WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'E10H05_P17_15.ab1' (466 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 3 Sequences : less than 3 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 773 147 |================================================= 6310 626 79 |========================== 3980 547 132 |============================================ 2510 415 104 |================================== 1580 311 63 |===================== 1000 248 54 |================== 631 194 39 |============= 398 155 77 |========================= 251 78 19 |====== 158 59 11 |=== 100 48 7 |== 63.1 41 11 |=== 39.8 30 2 |: 25.1 28 1 |: 15.8 27 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|9758155|dbj|BAB08712.1|(AB015477) 40S ribosomal pr... +1 303 5.8e-26 1 gi|11275277|pir||T45927ribosomal protein S3a homolog ... +1 290 1.4e-24 1 gi|4582468|gb|AAD24852.1|AC007071_24(AC007071) 40S ri... +1 282 9.8e-24 1 gi|6755372ref|NP_036182.1| ribosomal protein S3 [Mus ... +1 224 1.4e-17 1 gi|133940|sp|P02350|RS3A_XENLA40S RIBOSOMAL PROTEIN S... +1 224 1.4e-17 1 gi|70850|pir||R3RT3ribosomal protein S3, cytosolic [v... +1 224 1.4e-17 1 gi|1350988|sp|P47835|RS3B_XENLA40S RIBOSOMAL PROTEIN ... +1 224 1.4e-17 1 gi|4680363|gb|AAD27643.1|AF133129_1(AF133129) ribosom... +1 224 1.4e-17 1 gi|4506721ref|NP_000996.1| ribosomal protein S3 [Homo... +1 223 1.7e-17 1 gi|11437285ref|XP_006219.1| ribosomal protein S3 [Hom... +1 223 1.7e-17 1 gi|2500399|sp|P79891|RS3_AMBME40S RIBOSOMAL PROTEIN S... +1 223 1.7e-17 1 gi|7765076|gb|AAB19349.2|(S42658) S3 ribosomal protei... +1 223 1.7e-17 1 gi|9022435|gb|AAF82383.1|AF281313_1(AF281313) ribosom... +1 223 1.7e-17 1 gi|548856|sp|Q06559|RS3_DROME40S RIBOSOMAL PROTEIN S3... +1 222 2.2e-17 1 gi|422495|pir||S32728ribosomal protein S3 - fruit fly... +1 222 2.2e-17 1 gi|1350990|sp|P48153|RS3_MANSE40S RIBOSOMAL PROTEIN S... +1 209 5.3e-16 1 gi|6094179|sp|O60128|RS3_SCHPO40S RIBOSOMAL PROTEIN S... +1 202 2.9e-15 1 gi|1350989|sp|P48152|RS3_CAEELPROBABLE 40S RIBOSOMAL ... +1 201 3.7e-15 1 gi|7440096|pir||T01065ribosomal protein S1 - African ... +1 199 6.1e-15 1 gi|6324151ref|NP_014221.1| Ribosomal protein S3 (rp13... +1 193 2.6e-14 1 gi|468426|gb|AAA35010.1|(L31405) ribosomal protein S3... +1 193 2.6e-14 1 gi|6540574|gb|AAF16402.1|(AF207603) ribosomal protein... +1 151 7.4e-10 1 gi|1688320|gb|AAB36959.1|(U78756) RpgG [Dictyostelium... +1 145 3.2e-09 1 gi|9558269|emb|CAC00395.1|(AL160371) probable ribosom... +1 138 1.8e-08 1 gi|3642663|gb|AAC36521.1|(U89414) ribosomal protein S... +1 122 8.8e-07 1 gi|8247324|emb|CAB92940.1|(AJ290932) putative 40S rib... +1 121 1.1e-06 1
Use the and icons to retrieve links to Entrez:
>gi|9758155|dbj|BAB08712.1| (AB015477) 40S ribosomal protein S3 [Arabidopsis thaliana] Length = 248 Frame 1 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | | 248 0 50 100 150 200 Plus Strand HSPs: Score = 303 (106.7 bits), Expect = 5.8e-26, P = 5.8e-26 Identities = 57/79 (72%), Positives = 65/79 (82%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 M+S GQP K+YID+AVRHVLLRQGVLG+KVKIMLDWDPKGKQGP TPLPD+V IHTPKE+ Sbjct: 157 MVSSGQPTKEYIDAAVRHVLLRQGVLGLKVKIMLDWDPKGKQGPMTPLPDVVIIHTPKED 216 Query: 193 EEYARPAAVLATDIEVPVA 249 + Y PA V+ VP A Sbjct: 217 DVYIAPAQVVTQAAFVPEA 235 >gi|11275277|pir||T45927 ribosomal protein S3a homolog - Arabidopsis thaliana >gi|7630007|emb|CAB88349.1| (AL132960) ribosomal protein S3a homolog [Arabidopsis thaliana] Length = 249 Frame 1 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | | 249 0 50 100 150 200 Plus Strand HSPs: Score = 290 (102.1 bits), Expect = 1.4e-24, P = 1.4e-24 Identities = 55/71 (77%), Positives = 60/71 (84%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 M+S GQP K+YIDSAVRHVLLRQGVLGIKVK+MLDWDPKG GPKTPLPD+V IH+PKEE Sbjct: 157 MVSSGQPTKEYIDSAVRHVLLRQGVLGIKVKVMLDWDPKGISGPKTPLPDVVIIHSPKEE 216 Query: 193 EEYARPAAVLA 225 E PA V A Sbjct: 217 EAIYAPAQVAA 227 >gi|4582468|gb|AAD24852.1|AC007071_24 (AC007071) 40S ribosomal protein; contains C-terminal domain [Arabidopsis thaliana] Length = 250 Frame 1 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | | 250 0 50 100 150 200 Plus Strand HSPs: Score = 282 (99.3 bits), Expect = 9.8e-24, P = 9.8e-24 Identities = 52/71 (73%), Positives = 59/71 (83%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 M+S GQP K+YID+AVRHVLLRQGVLGIKVKIMLDWDP GK GPKTPLPD+V IH PK++ Sbjct: 157 MVSSGQPTKEYIDAAVRHVLLRQGVLGIKVKIMLDWDPTGKSGPKTPLPDVVIIHAPKDD 216 Query: 193 EEYARPAAVLA 225 Y+ PA A Sbjct: 217 VVYSAPAQAAA 227 >gi|6755372 ref|NP_036182.1| ribosomal protein S3 [Mus musculus] >gi|1173253|sp|P17073|RS3_MOUSE 40S RIBOSOMAL PROTEIN S3 >gi|543317|pir||S41170 ribosomal protein S3, cytosolic - mouse >gi|57728|emb|CAA35916.1| (X51536) ribosomal protein S3 (AA 1-243) [Rattus rattus] >gi|439522|emb|CAA54167.1| (X76772) ribosomal protein S3 [Mus musculus] Length = 243 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | 243 0 50 100 150 200 Plus Strand HSPs: Score = 224 (78.9 bits), Expect = 1.4e-17, P = 1.4e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216 >gi|133940|sp|P02350|RS3A_XENLA 40S RIBOSOMAL PROTEIN S3A (S1A) >gi|70851|pir||R3XL3A ribosomal protein S3a - African clawed frog >gi|65091|emb|CAA40592.1| (X57322) ribosomal protein S1a [Xenopus laevis] Length = 246 Frame 1 hits (HSPs): _____________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 246 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL00548: Ribosomal protein S3 proteins. 66..95 DOMO DM00298: RIBOSOMALPROTEINS3 27..190 PFAM KH-domain: KH domain 47..95 PFAM Ribosomal_S3_C: Ribosomal protein S3, C- 104..188 PRODOM PD149954: RS3(8) P90526(1) RS3A(1) 4..68 PRODOM PD150147: RS3(13) 70..215 PRODOM PD037257: RS3A(1) RS3B(1) 217..245 PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 147..183 __________________ Plus Strand HSPs: Score = 224 (78.9 bits), Expect = 1.4e-17, P = 1.4e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216 >gi|70850|pir||R3RT3 ribosomal protein S3, cytosolic [validated] - rat Length = 243 Frame 1 hits (HSPs): _____________ Annotated Domains: ________ __________________________________________________ Database sequence: | | | | | | 243 0 50 100 150 200 __________________ Annotated Domains: PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 147..183 __________________ Plus Strand HSPs: Score = 224 (78.9 bits), Expect = 1.4e-17, P = 1.4e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216 >gi|1350988|sp|P47835|RS3B_XENLA 40S RIBOSOMAL PROTEIN S3B (S1B) >gi|2119058|pir||I51635 ribosomal protein S1 - African clawed frog >gi|587600|emb|CAA84291.1| (Z34530) ribosomal protein S1 [Xenopus laevis] >gi|587602|emb|CAA84290.1| (Z34529) ribosomal protein [Xenopus laevis] Length = 246 Frame 1 hits (HSPs): _____________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 246 0 50 100 150 200 __________________ Annotated Domains: BLOCKS BL00548: Ribosomal protein S3 proteins. 