WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A10G03_CONSENSUS (497 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 8 Sequences : less than 8 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1985 489 |============================================================= 6310 1496 281 |=================================== 3980 1215 298 |===================================== 2510 917 257 |================================ 1580 660 202 |========================= 1000 458 97 |============ 631 361 122 |=============== 398 239 86 |========== 251 153 40 |===== 158 113 31 |=== 100 82 20 |== 63.1 62 25 |=== 39.8 37 6 |: 25.1 31 9 |= 15.8 22 4 |: >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 18 <<<<<<<<<<<<<<<<< 10.0 18 6 |: 6.31 12 4 |: 3.98 8 5 |: 2.51 3 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|4581119|gb|AAD24609.1|AC005825_16(AC005825) hypoth... +2 303 5.8e-26 1 gi|2275215|gb|AAB63837.1|(AC002337) hypothetical prot... +2 273 8.7e-23 1 gi|2143796|pir||I65198homeotic protein Hox A4 - rat (... -1 65 0.86 1 gi|11346533|pir||T44657protein GP80 [imported] - bovi... +3 83 0.93 1 gi|1019443|gb|AAC46905.1|(U32572) mucin [Trypanosoma ... +3 64 0.93 1 gi|6321759ref|NP_011835.1| Putative integral membrane... +3 86 0.97 1 gi|1582765|prf||2119294AYFW1 gene [Saccharomyces cere... +3 86 0.97 1 gi|881439|gb|AAA68946.1|(U27588) immunoreactive prote... +3 72 0.98 2 gi|1869816|emb|CAA68061.1|(X99721) transcription fact... +3 80 0.98 1 gi|688080|gb|AAB31576.1|lectin=chitin-binding protein... +3 40 0.99 2 gi|5668970|gb|AAD46109.1|AF078793_1(AF078793) hensin ... +3 62 0.99 1 gi|7472482|pir||D75497hypothetical protein - Deinococ... +3 61 0.997 1 gi|3122583|sp|Q28466|OCT1_MACEUOCTAMER-BINDING TRANSC... +3 60 0.9995 1 gi|7296560|gb|AAF51843.1|(AE003598) CG14454 gene prod... +3 71 0.99994 1 gi|2833375|sp|Q39290|RPBX_BRANADNA-DIRECTED RNA POLYM... +3 59 0.99995 1 gi|6647762|sp|O26147|RPON_METTHDNA-DIRECTED RNA POLYM... +3 59 0.99995 1 gi|11134747|sp|Q9SYA6|RPBX_ARATHDNA-DIRECTED RNA POLY... +3 59 0.99995 1 gi|9257102|pdb|1EF4|AChain A, Solution Structure Of T... +3 59 0.99995 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|11346533 |___________________ gi|1019443 | _______________ gi|6321759 | __________________ gi|1582765 | __________________ gi|881439 | _____________ gi|1869816 | __________________________________________ gi|688080 | ______ gi|5668970 | ___________________ gi|7472482 | ____________ gi|3122583 | ________________ gi|7296560 |____________________________ gi|2833375 | _____ gi|6647762 | ______ gi|11134747 | _____ gi|9257102 | ______ __________________________________________________ Query sequence: | | | | | 166 0 50 100 150 Locus_ID Frame 2 Hits gi|4581119 | _______________________________________ gi|2275215 | ______________________________________ gi|881439 | ______ __________________________________________________ Query sequence: | | | | | 166 0 50 100 150 Locus_ID Frame 1 Hits gi|688080 | ___ __________________________________________________ Query sequence: | | | | | 166 0 50 100 150 Locus_ID Frame -1 Hits gi|2143796 | __________________________________________________ Query sequence: | | | | | 166 0 50 100 150
