WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'D06C04_C04_06.ab1' (657 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 6 Sequences : less than 6 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1882 342 |========================================================= 6310 1540 265 |============================================ 3980 1275 249 |========================================= 2510 1026 221 |==================================== 1580 805 152 |========================= 1000 653 153 |========================= 631 500 108 |================== 398 392 90 |=============== 251 302 79 |============= 158 223 46 |======= 100 177 36 |====== 63.1 141 21 |=== 39.8 120 41 |====== 25.1 79 15 |== 15.8 64 13 |== >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 51 <<<<<<<<<<<<<<<<< 10.0 51 9 |= 6.31 42 11 |= 3.98 31 8 |= 2.51 23 7 |= 1.58 16 3 |: 1.00 13 1 |: 0.63 12 3 |: 0.40 9 1 |: 0.25 8 0 | 0.16 8 2 |: 0.10 6 1 |: 0.063 5 1 |: 0.040 4 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|7487112|pir||T13434hypothetical protein T17A13.50 ... +1 246 3.1e-19 1 gi|9049470|dbj|BAA99435.1|(AP002743) hypothetical pro... +1 190 5.1e-13 1 gi|10176766|dbj|BAB09880.1|(AB013392) gene_id:MIK19.7... +1 128 5.7e-05 1 gi|12643595|sp||HUNB_DROPO_1[Segment 1 of 2] HUNCHBAC... +1 83 0.037 1 gi|12643610|sp||HUNB_DRODA_1[Segment 1 of 2] HUNCHBAC... +1 81 0.061 1 gi|12643571|sp||HUNB_DROAA_1[Segment 1 of 2] HUNCHBAC... +1 80 0.078 1 gi|5106561|gb|AAD39751.1|AF128626_1(AF128626) RNA bin... +1 104 0.10 1 gi|1085142|pir||S55017hypothetical protein 2 - fruit ... +1 91 0.13 1 gi|6484403|dbj|BAA87604.1|(AB017036) fast skeletal mu... +1 74 0.31 1 gi|7506946|pir||T24366hypothetical protein T02E1.3a -... +1 98 0.33 1 gi|7506947|pir||T24365hypothetical protein T02E1.3b -... +1 98 0.35 1 gi|12643607|sp||HUNB_DROTA_1[Segment 1 of 2] HUNCHBAC... +1 72 0.47 1 gi|12004025|gb|AAG43852.1|AF213985_1(AF213985) caudal... +1 89 0.53 1 gi|129172|sp|P23488|OPAP_DROMEDROMSOPA PROTEIN >gi|10... +1 70 0.65 1 gi|12643598|sp||HUNB_SCAAL_1[Segment 1 of 2] HUNCHBAC... +1 69 0.74 1 gi|5359741|gb|AAD42790.1|(AF139119) fast troponin T i... +1 81 0.79 1 gi|7321824|gb|AAC37219.2|(L31349) out at first [Droso... +1 91 0.82 1 gi|12643516|sp|Q9NLA6|OAF_DROMEOUT AT FIRST PROTEIN [... +1 91 0.82 1 gi|1296429|gb|AAB08703.1|(L77967) small proline-rich ... +1 68 0.82 1 gi|7299916|gb|AAF55090.1|(AE003706) CG7552 gene produ... +1 68 0.82 1 gi|7301661|gb|AAF56777.1|(AE003764) CG12852 gene prod... +1 76 0.89 1 gi|2921775|gb|AAC70917.1|(AF044922) troponin T varian... +1 87 0.90 1 gi|7428|emb|CAA41117.1|(X58114) testis-specific RNA [... -2 42 0.91 2 gi|3928813|gb|AAC79689.1|(AC005013) cAMP response ele... +1 86 0.93 1 gi|6753232ref|NP_033913.1| calcium channel, voltage-d... +1 96 0.94 1 gi|2498466|sp|Q48251|HPN_HELPYHISTIDINE-RICH, METAL B... +1 66 0.94 1 gi|5359755|gb|AAD42797.1|(AF139126) fast troponin T i... +1 76 0.97 1 gi|7293625|gb|AAF48997.1|(AE003512) CG14223 gene prod... +1 84 0.97 2 gi|5921700|sp|O54898|CCAG_RATVOLTAGE-DEPENDENT T-TYPE... +1 95 0.97 1 gi|629324|pir||S48621hypothetical protein - Mycoplasm... -1 65 0.97 1 gi|4633670|gb|AAD26858.1|AF125161_1(AF125161) T-type ... +1 95 0.97 1 gi|2231301|gb|AAB61993.1|(U73846) testis-specific RNP... +1 90 0.99 1 gi|2134860|pir||I78877cAMP responsive element binding... +1 86 0.99 1 gi|7290441|gb|AAF45896.1|(AE003429) CG12632 gene prod... +1 83 0.991 1 gi|10728735|gb|AAF53180.2|(AE003635) aret gene produc... +1 83 0.991 1 gi|5359745|gb|AAD42792.1|(AF139121) fast troponin T i... +1 76 0.991 1 gi|7291971|gb|AAF47387.1|(AE003468) CG13885 gene prod... +1 64 0.992 1 gi|7107412|gb|AAF36404.1|AF231987_1(AF231987) LIM dom... +1 83 0.996 1 gi|7295347|gb|AAF50665.1|(AE003563) CG13300 gene prod... +1 85 0.998 1 gi|2314605|gb|AAD08472.1|(AE000643) histidine and glu... +1 63 0.998 1 gi|7464107|pir||H64698histidine and glutamine-rich pr... +1 63 0.998 1 gi|2134861|pir||I78878cAMP responsive element binding... +1 86 0.998 1 gi|4758500ref|NP_004895.1| cAMP response element-bind... +1 86 0.999 1 gi|12733360ref|XP_004938.2| cAMP response element-bin... +1 86 0.999 1 gi|422795|pir||A45477cAMP response element-binding pr... +1 86 0.999 1 gi|12643601|sp||HUNB_DROSL_1[Segment 1 of 2] HUNCHBAC... +1 70 0.9994 1 gi|4566516|gb|AAD23383.1|AF108140_1(AF108140) gamete-... +1 74 0.9998 2 gi|7331212|gb|AAF60324.1|AF236639_1(AF236639) alpha1G... +1 83 0.9998 1 gi|12643586|sp||HUNB_DROLI_1[Segment 1 of 2] HUNCHBAC... +1 70 0.99992 1 gi|7290593|gb|AAF46043.1|(AE003434) CG15781 gene prod... +1 69 0.99993 2
