDMSYEQLMQLYSAR.Q
UQ9D1I883.4%596.2%513575017.0(Q9D1I8) 2610203K23Rik protein
	TK_050702_lung_E16_NE_2D_step05.1891.1891.1	0.2368	0.0035	542.71	9	1670.0%	2	K.LWKP.-
	TK_050702_lung_E16_NE_2D_step07.3640.3640.2	1.6777	0.382	1242.8	1	6670.0%	1	R.YIHLENLLAR.S
	TK_050702_lung_E16_NE_2D_step11.3902.3902.2	1.3448	0.1332	2139.47	2	3240.0%	2	K.WQQHQGLLPPGMTIDLFR.G
UMYH6_MOUSE83.4%885.9%19382235635.7(Q02566) Myosin heavy chain, cardiac muscle alpha isoform (MyHC-alpha)
	TK_050702_lung_E16_NE_2D_step08.4202.4202.2	1.1926	0.074	2345.09	2	2630.0%	1	K.NDLQLQVQAEQDNLNDAEER.C
	TK_050702_lung_E16_NE_2D_step04.4379.4379.2	1.0466	0.0535	2151.0	106	1940.0%	1	K.ALQEAHQQALDDLQAEEDK.V
	TK_050702_lung_E16_NE_2D_step06.2405.2405.2	1.1757	0.0848	1488.04	30	3180.0%	1	R.IEELEEELEAER.T
	TK_050702_lung_E16_NE_2D_step02.3013.3013.2	1.0069	0.0611	1653.15	8	2690.0%	1	K.WLPVYNAEVVAAYR.G
	TK_050702_lung_E16_NE_2D_step05.4696.4696.1	0.2071	0.0	539.1	2	1670.0%	1	R.IEFK.K
	TK_050702_lung_E16_NE_2D_step11.4703.4703.2	0.73	0.1453	2120.68	130	1110.0%	1	K.HADSVAELGEQIDNLQRVK.Q
	TK_050702_lung_E16_NE_2D_step07.2973.2973.2	2.0714	0.3441	1723.98	5	3570.0%	1	R.VQLLHSQNTSLINQK.K
	TK_050702_lung_E16_NE_2D_step13.4341.4341.1	0.2401	0.0138	1457.89	4	450.0%	1	K.GFPNRILYGDFR.Q
UQ9WTU083.3%223.4%10961207999.2(Q9WTU0) PHD-finger protein
	TK_050702_lung_E16_NE_2D_step04.4340.4340.3	1.1996	0.1741	2273.88	6	1250.0%	1	K.KLSWVENYWPDDALLAKPK.V
	TK_050702_lung_E16_NE_2D_step12.3265.3265.2	1.9285	0.4271	1859.02	1	4710.0%	1	K.ALRPPSSPGVFGALQSFK.E
UO7027982.8%112.9%480526286.5(O70279) ES2 protein
*	TK_050702_lung_E16_NE_2D_step05.2406.2406.2	1.8901	0.4699	1508.68	1	5380.0%	1	R.SQLQQAAALNAQHK.Q
UHG17_MOUSE82.8%1116.9%89929110.0(P09602) Nonhistone chromosomal protein HMG-17
	TK_050702_lung_E16_NE_2D_step13.2089.2089.2	1.8892	0.4384	1585.29	2	3930.0%	1	R.LSAKPAPPKPEPKPK.K
UO7513982.8%5116.9%811886969.6(O75139) Hypothetical protein KIAA0644
*	TK_050702_lung_E16_NE_2D_step10.0836.0836.3	0.7327	0.1965	1441.58	2	1430.0%	1	R.FMDSAGGGAGGSLRR.E
*	TK_050702_lung_E16_NE_2D_step03.2658.2658.2	1.4843	0.0586	2023.81	3	3330.0%	3	K.FILCNLTVEAVGADSASVR.W
*	TK_050702_lung_E16_NE_2D_step13.4719.4719.2	0.925	0.0399	2363.59	1	2620.0%	1	R.VCPVAPRDHCAGLVTLPEAGSR.G
UQ9CWX982.4%51711.8%323368139.9(Q9CWX9) 4930588A18Rik protein
*	TK_050702_lung_E16_NE_2D_step08.3703.3703.2	1.9471	0.3644	2165.52	1	5000.0%	4	K.KLPVFPTQDEEVMMLTER.V
	TK_050702_lung_E16_NE_2D_step09.3777.3777.2	0.7515	0.0985	2205.5	16	1840.0%	1	R.GLDIPHVDVVVNFDIPTHSK.D
UQ9JII182.4%4610.8%647719159.2(Q9JII1) Inositol polyphosphate 5-phosphatase
*	TK_050702_lung_E16_NE_2D_step04.4835.4835.2	1.5518	0.245	2416.75	2	2620.0%	1	R.HTEAPGQLEGRMLQGQPPNTEK.K
*	TK_050702_lung_E16_NE_2D_step04.2608.2608.2	2.4826	0.0697	2024.52	1	4120.0%	2	R.FRGSQEDLTVQNGASPCR.G
*	TK_050702_lung_E16_NE_2D_step02.4191.4191.3	1.3038	0.0834	3192.85	12	1550.0%	1	R.RATGSEGGSPSLWSDCLSGMISTSLDLLHR.D
UQ9D9V182.3%114.4%361406617.9(Q9D9V1) 4921506I22Rik protein
	TK_050702_lung_E16_NE_2D_step06.2877.2877.2	1.9174	0.4014	1839.36	1	3670.0%	1	K.LHVGNISPTCTNQELR.A
UQ96PU482.3%465.0%802899858.2(Q96PU4) Np95-like ring finger protein
*	TK_050702_lung_E16_NE_2D_step09.2918.2918.1	0.9796	0.2363	772.69	97	4170.0%	1	K.KPKGQSK.K
*	TK_050702_lung_E16_NE_2D_step02.0147.0147.1	0.2402	1.0E-4	1121.61	13	560.0%	1	R.LIDPGFGIYK.V
*	TK_050702_lung_E16_NE_2D_step06.3620.3620.2	1.928	0.3937	2538.67	1	2730.0%	2	R.ECTIVPSNHYGPIPGIPVGSTWR.F
UQ9BWF382.3%114.4%364403147.1(Q9BWF3) RNA binding motif protein 4
	TK_050702_lung_E16_NE_2D_step06.2877.2877.2	1.9174	0.4014	1839.36	1	3670.0%	1	K.LHVGNISPTCTNKELR.A
URS4_HUMAN82.1%3312.6%2622946710.2(P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10)
	TK_050702_lung_E16_NE_2D_step05.3004.3004.1	1.467	0.2632	829.74	1	8000.0%	1	K.HWMLDK.L
	TK_050702_lung_E16_NE_2D_step01.3019.3019.2	1.9556	0.0064	1784.0	4	3750.0%	1	K.FDTGNLCMVTGGANLGR.I
	TK_050702_lung_E16_NE_2D_step10.3420.3420.2	0.8624	0.0749	1168.25	17	3330.0%	1	K.GNKPWISLPR.G
USKIP_HUMAN82.0%5510.6%536614959.5(Q13573) Nuclear protein SkiP (Ski-interacting protein) (SNW1 protein) (Nuclear receptor coactivator NCoA-62)
*	TK_050702_lung_E16_NE_2D_step06.2491.2491.2	1.9032	0.4151	1135.61	1	6250.0%	1	R.REPPPYGYR.K
*	TK_050702_lung_E16_NE_2D_step01.3833.3833.2	1.3857	0.2264	2748.89	1	2710.0%	1	R.LLEDFGDGGAFPEIHVAQYPLDMGR.K
*	TK_050702_lung_E16_NE_2D_step04.2577.2577.1	1.3405	0.0681	950.7	5	5000.0%	1	K.IKYDAIAR.Q
*	TK_050702_lung_E16_NE_2D_step01.2198.2198.1	1.2137	0.2488	1554.62	1	4290.0%	1	R.YTPSQQGVAFNSGAK.Q
UZ236_HUMAN82.0%110.5%18452036588.1(Q9UL36) Zinc finger protein 236
*	TK_050702_lung_E16_NE_2D_step03.3048.3048.1	1.7208	0.2033	1057.78	3	6880.0%	1	K.QAELQDEPK.H
UQ8WWT482.0%223.3%641720117.3(Q8WWT4) RNA-binding protein splice variant a
	TK_050702_lung_E16_NE_2D_step04.3124.3124.2	1.8642	0.4633	1700.64	1	4060.0%	1	K.GKPVGLVGVTELSDAQK.K
	TK_050702_lung_E16_NE_2D_step12.1895.1895.1	0.2375	0.0105	596.18	6	1670.0%	1	R.RPYY.-
UQ9QYY582.0%2214.2%218218436.5(Q9QYY5) MTAFII30 protein
*	TK_050702_lung_E16_NE_2D_step02.2493.2493.2	1.8649	0.4464	2064.75	1	3330.0%	1	K.ASPAGTAGGPVAGVATAGTGPVAAR.A
	TK_050702_lung_E16_NE_2D_step10.2857.2857.1	0.7735	0.2143	792.53	2	5000.0%	1	K.KPHYFT.-
UPLD2_MOUSE81.8%467.3%9331061687.4(P97813) Phospholipase D2 (EC 3.1.4.4) (PLD 2) (Choline phosphatase 2) (Phosphatidylcholine-hydrolyzing phospholipase D2) (PLD1C) (mPLD2)
	TK_050702_lung_E16_NE_2D_step10.3225.3225.2	1.3239	0.1354	2160.62	7	2780.0%	1	R.WSAGTLENSILNAYLHTIR.E
*	TK_050702_lung_E16_NE_2D_step01.4133.4133.2	2.464	0.1062	2237.09	5	2750.0%	1	R.FAVTHSPAREAAAEDIPSLPR.G
*	TK_050702_lung_E16_NE_2D_step07.3869.3869.3	0.9235	0.0089	3019.4	4	1300.0%	2	K.STSTANNLPFMIPGGQCATVQVLRSVDR.W
UQ9CZ1781.8%1112.7%110118949.8(Q9CZ17) 2810417H13Rik protein
	TK_050702_lung_E16_NE_2D_step08.2496.2496.2	2.0938	0.3374	1519.66	1	4230.0%	1	K.YAGGNPVCVRPTPK.W
ULAMA_MOUSE81.5%223.9%665742107.0(P48678) Lamin A
	TK_050702_lung_E16_NE_2D_step05.3428.3428.2	2.0008	0.359	1244.37	1	5500.0%	1	R.LKDLEALLNSK.E
	TK_050702_lung_E16_NE_2D_step12.1955.1955.3	1.3509	0.013	1667.03	23	2500.0%	1	R.TLEGELHDLRGQVAK.L
UQ96I0581.4%112.9%345387737.5(Q96I05) Hypothetical protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.3119.3119.1	1.4955	0.2429	1172.33	2	5560.0%	1	R.GLNIIEQQQK.E
UQ91YR781.2%686.4%9411067228.1(Q91YR7) Hypothetical 106.7 kDa protein
	TK_050702_lung_E16_NE_2D_step05.2472.2472.2	1.5834	0.2808	1123.5	6	4440.0%	1	K.ALEHVPNSVR.L
	TK_050702_lung_E16_NE_2D_step05.2052.2052.1	0.6058	0.1534	966.83	3	2500.0%	1	K.EEIEKYR.M
	TK_050702_lung_E16_NE_2D_step03.2945.2945.2	0.8947	0.1278	1825.48	5	2330.0%	1	R.ESLEALLQRAVAHCPK.A
*	TK_050702_lung_E16_NE_2D_step01.4046.4046.2	1.8992	0.4016	2304.33	1	3680.0%	2	K.LEWVLGNISAAQELCEEALR.H
	TK_050702_lung_E16_NE_2D_step08.2846.2846.1	1.3518	0.081	836.91	27	5830.0%	1	R.HLPQSVR.I
UHS47_HUMAN81.2%394.6%417462678.3(P29043) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Colligin 1)
	TK_050702_lung_E16_NE_2D_step09.4098.4098.2	0.9176	0.0226	2222.26	35	1940.0%	3	R.TDGALLVNAMFFKPHWDEK.F
UQ91XD481.1%202929.8%541589396.1(Q91XD4) Similar to formiminotransferase cyclodeaminase
*	TK_050702_lung_E16_NE_2D_step02.4189.4189.2	1.1314	0.1118	2358.09	10	2140.0%	1	R.REAQELNLPVVGSQLVGLVPLK.A
*	TK_050702_lung_E16_NE_2D_step07.3073.3073.1	0.9608	0.0117	1431.93	27	2500.0%	1	R.AFAACLEAIKLPK.N
*	TK_050702_lung_E16_NE_2D_step03.4220.4220.2	1.289	0.1688	2207.58	6	2500.0%	17	R.EAQELNLPVVGSQLVGLVPLK.A
*	TK_050702_lung_E16_NE_2D_step08.3075.3075.3	1.388	0.1161	2050.34	199	1910.0%	1	K.GEHPRMGALDVCPFIPVR.G
UQ8TDT381.1%112.7%517560908.0(Q8TDT3) Putative G-protein coupled receptor
*	TK_050702_lung_E16_NE_2D_step01.3843.3843.2	2.4513	0.1553	1530.56	1	6920.0%	1	R.NGTEISITSLVLRK.L
UQ91YJ181.1%2412.4%258295289.4(Q91YJ1) Hypothetical 29.5 kDa protein
*	TK_050702_lung_E16_NE_2D_step08.3812.3812.3	2.6016	0.4354	3433.58	1	2260.0%	2	K.DMLNIPSSASHSLHPVLLPSDVFDQPQSVGNK.K
UQ8VCV880.7%112.3%394452985.2(Q8VCV8) Hypothetical 45.3 kDa protein
	TK_050702_lung_E16_NE_2D_step01.2685.2685.1	2.0324	0.0853	1181.46	3	6880.0%	1	R.EEEEEEEEK.E
UQ9NYI680.5%114.4%275307829.9(Q9NYI6) Mesenchymal stem cell protein DSC43 (Similar to mesenchymal stem cell protein DSC43)
	TK_050702_lung_E16_NE_2D_step06.2607.2607.2	1.8756	0.3965	1422.65	1	5910.0%	1	R.FAQSSNYAQHLR.V
UQ91YX080.2%337.5%664744796.2(Q91YX0) Hypothetical 74.5 kDa protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.3761.3761.2	2.4297	0.1235	1824.19	4	5000.0%	1	K.ELLHLPLSQKGPFWR.C
*	TK_050702_lung_E16_NE_2D_step02.4036.4036.2	0.9762	0.0812	2120.92	5	2500.0%	1	R.SGQVCGTKGQDIDVLVCQR.L
*	TK_050702_lung_E16_NE_2D_step02.3109.3109.3	1.2488	0.1689	1783.76	209	2000.0%	1	K.DTRHPTDPLASFPGLR.L
UHTF4_MOUSE80.1%112.7%706757846.9(Q61286) Transcription factor 12 (Transcription factor HTF-4) (E-box-binding protein) (DNA-binding protein HTF4) (Class A helix-loop-helix transcription factor ME1)
*	TK_050702_lung_E16_NE_2D_step05.2676.2676.2	2.026	0.3391	2016.43	1	3610.0%	1	K.TRPTTLGSSQFSGSGMDER.G
UHD_HUMAN80.1%224421.6%31443478596.2(P42858) Huntingtin (Huntington's disease protein) (HD protein)
*	TK_050702_lung_E16_NE_2D_step08.0031.0031.2	1.223	0.1	2329.42	2	2890.0%	21	R.RVHPSEDEILAQYLVPATCK.A
*	TK_050702_lung_E16_NE_2D_step13.3929.3929.3	0.8097	0.0188	3431.75	421	860.0%	1	K.LLGIAMELFLLCSDDAESDVRMVADECLNK.V
UP9786879.9%666.4%15911777639.7(P97868) Retinoblastoma binding protein 6 (Proliferation potential-related protein) (P53-associated cellular protein) (PACT)
*	TK_050702_lung_E16_NE_2D_step01.0144.0144.2	0.8685	0.2687	1047.78	93	2500.0%	1	K.DREHSGSEK.D
