WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker Server unavailable.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= B08C08.seq(1>480) (451 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 4 Sequences : less than 4 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 975 196 |================================================= 6310 779 126 |=============================== 3980 653 186 |============================================== 2510 467 121 |============================== 1580 346 86 |===================== 1000 260 56 |============== 631 204 37 |========= 398 167 28 |======= 251 139 19 |==== 158 120 22 |===== 100 98 6 |= 63.1 92 5 |= 39.8 87 2 |: 25.1 85 5 |= 15.8 80 0 | >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 80 <<<<<<<<<<<<<<<<< 10.0 80 1 |: 6.31 79 0 | 3.98 79 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|81807|pir||JQ1070phenylalanine ammonia-lyase (EC 4... +1 318 1.5e-27 1 gi|129585|sp|P19142|PAL2_PHAVUPHENYLALANINE AMMONIA-L... +1 311 7.2e-26 1 gi|1172003|sp|P45734|PALY_TRISUPHENYLALANINE AMMONIA-... +1 311 7.5e-26 1 gi|741010|prf||2006271APhe ammonia lyase [Trifolium s... +1 311 7.5e-26 1 gi|129590|sp|P27990|PALY_MEDSAPHENYLALANINE AMMONIA-L... +1 305 3.3e-25 1 gi|417444|sp|Q04593|PAL2_PEAPHENYLALANINE AMMONIA-LYA... +1 300 1.2e-24 1 gi|81875|pir||A24727phenylalanine ammonia-lyase (EC 4... +1 293 2.2e-24 1 gi|129583|sp|P07218|PAL1_PHAVUPHENYLALANINE AMMONIA-L... +1 293 2.2e-24 1 gi|1172002|sp|P45732|PALY_STYHUPHENYLALANINE AMMONIA-... +1 297 2.4e-24 1 gi|2285893|dbj|BAA21643.1|(D30656) phenylalanine ammo... +1 292 8.2e-24 1 gi|1172001|sp|P45730|PALY_POPTRPHENYLALANINE AMMONIA-... +1 291 1.0e-23 1 gi|266731|sp|Q01861|PAL1_PEAPHENYLALANINE AMMONIA-LYA... +1 290 1.4e-23 1 gi|738926|prf||2001451APhe ammonia lyase [Pisum sativum] +1 290 1.4e-23 1 gi|1172004|sp|P45735|PALY_VITVIPHENYLALANINE AMMONIA-... +1 275 7.0e-23 1 gi|129584|sp|P27991|PAL1_SOYBNPHENYLALANINE AMMONIA-L... +1 282 9.7e-23 1 gi|1171991|sp|P35510|PAL1_ARATHPHENYLALANINE AMMONIA-... +1 279 2.1e-22 1 gi|6598547|gb|AAD18156.2|(AC006260) phenylalanine amm... +1 279 2.1e-22 1 gi|1171993|sp|P45724|PAL2_ARATHPHENYLALANINE AMMONIA-... +1 278 2.7e-22 1 gi|11269670|pir||T46172phenylalanine ammonia-lyase (E... +1 278 2.7e-22 1 gi|3024362|sp|Q43052|PAL2_POPKIPHENYLALANINE AMMONIA-... +1 276 4.3e-22 1 gi|1172000|sp|P45731|PAL1_POPKIPHENYLALANINE AMMONIA-... +1 275 5.0e-22 1 gi|1171999|sp|P45727|PALY_PERAEPHENYLALANINE AMMONIA-... +1 274 5.1e-22 1 gi|129594|sp|P25872|PAL1_TOBACPHENYLALANINE AMMONIA-L... +1 275 5.6e-22 1 gi|9910836|sp|Q9SMK9|PAL2_CICARPHENYLALANINE AMMONIA-... +1 274 7.2e-22 1 gi|548457|sp|P35512|PALY_MALDOPHENYLALANINE AMMONIA-L... +1 264 7.9e-22 1 gi|129589|sp|P14166|PAL1_IPOBAPHENYLALANINE AMMONIA-L... +1 273 8.9e-22 1 gi|12240240|gb|AAG49585.1|AF325496_1(AF325496) phenyl... +1 273 9.0e-22 1 gi|1171997|sp|P45733|PAL3_TOBACPHENYLALANINE AMMONIA-... +1 273 9.0e-22 1 gi|1171998|sp|P45726|PALY_CAMSIPHENYLALANINE AMMONIA-... +1 273 9.1e-22 1 gi|6647711|sp|O64963|PAL1_PRUAVPHENYLALANINE AMMONIA-... +1 273 9.2e-22 1 gi|3024360|sp|Q42667|PALY_CITLIPHENYLALANINE AMMONIA-... +1 271 1.5e-21 1 gi|3914261|sp|O49835|PAL1_LITERPHENYLALANINE AMMONIA-... +1 270 1.9e-21 1 gi|4808126|emb|CAB42793.1|(AJ238753) phenylalanine-am... +1 269 2.5e-21 1 gi|5690433|gb|AAD47085.1|AF167487_1(AF167487) phenyla... +1 260 2.8e-21 1 gi|7208616|gb|AAF40224.1|AF237955_1(AF237955) phenyla... +1 267 4.2e-21 1 gi|3024361|sp|Q42858|PAL2_IPOBAPHENYLALANINE AMMONIA-... +1 266 5.1e-21 1 gi|3123241|sp|P35513|PAL2_TOBACPHENYLALANINE AMMONIA-... +1 266 5.1e-21 1 gi|3513758|gb|AAC33966.1|(AF081215) phenylalanine amm... +1 263 5.3e-21 1 gi|548454|sp|P35511|PAL1_LYCESPHENYLALANINE AMMONIA-L... +1 265 6.4e-21 1 gi|5332353|gb|AAA34179.2|(M83314) phenylalanine ammon... +1 265 6.4e-21 1 gi|7208614|gb|AAF40223.1|AF237954_1(AF237954) phenyla... +1 264 8.4e-21 1 gi|5566388|gb|AAD45384.1|(AF165998) phenylalanine amm... +1 263 9.0e-21 1 gi|4808128|emb|CAB42794.1|(AJ238754) phenylalanine-am... +1 262 1.4e-20 1 gi|3334286|sp|O23924|PALY_DIGLAPHENYLALANINE AMMONIA-... +1 260 2.3e-20 1 gi|3914262|sp|O49836|PAL2_LITERPHENYLALANINE AMMONIA-... +1 256 6.0e-20 1 gi|11761146|dbj|BAB19128.1|(AB041361) phenylalanine a... +1 254 7.5e-20 1 gi|1171996|sp|P45729|PAL3_PETCRPHENYLALANINE AMMONIA-... +1 255 8.0e-20 1 gi|1363495|pir||S48726phenylalanine ammonia-lyase (EC... +1 255 8.0e-20 1 gi|129587|sp|P26600|PAL5_LYCESPHENYLALANINE AMMONIA-L... +1 255 8.0e-20 1 gi|322743|pir||A44133phenylalanine ammonia-lyase (EC ... +1 255 8.0e-20 1