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 1 database sequences were not reported due to the limiting value of parameter V = 50. >gi|7487112|pir||T13434 hypothetical protein T17A13.50 - Arabidopsis thaliana >gi|7269821|emb|CAB79681.1| (AL161574) putative protein [Arabidopsis thaliana] Length = 498 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | 498 0 150 300 450 Plus Strand HSPs: Score = 246 (86.6 bits), Expect = 3.1e-19, P = 3.1e-19 Identities = 56/123 (45%), Positives = 72/123 (58%), Frame = +1 Query: 82 DHFSFIPFRKTFDEVGTGEA-STAREVVQASGSCEEVHERQRAQHVAHHQQQQHAHHH-- 252 D SF+PF K+FDEV E T + + + H Q + +HH H HHH Sbjct: 308 DQLSFVPFMKSFDEVARRETPQTGHATCEDVMAEQHRHRHQPSSSTSHHMAHDHHHHHHQ 367 Query: 253 --QISNSAFHISRPSHPISTIISPPP-LHHTSIILDDNNSYHVSRIMLQNENFQVITTQI 423 Q + AF+IS+P+HPISTIISP LHH SI + D+N YHV RI+L NEN+Q TQ Sbjct: 368 QQQQRHHAFNISQPTHPISTIISPSTSLHHASINILDDNPYHVHRILLPNENYQ---TQQ 424 Query: 424 PLLKHG 441 L + G Sbjct: 425 QLRQEG 430 >gi|9049470|dbj|BAA99435.1| (AP002743) hypothetical protein [Oryza sativa] Length = 569 Frame 1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | 569 0 150 300 450 Plus Strand HSPs: Score = 190 (66.9 bits), Expect = 5.1e-13, P = 5.1e-13 Identities = 48/133 (36%), Positives = 78/133 (58%), Frame = +1 Query: 13 SALRPGMTGFTTHHPLDIQQLK--PDHFSFIPFRKTFDEVG-TGEASTAREVVQASGSCE 183 SA G+ +++Q LK DHFSF PFRK+F+EVG +G+ + ++ G E Sbjct: 383 SATSYSTAGYAVAAAVEMQHLKHAADHFSFAPFRKSFEEVGISGDQVHSNQL----GRSE 438 Query: 184 EVHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILDDNNS 363 + H Q Q H+ A + +AF ISRP++P+S I+ PP + H S++LD ++ Sbjct: 439 QQHAGQEQQP---HRPLL-ATTTAVPATAFLISRPTNPVSNIV-PPAMQHASVVLD-HDQ 492 Query: 364 YHVSRIMLQNENFQVI 411 +HV I+L ++ FQ++ Sbjct: 493 FHVPAILLHHDKFQLL 508 >gi|10176766|dbj|BAB09880.1| (AB013392) gene_id:MIK19.7~pir||T13434~similar to unknown protein [Arabidopsis thaliana] Length = 386 Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 386 0 150 300 Plus Strand HSPs: Score = 128 (45.1 bits), Expect = 5.7e-05, P = 5.7e-05 Identities = 34/81 (41%), Positives = 46/81 (56%), Frame = +1 Query: 100 PFRKTFDEVGTGEASTAREVVQASGSCEEVHERQRAQHVA-HHQ-QQQHAHHHQISNSA- 270 P ++FDE GT EAS RE SG+CEEVH+ ++ HH H HHQI + Sbjct: 266 PHTRSFDE-GTAEASKGRENQHVSGTCEEVHDGIITSSMSSHHMIHDHHNQHHQIGDRRE 324 Query: 271 FHISRPSHPISTIISPPPLHHTSI 342 FH+S S+P++ I+ H SI Sbjct: 325 FHMSS-SYPMTPTITS---QHESI 344 >gi|12643595|sp||HUNB_DROPO_1 [Segment 1 of 2] HUNCHBACK PROTEIN >gi|2896876|gb|AAC03264.1| (U93017) hunchback protein [Drosophila petalopeza] Length = 100 Frame 1 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | | | 100 0 20 40 60 80 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 0.038, P = 0.037 Identities = 22/75 (29%), Positives = 35/75 (46%), Frame = +1 Query: 193 ERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILDDNNSYHV 372 +++ H HH H+HH SNS + S P H S + SP P +T++ L+ Sbjct: 11 KQEPISHHLHHHHAHHSHHRHDSNSNSNASSP-HQ-SPLPSPNPPSNTNLQLEQYLKQQQ 68 Query: 373 SRIMLQNENFQVITT 417 + LQ + Q + T Sbjct: 69 QQQQLQQQQQQPMDT 83 >gi|12643610|sp||HUNB_DRODA_1 [Segment 1 of 2] HUNCHBACK PROTEIN >gi|2896901|gb|AAC03274.1| (U93027) hunchback protein [Drosophila dasycnemia] Length = 102 Frame 1 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | | | 102 0 20 40 60 80 100 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 0.063, P = 0.061 Identities = 19/53 (35%), Positives = 28/53 (52%), Frame = +1 Query: 193 ERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILD 351 +++ H HH H+HH SNS + S P H S + SP P HT++ L+ Sbjct: 11 KQEPISHHHHHHHAHHSHHAHDSNSNSNASSP-HQ-SPLPSPNPPSHTNLQLE 61 >gi|12643571|sp||HUNB_DROAA_1 [Segment 1 of 2] HUNCHBACK PROTEIN >gi|2896832|gb|AAC03247.1| (U92999) hunchback protein [Drosophila adunca] Length = 101 Frame 1 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | || 101 0 20 40 60 80 100 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.081, P = 0.078 Identities = 17/50 (34%), Positives = 27/50 (54%), Frame = +1 Query: 202 RAQHVAHHQQQQHAHH-HQISNSAFHISRPSHPISTIISPPPLHHTSIILD 351 + + ++HH HAHH H +S + S H S + SP P HT++ L+ Sbjct: 11 KQEPISHHHHHHHAHHSHHAHDSNSNASNSPHQ-SPLPSPNPPSHTNLQLE 60 >gi|5106561|gb|AAD39751.1|AF128626_1 (AF128626) RNA binding protein PufA [Dictyostelium discoideum] Length = 795 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | | 795 0 150 300 450 600 750 Plus Strand HSPs: Score = 104 (36.6 bits), Expect = 0.11, P = 0.10 Identities = 26/55 (47%), Positives = 34/55 (61%), Frame = +1 Query: 208 QHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPP---LHH---TSIILDDNNS 363 QH HHQQQQH HHHQ + H ++ HP+ T+ S P L H T + L++NNS Sbjct: 219 QH-HHHQQQQHHHHHQHHHQQQHHNQ--HPVVTLSSSPTSSSLSHSPSTIVTLNNNNS 273 >gi|1085142|pir||S55017 hypothetical protein 2 - fruit fly (Drosophila melanogaster) Length = 154 Frame 1 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | 154 0 50 100 150 Plus Strand HSPs: Score = 91 (32.0 bits), Expect = 0.14, P = 0.13 Identities = 19/46 (41%), Positives = 27/46 (58%), Frame = +1 Query: 190 HERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPI--STIISPP 321 H + ++QH QQ+QH HH Q++ ++ H S S P ST SPP Sbjct: 93 HHQSQSQHKPSRQQKQHQHHSQVAPTSHHQSSSSTPPTPSTSSSPP 138 >gi|6484403|dbj|BAA87604.1| (AB017036) fast skeletal muscle troponin T [Gallus gallus] Length = 68 Frame 1 hits (HSPs): _________________________________________ __________________________________________________ Database sequence: | | | | | 68 0 20 40 60 Plus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.38, P = 0.31 Identities = 17/55 (30%), Positives = 24/55 (43%), Frame = +1 Query: 118 DEVGTGEASTAREVVQASGSCEEVHERQRAQHVAHHQQQQHA--HHHQISNSAFH 276 +EV GE E +A EE H + AHH++ HA HH + + H Sbjct: 5 EEVEHGEEEYEEEAHEAEEVHEEAHHEEAHHEEAHHEEAHHAEAHHAEAHHEEAH 59 Score = 73 (25.7 bits), Expect = 0.49, P = 0.39 Identities = 13/40 (32%), Positives = 20/40 (50%), Frame = +1 Query: 181 EEVHERQRAQHVAHHQQQQH--AHHHQISNSAFHISRPSH 294 EE HE + AHH++ H AHH + ++ H + H Sbjct: 16 EEAHEAEEVHEEAHHEEAHHEEAHHEEAHHAEAHHAEAHH 55 >gi|7506946|pir||T24366 hypothetical protein