Use the and icons to retrieve links to Entrez:
>gi|4581119|gb|AAD24609.1|AC005825_16 (AC005825) hypothetical protein [Arabidopsis thaliana] Length = 327 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | 327 0 150 300 Plus Strand HSPs: Score = 303 (106.7 bits), Expect = 5.8e-26, P = 5.8e-26 Identities = 68/127 (53%), Positives = 91/127 (71%), Frame = +2 Query: 17 AFCSPKFLS-LLLLLSAIPIGIIVTLERAKPATHVYHYHSNGWFRXCAKWDSHNRRFIVS 193 +FCS + + L L++SA+PI +++LE A P+THV+ Y S+G+FR CAKWD RRF+VS Sbjct: 4 SFCSGRCTAALFLVISAVPIAYLISLELAVPSTHVFSYQSSGFFRECAKWDDVGRRFLVS 63 Query: 194 FFEGG-LGQVLLPEKDYESSPPLEEVTVVKXTHLAGNASLGIAIDAPRNRVLXVNADVXS 370 F +GG +G+++ P KD S LEEVT+VK LAGNASLGIAID RNR+L AD+ Sbjct: 64 FMDGGGVGEIV-P-KD--SDDVLEEVTLVKDVDLAGNASLGIAIDHVRNRLLVAVADLLG 119 Query: 371 VIRYGALCS 397 RY AL + Sbjct: 120 N-RYSALAA 127 >gi|2275215|gb|AAB63837.1| (AC002337) hypothetical protein [Arabidopsis thaliana] Length = 330 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | 330 0 150 300 Plus Strand HSPs: Score = 273 (96.1 bits), Expect = 8.7e-23, P = 8.7e-23 Identities = 62/123 (50%), Positives = 82/123 (66%), Frame = +2 Query: 23 CSPKFLSLLL--LLSAIPIGIIVTLERAKPATHVYHYHSNGWFRXCAKWDSHNRRFIVSF 196 CS K+ L +LSA+PI I++ E+A P+THV YHS+G+ R CAKWD RRF+VS+ Sbjct: 6 CSGKYSVALFFFILSAVPIAYIISSEKAVPSTHVISYHSSGFLRECAKWDDVGRRFLVSY 65 Query: 197 FEGG--LGQVLLPEKDYESSPPLEEVTVVKXTHLAGNASLGIAIDAPRNRVLXVNADVXS 370 +GG +G+ L+P KD S L+EVT+VK LAGN+S G ID RNR+L D+ Sbjct: 66 MDGGGGIGE-LVPTKD--SDDVLKEVTLVKDVDLAGNSSNGFVIDRHRNRLLLAVGDLLG 122 Query: 371 VIRYGAL 391 RY AL Sbjct: 123 N-RYSAL 128 >gi|2143796|pir||I65198 homeotic protein Hox A4 - rat (fragment) >gi|204646|gb|AAA67845.1| (L03557) hox1.4 protein [Rattus norvegicus] Length = 85 Frame -1 hits (HSPs): ________________________________________ Annotated Domains: ______________ __________________________________________________ Database sequence: | | | | | | 85 0 20 40 60 80 __________________ Annotated Domains: PROSITE HOMEOBOX_1: 'Homeobox' domain signature. 