*	TK_050702_lung_E16_NE_2D_step13.4629.4629.3	1.8297	0.1282	3610.35	12	1480.0%	1	R.ETDEAAFEPDYNESDSESNVSVKEEEAVASISK.D
*	TK_050702_lung_E16_NE_2D_step03.2116.2116.2	1.1165	0.0271	1524.42	100	2690.0%	1	K.SAVKPKPQLSHSSR.L
	TK_050702_lung_E16_NE_2D_step11.4081.4081.3	1.0569	0.0349	3101.05	4	1120.0%	1	K.GYQVPVLGTPSLLGQSLLHGQLIPTTGPVR.I
*	TK_050702_lung_E16_NE_2D_step05.2810.2810.2	1.9193	0.3653	1685.93	1	5000.0%	1	K.TTQPIQSVGKPSSIIK.N
UQ9DCB779.8%116.3%1591826210.1(Q9DCB7) 3100001N19Rik protein
	TK_050702_lung_E16_NE_2D_step01.3658.3658.1	2.0592	0.0166	1269.79	1	6670.0%	1	K.CMQLTDFILK.F
ULRP1_HUMAN79.8%682.4%45445045795.4(Q07954) Low-density lipoprotein receptor-related protein 1 precursor (LRP) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD91)
*	TK_050702_lung_E16_NE_2D_step01.4801.4801.3	1.8694	0.1976	3305.9	22	1300.0%	1	R.AQDEFECANGECINFSLTCDGVPHCKDK.S
*	TK_050702_lung_E16_NE_2D_step10.3632.3632.3	1.3246	0.0195	2737.49	46	1590.0%	1	R.SERPPIFEIRMYDAQQQQVGTNK.C
*	TK_050702_lung_E16_NE_2D_step09.4252.4252.3	1.6643	0.2262	4493.48	27	1010.0%	1	R.CQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCR.E
*	TK_050702_lung_E16_NE_2D_step07.3313.3313.2	1.0788	0.01	2016.9	4	2940.0%	2	R.RITIVENVGSVEGLAYHR.G
*	TK_050702_lung_E16_NE_2D_step03.3569.3569.3	1.1566	0.131	2206.48	52	1390.0%	1	R.LCNGVQDCMDGSDEGPHCR.E
UQ96RE779.7%4163.4%527572585.7(Q96RE7) NAC1 protein
*	TK_050702_lung_E16_NE_2D_step02.4659.4659.2	1.9798	0.3403	2067.51	3	3240.0%	4	R.VKTEQQESDSVQCMPVAK.R
UQ9CVU979.6%246.0%2322547110.7(Q9CVU9) 1700027L20Rik protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.1885.1885.1	2.0834	0.3922	1522.97	6	3850.0%	2	R.GAQELLGPRPGLRR.G
UCAB5_MOUSE79.6%5728.3%173197294.5(Q9JLK3) Calcium-binding protein CaBP5
	TK_050702_lung_E16_NE_2D_step05.4462.4462.1	0.2352	0.0	486.23	5	1670.0%	1	K.LTPR.E
*	TK_050702_lung_E16_NE_2D_step07.3181.3181.3	1.0771	0.0136	2881.12	65	1500.0%	1	K.EFDANGDGEITLAELQQAMQRLLGEK.L
*	TK_050702_lung_E16_NE_2D_step03.4073.4073.2	1.9742	0.3275	2232.05	1	3330.0%	2	R.TMGYMPTEMELTELGQQIR.M
URP1_MOUSE79.4%8281.9%20952343867.5(P56716) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein homolog)
	TK_050702_lung_E16_NE_2D_step01.4883.4883.1	0.6595	0.0237	1313.27	1	3330.0%	1	R.RRPRPWLSSR.S
	TK_050702_lung_E16_NE_2D_step01.1273.1273.1	0.4868	0.0136	531.68	3	3330.0%	1	K.MRVK.K
	TK_050702_lung_E16_NE_2D_step01.4874.4874.1	0.9155	0.062	841.58	4	5000.0%	1	K.TYLDSDK.D
*	TK_050702_lung_E16_NE_2D_step04.4443.4443.2	1.4417	0.1427	2066.55	1	3330.0%	5	K.NDNWSGNTNQETGKSLVAK.D
UQ921K278.8%355.3%10141127219.0(Q921K2) Similar to ADP-ribosyltransferase (NAD+, poly (ADP-ribose) polymerase)
*	TK_050702_lung_E16_NE_2D_step02.3672.3672.3	1.3768	0.3213	3876.64	1	1910.0%	2	R.IFPPESSAPAPLALPLSVTSAPTAVNSSAPADKPLSNMK.I
*	TK_050702_lung_E16_NE_2D_step02.3172.3172.2	1.8603	0.3742	1699.3	1	4290.0%	1	R.VVCEDFLQDVSASTK.S
UTE2I_MOUSE78.5%225.6%393433534.8(Q91VL8) Telomeric repeat binding factor 2 interacting protein 1 (TRF2-interacting telomeric protein Rap1)
*	TK_050702_lung_E16_NE_2D_step07.3175.3175.2	1.2425	0.1636	1320.53	6	3890.0%	1	R.RPDGYPIWCR.Q
	TK_050702_lung_E16_NE_2D_step06.2940.2940.2	2.3872	0.1548	1403.3	1	7270.0%	1	K.SSLTQHSWQSLK.D
UQ9CXA278.4%226.5%354378046.7(Q9CXA2) 2810055F11Rik protein
*	TK_050702_lung_E16_NE_2D_step01.3355.3355.2	1.1459	0.0177	1898.22	116	2330.0%	1	R.IALQYHKGLLQLNQTR.A
*	TK_050702_lung_E16_NE_2D_step07.3104.3104.2	2.3976	0.0364	917.55	2	10000.0%	1	R.RLVFEPR.G
UQ9R19078.3%335.2%668750309.7(Q9R190) Metastasis associated protein MTA2 (Mta2 protein)
*	TK_050702_lung_E16_NE_2D_step13.4021.4021.2	1.287	0.01	1907.8	15	2650.0%	1	K.TPTQLEGAARGTTEPHSR.G
	TK_050702_lung_E16_NE_2D_step03.2684.2684.2	2.2829	0.2924	1182.32	1	6500.0%	1	K.DLVAQAPLKPK.T
	TK_050702_lung_E16_NE_2D_step11.2222.2222.1	0.7444	0.127	734.81	12	4000.0%	1	K.IHPLVR.L
UQ9NNY378.2%113.4%1762086710.8(Q9NNY3) Ribosomal protein L18a
*	TK_050702_lung_E16_NE_2D_step04.3119.3119.1	1.8135	0.1786	784.24	1	7000.0%	1	K.RPDTFF.-
UBTF3_MOUSE78.1%2220.1%204220119.4(Q64152) Transcription factor BTF3 (RNA polymerase B transcription factor 3)
	TK_050702_lung_E16_NE_2D_step05.3095.3095.2	1.9299	0.3519	1961.26	1	4720.0%	1	K.VQASLAANTFTITGHAETK.Q
*	TK_050702_lung_E16_NE_2D_step04.2575.2575.3	1.4437	0.1341	2132.41	88	1790.0%	1	R.VRGGXPGGEATPSLPLGGXXXR.E
USY19_HUMAN77.9%1112.2%98109939.7(Q99731) Small inducible cytokine A19 precursor (CCL19) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (EBI1-ligand chemokine) (ELC) (Beta chemokine exodus-3) (CK beta-11)
*	TK_050702_lung_E16_NE_2D_step02.4075.4075.2	1.8392	0.3816	1316.21	1	3180.0%	1	R.VPAVVFTTLRGR.Q
UDIA1_HUMAN77.6%162263.0%12481389785.4(O60610) Diaphanous protein homolog 1 (Diaphanous-related formin 1) (DRF1)
*	TK_050702_lung_E16_NE_2D_step01.4593.4593.2	2.1644	0.0232	2206.26	4	3610.0%	15	R.FENNELFAKLTLTFSAQTK.T
*	TK_050702_lung_E16_NE_2D_step04.2441.2441.3	1.6195	0.2549	2188.33	6	2350.0%	1	R.MEMDDFNEVFQILLNTVK.D
URL9_MOUSE77.6%115.7%1922188110.0(P51410) 60S ribosomal protein L9
	TK_050702_lung_E16_NE_2D_step04.3157.3157.2	2.2798	0.292	1299.98	1	7000.0%	1	R.KFLDGIYVSEK.G
UG10_HUMAN77.3%116.9%144168449.1(P41223) G10 protein homolog (EDG-2)
	TK_050702_lung_E16_NE_2D_step04.2167.2167.2	1.7943	0.4164	1306.76	1	7220.0%	1	R.IIECTHCGCR.G
UQ924Z677.1%222.5%11251286766.4(Q924Z6) RANBP20
	TK_050702_lung_E16_NE_2D_step07.3143.3143.2	1.2808	0.0568	2146.98	3	2500.0%	1	R.LEELDESYIEKFTDFLR.L
	TK_050702_lung_E16_NE_2D_step01.2863.2863.1	1.8379	0.1672	1308.62	1	5500.0%	1	R.YLRQSLEVVAK.V
UQ9DAW677.0%226.7%521583707.3(Q9DAW6) 1600015H11Rik protein
	TK_050702_lung_E16_NE_2D_step06.3064.3064.2	1.9937	0.3363	2224.99	1	3530.0%	1	K.SKEEYQQTWYHEGPNSLK.V
	TK_050702_lung_E16_NE_2D_step03.3397.3397.3	1.5155	0.0679	2085.86	27	2340.0%	1	R.VMWHPSGRFLGTTCYDR.S
UALS_MOUSE76.3%112.7%603669606.6(P70389) Insulin-like growth factor binding protein complex acid labile chain precursor (ALS)
*	TK_050702_lung_E16_NE_2D_step01.3687.3687.2	2.3391	0.2491	1747.79	1	5330.0%	1	R.LETPAEGLFSSLGRLR.Y
UO8862476.0%242.6%346388578.1(O88624) ETOILE
	TK_050702_lung_E16_NE_2D_step01.2979.2979.1	1.7702	0.0705	1096.12	1	6250.0%	2	K.YLPELMAEK.D
UQ96PW575.9%5117.3%832938348.1(Q96PW5) Hypothetical protein KIAA1923 (Fragment)
*	TK_050702_lung_E16_NE_2D_step05.3034.3034.2	2.2681	0.2747	2239.37	1	4170.0%	3	K.SLGELYILNVNDIQETCQK.N
*	TK_050702_lung_E16_NE_2D_step04.4069.4069.2	0.6276	0.0085	2190.22	18	1050.0%	1	K.DLVQVWSLATVATDLCLGPK.S
	TK_050702_lung_E16_NE_2D_step01.3407.3407.3	2.5027	0.2564	2527.06	3	2380.0%	1	K.SDQLGLPQTLQQEFSLINVQIR.N
URL24_HUMAN75.8%118.3%1571777911.3(P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30)
	TK_050702_lung_E16_NE_2D_step01.3226.3226.1	1.7439	0.1814	1262.06	1	5420.0%	1	R.AITGASLADIMAK.R
UQ6116475.6%557.7%736837296.9(Q61164) 11-zinc-finger transcription factor
	TK_050702_lung_E16_NE_2D_step12.1861.1861.2	1.3761	0.3754	1296.63	1	4550.0%	1	K.VVGNMKPPKPTK.I
	TK_050702_lung_E16_NE_2D_step04.3273.3273.2	1.1774	0.2621	1033.0	21	5710.0%	1	K.QLLDMHFK.R
	TK_050702_lung_E16_NE_2D_step02.3479.3479.2	2.0482	0.325	2872.2	1	3330.0%	1	K.DVDVSVYDFEEEQQEGLLSEVNAEK.V
	TK_050702_lung_E16_NE_2D_step02.3483.3483.3	2.5077	0.4082	3581.55	1	1750.0%	1	R.YTEEGKDVDVSVYDFEEEQQEGLLSEVNAEK.V
	TK_050702_lung_E16_NE_2D_step07.2708.2708.1	1.4277	0.2315	769.68	2	6000.0%	1	K.MHILQK.H
UPOR1_MOUSE75.4%396.8%296323518.4(Q60932) Voltage-dependent anion-selective channel protein 1 (VDAC-1) (mVDAC1) (mVDAC5) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin)
	TK_050702_lung_E16_NE_2D_step07.3392.3392.2	1.7855	0.435	2106.34	1	3420.0%	3	K.VNNSSLIGLGYTQTLKPGIK.L
UQ1467375.1%241.7%92010612210.0(Q14673) Hypothetical protein KIAA0164 (BK211L9.1)
*	TK_050702_lung_E16_NE_2D_step04.3301.3301.2	2.1945	0.2905	2016.07	1	5000.0%	2	K.YFLHDDRDDGVDYWAK.R
URL10_MOUSE74.7%4623.9%2132447310.1(P45634) 60S ribosomal protein L10 (QM protein homolog)
	TK_050702_lung_E16_NE_2D_step07.2489.2489.2	1.3677	0.1431	1189.82	50	3180.0%	1	R.GAFGKPQGTVAR.V
	TK_050702_lung_E16_NE_2D_step06.2753.2753.2	2.1817	0.2878	1115.88	2	6110.0%	1	K.RLIPDGCGVK.Y
	TK_050702_lung_E16_NE_2D_step08.3823.3823.3	2.2674	0.2541	3283.79	1	2230.0%	2	K.AKVDEFPLCGHMVSDEYEQLSSEALEAAR.I
UQ9CQX874.6%2423.5%1021110110.0(Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene)
*	TK_050702_lung_E16_NE_2D_step07.3068.3068.2	1.2871	0.3182	2338.46	9	1960.0%	2	K.LSASEALGSAALPSHSSAISQHSK.G
UQ925F273.9%113.0%394418109.3(Q925F2) Endothelial cell-selective adhesion molecule
*	TK_050702_lung_E16_NE_2D_step04.2949.2949.1	1.6542	0.1854	1328.15	2	5000.0%	1	K.CNVTLDVMTGSK.A
UKLFC_MOUSE73.8%226.0%402442159.8(O35738) Krueppel-like factor 12 (Transcriptional repressor AP-2rep)
*	TK_050702_lung_E16_NE_2D_step02.3184.3184.2	0.8502	0.0431	1756.23	160	1790.0%	1	K.FACSISPFSIESTRR.Q
	TK_050702_lung_E16_NE_2D_step06.2816.2816.1	1.5578	0.1884	1041.77	2	5620.0%	1	R.KHTGVKPFK.C
UQ9UEF773.7%223.4%10121161338.0(Q9UEF7) Klotho protein
*	TK_050702_lung_E16_NE_2D_step01.4245.4245.2	2.3134	0.1058	2209.15	10	2750.0%	1	R.RPRPPPPSLSLLLVLLGLGGR.R
	TK_050702_lung_E16_NE_2D_step04.0127.0127.2	1.2214	0.1537	1489.26	14	3750.0%	1	R.YAADQFEPKASMK.H
UQ8TF5273.7%4412.8%662730645.5(Q8TF52) Hypothetical protein KIAA1949 (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.0099.0099.1	0.4449	0.0071	928.47	49	1430.0%	1	R.RPSPGEMR.D
*	TK_050702_lung_E16_NE_2D_step05.3220.3220.2	1.9299	0.3264	2442.01	2	2860.0%	1	K.EEWPVPGVAPKETAELSETLTR.E
*	TK_050702_lung_E16_NE_2D_step01.3747.3747.3	1.9862	0.2257	2731.11	4	1900.0%	1	K.WRPDSRESQEQSLVQLEATEWR.L