T02E1.3a - Caenorhabditis elegans >gi|3879306|emb|CAB04667.1| (Z81581) Similarity in N-terminus to Human TIS11 protein (SW:Q07352), contains similarity to Pfam domain: PF00642 (Zinc finger C-x8-C-x5-C-x3-H type (and similar).), Score=39.5, E-value=3.9e-10, N=2~cDNA EST EMBL:M75782 comes from this gene~cDNA EST yk> Length = 644 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 644 0 150 300 450 600 Plus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.40, P = 0.33 Identities = 19/59 (32%), Positives = 30/59 (50%), Frame = +1 Query: 187 VHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILDDNNS 363 +H ++QH H Q QQ+ HH H P HP + ++SPP + + + DD+ S Sbjct: 394 IHHHHQSQHQLH-QHQQYLHHAAQQYRYSHQQGPQHPFAALLSPPEISESLLPPDDSFS 451 >gi|7506947|pir||T24365 hypothetical protein T02E1.3b - Caenorhabditis elegans >gi|3879305|emb|CAB04666.1| (Z81581) contains similarity to Pfam domain: PF00642 (Zinc finger C-x8-C-x5-C-x3-H type (and similar).), Score=38.0, E-value=1e-09, N=2~cDNA EST yk194f9.3 comes from this gene~cDNA EST yk194f9.5 comes from this gene~cDNA EST yk583b8.5 comes from this g> Length = 679 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 679 0 150 300 450 600 Plus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.43, P = 0.35 Identities = 19/59 (32%), Positives = 30/59 (50%), Frame = +1 Query: 187 VHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILDDNNS 363 +H ++QH H Q QQ+ HH H P HP + ++SPP + + + DD+ S Sbjct: 429 IHHHHQSQHQLH-QHQQYLHHAAQQYRYSHQQGPQHPFAALLSPPEISESLLPPDDSFS 486 >gi|12643607|sp||HUNB_DROTA_1 [Segment 1 of 2] HUNCHBACK PROTEIN >gi|2896896|gb|AAC03272.1| (U93025) hunchback protein [Drosophila tanythrix] Length = 97 Frame 1 hits (HSPs): _________________________ __________________________________________________ Database sequence: | | | | | | 97 0 20 40 60 80 Plus Strand HSPs: Score = 72 (25.3 bits), Expect = 0.63, P = 0.47 Identities = 16/50 (32%), Positives = 28/50 (56%), Frame = +1 Query: 202 RAQHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILD 351 + + ++HH HAHH ++S + S P H S + SP P +T++ L+ Sbjct: 11 KQEPISHHHHHHHAHHSHHADSNSNASSP-HQ-SPLPSPNPPSNTNLQLE 58 >gi|12004025|gb|AAG43852.1|AF213985_1 (AF213985) caudal homeobox protein [Sacculina carcini] Length = 216 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | | 216 0 50 100 150 200 Plus Strand HSPs: Score = 89 (31.3 bits), Expect = 0.76, P = 0.53 Identities = 17/35 (48%), Positives = 19/35 (54%), Frame = +1 Query: 190 HERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSH 294 H Q QH+ HH QH HHHQ + S H PSH Sbjct: 129 HSLQHHQHLQHHDVIQHQHHHQRNISGLH--HPSH 161 Score = 81 (28.5 bits), Expect = 6.7, P = 1.0 Identities = 19/58 (32%), Positives = 28/58 (48%), Frame = +1 Query: 190 HERQRAQHVAHHQQQQHAHHHQISNSAFH-------ISRPSHP-ISTIISPPPLHHTS 339 H Q QH+ HH QH HHHQ + S H + + +HP ++ + + P H S Sbjct: 129 HSLQHHQHLQHHDVIQHQHHHQRNISGLHHPSHSSVLHQAAHPSVAALATLHPGHLAS 186 >gi|129172|sp|P23488|OPAP_DROME DROMSOPA PROTEIN >gi|103500|pir||S17518 opa protein - fruit fly (Drosophila sp.) >gi|8305|emb|CAA39846.1| (X56491) dromsopa [Drosophila melanogaster] Length = 69 Frame 1 hits (HSPs): _________________________ Annotated Domains: ___________________________________________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 __________________ Annotated Domains: PRODOM PD046431: OPAP_DROME 1..30 PRODOM PD001830: HSP1(29) VE2(21) GAG(12) 32..60 __________________ Plus Strand HSPs: Score = 70 (24.6 bits), Expect = 1.0, P = 0.65 Identities = 15/37 (40%), Positives = 21/37 (56%), Frame = +1 Query: 181 EEVHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPS 291 ++ H +Q+ QH QQQQH HHQ + H+ R S Sbjct: 32 QQQHHQQQQQH--QQQQQQHHQHHQ-HHQLQHLKRSS 65 >gi|12643598|sp||HUNB_SCAAL_1 [Segment 1 of 2] HUNCHBACK PROTEIN >gi|2896881|gb|AAC03266.1| (U93019) hunchback protein [Scaptomyza albovittata] Length = 80 Frame 1 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Plus Strand HSPs: Score = 69 (24.3 bits), Expect = 1.3, P = 0.74 Identities = 17/47 (36%), Positives = 23/47 (48%), Frame = +1 Query: 211 HVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILD 351 H HH H HHH SNS + S P S + SP P +++ L+ Sbjct: 17 HHHHHSHHSHGHHHSNSNS--NASSPRQ--SPLPSPNPPSSSNLHLE 59 >gi|5359741|gb|AAD42790.1| (AF139119) fast troponin T isoform [Coturnix japonica] Length = 135 Frame 1 hits (HSPs): __________________ __________________________________________________ Database sequence: | | | | 135 0 50 100 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 1.6, P = 0.79 Identities = 16/49 (32%), Positives = 23/49 (46%), Frame = +1 Query: 184 EVHERQRAQHVAHHQQQQH--AHHHQISNSAFHISRPSHPISTIISPPPLH 330 E HE + Q AHH++ H HH + + H P +PPP+H Sbjct: 16 EAHETEEVQEEAHHEEAHHEEVHHEEAHHEEAHAEEVHEP-----APPPVH 61 >gi|7321824|gb|AAC37219.2| (L31349) out at first [Drosophila melanogaster] Length = 487 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 487 0 150 300 450 Plus Strand HSPs: Score = 91 (32.0 bits), Expect = 1.7, P = 0.82 Identities = 19/46 (41%), Positives = 27/46 (58%), Frame = +1 Query: 190 HERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPI--STIISPP 321 H + ++QH QQ+QH HH Q++ ++ H S S P ST SPP Sbjct: 426 HHQSQSQHKPSRQQKQHQHHSQVAPTSHHQSSSSTPPTPSTSSSPP 471 >gi|12643516|sp|Q9NLA6|OAF_DROME OUT AT FIRST PROTEIN [CONTAINS: OUT AT FIRST SHORT PROTEIN] Length = 487 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 487 0 150 300 450 Plus Strand HSPs: Score = 91 (32.0 bits), Expect = 1.7, P = 0.82 Identities = 19/46 (41%), Positives = 27/46 (58%), Frame = +1 Query: 190 HERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPI--STIISPP 321 H + ++QH QQ+QH HH Q++ ++ H S S P ST SPP Sbjct: 426 HHQSQSQHKPSRQQKQHQHHSQVAPTSHHQSSSSTPPTPSTSSSPP 471 >gi|1296429|gb|AAB08703.1| (L77967) small proline-rich protein with paired repeat [Ovis aries] Length = 77 Frame 1 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | | 77 0 20 40 60 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 1.7, P = 0.82 Identities = 16/37 (43%), Positives = 17/37 (45%), Frame = +1 Query: 220 HHQQQQHAHHHQISNSAFHISRPSHPISTIISPPPLH 330 H QQQQH HHHQ P HP + PP H Sbjct: 14 HPQQQQHHHHHQCKE-------PCHPPPKVC-PPKCH 42 >gi|7299916|gb|AAF55090.1| (AE003706) CG7552 gene product [Drosophila melanogaster] Length = 88 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 1.7, P = 0.82 Identities = 13/24 (54%), Positives = 16/24 (66%), Frame = +1 Query: 193 ERQRAQHVAHHQQQQ---HAHHHQ 255 ++Q+ QH HHQQQQ H HH Q Sbjct: 23 QQQQQQHHHHHQQQQQQQHTHHQQ 46 >gi|7301661|gb|AAF56777.1| (AE003764) CG12852 gene product [Drosophila melanogaster] Length = 114 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | 114 0 50 100 Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 2.2, P = 0.89 Identities = 20/49 (40%), Positives = 27/49 (55%), Frame = +1 Query: 163 QASGSC--EEVHERQRAQHVAHHQ-QQQHAHH-HQISNSAFH-ISRPSH 294 Q SG E ++ Q+ Q + HHQ QQQH+H+ HQ H + PSH Sbjct: 29 QTSGEYVKEPPYQTQQLQQLQHHQLQQQHSHNQHQQQQHYIHQLYYPSH 77 >gi|2921775|gb|AAC70917.1| (AF044922) troponin T variant TnTx7-e16 [Gallus gallus] Length = 287 Frame 1 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | | | | 287 0 50 100 150 200 250 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 2.3, P = 0.90 Identities = 28/107 (26%), Positives = 44/107 (41%), Frame = +1 Query: 118 DEVGTGEASTAREVVQASGSCEEVHERQRAQHVAHHQQQQHA--HHHQISNSAFHISRPS 291 +EV GEA A EV + + EE H + AHH + HA HH + A + P+ Sbjct: 5 EEVEHGEAHEAEEVHEEAHH-EEAHHEEAHHEEAHHAEAHHAEAHHEEAHAHAEEVHEPA 63 Query: 292 HPISTIISPPPLHHTSIILDDNNSYHVSRIMLQNENFQVITTQIPLLKH 438 P P + T+ + + I + +N +I Q + H Sbjct: 64 PPPE---EKPRIKLTAPKIPEGEKVDFDDIQKKRQNKDLIELQALIDSH 109 >gi|7428|emb|CAA41117.1| (X58114) testis-specific RNA [Drosophila hydei] Length = 49 Frame -1 hits (HSPs): _________ Frame -2 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | 49 0 20 40 Minus Strand HSPs: Score = 42 (14.8 bits), Expect = 2.4, Sum P(2) = 0.91 Identities = 9/22 (40%), Positives = 10/22 (45%), Frame = -2 Query: 239 CC-----CC***ATCCARCRSC 189 CC CC +CC C SC Sbjct: 9 CCGPCGGCCGPCYSCCGPCYSC 30 Score = 41 (14.4 bits), Expect = 2.4, Sum P(2) = 0.91 Identities = 6/9 (66%), Positives = 7/9 (77%), Frame = -1 Query: 168 CLHYFSCCG 142 C Y+SCCG Sbjct: 31 CGPYYSCCG 39 >gi|3928813|gb|AAC79689.1| (AC005013) cAMP response element-binding protein CRE-BPa [Homo sapiens] Length = 274 Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | | 274 0 50 100 150 200 250 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 2.7, P = 0.93 Identities = 22/47 (46%), Positives = 25/47 (53%), Frame = +1 Query: 190 HERQRAQHVAH---HQQQQHAHHHQISNSAFHISRPSHPISTIISP-PPLH 330 H+ Q H H H QQ H HHH S+S H +HP SP PPLH Sbjct: 58 HQHQHPAHHPHPQPHHQQNHPHHH--SHSHLH----AHPAHHQTSPHPPLH 102 >gi|6753232 ref|NP_033913.1| calcium channel, voltage-dependent, T type, alpha 1G subunit [Mus musculus] >gi|4584688|emb|CAB40793.1| (AJ012569) voltage-gated calcium channel, alpha-1-G subunit [Mus musculus] Length = 2295 Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | 2295 0 500 1000 1500 2000 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 2.8, P = 0.94 Identities = 17/46 (36%), Positives = 21/46 (45%), Frame = +1 Query: 163 QASGSCEEVHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPI 300 Q SGSC H R H+ HH H HH+ + N + R S I Sbjct: 477 QPSGSCSRSHRRLSVHHLVHHHHHHH-HHYHLGNGTLRVPRASPEI 521 >gi|2498466|sp|Q48251|HPN_HELPY HISTIDINE-RICH, METAL BINDING POLYPEPTIDE >gi|7465222|pir||C64698 probable histidine-rich metal-binding protein - Helicobacter pylori >gi|836667|gb|AAA85859.1| (U26361) Hpn [Helicobacter pylori] >gi|2314604|gb|AAD08471.1| (AE000643) histidine-rich, metal binding polypeptide (hpn) [Helicobacter pylori 26695] >gi|4155931|gb|AAD06898.1| (AE001555) putative histidine-rich metal-binding protein [Helicobacter pylori J99] Length = 60 Frame 1 hits (HSPs): ____________________________________ Annotated Domains: ____________ _____ __________________ __________________________________________________ Database sequence: | | | | 60 0 20 40 __________________ Annotated Domains: Entrez Domain: POLY-HIS. 11..24 Entrez Domain: POLY-HIS. 28..33 Entrez Domain: 2 X 5 AA REPEATS OF E-E-G-C-C. 38..55 Entrez Repetitive region: 1. 38..42 Entrez Repetitive region: 2. 