13..36 __________________ Minus Strand HSPs: Score = 65 (22.9 bits), Expect = 2.0, P = 0.86 Identities = 18/72 (25%), Positives = 30/72 (41%), Frame = -1 Query: 431 KKRXFQVGEIICCKARRIGLPNXRQR*RXGLDF*VRQWRCPRRHFRPSGXL*PP*LPPTA 252 ++R ++ +C R++ + +R + D + P R S P PP Sbjct: 7 RRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDH-----KLPNTKMRSSNPASAPAGPPGK 61 Query: 251 AMTHNPSPAAKP 216 A THNP P + P Sbjct: 62 AQTHNPHPHSHP 73 >gi|11346533|pir||T44657 protein GP80 [imported] - bovine herpesvirus 4 >gi|1834361|emb|CAB06616.1| (Z84818) GP80 [Bovine herpesvirus 4] Length = 273 Frame 3 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | 273 0 50 100 150 200 250 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 2.7, P = 0.93 Identities = 28/68 (41%), Positives = 36/68 (52%), Frame = +3 Query: 6 SLTWLSVLQNSSAS-SSYSLPYPSESS------SL*SEPNPPPTSTTTTVTAG-SXNAPS 161 ++T S +S+AS SS S P PS SS S S P PT+TTTT T+ S N S Sbjct: 45 TVTSTSTSTSSNASTSSVSSPSPSSSSVPSTATSSSSSPTSTPTATTTTATSSTSTNTTS 104 Query: 162 GILITAAS 185 + T +S Sbjct: 105 SVSTTVSS 112 Score = 82 (28.9 bits), Expect = 3.5, P = 0.97 Identities = 22/51 (43%), Positives = 30/51 (58%), Frame = +3 Query: 33 NSSASSSYSLPYPSESSSL*SEPNPPPTSTTTTVTAG-SXNAPSGILITAAS 185 +S + SS S+P + SSS S P PT+TTTT T+ S N S + T +S Sbjct: 63 SSPSPSSSSVPSTATSSS--SSPTSTPTATTTTATSSTSTNTTSSVSTTVSS 112 >gi|1019443|gb|AAC46905.1| (U32572) mucin [Trypanosoma cruzi] >gi|1585303|prf||2124391A mucin-like protein [Trypanosoma cruzi] Length = 78 Frame 3 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | 78 0 20 40 60 Plus Strand HSPs: Score = 64 (22.5 bits), Expect = 2.7, P = 0.93 Identities = 18/54 (33%), Positives = 32/54 (59%), Frame = +3 Query: 21 SVLQNSSASSSYSLPYPSESSSL*SEP--------NPPPTSTTTTVTAGSXNAPS 161 SV QN++ +++ + P P+ +++ ++P PPT+TTTT T + APS Sbjct: 24 SVSQNNTTTTTTTKP-PTTTTTTTTKPPTTTTTTTTKPPTTTTTTTTTTAPEAPS 77 >gi|6321759 ref|NP_011835.1| Putative integral membrane protein containing novel cysteine motif. Similarity to SLG1 (WSC1), WSC2 and WSC3; Wsc4p [Saccharomyces cerevisiae] >gi|731607|sp|P38739|YHC8_YEAST HYPOTHETICAL 63.8 KD PROTEIN IN GUT1-RIM1 INTERGENIC REGION PRECURSOR >gi|626575|pir||S48940 hypothetical protein YHL028w - yeast (Saccharomyces cerevisiae) >gi|2289857|gb|AAB65040.1| (U11583) Similiar to mucin and several other Ser-Thr-rich proteins [Saccharomyces cerevisiae] Length = 605 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | || 605 0 150 300 450 600 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 3.6, P = 0.97 Identities = 24/56 (42%), Positives = 30/56 (53%), Frame = +3 Query: 18 LSVLQNSSASSSYSLPYPSESSSL*SEPNPPPTSTTTTVTAGSXNAPSGILITAAS 185 +S SS S+S S P+ SS+ S N PTSTT T T+ S APS +T S Sbjct: 251 ISTSTTSSTSTSTSTTSPTSSSAPTSSSNTTPTSTTFTTTSPST-APSSTTVTYTS 305 >gi|1582765|prf||2119294A YFW1 gene [Saccharomyces cerevisiae] Length = 605 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | || 605 0 150 300 450 600 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 3.6, P = 0.97 Identities = 24/56 (42%), Positives = 30/56 (53%), Frame = +3 Query: 18 LSVLQNSSASSSYSLPYPSESSSL*SEPNPPPTSTTTTVTAGSXNAPSGILITAAS 185 +S SS S+S S