*	TK_050702_lung_E16_NE_2D_step03.4253.4253.3	1.1669	0.1325	3494.15	9	1330.0%	1	R.DIEAQTQKPEPPESAEKLLESPGVEAGEGEAEK.E
UQ9288873.4%112.4%9121025165.7(Q92888) Guanine nucleotide exchange factor p115-RhoGEF
*	TK_050702_lung_E16_NE_2D_step01.4149.4149.3	2.6946	0.3079	2599.57	1	2500.0%	1	K.AVEVHVLLLDDLLLLLQRQDER.L
UQ9BXT573.1%9214.6%27893153626.2(Q9BXT5) TEX15
*	TK_050702_lung_E16_NE_2D_step06.3356.3356.2	1.7146	0.1321	2012.37	1	4410.0%	1	K.VEMQRSLPGSLLPLENPK.D
*	TK_050702_lung_E16_NE_2D_step07.2656.2656.1	1.7622	0.0739	1174.89	2	6250.0%	1	K.HEEKQTSWK.E
*	TK_050702_lung_E16_NE_2D_step02.2976.2976.3	1.4421	0.0281	2198.03	22	2110.0%	1	K.ENINSSTGNDCDATCIGHTK.A
*	TK_050702_lung_E16_NE_2D_step05.3118.3118.2	1.6372	0.1098	1426.62	5	4550.0%	1	R.VSDCEIDTDKNK.S
*	TK_050702_lung_E16_NE_2D_step08.4179.4179.3	1.7779	0.0858	3923.8	1	1670.0%	1	K.TASSSVCVASNAAIQIASATMPALSLNNDDHQIYQFK.E
*	TK_050702_lung_E16_NE_2D_step03.3568.3568.3	2.6295	0.3367	3412.41	1	1750.0%	4	R.NTDVNHTSENQNSESLFTEPSNVTTIDDGSR.C
UK1CJ_MOUSE73.1%111.2%569577115.1(P02535) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (56 kDa cytokeratin) (Keratin, type I cytoskeletal 59 kDa)
	TK_050702_lung_E16_NE_2D_step04.2733.2733.1	1.7269	0.1606	995.9	1	6670.0%	1	K.IKEWYEK.H
UQ99JN672.9%7710.6%792864968.1(Q99JN6) Similar to KIAA0663 gene product
*	TK_050702_lung_E16_NE_2D_step08.3519.3519.3	2.3556	0.054	2275.61	4	3030.0%	1	R.MVTLSSKPEEPLVRLSLSER.L
	TK_050702_lung_E16_NE_2D_step06.2451.2451.2	1.5829	0.0863	970.85	3	5000.0%	1	K.VNVKPSVVK.V
*	TK_050702_lung_E16_NE_2D_step05.2630.2630.3	1.3145	0.0291	1604.69	8	3390.0%	1	K.TPALQPSPDVHNGLR.V
	TK_050702_lung_E16_NE_2D_step08.3152.3152.2	1.7552	0.2774	2165.03	1	3160.0%	1	R.RLSSASTGKPPLSVEDDFEK.L
*	TK_050702_lung_E16_NE_2D_step05.3375.3375.3	1.5401	0.1877	2021.68	41	2370.0%	1	K.TVSLPTVAVSKGQPEEPAGR.A
UQ9294672.9%61012.0%600638798.6(Q92946) FUSE binding protein 3 (Fragment)
	TK_050702_lung_E16_NE_2D_step06.3300.3300.2	0.8504	0.1633	2568.86	11	1960.0%	1	R.NGPGFHNDIDSNSTIQEILIPASK.V
	TK_050702_lung_E16_NE_2D_step02.3155.3155.2	1.4353	0.2183	1940.81	2	2650.0%	2	K.MVMIQDGPLPTGADKPLR.I
	TK_050702_lung_E16_NE_2D_step05.0123.0123.2	1.8509	0.34	1569.84	1	5770.0%	2	K.SINQQSGAHVELQR.N
	TK_050702_lung_E16_NE_2D_step08.3862.3862.2	0.6862	0.033	1822.73	185	1330.0%	1	R.GVPQQIEVARQLIDEK.V
UUBPD_HUMAN72.8%579.0%863972995.5(Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15) (Ubiquitin thiolesterase 13) (Ubiquitin-specific processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3)
*	TK_050702_lung_E16_NE_2D_step06.2867.2867.3	1.9275	0.2231	2671.03	1	2190.0%	1	R.ARGLQPGEEELPDISPPIVIPDDSK.D
*	TK_050702_lung_E16_NE_2D_step01.3702.3702.2	0.9054	0.0080	1928.93	1	3330.0%	2	K.EEHKPQQNGISPRMFK.A
*	TK_050702_lung_E16_NE_2D_step02.3721.3721.3	1.0381	0.0564	2716.3	117	1670.0%	1	R.GLQPGEEELPDISPPIVIPDDSKDR.L
*	TK_050702_lung_E16_NE_2D_step11.4555.4555.3	1.4792	0.0017	3922.97	43	1250.0%	1	R.IFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVK.S
UQ9D7J271.9%115.5%325347869.2(Q9D7J2) 2310006I24Rik protein
	TK_050702_lung_E16_NE_2D_step12.2447.2447.2	1.7637	0.4326	1752.73	1	3820.0%	1	R.SPLLAGGSPPQPVVPAHK.D
UHH1R_HUMAN71.3%113.3%487557849.2(P35367) Histamine H1 receptor
*	TK_050702_lung_E16_NE_2D_step05.2286.2286.2	1.9335	0.3217	1529.39	2	4670.0%	1	K.DAGGGSVLKSPSQTPK.E
UAP1_MOUSE70.9%2212.9%334359448.7(P05627) Transcription factor AP-1 (Activator protein 1) (AP1) (Proto-oncogene c-jun) (V-jun avian sarcoma virus 17 oncogene homolog) (Jun A) (AH119)
	TK_050702_lung_E16_NE_2D_step08.3440.3440.2	1.6132	0.3029	2556.01	1	3180.0%	1	R.LIIQSSNGHITTTPTPTQFLCPK.N
	TK_050702_lung_E16_NE_2D_step03.3588.3588.2	1.8448	0.3304	2349.98	1	3950.0%	1	K.VMNHVNSGCQLMLTQQLQTF.-
UQ91YJ370.8%114.0%226261789.1(Q91YJ3) Similar to HSPC144 protein
*	TK_050702_lung_E16_NE_2D_step07.3452.3452.2	2.31	0.1313	1145.6	1	6250.0%	1	K.RFIPLEELK.T
UQ9D3E270.4%2211.2%285329615.2(Q9D3E2) 5830446M03Rik protein
	TK_050702_lung_E16_NE_2D_step09.3840.3840.2	1.5706	0.3253	2164.47	2	2780.0%	1	K.FIAHVPVPSQQEIEEALVR.R
	TK_050702_lung_E16_NE_2D_step07.3095.3095.2	2.1251	0.2855	1549.09	1	6670.0%	1	R.RPFLASECTELPK.A
UQ9H6N870.2%114.5%287314176.5(Q9H6N8) Hypothetical protein FLJ22032
	TK_050702_lung_E16_NE_2D_step04.2905.2905.1	1.4061	0.3104	1469.01	3	3750.0%	1	R.SVPLAEEEDFDSK.E
UCH60_MOUSE70.0%3311.0%573609566.2(P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65)
*	TK_050702_lung_E16_NE_2D_step05.3562.3562.2	1.905	0.3214	1907.04	1	4120.0%	1	K.ISSVQSIVPALEIANAHR.K
	TK_050702_lung_E16_NE_2D_step04.2651.2651.2	1.1942	0.0387	2605.48	6	2170.0%	1	R.KPLVIIAEDVDGEALSTLVLNRLK.V
	TK_050702_lung_E16_NE_2D_step03.4198.4198.2	1.5681	0.3832	2115.81	4	3000.0%	1	R.ALMLQGVDLLADAVAVTMGPK.G
UQ9BYE269.1%227.6%581626908.7(Q9BYE2) Membrane-type mosaic serine protease
*	TK_050702_lung_E16_NE_2D_step11.3605.3605.2	1.6863	0.1534	2316.07	1	2390.0%	1	R.SLQQDTAPSRLGTSSGGDPGGAPR.V
	TK_050702_lung_E16_NE_2D_step05.2714.2714.2	2.128	0.2731	1836.47	3	2890.0%	1	R.ASPAQASPAGTPPGRASPGR.A
UO1505469.1%351.9%16161741148.7(O15054) Hypothetical protein KIAA0346 (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.2449.2449.1	1.2059	0.0356	1156.25	5	4500.0%	2	R.YGGSFAELGPR.I
*	TK_050702_lung_E16_NE_2D_step01.1929.1929.3	1.2442	0.0598	2262.9	114	1940.0%	1	R.AKVLPPLEQVWNLLHLEHK.R
UQ99M3369.0%116.5%443483718.7(Q99M33) Src associated in mitosis, 68 kDa
*	TK_050702_lung_E16_NE_2D_step11.4118.4118.3	2.6816	0.2713	3336.98	1	2230.0%	1	K.YLPELMAEKDSLDPSFTHAMQLLSVEIEK.I
USOA2_MOUSE68.3%3315.6%525608248.9(O88908) Sterol O-acyltransferase 2 (EC 2.3.1.26) (Cholesterol acyltransferase 2) (Acyl coenzyme A:cholesterol acyltransferase 2) (ACAT-2)
*	TK_050702_lung_E16_NE_2D_step11.3581.3581.3	2.6357	0.3164	3141.72	4	2080.0%	1	R.TWNVVVHDWLYSYVYQDGLWLLGRR.A
*	TK_050702_lung_E16_NE_2D_step05.2956.2956.3	1.443	0.0749	3384.73	14	1480.0%	1	R.AGGAWMLGASLGCVLLAAHAVVLCVLPVHVSVR.H
*	TK_050702_lung_E16_NE_2D_step01.3202.3202.3	1.9177	0.156	2876.66	2	2070.0%	1	R.WNYVAKNFAQVLGCLLYACFILGR.L
UQ9JL3568.3%5115.2%406453124.4(Q9JL35) Nucleosome binding protein 1 (Nucleosome binding protein 45) (NBP-45) (GARP45 protein)
	TK_050702_lung_E16_NE_2D_step08.3480.3480.2	1.937	0.3084	1656.9	1	4640.0%	3	R.LSAMPVPFTPELKPK.R
	TK_050702_lung_E16_NE_2D_step10.0610.0610.1	0.3593	0.0069	522.67	2	2500.0%	1	R.ASTSR.K
	TK_050702_lung_E16_NE_2D_step13.2242.2242.2	0.4188	0.0216	1814.13	18	1000.0%	1	R.LSAMPVPFTPELKPKR.A
UACHG_MOUSE68.1%113.9%519587457.0(P04760) Acetylcholine receptor protein, gamma chain precursor
*	TK_050702_lung_E16_NE_2D_step01.3962.3962.2	2.2557	0.2205	2207.22	3	3160.0%	1	K.QASPAIQACVDACNLMARAR.R
UQ1474868.0%117.5%134154527.4(Q14748) LFA-3(delta D2) (Fragment)
*	TK_050702_lung_E16_NE_2D_step04.3248.3248.1	1.9204	0.0946	1238.94	1	5000.0%	1	K.FFLYVLGHSR.H
UQ9Y4F467.9%444.5%16961868458.5(Q9Y4F4) Hypothetical protein KIAA0423 (Fragment)
*	TK_050702_lung_E16_NE_2D_step09.4317.4317.3	0.6611	0.086	4296.62	149	250.0%	1	K.LDLTMDSPSLSSSPNINSYSESGVYSQESLTSSLSTTPQGK.R
*	TK_050702_lung_E16_NE_2D_step02.2395.2395.2	1.2501	0.2451	1857.43	1	2670.0%	1	K.SMDQELDTTVKVLLHK.A
*	TK_050702_lung_E16_NE_2D_step01.0104.0104.1	0.9538	0.0279	888.8	110	4290.0%	1	K.NLRSGVSR.A
*	TK_050702_lung_E16_NE_2D_step01.3133.3133.1	1.974	0.0934	1324.83	6	5000.0%	1	K.YVPSKDLPYIK.D
UQ9CWV167.9%3314.7%489537166.8(Q9CWV1) 5730432L01Rik protein
*	TK_050702_lung_E16_NE_2D_step08.3274.3274.2	2.2695	0.2022	2015.58	1	4710.0%	1	R.LKVAPGEQTDPIPHQLLR.K
	TK_050702_lung_E16_NE_2D_step02.3904.3904.3	1.3966	0.0506	3341.99	17	1420.0%	1	K.MGNQHQALLEAMEQQSISLAKAGVVCSLPAR.T
*	TK_050702_lung_E16_NE_2D_step01.3887.3887.3	0.9665	0.0142	2798.96	2	1820.0%	1	R.FISALNSIAERTYNNIFQYHQLR.Q
UATPB_MOUSE67.8%5134.2%529563015.3(P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14)
	TK_050702_lung_E16_NE_2D_step02.4711.4711.1	0.3131	0.3425	413.55	8	1670.0%	2	R.GPIK.T
	TK_050702_lung_E16_NE_2D_step09.4138.4138.2	1.0296	0.0187	2025.64	1	2650.0%	3	R.FLSQPFQVAEVFTGHMGK.L
UQ9H1B767.8%356.2%796826598.2(Q9H1B7) Polyglutamine-containing protein
	TK_050702_lung_E16_NE_2D_step06.2764.2764.2	1.787	0.207	1882.55	1	4330.0%	2	R.LEDTHFVQCPSVPSHK.F
*	TK_050702_lung_E16_NE_2D_step13.4537.4537.3	1.2574	0.0759	3610.65	45	1330.0%	1	R.FFKEGVPGADMLPQPYLDASCPMLPTALVSLSR.A
UMCM6_MOUSE67.7%467.2%821928675.5(P97311) DNA replication licensing factor MCM6 (Mis5 homolog)
*	TK_050702_lung_E16_NE_2D_step04.3016.3016.2	2.0672	0.2926	1674.11	1	4670.0%	2	R.TSILAAANPVSGHYDR.S
*	TK_050702_lung_E16_NE_2D_step11.3033.3033.2	0.9298	0.0046	1595.09	4	2690.0%	1	R.LVFLACHVAPTNPR.F
	TK_050702_lung_E16_NE_2D_step02.3068.3068.3	1.8976	0.0020	3313.54	1	1960.0%	1	R.DEESHEFVIEAGALMLADNGVCCIDEFDK.M
UQ920D367.1%3514.0%178195606.2(Q920D3) FKSG20
	TK_050702_lung_E16_NE_2D_step09.4066.4066.3	1.5391	0.2912	2596.43	1	1460.0%	1	K.KPADMPQGSLAFLEQASANIPAPLK.Q
UQ9CT4167.1%225.0%561637384.8(Q9CT41) 2600017A12Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step03.4028.4028.2	1.7148	0.4556	2333.28	1	4170.0%	1	K.NMFHPMDFEDDPLVLNEIR.E
*	TK_050702_lung_E16_NE_2D_step03.2381.2381.1	0.3584	0.0092	991.88	4	1250.0%	1	K.ESEGEDSLK.K
UQ9EPV867.1%246.8%7385478.4(Q9EPV8) Ubiquitin-like 5 (Beacon) (1110030M22Rik protein)
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	2	K.IVLKK.W
UQ8WYK167.1%6128.0%13061456226.3(Q8WYK1) Caspr5
*	TK_050702_lung_E16_NE_2D_step03.3626.3626.3	0.9493	0.1181	4244.71	41	560.0%	1	R.HATVAPVTVHGTLTESSCGFMVDSDVNAVTTVHSSSDPFGK.T
	TK_050702_lung_E16_NE_2D_step06.3247.3247.3	1.3509	0.0335	3173.91	35	1380.0%	1	R.TWNKDGLLLSTELSEGSGTLLLSLEGGILR.L