Use the
and
icons to retrieve links to Entrez:
WARNING: Descriptions of 30 database sequences were not reported due to the limiting value of parameter V = 50.>gi|81807|pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean (fragment) Length = 416 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 416 0 150 300 Plus Strand HSPs: Score = 318 (111.9 bits), Expect = 1.5e-27, P = 1.5e-27 Identities = 58/60 (96%), Positives = 59/60 (98%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGTALLTGERVISPGEECDKVFTALCQG IIDPLLECLGEWNGAPLPIC Sbjct: 357 SYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGNIIDPLLECLGEWNGAPLPIC 416
>gi|129585|sp|P19142|PAL2_PHAVU PHENYLALANINE AMMONIA-LYASE CLASS II >gi|81877|pir||S04127 phenylalanine ammonia-lyase (EC 4.3.1.5) class II - kidney bean >gi|228614|prf||1807329A Phe ammonia lyase [Phaseolus vulgaris] Length = 712 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 712 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 96..140 BLOCKS BL00488B: Phenylalanine and histidine am 172..225 BLOCKS BL00488C: Phenylalanine and histidine am 276..323 BLOCKS BL00488D: Phenylalanine and histidine am 357..410 BLOCKS BL00488E: Phenylalanine and histidine am 432..486 BLOCKS BL00488F: Phenylalanine and histidine am 490..542 BLOCKS BL00488G: Phenylalanine and histidine am 550..602 BLOCKS BL00488H: Phenylalanine and histidine am 638..687 Entrez active site: BY SIMILARITY. 199 PFAM PAL: Phenylalanine and histidine ammonia 21..702 PRODOM PD143664: PAL2_PHAVU 1..26 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 28..49 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 52..566 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 568..664 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 666..693 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 194..209 __________________ Plus Strand HSPs: Score = 311 (109.5 bits), Expect = 7.2e-26, P = 7.2e-26 Identities = 55/60 (91%), Positives = 60/60 (100%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT+LLTGE+VISPGEECDKVF+A+CQGKIIDPLLECLGEWNGAPLPIC Sbjct: 653 SYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC 712
>gi|1172003|sp|P45734|PALY_TRISU PHENYLALANINE AMMONIA-LYASE >gi|484062|gb|AAA17993.1| (M91192) phenylalanine ammonia-lyase [Trifolium subterraneum] Length = 725 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 725 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 109..153 BLOCKS BL00488B: Phenylalanine and histidine am 185..238 BLOCKS BL00488C: Phenylalanine and histidine am 289..336 BLOCKS BL00488D: Phenylalanine and histidine am 370..423 BLOCKS BL00488E: Phenylalanine and histidine am 445..499 BLOCKS BL00488F: Phenylalanine and histidine am 503..555 BLOCKS BL00488G: Phenylalanine and histidine am 563..615 BLOCKS BL00488H: Phenylalanine and histidine am 651..700 Entrez active site: BY SIMILARITY. 212 PFAM PAL: Phenylalanine and histidine ammonia 35..715 PRODOM PD018374: PALY(2) PAL1(1) PAL2(1) 1..39 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 41..64 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 66..579 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 581..677 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 679..706 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 207..222 __________________ Plus Strand HSPs: Score = 311 (109.5 bits), Expect = 7.5e-26, P = 7.5e-26 Identities = 55/60 (91%), Positives = 60/60 (100%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT+LLTGERVISPGEECDK+FTA+CQGKIIDPLL+CLGEWNGAPLPIC Sbjct: 666 SYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNGAPLPIC 725