66..95 PFAM KH-domain: KH domain 47..95 PFAM Ribosomal_S3_C: Ribosomal protein S3, C- 104..188 PRODOM PD149954: RS3(8) P90526(1) RS3A(1) 3..68 PRODOM PD150147: RS3(13) 70..215 PRODOM PD037257: RS3A(1) RS3B(1) 217..245 PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 147..183 __________________ Plus Strand HSPs: Score = 224 (78.9 bits), Expect = 1.4e-17, P = 1.4e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216 >gi|4680363|gb|AAD27643.1|AF133129_1 (AF133129) ribosomal protein S3 [Meriones unguiculatus] Length = 128 Frame 1 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | 128 0 50 100 Plus Strand HSPs: Score = 224 (78.9 bits), Expect = 1.4e-17, P = 1.4e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 42 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 101 >gi|4506721 ref|NP_000996.1| ribosomal protein S3 [Homo sapiens] >gi|32532|emb|CAA39248.1| (X55715) ribosomal protein s3 [Homo sapiens] Length = 243 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | 243 0 50 100 150 200 Plus Strand HSPs: Score = 223 (78.5 bits), Expect = 1.7e-17, P = 1.7e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDE 216 >gi|11437285 ref|XP_006219.1| ribosomal protein S3 [Homo sapiens] >gi|417719|sp|P23396|RS3_HUMAN 40S RIBOSOMAL PROTEIN S3 >gi|2144763|pir||R3HUS3 ribosomal protein S3, cytosolic - human >gi|555941|gb|AAB60336.1| (U14990) ribosomal protein S3 [Homo sapiens] >gi|555943|gb|AAB60337.1| (U14991) ribosomal protein S3 [Homo sapiens] >gi|555945|gb|AAB60338.1| (U14992) ribosomal protein S3 [Homo sapiens] Length = 243 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | 243 0 50 100 150 200 Plus Strand HSPs: Score = 223 (78.5 bits), Expect = 1.7e-17, P = 1.7e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDE 216 >gi|2500399|sp|P79891|RS3_AMBME 40S RIBOSOMAL PROTEIN S3 >gi|1836060|gb|AAB46849.1| (S83098) ribosomal protein S3 [Ambystoma mexicanum=Mexican axolotls, embryos, Peptide, 253 aa] Length = 253 Frame 1 hits (HSPs): _____________ Annotated Domains: ___________________________________________ __________________________________________________ Database sequence: | | | | | || 253 0 50 100 150 200 250 __________________ Annotated Domains: PFAM KH-domain: KH domain 47..95 PFAM Ribosomal_S3_C: Ribosomal protein S3, C- 104..188 PRODOM PD149954: RS3(8) P90526(1) RS3A(1) 4..68 PRODOM PD150147: RS3(13) 70..215 PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 147..183 __________________ Plus Strand HSPs: Score = 223 (78.5 bits), Expect = 1.7e-17, P = 1.7e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLAWDPSGKIGPKKPLPDHVSIVEPKDE 216 >gi|7765076|gb|AAB19349.2| (S42658) S3 ribosomal protein [Homo sapiens] Length = 243 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | 243 0 50 100 150 200 Plus Strand HSPs: Score = 223 (78.5 bits), Expect = 1.7e-17, P = 1.7e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 157 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDE 216 >gi|9022435|gb|AAF82383.1|AF281313_1 (AF281313) ribosomal protein S3; RPS3 [Homo sapiens] Length = 158 Frame 1 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | 158 0 50 100 150 Plus Strand HSPs: Score = 223 (78.5 bits), Expect = 1.7e-17, P = 1.7e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GPK PLPD V+I PK+E Sbjct: 72 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDE 131 >gi|548856|sp|Q06559|RS3_DROME 40S RIBOSOMAL PROTEIN S3 >gi|422496|pir||S35620 ribosomal protein S3.e, cytosolic - fruit fly (Drosophila melanogaster) >gi|290275|gb|AAA28875.1| (L13690) ribosomal protein S3/AP endonuclease DNA repair protein [Drosophila melanogaster] >gi|7300992|gb|AAF56129.1| (AE003743) RpS3 gene product [Drosophila melanogaster] Length = 246 Frame 1 hits (HSPs): _______________ Annotated