	TK_050702_lung_E16_NE_2D_step12.4568.4568.3	1.6054	0.124	3064.53	11	1520.0%	1	K.GETDALDIDYELSFGGIPVPGKPGTFLKK.N
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	3	R.LVIQK.M
UBRC2_MOUSE67.1%10165.3%33293706666.7(P97929) Breast cancer type 2 susceptibility protein
*	TK_050702_lung_E16_NE_2D_step07.3724.3724.3	1.3144	0.0311	3246.98	7	1380.0%	1	K.SSLPSNYKESGSSGNTQSIEVSLQLSQMER.N
*	TK_050702_lung_E16_NE_2D_step06.3189.3189.3	1.4216	0.0021	3489.82	2	1610.0%	1	K.GSPFISEVAVNMNSEELFPDSGNNFAFQVTNK.C
*	TK_050702_lung_E16_NE_2D_step12.4711.4711.3	2.2681	0.2478	3020.4	50	1600.0%	1	K.GMLEEFDLIRTEHTLQHSPIPEDVSK.I
*	TK_050702_lung_E16_NE_2D_step07.3781.3781.3	1.3592	0.2513	3677.88	1	1800.0%	1	R.LGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQR.V
*	TK_050702_lung_E16_NE_2D_step07.3797.3797.2	1.2193	0.0556	1763.15	70	2000.0%	1	R.LQPGSLYLTKSSTLPR.I
*	TK_050702_lung_E16_NE_2D_step01.1897.1897.2	1.3287	0.0071	1494.99	9	3570.0%	1	R.GGVTVDAVGQPPIKR.S
*	TK_050702_lung_E16_NE_2D_step02.3653.3653.3	1.5231	0.0271	2535.63	8	2250.0%	1	K.RTQYQQLPVSSETLLQVYQPR.E
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	3	K.IVIQK.D
UQ9NVE367.1%463.7%11741363787.5(Q9NVE3) Hypothetical protein FLJ10787 (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	2	K.LVIKK.M
*	TK_050702_lung_E16_NE_2D_step11.4531.4531.2	1.0074	0.074	2727.6	56	1360.0%	1	K.GLHLNLGDTIMKDYEYLWNTISK.L
*	TK_050702_lung_E16_NE_2D_step01.2710.2710.3	1.3894	0.078	1834.99	107	1670.0%	1	R.TALILHLQKNTTIDVR.T
UOPA1_MOUSE67.1%240.5%9601113397.5(P58281) Dynamin-like 120 kDa protein, mitochondrial precursor (Large GTP binding protein) (LargeG)
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	2	K.LVLQK.D
UEAA2_MOUSE67.1%4104.5%572620306.7(P43006) Excitatory amino acid transporter 2 (Sodium-dependent glutamate/aspartate transporter 2) (GLT-1)
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	3	K.IVIKK.G
*	TK_050702_lung_E16_NE_2D_step05.0504.0504.2	0.704	0.1207	2487.72	7	1000.0%	1	K.MGEQAKLMVEFFNILNEIVMK.L
UZ148_MOUSE67.1%390.6%794887516.5(Q61624) Zinc finger protein 148 (Zinc finger DNA binding protein 89) (Transcription factor ZBP-89) (G-rich box-binding protein) (Beta enolase repressor factor 1) (Transcription factor BFCOL1)
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	3	K.LVLKK.I
UQ8TDZ067.1%358.8%442499517.8(Q8TDZ0) SKP2-like protein type gamma
	TK_050702_lung_E16_NE_2D_step01.2101.2101.1	1.5604	0.1603	600.9	1	7500.0%	2	R.LVLKQ.-
*	TK_050702_lung_E16_NE_2D_step11.4791.4791.3	2.0257	0.2687	3929.85	5	1360.0%	1	R.CYDIIPETLLAGIYQNQNSHSNYNVSQVSHEGFK.V
UQ8VE3667.0%111.7%287327778.6(Q8VE36) Similar to hypothetical protein DKFZp586J1119 (Fragment)
	TK_050702_lung_E16_NE_2D_step01.1971.1971.1	1.8194	0.1006	535.67	1	7500.0%	1	K.SNVSK.I
UQ9D0D467.0%4610.5%3133527410.0(Q9D0D4) 1500031M22Rik protein (RIKEN cDNA 1500031M22 gene)
	TK_050702_lung_E16_NE_2D_step08.1973.1973.3	1.1996	0.0659	2228.34	122	1310.0%	1	K.AALRPTDVVLEVGPGTGNMTVK.L
*	TK_050702_lung_E16_NE_2D_step13.4865.4865.3	1.3124	0.1361	3436.04	6	1410.0%	2	K.NPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVK.L
UQ9R1C766.8%576.5%9531084817.7(Q9R1C7) Formin binding protein 11
*	TK_050702_lung_E16_NE_2D_step03.3502.3502.2	1.7322	0.4129	2164.89	1	3420.0%	2	K.ELEDLEGYQNTIVAGGLITK.S
*	TK_050702_lung_E16_NE_2D_step09.4180.4180.3	1.3371	0.0134	3058.12	29	1570.0%	1	K.ELEDLEGYQNTIVAGGLITKSNLHAMIK.A
	TK_050702_lung_E16_NE_2D_step07.2717.2717.1	1.1576	0.2387	913.78	12	5000.0%	1	K.SNLHAMIK.A
	TK_050702_lung_E16_NE_2D_step02.3368.3368.3	1.3675	0.1503	4067.96	2	1210.0%	1	R.ESFQIFLDELHEHGQLHSMSSWMELYPTISSDIR.F
UGBB3_HUMAN66.8%2213.8%340372215.7(P16520) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain 3)
*	TK_050702_lung_E16_NE_2D_step11.3598.3598.3	0.881	0.2071	2997.2	18	870.0%	1	R.ADQELICFSHESIICGITSVAFSLSGR.L
	TK_050702_lung_E16_NE_2D_step02.4139.4139.2	2.2659	0.145	2090.57	1	5530.0%	1	R.KACADVTLAELVSGLEVVGR.V
UQ8TEV066.5%221.4%17401892956.4(Q8TEV0) BRG1-binding protein ELD/OSA1
*	TK_050702_lung_E16_NE_2D_step01.2663.2663.1	1.0669	0.1618	1202.94	70	3000.0%	1	R.HMDGMYGPPAK.R
*	TK_050702_lung_E16_NE_2D_step10.2922.2922.2	1.7019	0.4019	1705.51	3	3080.0%	1	R.INHESQWPSHVSQR.Q
UQ9CS9266.5%336.8%695795399.7(Q9CS92) 5730406M06Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step11.1689.1689.3	0.7892	0.1029	1933.42	108	740.0%	1	R.SPIALPVKQEPPQIDAVK.R
	TK_050702_lung_E16_NE_2D_step12.4561.4561.3	1.0416	0.0186	3509.93	22	1070.0%	1	K.EYQMMLLTKMLLTEILLDVTDEEIYYVAK.D
	TK_050702_lung_E16_NE_2D_step04.4204.4204.2	1.729	0.3965	2374.22	2	2890.0%	1	K.MLLTEILLDVTDEEIYYVAK.D
UO9485166.2%7157.2%11241266898.6(O94851) Hypothetical protein KIAA0750
*	TK_050702_lung_E16_NE_2D_step04.0795.0795.1	0.4868	0.0051	1304.11	3	910.0%	1	K.AQATSPDLESMR.K
*	TK_050702_lung_E16_NE_2D_step06.2817.2817.1	1.9124	0.0186	974.91	4	6250.0%	2	K.EGGNQNKVK.S
*	TK_050702_lung_E16_NE_2D_step07.2889.2889.3	1.993	0.1329	3627.89	38	1180.0%	3	R.RDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLLG.-
*	TK_050702_lung_E16_NE_2D_step03.3676.3676.3	1.1543	0.0811	2881.12	126	1460.0%	1	R.QLQLILFKVALMLGVEIHVNVEFVK.V
UQ8R40966.1%4108.1%356402435.4(Q8R409) Cardiac lineage protein 1
	TK_050702_lung_E16_NE_2D_step10.3061.3061.1	0.7941	0.0179	1271.72	3	2220.0%	3	R.VRELELELDR.L
*	TK_050702_lung_E16_NE_2D_step07.3176.3176.2	1.7691	0.3364	2164.35	1	3890.0%	1	K.HQLPPLQTNACPELSSLEK.G
UA2A2_HUMAN66.0%8642.8%9391039607.0(O94973) Adapter-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) (Huntingtin-interacting protein HYPJ)
*	TK_050702_lung_E16_NE_2D_step09.3289.3289.3	1.6934	0.1443	3018.27	7	1800.0%	8	R.ALLLSTYIKFVNLFPEVKPTIQDVLR.S
UQ8WUN365.9%113.1%422491438.7(Q8WUN3) Hypothetical protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step08.2970.2970.2	2.2553	0.1376	1614.14	2	4580.0%	1	K.AFNRQSNLIQHQR.I
UO1503165.9%7195.2%18412054106.3(O15031) Hypothetical protein KIAA0315 (Fragment)
*	TK_050702_lung_E16_NE_2D_step13.4118.4118.3	1.0167	0.0659	3819.95	56	970.0%	1	R.RPVVEQALYQFSNLLNSKSFLINFIHTLENQR.E
*	TK_050702_lung_E16_NE_2D_step08.2914.2914.3	1.9426	0.2323	2507.13	18	1820.0%	1	R.TEAGAFEYVPDPTFENFTGGVKK.Q
*	TK_050702_lung_E16_NE_2D_step03.3090.3090.3	1.0276	0.0233	2213.11	31	1530.0%	1	K.TLTETDLYCEPPEVQPPPK.R
*	TK_050702_lung_E16_NE_2D_step07.3009.3009.2	1.4874	0.1019	2253.05	2	2500.0%	4	R.GTNLNKAMTLQEAEAFVGAER.C
UQ8R06865.8%228.8%554613768.4(Q8R068) Similar to cyclin K
*	TK_050702_lung_E16_NE_2D_step07.3203.3203.2	1.7845	0.3259	2389.23	1	2830.0%	1	R.KPPLAPALGEAEATGPVETSDLPK.V
*	TK_050702_lung_E16_NE_2D_step02.4252.4252.3	1.7639	0.18	2941.97	1	2290.0%	1	R.FIFDVGTRLGLHYDTLANGIIYFHR.F
UQ8VI9265.8%338.5%742849576.8(Q8VI92) 2',5'-oligoadenylate synthetase-like 11
*	TK_050702_lung_E16_NE_2D_step04.3033.3033.2	2.0064	0.2978	1639.67	3	4580.0%	1	K.EWLSSPCFQVEQK.G
*	TK_050702_lung_E16_NE_2D_step06.3184.3184.2	2.1632	0.0688	1659.1	10	3930.0%	1	K.HEHALVVQVSVPGQR.I
*	TK_050702_lung_E16_NE_2D_step11.3150.3150.3	1.5664	0.0765	3916.4	1	1990.0%	1	K.YALELLTVYAWEQGSGTDDFDIAEGLRTVLDLVIK.Y
UP7038865.6%555.6%13121534876.9(P70388) RAD50
	TK_050702_lung_E16_NE_2D_step06.3039.3039.2	1.7117	0.3758	2214.92	1	3530.0%	1	K.VFQGTDEQLNDLYHNHQR.T
	TK_050702_lung_E16_NE_2D_step12.2620.2620.1	0.2413	0.0	709.98	1	2500.0%	1	K.FYRVK.K
*	TK_050702_lung_E16_NE_2D_step11.2193.2193.3	1.5364	0.2313	1926.61	1	2500.0%	1	R.DEMLGLVPVRQSIIDLK.E
	TK_050702_lung_E16_NE_2D_step06.2141.2141.1	0.2385	0.0	540.9	3	1250.0%	1	R.LAPDK.L
*	TK_050702_lung_E16_NE_2D_step07.4308.4308.3	0.8075	0.1398	3018.33	54	830.0%	1	K.QIISFFSPLTILVGPNGAGKTTIIECLK.Y
UQ9ES8665.5%1129.1%5560785.9(Q9ES86) snRNP core protein SMX5a
	TK_050702_lung_E16_NE_2D_step01.4019.4019.2	2.2343	0.0416	1862.05	5	4330.0%	1	-.MVFWGKPLASPRESPR.A
UQ9QYC265.5%112.6%532576458.8(Q9QYC2) RRM-type RNA-binding protein BRPTB (PTB-like protein)
	TK_050702_lung_E16_NE_2D_step09.2571.2571.2	2.2412	0.0416	1476.33	5	4620.0%	1	-.MDGIVTEVAVGVKR.G
UQ6402865.5%338.7%10121063679.1(Q64028) Early development regulator protein 1 (RAE-28) (Polyhomeotic protein homolog) (MPH1)
	TK_050702_lung_E16_NE_2D_step09.3724.3724.3	1.5311	0.2385	3011.66	3	1750.0%	1	K.GTGVVQPLPAAQTVTVSQGSQTEAESAAAKK.A
*	TK_050702_lung_E16_NE_2D_step05.4834.4834.3	1.3848	0.0662	3412.35	35	1210.0%	1	K.GGPTASSPVVAQVPAAFYMQSVHLPGKAQTLAVK.R
*	TK_050702_lung_E16_NE_2D_step04.3661.3661.2	1.7073	0.3767	2217.24	1	4320.0%	1	R.QPGSAQAQALGLAQLAAAVPTPR.G
UO9488865.4%3511.4%490549915.2(O94888) Hypothetical protein KIAA0794 (Fragment)
*	TK_050702_lung_E16_NE_2D_step07.3556.3556.3	1.0772	0.1587	3798.12	21	1030.0%	1	R.RPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEK.A
*	TK_050702_lung_E16_NE_2D_step08.3218.3218.2	1.7722	0.3183	2304.23	2	2250.0%	2	R.APIPQKQEILVEPEPLFGAPK.R
UELV2_MOUSE65.3%228.1%360395779.1(Q60899) ELAV-like protein 2 (Hu-antigen B) (HuB) (ELAV-like neuronal protein 1) (Nervous system-specific RNA binding protein Mel-N1)
	TK_050702_lung_E16_NE_2D_step05.3584.3584.2	1.8147	0.3082	1735.52	2	4290.0%	1	K.TNQAILSQLYQSPNR.R
	TK_050702_lung_E16_NE_2D_step13.5115.5115.2	0.7522	0.0942	1652.21	73	2310.0%	1	R.FRLDNLLNMAYGVK.S
UQ9ERM565.0%240.5%12261385866.0(Q9ERM5) Protein tyrosine phosphatase BK
*	TK_050702_lung_E16_NE_2D_step01.4047.4047.1	0.6506	0.0071	788.67	17	4000.0%	2	K.YNVFSR.V
UQ9CW7964.9%112.3%264304206.2(Q9CW79) 0710001G09Rik protein (Fragment)
	TK_050702_lung_E16_NE_2D_step07.2708.2708.1	1.4277	0.2315	769.68	2	6000.0%	1	K.HMLLKK.E
UQ9D57864.7%2222.6%1241386510.1(Q9D578) 4930505H01Rik protein
*	TK_050702_lung_E16_NE_2D_step01.2750.2750.1	1.7335	0.1206	1244.1	4	5500.0%	1	K.AVHPFSEVSLR.R