P+ SS+ S N PTSTT T T+ S APS +T S Sbjct: 251 ISTSTTSSTSTSTSTTSPTSSSAPTSSSNTTPTSTTFTTTSPST-APSSTTVTYTS 305 >gi|881439|gb|AAA68946.1| (U27588) immunoreactive protein [Ajellomyces capsulatus] Length = 211 Frame 3 hits (HSPs): __________ Frame 2 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 211 0 50 100 150 200 Plus Strand HSPs: Score = 72 (25.3 bits), Expect = 3.7, Sum P(2) = 0.98 Identities = 16/40 (40%), Positives = 24/40 (60%), Frame = +3 Query: 96 EPN-PPPTSTTTTVTAGSXNAPSGILITAASLFPSSKVVLV 215 E N PPPT+TTTT T P+ I I + P++K +++ Sbjct: 33 ESNCPPPTTTTTTTTTTPTPTPTSI-IPITPIVPANKTIVL 72 Score = 40 (14.1 bits), Expect = 3.7, Sum P(2) = 0.98 Identities = 8/17 (47%), Positives = 10/17 (58%), Frame = +2 Query: 23 CSPKFLSLLLLLSAIPI 73 C P + LL LSAI + Sbjct: 5 CLPAYFKLLSFLSAIAV 21 >gi|1869816|emb|CAA68061.1| (X99721) transcription factor TFE3 [Homo sapiens] Length = 219 Frame 3 hits (HSPs): _______________________________ __________________________________________________ Database sequence: | | | | | | 219 0 50 100 150 200 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 4.2, P = 0.98 Identities = 38/135 (28%), Positives = 66/135 (48%), Frame = +3 Query: 21 SVLQNSSASSSYSLPYPSESS---SL*SEPNPPPTSTTTTVTAGSXNAPSGILITAASLF 191 +VL S S P P SS SL + P P T + ++ +AG P+ ++++S Sbjct: 57 NVLDPDSFYELKSQPLPLRSSLPISLQATPATPATLSASS-SAGGSRTPA---MSSSS-- 110 Query: 192 PSSKVVLVRFCCRRRIMSHRRRWRKSRWSKXPTWPEMPPWASP-LTHLEIESSSLTLTXI 368 SS+V+L + R + RR R+ + + P +P P ASP ++ + + + TL+ Sbjct: 111 -SSRVLLRQQLMRAQAQEQERRERREQAAAAP-FPSPAP-ASPAISVVGVSAGGHTLSRP 167 Query: 369 R*SDTARFAAYYLSHLESP 425 + R +HLE+P Sbjct: 168 PPAQVPREVLKVQTHLENP 186 >gi|688080|gb|AAB31576.1| lectin=chitin-binding protein [Solanum tuberosum=potatoes, tubers, Peptide Partial, 27 aa] Length = 27 Frame 3 hits (HSPs): ________________________________ Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | 27 0 20 Plus Strand HSPs: Score = 40 (14.1 bits), Expect = 4.3, Sum P(2) = 0.99 Identities = 9/19 (47%), Positives = 11/19 (57%), Frame = +3 Query: 63 PYPSESSSL*SEPNPPPTS 119 P+PS S P+PPP S Sbjct: 9 PHPSPPPP--SPPSPPPPS 25 Score = 37 (13.0 bits), Expect = 4.3, Sum P(2) = 0.99 Identities = 5/7 (71%), Positives = 6/7 (85%), Frame = +1 Query: 34 IPQPPPP 54 +P PPPP Sbjct: 1 LPSPPPP 7 >gi|5668970|gb|AAD46109.1|AF078793_1 (AF078793) hensin [Oryctolagus cuniculus] Length = 86 Frame 3 hits (HSPs): _________________________________ __________________________________________________ Database sequence: | | | | | | 86 0 20 40 60 80 Plus Strand HSPs: Score = 62 (21.8 bits), Expect = 4.5, P = 0.99 Identities = 18/60 (30%), Positives = 29/60 (48%), Frame = +3 Query: 18 LSVLQNSSASSSYSLPYPSESSSL*SEPNPPPTSTTTTVTAGSXNAPSGILITAASLFPS 197 LS+L + S +PY + S+ S P P +TTTT P+ ++ + +FPS Sbjct: 9 