51..55 PRODOM PD044471: HPN_HELPY 40..58 __________________ Plus Strand HSPs: Score = 66 (23.2 bits), Expect = 2.9, P = 0.94 Identities = 14/43 (32%), Positives = 14/43 (32%), Frame = +1 Query: 208 QHVAHHQQQQHAHHHQISNSAFHISR-PSHPISTIISPPPLHH 333 QH HH H HHH H SH S HH Sbjct: 7 QHGGHHHHHHHTHHHHYHGGEHHHHHHSSHHEEGCCSTSDSHH 49 >gi|5359755|gb|AAD42797.1| (AF139126) fast troponin T isoform [Coturnix japonica] Length = 119 Frame 1 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | 119 0 50 100 Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 3.4, P = 0.97 Identities = 19/87 (21%), Positives = 32/87 (36%), Frame = +1 Query: 184 EVHERQRAQHVAHHQQQQH--AHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILDDN 357 E HE + Q AHH++ H HH + + H P P + T+ + + Sbjct: 10 EAHETEEVQEEAHHEEAHHEEVHHEEAHHEEAHAEEVHEPAPPPEEKPRIKLTAPKIPEG 69 Query: 358 NSYHVSRIMLQNENFQVITTQIPLLKH 438 I + +N +I Q + H Sbjct: 70 EKVDFDDIQKKRQNKDLIELQALIDSH 96 >gi|7293625|gb|AAF48997.1| (AE003512) CG14223 gene product [Drosophila melanogaster] Length = 581 Frame 2 hits (HSPs): ___ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 581 0 150 300 450 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 3.6, Sum P(2) = 0.97 Identities = 13/21 (61%), Positives = 17/21 (80%), Frame = +1 Query: 190 HERQRAQHVAHHQQQQHAHHH 252 H++Q+ QH HHQQQQH +HH Sbjct: 204 HQQQQQQHQHHHQQQQHHNHH 224 Score = 44 (15.5 bits), Expect = 3.6, Sum P(2) = 0.97 Identities = 9/17 (52%), Positives = 12/17 (70%), Frame = +2 Query: 275 ISVGHHIPSLPLSLPLP 325 IS G +LP+S+PLP Sbjct: 451 ISAGQLPATLPVSMPLP 467 >gi|5921700|sp|O54898|CCAG_RAT VOLTAGE-DEPENDENT T-TYPE CALCIUM CHANNEL ALPHA-1G SUBUNIT >gi|7514003|pir||T09053 low voltage-activated, T-type calcium channel alpha chain - rat >gi|3786351|gb|AAC67372.1| (AF027984) low voltage-activated, T-type calcium channel alpha subunit; alpha-1G calcium channel alpha subunit [Rattus norvegicus] >gi|11422004|gb|AAG35186.2|AF290212_1 (AF290212) calcium channel alpha-1-G subunit [Rattus norvegicus] Length = 2254 Frame 1 hits (HSPs): __ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 2254 0 500 1000 1500 2000 __________________ Annotated Domains: Entrez Repetitive region: I. 68..398 Entrez Repetitive region: II. 730..968 Entrez Repetitive region: III. 1242..1519 Entrez Repetitive region: IV. 1564..1822 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1..80 Entrez Transmembrane region: S1 OF REPEAT I. 81..101 Entrez Domain: EXTRACELLULAR (POTENTIAL). 102..119 Entrez Transmembrane region: S2 OF REPEAT I (PO 120..141 Entrez Domain: CYTOPLASMIC (POTENTIAL). 142..150 Entrez Transmembrane region: S3 OF REPEAT I. 151..170 Entrez Domain: EXTRACELLULAR (POTENTIAL). 171..175 Entrez Transmembrane region: S4 OF REPEAT I. 176..193 Entrez Domain: CYTOPLASMIC (POTENTIAL). 194..213 Entrez Transmembrane region: S5 OF REPEAT I (PO 214..234 Entrez Domain: EXTRACELLULAR (POTENTIAL). 235..370 Entrez Transmembrane region: S6 OF REPEAT I. 371..395 Entrez Domain: CYTOPLASMIC (POTENTIAL). 396..744 Entrez Transmembrane region: S1 OF REPEAT II (P 745..765 Entrez Domain: EXTRACELLULAR (POTENTIAL). 766..778 Entrez Transmembrane region: S2 OF REPEAT II (P 779..800 Entrez Domain: CYTOPLASMIC (POTENTIAL). 801..806 Entrez Transmembrane region: S3 OF REPEAT II (P 807..825 Entrez Domain: EXTRACELLULAR (POTENTIAL). 826..833 Entrez Transmembrane region: S4 OF REPEAT II (P 834..857 Entrez Domain: CYTOPLASMIC (POTENTIAL). 858..868 Entrez Transmembrane region: S5 OF REPEAT II (P 869..889 Entrez Domain: EXTRACELLULAR (POTENTIAL). 890..940 Entrez Transmembrane region: S6 OF REPEAT II (P 941..965 Entrez Domain: CYTOPLASMIC (POTENTIAL). 966..1251 Entrez Transmembrane region: S1 OF REPEAT III ( 1252..1274 Entrez Domain: EXTRACELLULAR (POTENTIAL). 1275..1292 Entrez Transmembrane region: S2 OF REPEAT III ( 1293..1313 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1314..1323 Entrez Transmembrane region: S3 OF REPEAT III ( 1324..1343 Entrez Domain: EXTRACELLULAR (POTENTIAL). 1344..1357 Entrez Transmembrane region: S4 OF REPEAT III ( 1358..1379 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1380..1389 Entrez Transmembrane region: S5 OF REPEAT III ( 1390..1413 Entrez Domain: EXTRACELLULAR (POTENTIAL). 1414..1490 Entrez Transmembrane region: S6 OF REPEAT III ( 1491..1516 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1517..1578 Entrez Transmembrane region: S1 OF REPEAT IV (P 1579..1599 Entrez Domain: EXTRACELLULAR (POTENTIAL). 1600..1613 Entrez Transmembrane region: S2 OF REPEAT IV (P 1614..1635 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1636..1642 Entrez Transmembrane region: S3 OF REPEAT IV (P 1643..1661 Entrez Domain: EXTRACELLULAR (POTENTIAL). 1662..1675 Entrez Transmembrane region: S4 OF REPEAT IV (P 1676..1699 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1700..1713 Entrez Transmembrane region: S5 OF REPEAT IV (P 1714..1734 Entrez Domain: EXTRACELLULAR (POTENTIAL). 1735..1794 Entrez Transmembrane region: S6 OF REPEAT IV (P 1795..1822 Entrez Domain: CYTOPLASMIC (POTENTIAL). 1823..2058 Entrez Domain: POLY-GLY. 290..295 Entrez Domain: POLY-HIS. 496..506 Entrez Domain: POLY-GLU. 1527..1530 Entrez other site: CALCIUM ION SELECTIVITY AND 354 Entrez other site: CALCIUM ION SELECTIVITY AND 924 Entrez other site: CALCIUM ION SELECTIVITY AND 1465 Entrez other site: CALCIUM ION SELECTIVITY AND 1770 Entrez glycosylation site: POTENTIAL. 173 Entrez glycosylation site: POTENTIAL. 246 Entrez glycosylation site: POTENTIAL. 306 Entrez glycosylation site: POTENTIAL. 310 Entrez glycosylation site: POTENTIAL. 322 Entrez glycosylation site: POTENTIAL. 1427 Entrez glycosylation site: POTENTIAL. 1430 Entrez glycosylation site: POTENTIAL. 