*	TK_050702_lung_E16_NE_2D_step03.2964.2964.2	0.4528	0.0016	2136.1	143	620.0%	1	-.MSCPFSSLIQQHRVQYR.G
UQ9NYU264.6%668.0%15551771895.6(Q9NYU2) UDP-glucose:glycoprotein glucosyltransferase 1 precursor
*	TK_050702_lung_E16_NE_2D_step11.4499.4499.2	1.1117	0.1847	2516.97	7	2050.0%	1	R.ILASPVELALVVMKDLSQNFPTK.A
*	TK_050702_lung_E16_NE_2D_step06.4903.4903.3	1.3713	0.1262	3410.14	14	1470.0%	1	R.SEDIYRIYSHDGTDSPPDADEVVIVLNNFK.S
*	TK_050702_lung_E16_NE_2D_step07.3593.3593.2	0.8851	0.0425	1927.62	39	2370.0%	1	K.GDASGACAAGALPVTGVCYK.M
*	TK_050702_lung_E16_NE_2D_step03.2337.2337.2	1.1375	0.1256	1273.9	104	2730.0%	1	R.AITKTAVSSELR.T
*	TK_050702_lung_E16_NE_2D_step02.3095.3095.3	2.8417	0.24	2205.76	3	3330.0%	1	K.KYPYVEVNSILGIDSAYDR.N
*	TK_050702_lung_E16_NE_2D_step11.2754.2754.2	0.8216	0.0173	2247.24	67	1580.0%	1	K.EPVYLSGYGVELAIKSTEYK.A
UKLC2_MOUSE64.1%226.2%599666627.2(O88448) Kinesin light chain 2 (KLC 2)
*	TK_050702_lung_E16_NE_2D_step01.3409.3409.1	1.4934	0.1747	1363.04	3	4500.0%	1	R.KLDEMLPQEEK.G
*	TK_050702_lung_E16_NE_2D_step03.0084.0084.3	0.9684	0.0703	2791.96	16	1100.0%	1	R.ALLAPLASHEAGEAEPGSQERCLLLR.R
UADT1_MOUSE64.1%114.7%298329049.7(P48962) ADP,ATP carrier protein, heart/skeletal muscle isoform T1 (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) (mANC1)
	TK_050702_lung_E16_NE_2D_step04.3499.3499.2	2.2253	0.1107	1693.01	2	4230.0%	1	R.YFPTQALNFAFKDK.Y
UQ9BTA964.1%4611.1%604656919.3(Q9BTA9) Hypothetical protein
	TK_050702_lung_E16_NE_2D_step02.4104.4104.3	1.3326	0.1013	3314.78	48	1410.0%	1	R.SSSQRSPSPGPNHTSNSSNASNATVVPQNSSAR.S
	TK_050702_lung_E16_NE_2D_step03.3508.3508.2	1.9554	0.0572	1613.56	8	3930.0%	2	K.LPTPTSSVPAQKTER.K
	TK_050702_lung_E16_NE_2D_step08.3128.3128.3	1.1607	0.0764	2229.69	4	2500.0%	1	R.EEAHNMGTIHMSEICTELK.N
UQ91ZA564.1%5725.9%228244515.1(Q91ZA5) Nuclear pore complex-associated intranuclear protein TPR (Fragment)
	TK_050702_lung_E16_NE_2D_step11.2713.2713.2	0.8681	0.1465	1753.06	2	2000.0%	1	R.LTIHAPPQELGPPVQR.I
	TK_050702_lung_E16_NE_2D_step13.2258.2258.2	1.5672	0.2434	1067.69	1	6250.0%	2	R.RPPHPLPPR.L
	TK_050702_lung_E16_NE_2D_step07.2927.2927.2	0.9875	0.0933	1404.52	5	3330.0%	1	R.TVPSTPTLVVPHR.T
	TK_050702_lung_E16_NE_2D_step04.3556.3556.2	1.7515	0.3527	2362.58	1	4000.0%	1	R.GLQLTPGIGGMQQHFFDDEDR.T
UO4314964.0%577.8%9861107936.3(O43149) Hypothetical protein KIAA0399 (Fragment)
*	TK_050702_lung_E16_NE_2D_step09.3614.3614.2	1.8427	0.1252	1971.03	1	4690.0%	2	K.LISSTESELQQSYAKQR.R
*	TK_050702_lung_E16_NE_2D_step05.4891.4891.2	0.6966	0.211	2573.93	2	1090.0%	1	R.CAAQALQNIAAISLAINYPNKATR.L
*	TK_050702_lung_E16_NE_2D_step13.2191.2191.1	0.2298	0.0086	819.47	7	1000.0%	1	R.LWNVEC.-
	TK_050702_lung_E16_NE_2D_step13.4498.4498.3	0.7346	0.1624	3390.95	177	520.0%	1	K.TTHLLFSLGAVCLDSRVGLDWACSMAEILR.S
UQ9DA1563.9%61017.6%459518019.8(Q9DA15) 1700023E05Rik protein
*	TK_050702_lung_E16_NE_2D_step03.3768.3768.3	1.7547	0.1512	2867.27	2	1980.0%	1	R.WPVSYAATHSQVSERVQELANPHTR.G
*	TK_050702_lung_E16_NE_2D_step11.3223.3223.3	1.0341	0.163	2828.47	1	1000.0%	2	R.LLEVQNGDEAEAVGEEGQEEDYEGSK.T
*	TK_050702_lung_E16_NE_2D_step02.2855.2855.2	1.2156	0.0234	1018.57	133	4380.0%	1	K.RETVPGTTR.Y
*	TK_050702_lung_E16_NE_2D_step08.2494.2494.2	2.2141	0.1547	2253.75	1	3000.0%	2	K.ISFSTLSAVATPRIVDLAHPR.I
UQ8VG3963.6%119.3%312354568.0(Q8VG39) Olfactory receptor MOR172-3
*	TK_050702_lung_E16_NE_2D_step03.2322.2322.3	2.5272	0.3853	3482.27	1	2320.0%	1	R.LFACILQSFFFAVYVTTEVIFLSMMAYDR.Y
UQ91WN163.5%2213.9%288328277.2(Q91WN1) Hypothetical 32.8 kDa protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step09.2962.2962.2	1.0308	0.0772	2185.12	11	1840.0%	1	K.AVYDEQGTVDEDSAGLNQDR.D
*	TK_050702_lung_E16_NE_2D_step02.3827.3827.2	2.1892	0.2052	2388.46	1	4740.0%	1	K.GDMDQIMESVLCVQYTDEPR.I
UQ9CWI563.4%113.4%2042404711.6(Q9CWI5) Ribosomal protein L15
	TK_050702_lung_E16_NE_2D_step06.2476.2476.1	1.5237	0.1628	881.83	2	6670.0%	1	R.NTLQLHR.Y
UQ9Y36363.4%113.3%428469219.1(Q9Y363) CGI-49 protein
	TK_050702_lung_E16_NE_2D_step01.3979.3979.2	2.2193	0.0738	1477.79	1	6150.0%	1	R.NVSNLKPVPLIGPK.L
UQ9D5K363.4%228.5%484550626.5(Q9D5K3) 4930429H24Rik protein (RIKEN cDNA 4930429H24 gene)
	TK_050702_lung_E16_NE_2D_step12.4275.4275.2	0.8059	0.022	2491.9	29	1250.0%	1	R.LSSVECYDSFSNRWTEVAPLK.E
	TK_050702_lung_E16_NE_2D_step11.4201.4201.2	2.2092	0.0583	2165.52	1	3680.0%	1	K.RCITAVSLNNLIYVAGGLTK.A
URS19_HUMAN63.1%116.9%1441592910.3(P39019) 40S ribosomal protein S19
*	TK_050702_lung_E16_NE_2D_step01.1902.1902.1	1.3657	0.3524	942.97	1	5000.0%	1	R.IAGQVAAANK.K
UTPM4_HUMAN63.1%41010.1%248285224.7(P07226) Tropomyosin alpha 4 chain (Tropomyosin 4) (TM30p1)
*	TK_050702_lung_E16_NE_2D_step13.5198.5198.2	1.0728	0.1401	2850.65	4	1880.0%	1	K.LAQAKEENVGLHQTLDQTLNELNCI.-
*	TK_050702_lung_E16_NE_2D_step11.4105.4105.2	0.8134	0.0458	2343.1	12	2110.0%	3	K.EENVGLHQTLDQTLNELNCI.-
UQ96FI762.6%247.0%287323647.2(Q96FI7) Hypothetical protein
*	TK_050702_lung_E16_NE_2D_step05.3150.3150.2	2.187	0.0021	2239.8	14	2630.0%	2	-.MLSVVKNQNIGFNNAAFITR.N
UR13A_MOUSE62.4%226.9%2022333311.0(P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen)
	TK_050702_lung_E16_NE_2D_step05.2706.2706.1	1.4218	0.2278	939.79	1	7140.0%	1	R.LAHEVGWK.Y
	TK_050702_lung_E16_NE_2D_step09.2683.2683.1	1.2275	0.3119	652.6	2	5000.0%	1	R.GHLLGR.L
UQ9D5X562.1%351.7%574642149.4(Q9D5X5) 4921509B22Rik protein
*	TK_050702_lung_E16_NE_2D_step01.2059.2059.1	1.631	0.0029	1153.86	1	6110.0%	2	K.KTFNTLVLSK.E
UQ9Y6U662.1%15934.5%16311789956.3(Q9Y6U6) WUGSC:H_RG015P03.1 protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step09.0050.0050.2	2.1916	0.1629	2015.98	1	3750.0%	3	K.VKNFLLEENVPPEDIEK.V
*	TK_050702_lung_E16_NE_2D_step07.3935.3935.3	1.3481	0.1245	3642.17	8	1450.0%	1	R.ISGAPCQPCACNNNIDVTDPESCSRVTGECLR.C
*	TK_050702_lung_E16_NE_2D_step05.4428.4428.1	0.2406	0.0	636.1	1	1250.0%	1	R.TDENR.L
*	TK_050702_lung_E16_NE_2D_step06.0600.0600.1	0.443	0.0044	544.11	2	2500.0%	9	K.AQEAK.S
*	TK_050702_lung_E16_NE_2D_step12.2812.2812.2	1.0325	0.092	1564.41	114	1920.0%	1	K.NQIESISEQAEVSK.N
UCXAR_MOUSE61.9%61818.1%365399487.0(P97792) Coxsackievirus and adenovirus receptor homolog precursor (mCAR)
	TK_050702_lung_E16_NE_2D_step10.3692.3692.3	2.4773	0.0908	3416.25	5	1750.0%	4	R.VHFTSNDVKSGDASINVTNLQLSDIGTYQCK.V
	TK_050702_lung_E16_NE_2D_step12.4259.4259.3	1.2406	0.0678	2938.86	3	1850.0%	1	R.TSTARSYIGSNHSSLGSMSPSNMEGYSK.T
	TK_050702_lung_E16_NE_2D_step10.4719.4719.1	0.4603	0.2572	656.13	8	1670.0%	1	K.APGVANK.K
USMF1_HUMAN61.9%222.1%19022059456.7(O14497) SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 (SWI-SNF complex protein p270) (B120)
	TK_050702_lung_E16_NE_2D_step02.2216.2216.2	1.6953	0.497	1581.62	1	4060.0%	1	R.GPSPSPVGSPASVAQSR.S
	TK_050702_lung_E16_NE_2D_step11.2681.2681.3	1.4136	0.233	2263.41	3	1190.0%	1	K.AGPPVPASHIAPAPVQPPMIRR.D
UZ341_HUMAN61.9%111.7%773847669.0(Q9BYN7) Zinc finger protein 341
*	TK_050702_lung_E16_NE_2D_step01.2971.2971.1	1.3977	0.2406	1575.13	1	4580.0%	1	K.YKCPFSTHTGCSK.E
UH2AO_HUMAN61.7%2422.5%1291396410.9(P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615) (P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615)
	TK_050702_lung_E16_NE_2D_step04.4280.4280.3	2.5172	0.3984	2937.42	1	2050.0%	2	R.VGAGAPVYMAAVLEYLTAEILELAGNAAR.D
UO0899561.6%6614.4%10781187055.0(O08995) Myelin transcription factor 1
*	TK_050702_lung_E16_NE_2D_step12.3783.3783.1	0.4495	0.01	1252.85	2	1500.0%	1	-.MMDGIGIRTEK.Y
*	TK_050702_lung_E16_NE_2D_step08.4175.4175.3	1.262	0.0437	3236.56	2	1670.0%	1	R.MAYSSFPYFLSYSAESGQVGIGGELATVGSR.D
*	TK_050702_lung_E16_NE_2D_step05.3822.3822.3	0.9171	0.0874	3745.07	15	980.0%	1	K.QPFWLSKSSYSSYQGIIATSLLNLGQIAEEALVK.E
*	TK_050702_lung_E16_NE_2D_step10.2590.2590.3	2.5317	0.3648	3380.16	1	1900.0%	1	R.IPPEILAMHENVLKCPTPGCTGQGHVNSYR.N
*	TK_050702_lung_E16_NE_2D_step11.2217.2217.2	0.6975	0.0173	2098.39	44	1250.0%	1	R.QSSTSAPSSSMTSPQSSQASR.Q
*	TK_050702_lung_E16_NE_2D_step08.3803.3803.3	1.7917	0.1231	3114.9	4	1760.0%	1	R.DLNESNSGMEAAMVQLQSQISSMERNLK.N
UQ8VH5161.6%113.0%5305949410.1(Q8VH51) Transcription coactivator CAPER
	TK_050702_lung_E16_NE_2D_step02.3856.3856.2	1.6966	0.4172	1909.8	1	4670.0%	1	R.LYVGSLHFNITEDMLR.G
UTCPB_MOUSE61.6%4417.0%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta)
	TK_050702_lung_E16_NE_2D_step09.2760.2760.1	0.9346	0.0302	876.47	107	4290.0%	1	R.VRVDSTAK.V
	TK_050702_lung_E16_NE_2D_step03.3600.3600.2	1.936	0.2828	2366.69	1	2380.0%	1	R.TVYGGGCSEMLMAHAVTQLANR.T
	TK_050702_lung_E16_NE_2D_step04.4011.4011.3	0.9991	0.1303	3213.74	46	710.0%	1	K.LIEEVMIGEDKLIHFSGVALGEACTIVLR.G
	TK_050702_lung_E16_NE_2D_step09.3306.3306.3	1.2715	0.0657	3452.18	122	1130.0%	1	R.EALLSSAVDHGSDEARFWQDLMNIAGTTLSSK.L
UQ9H5U961.5%1110.7%205234566.9(Q9H5U9) Hypothetical protein FLJ23017
*	TK_050702_lung_E16_NE_2D_step08.3859.3859.2	1.6918	0.3886	2419.96	4	2380.0%	1	K.GSKPITLPLDACSLSELCEMAK.H
UO1500061.5%114.5%154170435.7(O15000) Match: multiple proteins (Fragment)
*	TK_050702_lung_E16_NE_2D_step01.2366.2366.1	1.5661	0.1546	801.92	3	6670.0%	1	K.TLLVDNK.C
UFHR2_HUMAN61.4%359.3%270306516.4(P36980) Complement factor H-related protein 2 precursor (FHR-2) (H factor-like protein 2) (H factor-like 3) (DDESK59)
*	TK_050702_lung_E16_NE_2D_step12.1587.1587.1	0.4494	0.0171	808.31	8	1670.0%	1	R.AMCQNGK.L
*	TK_050702_lung_E16_NE_2D_step05.3078.3078.2	2.2003	0.0946	2242.43	2	3820.0%	2	K.CLDPCVISQEIMEKYNIK.L
UQ91X0361.3%112.0%664766208.6(Q91X03) Tyrosine phosphatase isoform A
*	TK_050702_lung_E16_NE_2D_step05.3232.3232.2	2.1989	0.0115	1609.85	8	3330.0%	1	R.NELDNTHKPKTWK.I
URN23_MOUSE61.3%353.9%488563696.9(Q9ESN2) RING finger protein 23 (Testis-abundant finger protein) (Tripartite motif-containing protein 39)