LSLLWGPALSQGQWIPYTTYHDSV-SSPGAPVEATTTT----EDTWPTTVIYESTPVFPS 63 >gi|7472482|pir||D75497 hypothetical protein - Deinococcus radiodurans (strain R1) >gi|6458317|gb|AAF10197.1|AE001919_10 (AE001919) hypothetical protein [Deinococcus radiodurans] Length = 73 Frame 3 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | 73 0 20 40 60 Plus Strand HSPs: Score = 61 (21.5 bits), Expect = 5.9, P = 1.0 Identities = 10/38 (26%), Positives = 16/38 (42%), Frame = +3 Query: 243 SHRRRWRKSRWSKXPTWPEMPPWASPLTHLEIESSSLT 356 +H W W WP P W +P+ ++ S+T Sbjct: 24 AHAGHWSPPDWEAVAKWPYQP-WQTPVLRVDTARDSVT 60 >gi|3122583|sp|Q28466|OCT1_MACEU OCTAMER-BINDING TRANSCRIPTION FACTOR 1 (OTF-1) (NF-A1) >gi|166096|gb|AAA31607.1| (M97955) oct-1 [Macropus eugenii] Length = 75 Frame 3 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | 75 0 20 40 60 Plus Strand HSPs: Score = 60 (21.1 bits), Expect = 7.6, P = 1.0 Identities = 19/53 (35%), Positives = 32/53 (60%), Frame = +3 Query: 42 ASSSYSLPY--PSESSSL*SEPNPPPTSTTTTVTAGSXNAPSG---ILITAASL 188 ASS+ +LP PS S+S SE + ++TT T+ ++P G +++TA+ L Sbjct: 13 ASSAVTLPSMSPSPSASA-SEASSASETSTTQTTSTPLSSPLGTGQVMVTASGL 65 >gi|7296560|gb|AAF51843.1| (AE003598) CG14454 gene product [Drosophila melanogaster] Length = 120 Frame 3 hits (HSPs): __________________________________ __________________________________________________ Database sequence: | | | | 120 0 50 100 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 9.6, P = 1.0 Identities = 28/88 (31%), Positives = 43/88 (48%), Frame = +3 Query: 9 LTWLSVLQNSSASSSYSLPYPSESSSL*SEPNPPPTSTTTTVTAGSXNAPSGILITAASL 188 L L + SS++S+ S S SS + ++TTTT TA S + + TA+S Sbjct: 13 LCLLLAQEGSSSTSTSSTATTSTDSS--ATTTTASSATTTTTTASSASTTT----TASSS 66 Query: 189 FPSSKVVLVRFCCRRRIMSHRRRWRKSR 272 S++ R RRR+ RRR ++ R Sbjct: 67 SSSAEARRRRRARRRRLARERRRRQERR 94 >gi|2833375|sp|Q39290|RPBX_BRANA DNA-DIRECTED RNA POLYMERASE II 8.2 KDA POLYPEPTIDE (RPB10) (RP10) (ABC10) >gi|7447619|pir||T07852 probable DNA-directed RNA polymerase (EC 2.7.7.6) II chain RPB10 - rape >gi|533690|gb|AAA21279.1| (U12133) RNA polymerase II subunit RPB10 homolog; similar to yeast RNA polymerase II subunit RPB10, Swiss-Prot Accession Number P22139 [Brassica napus] Length = 71 Frame 3 hits (HSPs): _________ Annotated Domains: __________________________________________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 __________________ Annotated Domains: BLOCKS BL01112A: RNA polymerases N / 8 Kd subun 1..18 BLOCKS BL01112B: RNA polymerases N / 8 Kd subun 35..54 PFAM RNA_pol_N: RNA polymerases N / 8 kDa sub 1..60 PRODOM PD006539: RPBX(4) RPON(3) O26147(1) 2..53 PROSITE RNA_POL_N_8KD: RNA polymerases N / 8 Kd 2..11 __________________ Plus Strand HSPs: Score = 59 (20.8 bits), Expect = 10., P = 1.0 Identities = 9/13 (69%), Positives = 12/13 (92%), Frame = +3 Query: 