Domains: _____________________________________________ __________________________________________________ Database sequence: | | | | | | 246 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00298: RIBOSOMALPROTEINS3 29..192 PFAM KH-domain: KH domain 49..97 PFAM Ribosomal_S3_C: Ribosomal protein S3, C- 106..190 PRODOM PD149954: RS3(8) P90526(1) RS3A(1) 7..70 PRODOM PD150147: RS3(13) 72..226 PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 149..185 __________________ Plus Strand HSPs: Score = 222 (78.1 bits), Expect = 2.2e-17, P = 2.2e-17 Identities = 44/77 (57%), Positives = 55/77 (71%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G P DY+++A RHVLLRQGVLGIKVK+ML +DPK K GPK PLPD V++ PKEE Sbjct: 159 MIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEE 218 Query: 193 EEYARPAAVLATDIEVP 243 + Y P T+ ++P Sbjct: 219 KIYETPE----TEYKIP 231 >gi|422495|pir||S32728 ribosomal protein S3 - fruit fly (Drosophila melanogaster) >gi|296094|emb|CAA51425.1| (X72921) ribosomal protein S3 [Drosophila melanogaster] Length = 246 Frame 1 hits (HSPs): _______________ Annotated Domains: ________ __________________________________________________ Database sequence: | | | | | | 246 0 50 100 150 200 __________________ Annotated Domains: PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 149..185 __________________ Plus Strand HSPs: Score = 222 (78.1 bits), Expect = 2.2e-17, P = 2.2e-17 Identities = 44/77 (57%), Positives = 55/77 (71%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G P DY+++A RHVLLRQGVLGIKVK+ML +DPK K GPK PLPD V++ PKEE Sbjct: 159 MIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEE 218 Query: 193 EEYARPAAVLATDIEVP 243 + Y P T+ ++P Sbjct: 219 KIYETPE----TEYKIP 231 >gi|1350990|sp|P48153|RS3_MANSE 40S RIBOSOMAL PROTEIN S3 >gi|527680|gb|AAB05575.1| (U12708) ribosomal protein S3 [Manduca sexta] Length = 243 Frame 1 hits (HSPs): _________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 243 0 50 100 150 200 __________________ Annotated Domains: PFAM KH-domain: KH domain 48..96 PFAM Ribosomal_S3_C: Ribosomal protein S3, C- 105..189 PRODOM PD149954: RS3(8) P90526(1) RS3A(1) 3..69 PRODOM PD150147: RS3(13) 71..216 PRODOM PD110352: RS3_MANSE 218..242 PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 148..184 __________________ Plus Strand HSPs: Score = 209 (73.6 bits), Expect = 5.3e-16, P = 5.3e-16 Identities = 40/78 (51%), Positives = 51/78 (65%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G P DY+++A RHVLLRQGVLGIKVKIML WD +GK GPK P PD + + PK+E Sbjct: 158 MIHSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDE 217 Query: 193 EEYARPAAVLATDIEVPV 246 P + + + P+ Sbjct: 218 PAPLEPTSDIRSLAPAPL 235 >gi|6094179|sp|O60128|RS3_SCHPO 40S RIBOSOMAL PROTEIN S3 >gi|7489988|pir||T39606 40s ribosomal protein s3 - fission yeast (Schizosaccharomyces pombe) >gi|3133108|emb|CAA19033.1| (AL023554) 40s ribosomal protein s3. [Schizosaccharomyces pombe] Length = 249 Frame 1 hits (HSPs): ________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 249 0 50 100 150 200 __________________ Annotated Domains: PFAM KH-domain: KH domain 49..97 PFAM Ribosomal_S3_C: Ribosomal protein S3, C- 106..190 PRODOM PD149954: RS3(8) P90526(1) RS3A(1) 7..70 PRODOM PD150147: RS3(13) 72..219 PRODOM PD110355: RS3_SCHPO 221..248 PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 149..185 __________________ Plus Strand HSPs: Score = 202 (71.1 bits), Expect = 2.9e-15, P = 2.9e-15 Identities = 44/79 (55%), Positives = 53/79 (67%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI GQP D+IDSA RHVLLRQGVLG+KVKIML +PK +Q K LPD+V + PKEE Sbjct: 159 MIHSGQPAVDFIDSATRHVLLRQGVLGVKVKIMLP-EPKTRQ--KKSLPDIVVVLDPKEE 215 Query: 193 EEYARPAAVLATDIEVPVA 249 E +P V+ +E A Sbjct: 216 EPITKPYTVINQPVEAAAA 234 >gi|1350989|sp|P48152|RS3_CAEEL PROBABLE 40S RIBOSOMAL PROTEIN S3 >gi|7440100|pir||T15579 hypothetical protein C23G10.3 - Caenorhabditis elegans >gi|9802859|gb|AAF99870.1| (U39851) Contains similarity to Pfam domain: PF00189 (S3_C), Score=99.7, E-value=4.7e-31, N=1 [Caenorhabditis elegans] Length = 247 Frame 1 hits (HSPs): __________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 247 0 50 100 150 200 __________________ Annotated Domains: DOMO DM00298: RIBOSOMALPROTEINS3 29..192 PFAM KH-domain: KH domain 49..97 PFAM Ribosomal_S3_C: Ribosomal protein S3, C- 106..190 PRODOM PD149954: RS3(8) P90526(1) RS3A(1) 7..70 PRODOM PD150147: RS3(13) 72..222 PRODOM PD110348: RS3_CAEEL 224..246 PROSITE RIBOSOMAL_S3: Ribosomal protein S3 signa 149..185 __________________ Plus Strand HSPs: Score = 201 (70.8 bits), Expect = 3.7e-15, P = 3.7e-15 Identities = 44/82 (53%), Positives = 53/82 (64%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 MI G PV DYI AVRHV LRQGV+GIKVKIML +DP+G+ GP+ LPD V I P+EE Sbjct: 159 MIHSGHPVNDYIQQAVRHVQLRQGVIGIKVKIMLPYDPRGQNGPRNALPDHVQIVEPQEE 218 Query: 193 EEYARPAAVLAT---DIEVPVA 249 P + D++VP A Sbjct: 219 VLPKEPHSQHKEEKKDVQVPAA 240 >gi|7440096|pir||T01065 ribosomal protein S1 - African clawed frog (fragment) >gi|65051|emb|CAA24702.1| (V01441) ribosomal protein S1 [Xenopus laevis] Length = 125 Frame 1 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | 125 0 50 100 Plus Strand HSPs: Score = 199 (70.1 bits), Expect = 6.1e-15, P = 6.1e-15 Identities = 40/58 (68%), Positives = 45/58 (77%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPK 186 MI G PV Y+D+AVRHVLLRQGVLGIKVKIML DP GK GPK PLPD V + +P+ Sbjct: 30 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPKDPSGKIGPKKPLPDHVALLSPR 87 >gi|6324151 ref|NP_014221.1| Ribosomal protein S3 (rp13) (YS3); Rps3p [Saccharomyces cerevisiae] >gi|1173255|sp|P05750|RS3_YEAST 40S RIBOSOMAL PROTEIN S3 (YS3) (RP13) >gi|626906|pir||S48510 ribosomal protein S3.e, cytosolic - yeast (Saccharomyces cerevisiae) >gi|457164|dbj|BAA04973.1| (D25285) ribosomal protein YS3 [Saccharomyces cerevisiae] >gi|1302158|emb|CAA96070.1| (Z71454) ORF YNL178w [Saccharomyces cerevisiae] >gi|1463121|gb|AAC49380.1| (U34347) ribosomal protein S3 [Saccharomyces cerevisiae] Length = 240 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | | 240 0 50 100 150 200 Plus Strand HSPs: Score = 193 (67.9 bits), Expect = 2.6e-14, P = 2.6e-14 Identities = 42/67 (62%), Positives = 48/67 (71%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 +I GQPV D+ID+A RHVL+RQGVLGIKVKIM D K + GPK LPD VTI PKEE Sbjct: 157 LIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRD-PAKSRTGPKA-LPDAVTIIEPKEE 214 Query: 193 EEYARPA 213 E P+ Sbjct: 215 EPILAPS 221 >gi|468426|gb|AAA35010.1| (L31405) ribosomal protein S3 [Saccharomyces cerevisiae] Length = 240 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | | 240 0 50 100 150 200 Plus Strand HSPs: Score = 193 (67.9 bits), Expect = 2.6e-14, P = 2.6e-14 Identities = 42/67 (62%), Positives = 48/67 (71%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEE 192 +I GQPV D+ID+A RHVL+RQGVLGIKVKIM D K + GPK LPD VTI PKEE Sbjct: 157 LIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRD-PAKSRTGPKA-LPDAVTIIEPKEE 214 Query: 193 EEYARPA 213 E P+ Sbjct: 215 EPILAPS 221 >gi|6540574|gb|AAF16402.1| (AF207603) ribosomal protein RPS3 [Musca domestica] Length = 165 