	TK_050702_lung_E16_NE_2D_step07.1775.1775.1	0.7374	0.0040	629.48	6	3750.0%	1	R.QQILK.E
	TK_050702_lung_E16_NE_2D_step05.3798.3798.2	1.8957	0.2748	1564.36	1	5380.0%	2	K.YAATTTPFTPLHIK.V
UATDA_HUMAN61.3%4167.6%171200245.1(P21673) Diamine acetyltransferase (EC 2.3.1.57) (Spermidine/spermine N(1)-acetyltransferase) (SSAT) (Putrescine acetyltransferase)
	TK_050702_lung_E16_NE_2D_step04.3320.3320.2	1.9006	0.2785	1678.36	3	5000.0%	4	K.YEYMEEQVILTEK.D
UQ8VCC561.1%114.3%415453908.3(Q8VCC5) Hypothetical 45.4 kDa protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step06.2625.2625.2	2.1435	0.2334	2027.37	1	3820.0%	1	K.ELCMLLDEEKGVGCAGSR.C
UQ9BSK261.1%115.0%321353759.6(Q9BSK2) Mitochondrial carrier protein
*	TK_050702_lung_E16_NE_2D_step04.3340.3340.2	1.8695	0.2779	1681.43	1	5000.0%	1	K.YLKEAPLASSANGTEK.N
UQ9BUK061.1%1110.6%85100958.8(Q9BUK0) Hypothetical protein
*	TK_050702_lung_E16_NE_2D_step01.2098.2098.1	1.3873	0.2912	1088.02	5	5620.0%	1	-.MPSVTQRLR.D
UQ9D99061.0%114.6%304329375.1(Q9D990) 4632415H16Rik protein
*	TK_050702_lung_E16_NE_2D_step06.3317.3317.2	1.7831	0.293	1523.48	1	5770.0%	1	R.SPQNLSHAVEEALK.T
UQ9NPF461.0%114.8%335364276.4(Q9NPF4) Putative sialoglycoprotease (EC 3.4.24.57) (Hypothetical protein FLJ20411) (Putative metalloglycoprotease) (PRSMG1/GCPL1 protein)
*	TK_050702_lung_E16_NE_2D_step08.0039.0039.2	1.7711	0.2957	1483.42	1	4330.0%	1	K.GPGMGAPLVSVAVVAR.T
UZN41_HUMAN60.6%223.2%821937288.8(P51814) Zinc finger protein 41
*	TK_050702_lung_E16_NE_2D_step06.2821.2821.2	1.8464	0.2877	1141.2	1	6110.0%	1	R.TPEARIHSVK.R
*	TK_050702_lung_E16_NE_2D_step08.3332.3332.2	0.7815	0.0376	1875.68	141	2000.0%	1	R.QENQNNLLSHVKVLIK.E
UCALX_MOUSE60.5%355.2%591672784.6(P35564) Calnexin precursor
*	TK_050702_lung_E16_NE_2D_step08.3996.3996.2	0.9624	0.0931	1837.22	1	2500.0%	2	R.KIPNPDFFEDLEPFK.M
	TK_050702_lung_E16_NE_2D_step12.2016.2016.2	0.8693	0.0758	1774.39	4	2330.0%	1	K.APVPTGEVYFADSFDR.G
UQ9DA8760.3%2210.0%498577838.4(Q9DA87) 1700017G21Rik protein
	TK_050702_lung_E16_NE_2D_step12.4065.4065.3	2.8912	0.1309	3604.0	7	1550.0%	1	R.FQHIICDLTSTTILEQDRLIPMAWLSPIYK.Q
*	TK_050702_lung_E16_NE_2D_step12.2624.2624.3	1.0769	0.163	2513.16	3	1180.0%	1	R.TWCLYKVFLCQSGYFANILK.G
UQ9UKI860.2%110.8%718819428.7(Q9UKI8) Tousled-like kinase 1
	TK_050702_lung_E16_NE_2D_step01.2299.2299.1	1.8452	0.0657	794.12	10	8000.0%	1	K.LLEKYK.E
UCNG1_MOUSE60.2%332.0%684794607.6(P29974) cGMP-gated cation channel alpha 1 (CNG channel alpha 1) (CNG-1) (CNG1) (Cyclic nucleotide gated channel alpha 1) (Cyclic nucleotide gated channel, photoreceptor) (Cyclic-nucleotide-gated cation channel 1) (Rod photoreceptor cGMP-gated channel alpha subunit)
	TK_050702_lung_E16_NE_2D_step01.0179.0179.1	0.7289	0.0164	417.6	5	6670.0%	1	K.AGNR.R
*	TK_050702_lung_E16_NE_2D_step01.2299.2299.1	1.8452	0.0657	794.12	10	8000.0%	1	K.LIEKYK.A
	TK_050702_lung_E16_NE_2D_step02.2231.2231.1	0.2434	0.0	517.97	1	1670.0%	1	K.RVIK.W
UMCM2_MOUSE60.1%4105.2%9041020475.8(P97310) DNA replication licensing factor MCM2
*	TK_050702_lung_E16_NE_2D_step06.3465.3465.3	1.2295	0.1108	3201.54	3	1640.0%	1	K.KDEGLTNGGTLEPAMPNTYGVEPLPQEVLK.K
*	TK_050702_lung_E16_NE_2D_step03.3925.3925.2	1.1786	0.2359	2027.71	17	2500.0%	3	R.QINIHNLSAFYDSDLFK.F
UQ9C0F259.8%333.3%10901244266.1(Q9C0F2) Hypothetical protein KIAA1711 (Fragment)
	TK_050702_lung_E16_NE_2D_step09.0826.0826.1	0.2348	0.0015	652.56	5	1250.0%	1	K.QWTSK.Y
	TK_050702_lung_E16_NE_2D_step01.3706.3706.2	0.9783	0.0098	2371.85	35	2000.0%	1	K.YIVIEDPFDLNHNLGAGLSRK.M
	TK_050702_lung_E16_NE_2D_step05.2656.2656.1	1.362	0.3195	1219.76	1	3890.0%	1	K.YFALPHKITK.S
UEPPL_HUMAN59.8%571.6%50655531025.6(P58107) Epiplakin (450 kDa epidermal antigen)
*	TK_050702_lung_E16_NE_2D_step06.2652.2652.2	1.8122	0.2816	2119.56	5	2940.0%	1	R.LPLEAALRCGCLDEDTQR.Q
*	TK_050702_lung_E16_NE_2D_step13.3547.3547.3	1.1582	0.1496	3022.0	60	710.0%	2	K.DVGSLASAQRYLQGTGCIAGLLLPGSQER.L
	TK_050702_lung_E16_NE_2D_step08.3752.3752.2	0.7901	0.0193	1918.3	4	2350.0%	1	R.AVPVWDVLASGYVSRAAR.E
*	TK_050702_lung_E16_NE_2D_step04.3863.3863.2	0.7736	0.0546	1947.83	52	1670.0%	1	R.CRPQEDTGWVLFPVNK.A
UKICH_HUMAN59.8%242.6%456520666.6(P35790) Choline kinase (EC 2.7.1.32) (CK) (CHETK-alpha)
*	TK_050702_lung_E16_NE_2D_step04.3003.3003.2	1.2847	0.036	1368.22	8	4550.0%	2	R.SCNKEGSEQAQK.E
UDCC_MOUSE59.2%333.2%14471582996.7(P70211) Tumor suppressor protein DCC precursor
*	TK_050702_lung_E16_NE_2D_step08.3680.3680.2	1.9058	0.27	2415.75	1	2950.0%	1	R.VVVLPSGALQISRLQPGDSGVYR.C
*	TK_050702_lung_E16_NE_2D_step06.3485.3485.2	1.1279	0.0351	2103.61	11	2500.0%	1	R.FLSQTESITAFMGDTVLLK.C
*	TK_050702_lung_E16_NE_2D_step12.1843.1843.3	1.2206	4.0E-4	1568.63	11	2690.0%	1	R.LQPGDSGVYRCSAR.N
UNFIA_MOUSE58.7%3311.8%532585538.6(Q02780) Nuclear factor 1 A-type (Nuclear factor 1/A) (NF1-A) (NFI-A) (NF-I/A) (CCAAT-box binding transcription factor) (CTF) (TGGCA-binding protein)
	TK_050702_lung_E16_NE_2D_step03.1148.1148.3	0.889	0.2016	2346.49	15	750.0%	1	R.LDLVMVILFKGIPLESTDGER.L
*	TK_050702_lung_E16_NE_2D_step07.3356.3356.3	1.3774	0.018	3718.82	11	1340.0%	1	K.WQLCYDISARTWWMDEFHPFIEALLPHVR.A
	TK_050702_lung_E16_NE_2D_step07.2519.2519.2	2.0495	0.2592	1543.46	1	6250.0%	1	K.KPPCCVLSNPDQK.G
UH15_HUMAN58.6%6104.4%2252244910.9(P16401) Histone H1.5 (Histone H1a)
*	TK_050702_lung_E16_NE_2D_step01.2797.2797.1	1.7038	0.2125	887.14	9	5000.0%	2	R.NGLSLAALK.K
*	TK_050702_lung_E16_NE_2D_step02.2900.2900.1	1.8117	0.0273	1015.89	9	4440.0%	1	R.NGLSLAALKK.A
UQ9P2M758.2%333.4%12081376005.5(Q9P2M7) Hypothetical protein KIAA1319 (Cingulin) (Fragment)
*	TK_050702_lung_E16_NE_2D_step04.0116.0116.3	1.5422	0.0231	2697.83	11	1880.0%	1	K.GFPAPSQSSTSDEEPGAYWNGKLLR.S
*	TK_050702_lung_E16_NE_2D_step01.0160.0160.1	1.8041	0.0487	861.59	5	6670.0%	1	K.LDEEVKK.R
*	TK_050702_lung_E16_NE_2D_step02.2425.2425.2	1.5987	0.1336	1044.6	20	5000.0%	1	R.ILGLEQQLK.E
UBAF_MOUSE58.1%1127.0%89101036.1(O54962) Barrier-to-autointegration factor (Breakpoint cluster region protein 1) (LAP2 binding protein 1)
*	TK_050702_lung_E16_NE_2D_step01.3559.3559.2	2.1097	0.2377	2417.73	1	3480.0%	1	R.DFVAEPMGEKPVGSLAGIGDVLSK.R
UQ9D5C958.0%61812.2%370431859.5(Q9D5C9) 4930463F05Rik protein
	TK_050702_lung_E16_NE_2D_step04.4719.4719.1	0.2467	0.0034	856.1	2	1430.0%	1	R.SSVDTPPR.L
	TK_050702_lung_E16_NE_2D_step04.3019.3019.2	2.0654	0.1706	2164.83	8	2780.0%	4	R.DPNPSDILENLDDSVFSKR.H
	TK_050702_lung_E16_NE_2D_step07.2788.2788.2	1.0848	0.0941	2057.07	46	2650.0%	1	K.HSPIKEEPCGSISETVCK.R
URL30_HUMAN57.4%1110.5%114126539.6(P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30
	TK_050702_lung_E16_NE_2D_step04.3275.3275.2	2.0156	0.2645	1447.05	1	5910.0%	1	R.KSEIEYYAMLAK.T
UQ9CQR157.1%336.9%564651468.9(Q9CQR1) DNA segment, Chr 6, Wayne state University 157, expressed
	TK_050702_lung_E16_NE_2D_step07.3781.3781.2	1.6822	0.3586	2452.25	1	2860.0%	1	K.NTTYDLIANIVHDGKPSEGSYR.I
	TK_050702_lung_E16_NE_2D_step12.1535.1535.1	0.2344	0.0	875.57	3	830.0%	1	R.VDSEDRR.S
	TK_050702_lung_E16_NE_2D_step08.0040.0040.3	1.5587	0.0521	3529.49	10	1690.0%	1	K.NTTYDLIANIVHDGKPSEGSYRIHVLHHGTGK.W
UCDK1_MOUSE57.1%2411.9%109117479.2(O35207) Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Putative oral cancer suppressor) (Deleted in oral cancer-1) (DOC-1) (Fragment)
	TK_050702_lung_E16_NE_2D_step07.4212.4212.2	1.7991	0.2506	1463.1	1	5420.0%	2	K.YAELLAIIEELGK.E
UQ9D2F857.0%223.4%683778869.6(Q9D2F8) 4930547C10Rik protein
*	TK_050702_lung_E16_NE_2D_step01.2354.2354.1	1.6507	0.114	701.83	2	8000.0%	1	R.ILIKSK.S
*	TK_050702_lung_E16_NE_2D_step03.2990.2990.3	1.5552	0.0117	2006.9	1	2970.0%	1	K.SQKGFLNSHPECVTSCR.R
UO8852857.0%222.2%16411876586.5(O88528) Citron-K kinase (Fragment)
*	TK_050702_lung_E16_NE_2D_step08.2754.2754.3	1.2309	0.0115	3269.88	21	1470.0%	1	K.NSWVSSSVCQLSPSGFSGEELPFVGFSYSK.A
	TK_050702_lung_E16_NE_2D_step01.2354.2354.1	1.6507	0.114	701.83	2	8000.0%	1	K.LLIKSK.E
UO1546357.0%665.9%12611421066.7(O15463) PTPL1-associated RhoGAP
*	TK_050702_lung_E16_NE_2D_step09.0042.0042.2	1.3758	0.0269	1583.62	3	4230.0%	1	K.QNALGKCDACLSDK.A
*	TK_050702_lung_E16_NE_2D_step10.0391.0391.3	0.9231	0.1044	1442.46	37	1360.0%	1	K.FCKNPAFEGVNR.K
*	TK_050702_lung_E16_NE_2D_step01.2354.2354.1	1.6507	0.114	701.83	2	8000.0%	1	R.ILLKSK.D
*	TK_050702_lung_E16_NE_2D_step10.3054.3054.1	0.4697	0.019	975.81	23	1430.0%	1	R.RNDVENTK.R
*	TK_050702_lung_E16_NE_2D_step01.4187.4187.3	1.4376	0.0056	2095.44	44	2360.0%	1	K.HQNLNSVDLQNAAEMLTAK.V
*	TK_050702_lung_E16_NE_2D_step01.2458.2458.2	0.9067	0.1312	1862.77	5	2500.0%	1	K.EAIFSDCFKEVIHIR.L
UQ9EPF156.7%113.2%648715125.8(Q9EPF1) L-gicerin/MUC18
*	TK_050702_lung_E16_NE_2D_step07.3748.3748.2	1.6734	0.3517	2290.85	1	3000.0%	1	R.LSLQDSVATLALSHVTPHDER.M
UQ91WJ856.5%465.1%651685407.9(Q91WJ8) Similar to far upstream element (FUSE) binding protein 1
	TK_050702_lung_E16_NE_2D_step03.1405.1405.1	0.2434	0.0	821.66	2	830.0%	1	R.NGEMIKK.I
	TK_050702_lung_E16_NE_2D_step07.3833.3833.2	1.0201	0.0359	1543.51	85	2500.0%	2	R.CQHAAEIITDLLR.S
	TK_050702_lung_E16_NE_2D_step01.2350.2350.1	0.9685	0.2183	1356.45	17	2500.0%	1	K.IQIAPDSGGLPER.S
UQ8VHM556.4%447.6%632708888.1(Q8VHM5) Heterogeneous nuclear ribonucleoprotein R
	TK_050702_lung_E16_NE_2D_step05.3434.3434.2	1.563	0.1695	2173.14	1	3330.0%	1	R.GGYEDPYYGYDDGYAVRGR.G
	TK_050702_lung_E16_NE_2D_step01.2615.2615.1	1.3738	0.2526	1070.04	1	5560.0%	1	K.TLIEAGLPQK.V
	TK_050702_lung_E16_NE_2D_step01.1843.1843.1	1.0148	0.1351	805.86	213	4290.0%	1	R.GAPPPRGR.A
	TK_050702_lung_E16_NE_2D_step01.3117.3117.1	1.0513	0.0318	1224.07	10	4500.0%	1	R.KADGYNQPDSK.R