210 LVRFCCRRRIMSH 248 LVR+CCRR +M+H Sbjct: 40 LVRYCCRRMLMTH 52 >gi|6647762|sp|O26147|RPON_METTH DNA-DIRECTED RNA POLYMERASE SUBUNIT N (RPB10) >gi|7447621|pir||A69152 DNA-dependent RNA polymerase, subunit N - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2621076|gb|AAB84548.1| (AE000796) DNA-dependent RNA polymerase, subunit N [Methanothermobacter thermautotrophicus] Length = 55 Frame 3 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | 55 0 20 40 Plus Strand HSPs: Score = 59 (20.8 bits), Expect = 10., P = 1.0 Identities = 9/17 (52%), Positives = 12/17 (70%), Frame = +3 Query: 210 LVRFCCRRRIMSHRRRW 260 L R+CCRR ++SH W Sbjct: 39 LKRYCCRRMLISHVETW 55 >gi|11134747|sp|Q9SYA6|RPBX_ARATH DNA-DIRECTED RNA POLYMERASE II 8.2 KDA POLYPEPTIDE (RPB10) (RP10) (ABC10) >gi|4508082|gb|AAD21426.1| (AC005882) Putative RNA polymerase II subunit Rpb10 [Arabidopsis thaliana] Length = 71 Frame 3 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 Plus Strand HSPs: Score = 59 (20.8 bits), Expect = 10., P = 1.0 Identities = 9/13 (69%), Positives = 12/13 (92%), Frame = +3 Query: 210 LVRFCCRRRIMSH 248 LVR+CCRR +M+H Sbjct: 40 LVRYCCRRMLMTH 52 >gi|9257102|pdb|1EF4|A Chain A, Solution Structure Of The Essential Rna Polymerase Subunit Rpb10 From Methanobacterium Thermoautotrophicum Length = 55 Frame 3 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | 55 0 20 40 Plus Strand HSPs: Score = 59 (20.8 bits), Expect = 10., P = 1.0 Identities = 9/17 (52%), Positives = 12/17 (70%), Frame = +3 Query: 210 LVRFCCRRRIMSHRRRW 260 L R+CCRR ++SH W Sbjct: 39 LKRYCCRRMLISHVETW 55 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.93 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.325 0.133 0.428 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.334 0.148 0.472 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.352 0.158 0.599 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.351 0.160 0.642 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.335 0.147 0.463 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.335 0.141 0.460 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 165 160 10. 75 3 12 22 0.10 34 30 0.099 37 +2 0 165 158 10. 74 3 12 22 0.098 34 30 0.097 37 +1 0 165 158 10. 74 3 12 22 0.098 34 30 0.097 37 -1 0 165 158 10. 74 3 12 22 0.098 34 30 0.097 37 -2 0 165 161 10. 75 3 12 22 0.10 34 30 0.10 37 -3 0 165 159 10. 75 3 12 22 0.099 34 30 0.098 37 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 18 No. of states in DFA: 590 (58 KB) Total size of DFA: 195 KB (256 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 180.89u 1.09s 181.98t Elapsed: 00:00:36 Total cpu time: 180.91u 1.11s 182.02t Elapsed: 00:00:36 Start: Mon Oct 1 23:08:56 2001 End: Mon Oct 1 23:09:32 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000