1666 PFAM ion_trans: Ion transport protein 77..394 PFAM ion_trans: Ion transport protein 740..964 PFAM ion_trans: Ion transport protein 1251..1515 PFAM ion_trans: Ion transport protein 1575..1818 PRODOM PD189948: CCAG(1) O94770(1) 1..49 PRODOM PD085893: 51..81 PRODOM PD000032: CCAA(20) CCAB(20) CCAE(20) 83..199 PRODOM PD000091: CCAA(25) CCAB(25) CCAD(25) 204..234 PRODOM PD085912: 255..325 PRODOM PD000091: CCAA(25) CCAB(25) CCAD(25) 328..360 PRODOM PD001530: CCAA(5) CCAB(5) CCAE(5) 362..411 PRODOM PD133921: CCAG(3) O94770(2) Q9Z0Y8(2) 419..489 PRODOM PD133921: CCAG(3) O94770(2) Q9Z0Y8(2) 508..533 PRODOM PD133921: CCAG(3) O94770(2) Q9Z0Y8(2) 549..584 PRODOM PD187402: CCAG(1) O94770(1) CCAH(1) 586..741 PRODOM PD000032: CCAA(20) CCAB(20) CCAE(20) 743..848 PRODOM PD000091: CCAA(25) CCAB(25) CCAD(25) 854..933 PRODOM PD106619: 935..1032 PRODOM PD210248: CCAG_RAT 1034..1086 PRODOM PD125952: CCAG(1) O94770(1) CCAH(1) 1088..1253 PRODOM PD000032: CCAA(20) CCAB(20) CCAE(20) 1255..1370 PRODOM PD000091: CCAA(25) CCAB(25) CCAD(25) 1372..1483 PRODOM PD186968: 1485..1525 PRODOM PD161408: CCAG_RAT 1548..1578 PRODOM PD000032: CCAA(20) CCAB(20) CCAE(20) 1580..1693 PRODOM PD000091: CCAA(25) CCAB(25) CCAD(25) 1696..1786 PRODOM PD186969: 1789..1825 PRODOM PD206255: CCAG_RAT 1843..1896 PRODOM PD188099: CCAG(1) CCAH(1) O95802(1) 1898..2036 PRODOM PD210156: CCAG_RAT 2038..2074 PRODOM PD139877: CCAG(1) O95802(1) 2076..2234 __________________ Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 3.6, P = 0.97 Identities = 17/46 (36%), Positives = 21/46 (45%), Frame = +1 Query: 163 QASGSCEEVHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPI 300 Q SGSC H R H+ HH H HH+ + N + R S I Sbjct: 477 QPSGSCTRSHRRLSVHHLVHHHHHHH-HHYHLGNGTLRVPRASPEI 521 >gi|629324|pir||S48621 hypothetical protein - Mycoplasma capricolum (fragment) Length = 80 Frame -1 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Minus Strand HSPs: Score = 65 (22.9 bits), Expect = 3.7, P = 0.97 Identities = 13/39 (33%), Positives = 20/39 (51%), Frame = -1 Query: 627 NKFIFNFFFYGQAHDINSYAIKTFSQCTLNYFSIMTTIW 511 N F+FNFF+ I S +F+ ++NYF + W Sbjct: 22 NXFLFNFFYTFIHRTIYSCXNCSFNXSSINYFYFLLNFW 60 >gi|4633670|gb|AAD26858.1|AF125161_1 (AF125161) T-type calcium channel isoform [Rattus norvegicus] Length = 2288 Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | 2288 0 500 1000 1500 2000 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 3.7, P = 0.97 Identities = 17/46 (36%), Positives = 21/46 (45%), Frame = +1 Query: 163 QASGSCEEVHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPI 300 Q SGSC H R H+ HH H HH+ + N + R S I Sbjct: 477 QPSGSCTRSHRRLSVHHLVHHHHHHH-HHYHLGNGTLRVPRASPEI 521 >gi|2231301|gb|AAB61993.1| (U73846) testis-specific RNP-type RNA binding protein [Drosophila melanogaster] Length = 808 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | | 808 0 150 300 450 600 750 Plus Strand HSPs: Score = 90 (31.7 bits), Expect = 4.3, P = 0.99 Identities = 24/67 (35%), Positives = 31/67 (46%), Frame = +1 Query: 121 EVGTGEASTAREVVQASGSCEE--VHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSH 294 E G E +++S S + H Q +H A HQQQQ HHHQ ++ H Sbjct: 81 EFGLAEVDAKLTQLKSSHSLQHHHSHHHQLQRHTALHQQQQQLHHHQPHHNHHHHHPYQR 140 Query: 295 PISTIISPP 321 P T SPP Sbjct: 141 PRPT--SPP 147 >gi|2134860|pir||I78877 cAMP responsive element binding protein - human >gi|181054|gb|AAC37527.1| (L05912) cAMP responsive element binding protein [Homo sapiens] Length = 369 Frame 1 hits (HSPs): _______ Annotated Domains: ________ __________________________________________________ Database sequence: | | | | 369 0 150 300 __________________ Annotated Domains: PROSITE BZIP_BASIC: bZIP transcription factors b 241..256 PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 264..285 PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 271..292 __________________ Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 4.4, P = 0.99 Identities = 22/47 (46%), Positives = 25/47 (53%), Frame = +1 Query: 190 HERQRAQHVAH---HQQQQHAHHHQISNSAFHISRPSHPISTIISP-PPLH 330 H+ Q H H H QQ H HHH S+S H +HP SP PPLH Sbjct: 153 HQHQHPAHHPHPQPHHQQNHPHHH--SHSHLH----AHPAHHQTSPHPPLH 197 >gi|7290441|gb|AAF45896.1| (AE003429) CG12632 gene product [Drosophila melanogaster] Length = 238 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 238 0 50 100 150 200 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 4.7, P = 0.99 Identities = 31/109 (28%), Positives = 47/109 (43%), Frame = +1 Query: 115 FDEVGTGEASTAREVVQASGSCEEVHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSH 294 +DE A+ +E++Q + Q+ Q QQQQH HHH N H Sbjct: 125 YDEAAVAVATLTQEMMQTNSGGGSTETSQQQQ-----QQQQHHHHHSHQNHQNHNQHHQR 179 Query: 295 --PISTIISPPPLHHTS-IILDDNNSYHVSRIMLQNENFQVITTQIPLLKHG 441 P + ++S L T+ IL N H + +Q+ N + T LL +G Sbjct: 180 LLPFNDLLSDDELRKTAGQIL---NGIH-REVEVQSVNSIISTYHDVLLDNG 227 >gi|10728735|gb|AAF53180.2| (AE003635) aret gene product [Drosophila melanogaster] Length = 238 Frame 1 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | | 238 0 50 100 150 200 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 4.7, P = 0.99 Identities = 23/67 (34%), Positives = 31/67 (46%), Frame = +1 Query: 121 EVGTGEASTAREVVQASGSCEE--VHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSH 294 E G E +++S S + H Q +H A +QQQQ HHHQ ++ H Sbjct: 81 