UK1M2_MOUSE56.2%121444.7%407463904.8(Q62168) Keratin, type I cuticular HA2 (Hair keratin, type I HA2)
*	TK_050702_lung_E16_NE_2D_step02.4143.4143.2	1.4248	0.0547	2273.94	8	2500.0%	12	R.TVCVPHTVCVPCSPCLQTR.Y
UQ96KR856.1%684.4%25672852396.9(Q96KR8) Myosin heavy chain
	TK_050702_lung_E16_NE_2D_step01.2153.2153.1	1.5318	0.1297	1176.09	3	5000.0%	1	K.EGAEPTNTVEK.G
	TK_050702_lung_E16_NE_2D_step04.2305.2305.2	1.056	0.1447	1489.86	100	1790.0%	2	K.MGQPQGKSGNAGEAR.S
	TK_050702_lung_E16_NE_2D_step03.2728.2728.3	2.0496	0.0542	2300.67	46	2240.0%	1	K.LESSALEQQKIQSQQENTIK.Q
*	TK_050702_lung_E16_NE_2D_step12.4733.4733.3	1.1292	0.119	4406.68	67	960.0%	1	R.TFVSTLQRYQEEGVPVQFDLPDPSPGTTVAVVDQNPSQVR.L
	TK_050702_lung_E16_NE_2D_step04.3377.3377.3	1.7188	0.0571	3393.08	3	1760.0%	1	K.QFMRFEWANYAAEALGCEYEELNTATFK.H
UBE16_MOUSE56.0%7493.3%2092361610.2(P28657) Brain protein 14 (Brain protein E161)
*	TK_050702_lung_E16_NE_2D_step01.0400.0400.1	1.2154	0.0411	791.64	16	5000.0%	7	R.LSNVKTK.S
UCATF_MOUSE56.0%114.1%462516616.6(Q9R013) Cathepsin F precursor (EC 3.4.22.41)
*	TK_050702_lung_E16_NE_2D_step03.3740.3740.2	1.6958	0.3117	2165.69	3	2780.0%	1	R.GTLLSLSEQELLDCDKVDK.A
UO3524355.6%111.6%15671648994.6(O35243) Antigen containing epitope to monoclonal antibody MMS-85/12 (Fragment)
*	TK_050702_lung_E16_NE_2D_step07.3703.3703.2	2.1523	0.1803	2432.63	1	2710.0%	1	K.ALTNAPLVAAGPCDDEGIVTSTGAK.E
URL7_MOUSE55.6%3310.7%2703142010.9(P14148) 60S ribosomal protein L7
	TK_050702_lung_E16_NE_2D_step06.2769.2769.2	1.527	0.0819	1082.52	7	3890.0%	1	K.KVPAVPETLK.K
	TK_050702_lung_E16_NE_2D_step04.2521.2521.2	1.9039	0.2681	2117.38	3	3610.0%	1	K.TTHFVEGGDAGNREDQINR.L
USSXT_MOUSE55.3%112.9%418458916.4(Q62280) SSXT protein (SYT protein) (Synovial sarcoma associated Ss18-alpha)
	TK_050702_lung_E16_NE_2D_step05.2470.2470.2	1.861	0.2613	1214.71	1	5910.0%	1	R.GKGEITPAAIQK.M
UQ1471055.2%117.1%268307939.3(Q14710) Pot. ORF I (Fragment)
*	TK_050702_lung_E16_NE_2D_step02.3835.3835.2	1.7609	0.2693	2231.24	2	3890.0%	1	K.DIQELDSALHQADLIDIYR.T
UQ91Y0355.0%112.5%802887385.0(Q91Y03) Protocadherin beta 16
*	TK_050702_lung_E16_NE_2D_step04.3219.3219.2	1.7217	0.2841	2194.11	1	2890.0%	1	K.ATEPGLFSVWAHNGEVHTSR.L
URL12_MOUSE54.9%2220.6%165177919.4(P35979) 60S ribosomal protein L12
	TK_050702_lung_E16_NE_2D_step04.3047.3047.2	1.8328	0.2603	2047.9	1	4440.0%	1	R.HPHDIIDDINSGAVECPAS.-
	TK_050702_lung_E16_NE_2D_step09.3757.3757.2	1.4866	0.3028	1688.17	2	3570.0%	1	K.HSGNITFDEIVNIAR.Q
UCTA4_HUMAN54.8%8286.3%13081453166.7(Q9C0A0) Contactin associated protein-like 4 precursor (Cell recognition molecule Caspr4)
*	TK_050702_lung_E16_NE_2D_step02.3424.3424.2	1.5833	0.0926	2406.77	1	2860.0%	5	-.MGSVTGAVLKTLLLLSTQNWNR.V
	TK_050702_lung_E16_NE_2D_step11.3163.3163.2	0.5977	0.0688	1846.44	14	1330.0%	1	R.ERTHSFADHSGTIDDR.E
	TK_050702_lung_E16_NE_2D_step07.3576.3576.2	1.1387	0.0349	2688.17	119	1400.0%	1	K.SDSAVIGGLIAVVIFILLCITAIAVR.I
	TK_050702_lung_E16_NE_2D_step12.1487.1487.3	0.7625	0.0061	2312.58	73	830.0%	1	R.GATCHNSIYEQSCEAYKHR.G
UQ99PC354.7%4610.5%3924659810.0(Q99PC3) CGI-74-like SR-rich protein
	TK_050702_lung_E16_NE_2D_step09.3146.3146.2	1.5682	0.2638	1866.89	1	4670.0%	2	K.SHLLNCCPHDVLSGTR.M
	TK_050702_lung_E16_NE_2D_step05.2990.2990.2	1.1883	0.0884	1871.53	11	2810.0%	1	R.AMLDQLMGTSRDGDTTR.Q
	TK_050702_lung_E16_NE_2D_step04.2376.2376.1	1.1354	0.1441	844.57	1	5000.0%	1	R.LADHFGGK.L
UPIN1_MOUSE54.4%2213.3%165183708.8(Q9QUR7) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (EC 5.2.1.8) (Rotamase Pin1) (PPIase Pin1)
	TK_050702_lung_E16_NE_2D_step04.3260.3260.2	1.8049	0.2596	1725.47	1	3930.0%	1	R.GQMQKPFEDASFALR.T
	TK_050702_lung_E16_NE_2D_step07.0766.0766.1	0.2442	0.0034	856.78	1	1670.0%	1	R.CSHLLVK.H
UQ91Y5854.2%353.5%10641237698.6(Q91Y58) DNA-dependent ATPase SNF2L
*	TK_050702_lung_E16_NE_2D_step01.3963.3963.2	1.9582	0.1596	2492.55	6	2380.0%	2	R.EEAIDAFNAPNSSKFIFMLSTR.A
	TK_050702_lung_E16_NE_2D_step05.3467.3467.2	1.6292	0.4344	1746.16	2	3570.0%	1	K.QTELFAHFIQPSAQK.S
UQ6134454.2%117.0%284328014.7(Q61344) Beta-tropomyosin
*	TK_050702_lung_E16_NE_2D_step02.3957.3957.2	2.1376	0.1438	2366.08	1	3950.0%	1	K.EENVEIHQTLDQTLLELNNL.-
UQ9R21854.2%112.0%751780488.5(Q9R218) Dachshund variant 1
	TK_050702_lung_E16_NE_2D_step06.3285.3285.2	1.6142	0.4154	1814.26	1	3930.0%	1	K.RLEITPVVCNVEQVR.I
UQ9CZA554.2%41010.2%402451075.4(Q9CZA5) 2810028A01Rik protein
*	TK_050702_lung_E16_NE_2D_step04.2973.2973.2	1.7905	0.2583	2356.39	1	3000.0%	3	R.EANQARLHQLLVGAEMSTDLR.F
*	TK_050702_lung_E16_NE_2D_step07.4212.4212.3	1.0709	0.0515	2194.14	6	1320.0%	1	R.LGSSRGQNSPLPPWAHSMLR.S
UCTA1_HUMAN54.1%111.3%13841562667.1(P78357) Contactin associated protein 1 precursor (Caspr) (Caspr1) (Neurexin 4) (Neurexin IV) (p190)
*	TK_050702_lung_E16_NE_2D_step04.3136.3136.2	1.6459	0.3718	2136.67	1	3240.0%	1	R.RLGFYAEVLFDTCGITDR.C
UQ9UI9254.1%112.1%629693989.3(Q9UI92) Putative WHSC1 protein
	TK_050702_lung_E16_NE_2D_step05.3195.3195.2	1.6395	0.3639	1595.81	1	4580.0%	1	R.QYHVQFFGDAPER.A
UT2FB_HUMAN54.1%3510.8%249283809.2(P13984) Transcription initiation factor IIF, beta subunit (TFIIF-beta) (Transcription initiation factor RAP30)
*	TK_050702_lung_E16_NE_2D_step06.3031.3031.1	1.2505	0.0028	847.93	12	5000.0%	1	K.QPVVYLK.E
*	TK_050702_lung_E16_NE_2D_step08.2868.2868.2	1.6174	0.3807	2439.86	1	3160.0%	2	K.VVTTNYKPVANHQYNIEYER.K
UO3525554.0%111.5%462516929.4(O35255) Nucleolar protein
	TK_050702_lung_E16_NE_2D_step03.2428.2428.1	1.5788	0.1105	785.57	5	5830.0%	1	K.QGVIKLK.N
UQ91XM953.9%112.6%852948036.2(Q91XM9) Chapsyn-110
	TK_050702_lung_E16_NE_2D_step12.3587.3587.2	2.0103	0.2538	2515.14	1	2620.0%	1	R.LLMVNNYSLEEVTHEEAVAILK.N
UQ8TEQ353.9%339.5%579647169.7(Q8TEQ3) FLJ00140 protein (Fragment)
*	TK_050702_lung_E16_NE_2D_step03.3622.3622.2	2.1245	0.1315	2320.5	1	3680.0%	1	R.GWGLCIFLPFVLSQLEPGCK.K
*	TK_050702_lung_E16_NE_2D_step12.1516.1516.3	0.9804	0.0622	2046.49	83	1250.0%	1	K.GRGAPGDDSSMGGRPSSPLDK.Q
*	TK_050702_lung_E16_NE_2D_step13.2247.2247.1	0.2467	0.0	1475.48	4	380.0%	1	R.SQAPAARAFLDAVR.L
UQ9D3U053.9%112.7%527597116.5(Q9D3U0) 4933435A13Rik protein (RIKEN cDNA 4933435A13 gene)
	TK_050702_lung_E16_NE_2D_step06.3267.3267.2	2.1491	0.0114	1613.28	1	5380.0%	1	R.DLQLVTREAIGHMK.E
UQ9Y4F953.7%241.0%10681185235.4(Q9Y4F9) Hypothetical protein KIAA0386
*	TK_050702_lung_E16_NE_2D_step01.3027.3027.1	1.6663	0.0615	1262.75	21	4500.0%	2	K.TPFVARSLLEK.L
UQ96JM753.7%352.6%781884636.5(Q96JM7) Hypothetical protein KIAA1798 (Fragment)
*	TK_050702_lung_E16_NE_2D_step04.0748.0748.1	0.3509	0.0022	687.59	5	2500.0%	1	R.GDSAVLK.Q
*	TK_050702_lung_E16_NE_2D_step02.2812.2812.2	1.9734	0.1434	1598.12	1	4580.0%	2	K.EDGEERDDEMENK.Q
UCA21_MOUSE53.6%446.4%13721295579.2(Q01149) Collagen alpha 2(I) chain precursor
*	TK_050702_lung_E16_NE_2D_step03.3134.3134.2	1.6453	0.3556	1403.57	2	4290.0%	1	K.GVSSGPGPMGLMGPR.G
*	TK_050702_lung_E16_NE_2D_step13.5327.5327.2	1.0783	0.104	2685.14	9	1720.0%	1	R.GYPGSIGPTGAAGAPGPHGSVGPAGKHGNR.G
*	TK_050702_lung_E16_NE_2D_step01.3310.3310.3	1.7892	0.0199	3608.42	3	1520.0%	1	K.NSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSR.F
*	TK_050702_lung_E16_NE_2D_step04.3617.3617.2	1.2736	0.1269	902.31	94	5000.0%	1	K.GHSGMDGLK.G
UTCP2_MOUSE53.5%110.9%556604496.2(P11983) T-complex protein 1, alpha subunit B (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1B) (TCP-1-B)
	TK_050702_lung_E16_NE_2D_step01.2437.2437.1	1.5125	0.1384	601.84	1	7500.0%	1	R.VLELK.S
UQ8R4U053.5%443.0%25592775316.9(Q8R4U0) Stabilin-2
*	TK_050702_lung_E16_NE_2D_step03.0136.0136.3	0.8169	0.0412	2846.99	87	770.0%	1	K.VITSATTLQGEPISISVSQDTVLINKK.A
	TK_050702_lung_E16_NE_2D_step01.2437.2437.1	1.5125	0.1384	601.84	1	7500.0%	1	K.VLEIK.K
*	TK_050702_lung_E16_NE_2D_step06.2601.2601.3	0.6888	0.026	2247.33	179	690.0%	1	K.SHYVGDGRDCEPEQLPLDR.C
*	TK_050702_lung_E16_NE_2D_step12.2909.2909.2	0.7078	0.2474	2717.11	10	1040.0%	1	K.IVQIIQGNIVASNGLVHILDRAMDK.I
UO6049453.5%442.4%36233989985.4(O60494) Intrinsic factor-B12 receptor precursor (Intrinsic factor-vitamin B12 receptor)
*	TK_050702_lung_E16_NE_2D_step09.4001.4001.3	1.0945	0.0972	3153.27	5	1350.0%	1	R.LCGPSKPTLPLVIPYSQVWIHFVTNER.V
*	TK_050702_lung_E16_NE_2D_step01.2437.2437.1	1.5125	0.1384	601.84	1	7500.0%	1	K.VIELK.F
*	TK_050702_lung_E16_NE_2D_step10.3882.3882.3	1.318	0.0839	3757.57	64	1370.0%	1	K.QYDNNMNCTYVIEANPLSVVLLTFVSFHLEAR.S
*	TK_050702_lung_E16_NE_2D_step01.1823.1823.3	1.5391	0.0963	2603.19	127	1670.0%	1	K.YDDCEGGSVARCVHGICEDLMR.E
USL53_HUMAN53.3%242.2%718796947.3(P53794) Sodium/myo-inositol cotransporter (Na(+)/myo-inositol cotransporter)
*	TK_050702_lung_E16_NE_2D_step01.4201.4201.2	2.1245	0.0766	1840.93	7	4000.0%	2	R.CSENNETINHIIPNGK.S
UQ96DL153.3%225.2%365416017.7(Q96DL1) Hypothetical protein FLJ25224
*	TK_050702_lung_E16_NE_2D_step01.3479.3479.2	2.1465	0.1229	1516.39	8	4290.0%	1	R.ARMYSTALMAGASGK.V
*	TK_050702_lung_E16_NE_2D_step09.4917.4917.1	0.2434	0.0	559.53	1	1670.0%	1	R.HTWL.-
UQ9P00853.0%2415.7%108115876.9(Q9P008) HSPC156
	TK_050702_lung_E16_NE_2D_step06.2649.2649.2	1.6236	0.0458	1921.31	53	2190.0%	2	K.TEDLKNSAQQFAETAHK.L
UQ9BZE553.0%334.3%16641776666.6(Q9BZE5) PGC-1 related co-activator (Hypothetical protein KIAA0595)
*	TK_050702_lung_E16_NE_2D_step02.3305.3305.2	1.6731	0.2909	1442.83	1	5000.0%	1	R.EGSSLHKLLTLSR.T
*	TK_050702_lung_E16_NE_2D_step01.4262.4262.3	1.5149	0.1541	3961.31	3	1380.0%	1	R.SQAPYGTLGAVSGGEQVLLHEEAGDSGFVSLSRQGPSLR.D
*	TK_050702_lung_E16_NE_2D_step01.4718.4718.2	1.0723	0.0402	2149.59	90	1940.0%	1	K.LDSACLLKPREVVEPVVPK.E
UQ923C352.8%228.5%520563829.1(Q923C3) Similar to regulator of differentiation (In S. pombe) 1