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | 165 0 50 100 150 Plus Strand HSPs: Score = 151 (53.2 bits), Expect = 7.4e-10, P = 7.4e-10 Identities = 29/41 (70%), Positives = 33/41 (80%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGK 135 MI G P DY+++A RHVLLRQGVLGIKVKIML +DPK K Sbjct: 124 MIHSGDPCNDYVETATRHVLLRQGVLGIKVKIMLPYDPKNK 164 >gi|1688320|gb|AAB36959.1| (U78756) RpgG [Dictyostelium discoideum] Length = 218 Frame 1 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | | 218 0 50 100 150 200 Plus Strand HSPs: Score = 145 (51.0 bits), Expect = 3.2e-09, P = 3.2e-09 Identities = 35/60 (58%), Positives = 39/60 (65%), Frame = +1 Query: 4 RPG-MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGK-QGP-KTPLPDLVTI 174 R G MI GQP KD+ID A RHVLLRQG LG+KV IML +D K G P PD+V I Sbjct: 156 RDGYMIKSGQPSKDFIDFACRHVLLRQGTLGVKVAIMLPYDETRKIHGACNIPQPDVVVI 215 >gi|9558269|emb|CAC00395.1| (AL160371) probable ribosomal protein S3 [Leishmania major] Length = 88 Frame 1 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 Plus Strand HSPs: Score = 138 (48.6 bits), Expect = 1.8e-08, P = 1.8e-08 Identities = 25/46 (54%), Positives = 32/46 (69%), Frame = +1 Query: 49 DSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPK 186 DSA RH +R G +G+KVKIML D G+ GP PLPD++T+ PK Sbjct: 39 DSACRHCYMRAGCIGVKVKIMLPGDSTGRNGPSEPLPDVITVIEPK 84 >gi|3642663|gb|AAC36521.1| (U89414) ribosomal protein S3 [Mus musculus] Length = 123 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | 123 0 50 100 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 25/32 (78%), Positives = 27/32 (84%), Frame = +1 Query: 13 MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKI 108 MI G PV Y+D+AVRHVLLRQGVLGIKVKI Sbjct: 92 MIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKI 123 >gi|8247324|emb|CAB92940.1| (AJ290932) putative 40S ribosomal protein S3 [Plasmodium falciparum] Length = 110 Frame 1 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | | | | 110 0 20 40 60 80 100 Plus Strand HSPs: Score = 121 (42.6 bits), Expect = 1.1e-06, P = 1.1e-06 Identities = 28/64 (43%), Positives = 41/64 (64%), Frame = +1 Query: 4 RPG-MISFGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHT 180 R G +IS G+P K ++++A R L+QGVLGIKVKIML + G + LPD +++ Sbjct: 43 RDGYLISTGEPSKRFVNTATRSAQLKQGVLGIKVKIMLPTAIDTRTGLTSILPDNISVLE 102 Query: 181 PKEE 192 PK + Sbjct: 103 PKTD 106 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.95 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.367 0.163 0.704 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.367 0.171 0.579 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.337 0.152 0.497 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.359 0.163 0.572 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.359 0.161 0.567 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.351 0.152 0.517 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 154 153 10. 74 3 12 22 0.095 34 30 0.12 36 +2 0 155 154 10. 74 3 12 22 0.095 34 30 0.12 36 +1 0 155 155 10. 74 3 12 22 0.096 34 30 0.12 36 -1 0 155 154 10. 74 3 12 22 0.095 34 30 0.12 36 -2 0 155 154 10. 74 3 12 22 0.095 34 30 0.12 36 -3 0 154 153 10. 74 3 12 22 0.095 34 30 0.12 36 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 26 No. of states in DFA: 597 (59 KB) Total size of DFA: 182 KB (192 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 144.13u 0.99s 145.12t Elapsed: 00:00:39 Total cpu time: 144.16u 1.01s 145.17t Elapsed: 00:00:39 Start: Wed Jan 23 15:17:51 2002 End: Wed Jan 23 15:18:30 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000