EFGLAEVDAKLTQLKSSHSLQHHHSHHHQLQRHTALNQQQQQLHHHQPHHNHHHHHPYQR 140 Query: 295 PISTIISPP 321 P T SPP Sbjct: 141 PRPT--SPP 147 >gi|5359745|gb|AAD42792.1| (AF139121) fast troponin T isoform [Coturnix japonica] Length = 125 Frame 1 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 125 0 50 100 Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 4.7, P = 0.99 Identities = 19/87 (21%), Positives = 32/87 (36%), Frame = +1 Query: 184 EVHERQRAQHVAHHQQQQH--AHHHQISNSAFHISRPSHPISTIISPPPLHHTSIILDDN 357 E HE + Q AHH++ H HH + + H P P + T+ + + Sbjct: 16 EAHETEEVQEEAHHEEAHHEEVHHEEAHHEEAHAEEVHEPAPPPEEKPRIKLTAPKIPEG 75 Query: 358 NSYHVSRIMLQNENFQVITTQIPLLKH 438 I + +N +I Q + H Sbjct: 76 EKVDFDDIQKKRQNKDLIELQALIDSH 102 >gi|7291971|gb|AAF47387.1| (AE003468) CG13885 gene product [Drosophila melanogaster] Length = 71 Frame 1 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 4.8, P = 0.99 Identities = 14/33 (42%), Positives = 17/33 (51%), Frame = +1 Query: 205 AQHVAHHQQQQ--HAHHHQISNSAFHISRPSHP 297 A HV +H H+HHH S+S H SHP Sbjct: 13 AAHVQNHSMHHPIHSHHHHHSHSHPHPHPHSHP 45 >gi|7107412|gb|AAF36404.1|AF231987_1 (AF231987) LIM domain protein [Dictyostelium discoideum] Length = 260 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | | | 260 0 50 100 150 200 250 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 5.5, P = 1.0 Identities = 24/69 (34%), Positives = 35/69 (50%), Frame = +1 Query: 205 AQHVAH-HQQQQHAHHHQISNSAF-HISRPSHPISTIISPPPLHHTSIILDDNNSYHVSR 378 A + H HQ QQH H HQ +A HI + S +PPP+ H + +NS + S Sbjct: 15 APEIQHQHQHQQHQHQHQQKTTATNHIHKEQD--SHKPNPPPISHQN----SSNSLNKSP 68 Query: 379 IMLQNENFQVI 411 L EN +++ Sbjct: 69 RKLDGENGELV 79 >gi|7295347|gb|AAF50665.1| (AE003563) CG13300 gene product [Drosophila melanogaster] Length = 388 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | 388 0 150 300 Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 6.1, P = 1.0 Identities = 28/96 (29%), Positives = 43/96 (44%), Frame = +1 Query: 10 NSALRPGMTGFTTHHPLD-IQQLKPDHFSFIPFRKTFDEVGTGEASTAREVVQASGSCEE 186 N+ LR + T HP D I+ L+P +P + +G AS A + ++ Sbjct: 232 NNHLR--RSNIYTAHPADSIRGLQPLPV-VLPLPLSLPHPPSGGASPASSSTTPPATQQQ 288 Query: 187 VHERQRAQHVAH-HQQQQHAHHHQISNSAFHISRPSHP 297 H+ + Q H +QQQQH HH + H P +P Sbjct: 289 QHQPLQQQQYFHPYQQQQHVHHSHTHHHHTHHHVPLYP 326 >gi|2314605|gb|AAD08472.1| (AE000643) histidine and glutamine-rich protein [Helicobacter pylori 26695] Length = 72 Frame 1 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 6.2, P = 1.0 Identities = 11/30 (36%), Positives = 14/30 (46%), Frame = +1 Query: 190 HERQRAQHV-AHHQQQQHAHHHQISNSAFH 276 HE+Q+ Q + H HAHHH H Sbjct: 4 HEQQQQQQANSQHHHHHHAHHHHYYGGEHH 33 >gi|7464107|pir||H64698 histidine and glutamine-rich protein - Helicobacter pylori (strain 26695) Length = 57 Frame 1 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | 57 0 20 40 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 6.2, P = 1.0 Identities = 11/30 (36%), Positives = 14/30 (46%), Frame = +1 Query: 190 HERQRAQHV-AHHQQQQHAHHHQISNSAFH 276 HE+Q+ Q + H HAHHH H Sbjct: 4 HEQQQQQQANSQHHHHHHAHHHHYYGGEHH 33 >gi|2134861|pir||I78878 cAMP responsive element binding protein - human >gi|181056|gb|AAC37526.1| (L05913) cAMP responsive element binding protein [Homo sapiens] Length = 475 Frame 1 hits (HSPs): _____ Annotated Domains: ______ __________________________________________________ Database sequence: | | | | | 475 0 150 300 450 __________________ Annotated Domains: PROSITE BZIP_BASIC: bZIP transcription factors b 347..362 PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 370..391 PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 377..398 __________________ Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 6.2, P = 1.0 Identities = 22/47 (46%), Positives = 25/47 (53%), Frame = +1 Query: 190 HERQRAQHVAH---HQQQQHAHHHQISNSAFHISRPSHPISTIISP-PPLH 330 H+ Q H H H QQ H HHH S+S H +HP SP PPLH Sbjct: 259 HQHQHPAHHPHPQPHHQQNHPHHH--SHSHLH----AHPAHHQTSPHPPLH 303 >gi|4758500 ref|NP_004895.1| cAMP response element-binding protein CRE-BPa [Homo sapiens] >gi|181052|gb|AAC37525.1| (L05911) cAMP responsive element binding protein [Homo sapiens] Length = 501 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 501 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 6.7, P = 1.0 Identities = 22/47 (46%), Positives = 25/47 (53%), Frame = +1 Query: 190 HERQRAQHVAH---HQQQQHAHHHQISNSAFHISRPSHPISTIISP-PPLH 330 H+ Q H H H QQ H HHH S+S H +HP SP PPLH Sbjct: 285 HQHQHPAHHPHPQPHHQQNHPHHH--SHSHLH----AHPAHHQTSPHPPLH 329 >gi|12733360 ref|XP_004938.2| cAMP response element-binding protein CRE-BPa [Homo sapiens] Length = 501 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 501 0 150 300 450 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 6.7, P = 1.0 Identities = 22/47 (46%), Positives = 25/47 (53%), Frame = +1 Query: 190 HERQRAQHVAH---HQQQQHAHHHQISNSAFHISRPSHPISTIISP-PPLH 330 H+ Q H H H QQ H HHH S+S H +HP SP PPLH Sbjct: 285 HQHQHPAHHPHPQPHHQQNHPHHH--SHSHLH----AHPAHHQTSPHPPLH 329 >gi|422795|pir||A45477 cAMP response element-binding protein CRE-BPa - human >gi|181050|gb|AAA52072.1| (L05515) cAMP response element-binding protein [Homo sapiens] Length = 508 Frame 1 hits (HSPs): _____ Annotated Domains: _________________ ____________________ __________________________________________________ Database sequence: | | | | | 508 0 150 300 450 __________________ Annotated Domains: DOMO DM00002: ZINCFINGER,C2H2TYPE,DOMAIN 5..38 DOMO DM03989: CAMPRESPONSEELEMENT-BINDINGPROT 40..167 DOMO DM00107: BZIPTRANSCRIPTIONFACTORSBASICDO 309..444 DOMO DM04956: CAMPRESPONSEELEMENT-BINDINGPROT 446..508 Entrez domain: fos/jun DNA-binding domain homol 370..410 PROSITE BZIP_BASIC: bZIP transcription factors b 380..395 PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 403..424 PROSITE LEUCINE_ZIPPER: Leucine zipper pattern. 