	TK_050702_lung_E16_NE_2D_step05.2600.2600.2	1.5977	0.4038	1492.54	1	5450.0%	1	R.SQPVYIQYSNHR.E
*	TK_050702_lung_E16_NE_2D_step02.3423.3423.3	0.8203	0.0437	3497.25	6	1050.0%	1	K.KPGSKNFQNIFPPSATLHLSNIPPSVTMDDLK.N
UO3593552.8%72716.2%302322975.2(O35935) Poly(A) binding protein II
	TK_050702_lung_E16_NE_2D_step09.3718.3718.3	1.505	0.1907	3056.44	4	1670.0%	5	R.SIYVGNVDYGATAEELEAHFHGCGSVNR.V
*	TK_050702_lung_E16_NE_2D_step03.4037.4037.2	0.8696	0.2003	2227.16	10	1500.0%	1	K.QMNMSPPPGNAGPVIMSLEEK.M
UQ91WM652.7%1119.9%156178106.5(Q91WM6) Similar to hypothetical protein FLJ13391 (Hypothetical 17.8 kDa protein)
*	TK_050702_lung_E16_NE_2D_step04.4151.4151.3	2.5739	0.2693	3519.13	1	2000.0%	1	R.AALYFVSGVCIGLFLTLAALVMRISCHTDCR.R
UQ9NXE252.7%118.9%325358237.6(Q9NXE2) Hypothetical protein FLJ20300
	TK_050702_lung_E16_NE_2D_step10.4308.4308.2	1.9531	0.2439	3192.58	1	2680.0%	1	R.NHCSDVIAGFILGTAVALFLGMCVVHNFK.G
UCN8A_MOUSE52.6%447.7%823931715.8(O88502) High-affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (EC 3.1.4.17) (MMPDE8)
*	TK_050702_lung_E16_NE_2D_step02.3435.3435.3	1.813	0.1867	3478.83	2	1940.0%	1	R.FSGNEYILATKNLPPLSNNLATPVSLHDVPPR.I
*	TK_050702_lung_E16_NE_2D_step07.3323.3323.2	2.1173	0.089	2012.27	2	4170.0%	1	R.WSTAPGLVEPQPRDNGASK.V
*	TK_050702_lung_E16_NE_2D_step01.2467.2467.1	0.5447	0.1472	1436.53	6	1250.0%	1	R.WSTAPGLVEPQPR.D
*	TK_050702_lung_E16_NE_2D_step01.0087.0087.3	1.1251	0.0719	1541.87	189	2050.0%	1	R.YPRQMDAETLCR.S
UQ922J352.4%778.5%13911558135.2(Q922J3) Similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein)
*	TK_050702_lung_E16_NE_2D_step05.3652.3652.2	1.0055	0.0594	2303.62	3	2250.0%	1	K.FASTSEEAVSAQTRMQDTVNK.L
	TK_050702_lung_E16_NE_2D_step05.2434.2434.1	0.8941	0.0298	799.78	38	5000.0%	1	R.KHEEEK.K
	TK_050702_lung_E16_NE_2D_step12.1413.1413.3	0.7204	0.143	2324.31	60	880.0%	1	K.LENDIAEIMKMSGDNSSQLTK.M
*	TK_050702_lung_E16_NE_2D_step11.4689.4689.2	1.0365	0.0218	2104.39	7	2500.0%	1	K.YTEQSEVIGNFTSQLSAVK.E
	TK_050702_lung_E16_NE_2D_step01.2714.2714.2	0.6321	0.0309	1219.64	216	1820.0%	1	K.IGFPSTTPAKAK.A
*	TK_050702_lung_E16_NE_2D_step01.0092.0092.1	1.7448	0.0583	731.92	3	8000.0%	1	K.ELQTLK.E
*	TK_050702_lung_E16_NE_2D_step01.4718.4718.3	1.9329	0.2032	3223.89	25	1560.0%	1	R.TASPLSTAAATMVSSSPATPSNIPHKPSQSTAK.E
UQ9H3Y652.4%111.2%488545078.2(Q9H3Y6) DJ697K14.1 (Novel tyrosine kinase)
*	TK_050702_lung_E16_NE_2D_step01.0092.0092.1	1.7448	0.0583	731.92	3	8000.0%	1	K.EIQTLK.G
UABC2_MOUSE52.4%662.2%24342705886.8(P41234) ATP-binding cassette, sub-family A, member 2 (ATP-binding cassette transporter 2) (ATP-binding cassette 2)
	TK_050702_lung_E16_NE_2D_step05.4462.4462.1	0.2352	0.0	486.23	5	1670.0%	1	K.DVVR.F
*	TK_050702_lung_E16_NE_2D_step06.4013.4013.2	0.7474	0.0117	1967.54	20	1000.0%	1	K.DVLPGAEGLTAVGGQAGNLAR.C
	TK_050702_lung_E16_NE_2D_step01.4914.4914.1	0.8312	0.1528	441.6	6	10000.0%	1	K.EHR.L
	TK_050702_lung_E16_NE_2D_step09.0175.0175.1	0.2368	0.0	612.14	13	1250.0%	1	K.IAVRR.V
*	TK_050702_lung_E16_NE_2D_step02.4099.4099.2	2.1116	0.0537	2055.45	3	3750.0%	1	R.CPQQPLAWVPSTLHCMK.W
	TK_050702_lung_E16_NE_2D_step12.1269.1269.1	0.2416	0.5198	523.28	1	1670.0%	1	R.HHTK.V
UQ8WYY152.3%115.3%320355685.6(Q8WYY1) Hypothetical protein
*	TK_050702_lung_E16_NE_2D_step09.3596.3596.2	1.9211	0.2472	1918.41	1	4380.0%	1	K.TEKAFGQLLCQPLGEPK.I
UQ1656352.2%2213.9%259285658.4(Q16563) PANTOPHYSIN
*	TK_050702_lung_E16_NE_2D_step11.4475.4475.2	0.741	0.0632	1887.28	11	2500.0%	1	K.GQTEIQVNCPPAVTENK.T
*	TK_050702_lung_E16_NE_2D_step11.0020.0020.2	1.5776	0.4461	2144.87	1	3060.0%	1	R.MSGFQINLNPLKEPLGFIK.V
UQ99JR852.2%113.1%456522829.4(Q99JR8) Similar to SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
*	TK_050702_lung_E16_NE_2D_step03.2933.2933.2	1.5741	0.3957	1546.58	1	3850.0%	1	R.LLVPQAQPPMPAQR.R
UQ99KQ252.1%228.4%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment)
	TK_050702_lung_E16_NE_2D_step09.3540.3540.2	1.6644	0.3079	2201.93	1	3160.0%	1	R.LVSNHSLHETSSVFVDSLTK.V
	TK_050702_lung_E16_NE_2D_step12.4513.4513.2	0.8521	0.0836	2306.62	166	1590.0%	1	K.GQHVPGSPFQFTVGPLGEGGAHK.V
USSF1_MOUSE52.1%113.4%4705272510.3(Q91YU8) Suppressor of SWI4 1 homolog (Ssf-1) (Peter Pan homolog)
*	TK_050702_lung_E16_NE_2D_step04.3328.3328.2	1.6603	0.3014	1867.65	1	4000.0%	1	R.NLESYAAQPHSFVFTR.G
USP41_HUMAN51.9%2219.7%117131938.1(Q16550) Transcription initiation protein SPT4 homolog 1 (Q16550) Transcription initiation protein SPT4 homolog 1
	TK_050702_lung_E16_NE_2D_step13.2133.2133.1	0.3374	0.0098	783.04	7	1670.0%	1	K.SRGVAYK.S
	TK_050702_lung_E16_NE_2D_step07.3060.3060.2	1.8612	0.2523	1682.25	1	4330.0%	1	R.VSNFKPGVYAVSVTGR.L
UQ96L0951.9%117.4%271311238.5(Q96L09) Similar to RIKEN cDNA 6720467C03 gene
*	TK_050702_lung_E16_NE_2D_step03.2493.2493.2	1.774	0.2556	2185.15	2	3160.0%	1	K.ADLLVNEINAYAATETPHLK.L
UQ8VGM051.8%117.4%312343168.2(Q8VGM0) Olfactory receptor MOR253-3
	TK_050702_lung_E16_NE_2D_step01.4341.4341.2	1.5928	0.3639	2554.67	1	2730.0%	1	R.SKVSSVLYSVLSPTLNPLIYTLR.N
UOXRP_HUMAN51.7%335.4%9991113355.2(Q9Y4L1) 150 kDa oxygen-regulated protein precursor (Orp150) (Hypoxia up-regulated 1)
*	TK_050702_lung_E16_NE_2D_step09.3192.3192.2	1.8345	0.2472	1586.4	3	3930.0%	1	R.FFGDSAASMAIKNPK.A
*	TK_050702_lung_E16_NE_2D_step13.2209.2209.1	0.1012	0.0	598.08	6	1250.0%	1	K.QKPAR.K
*	TK_050702_lung_E16_NE_2D_step07.3307.3307.3	1.8042	0.0062	3649.24	3	1440.0%	1	R.RVCWALVAVLLADLLALSDTLAVMSVDLGSESMK.V
ULEG1_MOUSE51.6%3333.6%134147355.5(P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin)
*	TK_050702_lung_E16_NE_2D_step12.1948.1948.2	0.8939	0.1095	1946.83	156	1760.0%	1	-.ACGLVASNLNLKPGECLK.V
	TK_050702_lung_E16_NE_2D_step03.2954.2954.2	0.9383	0.2269	1488.75	22	3180.0%	1	K.DSNNLCLHFNPR.F
	TK_050702_lung_E16_NE_2D_step04.2464.2464.2	1.6233	0.3158	1663.44	3	3570.0%	1	R.FNAHGDANTIVCNTK.E
UPYR5_MOUSE51.4%225.6%481522926.6(P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)]
*	TK_050702_lung_E16_NE_2D_step02.3751.3751.1	1.5214	0.1116	961.94	1	6430.0%	1	K.QYESGTFK.I
*	TK_050702_lung_E16_NE_2D_step12.4260.4260.2	0.9952	0.2361	2270.77	6	2220.0%	1	R.LHAVCTLSQMLEILQQQEK.I
UQ9H0X151.0%225.0%444515369.3(Q9H0X1) Hypothetical protein
*	TK_050702_lung_E16_NE_2D_step12.2547.2547.1	1.0009	0.0206	1370.93	6	3640.0%	1	K.AFNHPATLFSHK.K
*	TK_050702_lung_E16_NE_2D_step05.2276.2276.1	1.472	0.1376	1188.62	5	4440.0%	1	K.RIHTGDVPYK.C
UVGR3_HUMAN51.0%335.5%12981455986.3(P35916) Vascular endothelial growth factor receptor 3 precursor (EC 2.7.1.112) (VEGFR-3) (Tyrosine-protein kinase receptor FLT4)
*	TK_050702_lung_E16_NE_2D_step04.3947.3947.2	0.8484	0.0349	2269.65	145	1580.0%	1	R.KDAMWVPCLVSIPGLNVTLR.S
*	TK_050702_lung_E16_NE_2D_step02.3891.3891.3	2.7064	0.0469	3307.53	3	1940.0%	1	K.LVLNCTVWAEFNSGVTFDWDYPGKQAER.G
*	TK_050702_lung_E16_NE_2D_step13.4837.4837.2	0.7501	0.0736	2785.39	1	1590.0%	1	K.VLLLHEVHANDTGSYVCYYKYIK.A
UUBAL_HUMAN51.0%446.8%10111117205.9(P41226) Ubiquitin-activating enzyme E1 homolog (D8)
*	TK_050702_lung_E16_NE_2D_step10.3816.3816.2	1.0731	0.0020	2656.23	52	1740.0%	1	R.TEEEPLEEPLDEALVRTVALSSAR.C
*	TK_050702_lung_E16_NE_2D_step10.3014.3014.1	0.2434	0.0	1109.33	5	710.0%	1	R.HEFEELFR.L
*	TK_050702_lung_E16_NE_2D_step01.4151.4151.2	2.0075	0.0303	1630.05	6	4580.0%	1	R.HSYLHLAENYLIR.Y
*	TK_050702_lung_E16_NE_2D_step08.3746.3746.3	2.2047	0.4767	2681.72	1	1630.0%	1	K.VPAGQPERTLESLLAHLQEQHGLR.V
UQ9NXZ150.9%4410.6%904991986.5(Q9NXZ1) Putative tumor antigen
*	TK_050702_lung_E16_NE_2D_step12.2380.2380.2	0.6064	0.0627	1630.71	23	1540.0%	1	R.DLYVTATHSVHEEK.M
*	TK_050702_lung_E16_NE_2D_step05.3886.3886.3	0.7069	0.0436	3277.25	31	400.0%	1	K.NYSVSAGDPPVTVMSSVETVPNTPQISPAMAK.K
*	TK_050702_lung_E16_NE_2D_step13.4594.4594.2	1.7949	0.2469	1926.52	1	3440.0%	1	K.DELLYKPDSNEFAVGTK.N
*	TK_050702_lung_E16_NE_2D_step04.4015.4015.3	1.2414	0.1198	3403.84	116	940.0%	1	K.KDNSQPTPDNVLSAVTPELINLAGAGIPPMSTR.D
UQ96QW350.9%111.8%9118361910.9(Q96QW3) BA74P14.2 (Novel protein)
	TK_050702_lung_E16_NE_2D_step02.2257.2257.2	1.6866	0.2877	1441.33	5	3330.0%	1	K.AIVSGPGKAIVSGPGK.A
UTR1A_HUMAN50.7%228.4%455504956.6(P19438) Tumor necrosis factor receptor superfamily member 1A precursor (p60) (TNF-R1) (TNF-RI) (p55) (CD120a) [Contains: Tumor necrosis factor binding protein 1 (TBPI)]
*	TK_050702_lung_E16_NE_2D_step03.2174.2174.1	1.7689	0.117	891.67	9	5710.0%	1	R.DSVCPQGK.Y
*	TK_050702_lung_E16_NE_2D_step02.0078.0078.3	1.0428	0.1031	3368.49	1	1210.0%	1	K.WEDSAHKPQSLDTDDPATLYAVVENVPPLR.W
UE4L2_MOUSE50.7%333.1%9881098335.5(O70318) Band 4.1-like protein 2 (Generally expressed protein 4.1) (4.1G)
	TK_050702_lung_E16_NE_2D_step01.1235.1235.1	0.8758	0.1597	433.34	1	5000.0%	1	R.AGVGK.D
*	TK_050702_lung_E16_NE_2D_step01.3975.3975.1	0.4735	0.0052	1593.14	30	710.0%	1	K.GSQPGPPVERQSTPR.L
	TK_050702_lung_E16_NE_2D_step03.2550.2550.1	1.7682	0.0061	1379.88	3	5000.0%	1	K.NLPWLFTFNVK.F
UQ9NS8750.4%573.8%13881601596.0(Q9NS87) Kinesin-like protein 2
*	TK_050702_lung_E16_NE_2D_step13.2434.2434.1	0.1354	0.0	1150.8	4	620.0%	1	K.AFQEKEQLR.S
	TK_050702_lung_E16_NE_2D_step11.4101.4101.2	1.9779	0.2721	2335.19	39	2370.0%	1	K.ENETLKSDLNNLMELLEAEK.E
*	TK_050702_lung_E16_NE_2D_step09.3660.3660.2	2.0826	0.2063	1862.99	1	4330.0%	2	R.GGFLPEEQDRLLSELR.N
*	TK_050702_lung_E16_NE_2D_step02.2280.2280.1	0.4868	0.0	944.95	7	1430.0%	1	R.QEVSQLNK.I
UNO56_HUMAN50.2%112.2%596662369.1(O00567) Nucleolar protein Nop56 (Nucleolar protein 5A)
*	TK_050702_lung_E16_NE_2D_step07.3023.3023.2	1.7702	0.2471	1310.07	1	5830.0%	1	R.LIAHAGSLTNLAK.Y
ProteinsPeptide IDsCopies
Unfiltered160702893431714
Filtered732569146207