410..431 PROSITE ZINC_FINGER_C2H2: Zinc finger, C2H2 type 18..40 __________________ Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 6.8, P = 1.0 Identities = 22/47 (46%), Positives = 25/47 (53%), Frame = +1 Query: 190 HERQRAQHVAH---HQQQQHAHHHQISNSAFHISRPSHPISTIISP-PPLH 330 H+ Q H H H QQ H HHH S+S H +HP SP PPLH Sbjct: 292 HQHQHPAHHPHPQPHHQQNHPHHH--SHSHLH----AHPAHHQTSPHPPLH 336 >gi|12643601|sp||HUNB_DROSL_1 [Segment 1 of 2] HUNCHBACK PROTEIN >gi|2896886|gb|AAC03268.1| (U93021) hunchback protein [Drosophila silvestris] Length = 102 Frame 1 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | | | | 102 0 20 40 60 80 100 Plus Strand HSPs: Score = 70 (24.6 bits), Expect = 7.3, P = 1.0 Identities = 20/53 (37%), Positives = 30/53 (56%), Frame = +1 Query: 202 RAQHVAHHQQQQHAHH--HQI---SNSAFHISRPSHPISTIISPPPLHHTSIILD 351 + + ++HH HAHH HQ SNS + S P H S + SP P +T++ L+ Sbjct: 11 KQEPISHHHHHHHAHHSYHQHPHDSNSNSNASSP-HQ-SPLPSPNPPSNTNLQLE 63 >gi|4566516|gb|AAD23383.1|AF108140_1 (AF108140) gamete-specific homeodomain protein GSP1 [Chlamydomonas reinhardtii] Length = 1033 Frame 3 hits (HSPs): ___ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | | | 1033 0 150 300 450 600 750 900 Plus Strand HSPs: Score = 74 (26.0 bits), Expect = 8.5, Sum P(2) = 1.0 Identities = 20/55 (36%), Positives = 26/55 (47%), Frame = +1 Query: 169 SGSCEEVHERQRA-QHVAHHQQQQHA------H-HHQISNSAF----HISRPSHP 297 +G+ H+ Q QH HHQQ QH H HHQ + +A H +P HP Sbjct: 131 AGTYPAQHQHQHQHQHQQHHQQHQHVVPAAVGHSHHQAATAAAAHAPHYHQPQHP 185 Score = 57 (20.1 bits), Expect = 8.5, Sum P(2) = 1.0 Identities = 14/42 (33%), Positives = 19/42 (45%), Frame = +3 Query: 297 HLYHYLSPSPPPHFHHSR*QQLLPCL*NNAPKRKLPGNHHSN 422 H +H H H QQ +P ++A R LP NH S+ Sbjct: 293 HQHHQHHHQHHQHHHQHHHQQHVPAGAHHAAARPLPPNHQSH 334 >gi|7331212|gb|AAF60324.1|AF236639_1 (AF236639) alpha1G T-type calcium channel subunit [Bos taurus] Length = 342 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 342 0 150 300 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 8.6, P = 1.0 Identities = 17/46 (36%), Positives = 20/46 (43%), Frame = +1 Query: 163 QASGSCEEVHERQRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPI 300 Q SG C H R H+ HH H H+H + N RPS I Sbjct: 79 QPSGGCPRPHRRPSVHHLMHHHH--HPHYH-LGNGTLRAPRPSPQI 121 >gi|12643586|sp||HUNB_DROLI_1 [Segment 1 of 2] HUNCHBACK PROTEIN >gi|2896856|gb|AAC03256.1| (U93009) hunchback protein [Drosophila lineosetae] Length = 104 Frame 1 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | | | 104 0 20 40 60 80 100 Plus Strand HSPs: Score = 70 (24.6 bits), Expect = 9.4, P = 1.0 Identities = 20/53 (37%), Positives = 30/53 (56%), Frame = +1 Query: 202 RAQHVAHHQQQQHAHH--HQI---SNSAFHISRPSHPISTIISPPPLHHTSIILD 351 + + ++HH HAHH HQ SNS + S P H S + SP P +T++ L+ Sbjct: 11 KQEPISHHHHHHHAHHSHHQHPHDSNSNSNASSP-HQ-SPLPSPNPPSNTNLQLE 63 >gi|7290593|gb|AAF46043.1| (AE003434) CG15781 gene product [Drosophila melanogaster] Length = 198 Frame 3 hits (HSPs): __________ Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | 198 0 50 100 150 Plus Strand HSPs: Score = 69 (24.3 bits), Expect = 9.5, Sum P(2) = 1.0 Identities = 17/42 (40%), Positives = 18/42 (42%), Frame = +1 Query: 199 QRAQHVAHHQQQQHAHHHQISNSAFHISRPSHPISTIISPPP 324 Q A V HH Q QH HH H P HP + PPP Sbjct: 131 QLAAAVHHHHQHQHQHHPH------H--HPHHPHGAVGGPPP 164 Score = 44 (15.5 bits), Expect = 9.5, Sum P(2) = 1.0 Identities = 13/35 (37%), Positives = 13/35 (37%), Frame = +3 Query: 318 PSPPPHFHHSR*QQLLPCL*NNAPKRKLPGNHHSN 422 P PPP HH P L P NH SN Sbjct: 163 PPPPPMQHHHPHHPHHPLLHAQGKPMSPPANH-SN 196 WARNING: HSPs involving 1 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.94 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.377 0.168 0.657 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.363 0.163 0.537 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.329 0.140 0.425 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.352 0.157 0.542 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.381 0.173 0.692 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.376 0.173 0.699 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 218 216 10. 77 3 12 22 0.10 35 32 0.12 38 +2 0 218 215 10. 77 3 12 22 0.10 35 32 0.11 38 +1 0 219 218 10. 77 3 12 22 0.10 35 32 0.12 38 -1 0 219 216 10. 77 3 12 22 0.10 35 32 0.12 38 -2 0 218 215 10. 77 3 12 22 0.10 35 32 0.11 38 -3 0 218 216 10. 77 3 12 22 0.10 35 32 0.12 38 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 51 No. of states in DFA: 597 (59 KB) Total size of DFA: 222 KB (256 KB) Time to generate neighborhood: 0.01u 0.01s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 203.89u 1.09s 204.98t Elapsed: 00:00:38 Total cpu time: 203.95u 1.12s 205.07t Elapsed: 00:00:38 Start: Wed Jan 16 16:52:26 2002 End: Wed Jan 16 16:53:04 2002 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000