>gi|741010|prf||2006271A Phe ammonia lyase [Trifolium subterraneum] Length = 725 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 725 0 150 300 450 600 Plus Strand HSPs: Score = 311 (109.5 bits), Expect = 7.5e-26, P = 7.5e-26 Identities = 55/60 (91%), Positives = 60/60 (100%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT+LLTGERVISPGEECDK+FTA+CQGKIIDPLL+CLGEWNGAPLPIC Sbjct: 666 SYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNGAPLPIC 725
>gi|129590|sp|P27990|PALY_MEDSA PHENYLALANINE AMMONIA-LYASE >gi|99990|pir||S17444 phenylalanine ammonia-lyase (EC 4.3.1.5) 1 - alfalfa >gi|19650|emb|CAA41169.1| (X58180) phenylalanine ammonia-lyase [Medicago sativa] Length = 725 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 725 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 109..153 BLOCKS BL00488B: Phenylalanine and histidine am 185..238 BLOCKS BL00488C: Phenylalanine and histidine am 289..336 BLOCKS BL00488D: Phenylalanine and histidine am 370..423 BLOCKS BL00488E: Phenylalanine and histidine am 445..499 BLOCKS BL00488F: Phenylalanine and histidine am 503..555 BLOCKS BL00488G: Phenylalanine and histidine am 563..615 BLOCKS BL00488H: Phenylalanine and histidine am 651..700 Entrez active site: BY SIMILARITY. 212 Entrez Domain: POLY-ASN. 24..27 PFAM PAL: Phenylalanine and histidine ammonia 34..715 PRODOM PD018374: PALY(2) PAL1(1) PAL2(1) 1..38 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 40..63 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 65..579 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 581..677 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 679..706 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 207..222 __________________ Plus Strand HSPs: Score = 305 (107.4 bits), Expect = 3.3e-25, P = 3.3e-25 Identities = 54/60 (90%), Positives = 58/60 (96%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE VISPGEECDK+F+A+CQGKIIDPLLECLGEWNGAPLPIC Sbjct: 666 SYPLYKFVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGAPLPIC 725
>gi|417444|sp|Q04593|PAL2_PEA PHENYLALANINE AMMONIA-LYASE 2 >gi|217984|dbj|BAA00887.1| (D10003) phenylalanine ammonia-lyase [Pisum sativum] Length = 724 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 724 0 150 300 450 600 __________________ Annotated Domains: Entrez active site: BY SIMILARITY. 211 PFAM PAL: Phenylalanine and histidine ammonia 34..714 PRODOM PD018374: PALY(2) PAL1(1) PAL2(1) 1..38 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 40..63 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 65..578 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 580..676 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 678..705 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 206..221 __________________ Plus Strand HSPs: Score = 300 (105.6 bits), Expect = 1.2e-24, P = 1.2e-24 Identities = 53/59 (89%), Positives = 59/59 (100%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI 180 +YPLYKFVREELGT+LLTGE+VISPGEECDK+FTA+CQGKIIDPLLECLG+WNGAPLPI Sbjct: 665 SYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGAPLPI 723
>gi|81875|pir||A24727 phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney bean (fragment) >gi|169357|gb|AAA33770.1| (M11939) phenylalanine ammonia-lyase (EC 4.3.1.5) [Phaseolus vulgaris] >gi|224727|prf||1111326A ammonia lyase,Phe [Phaseolus vulgaris] Length = 505 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 505 0 150 300 450 Plus Strand HSPs: Score = 293 (103.1 bits), Expect = 2.2e-24, P = 2.2e-24 Identities = 53/60 (88%), Positives = 57/60 (95%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE+V SPGEE DK+FTA+CQGKIIDPLLECLGEWNGAPLPIC Sbjct: 446 SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC 505
>gi|129583|sp|P07218|PAL1_PHAVU PHENYLALANINE AMMONIA-LYASE CLASS I >gi|81876|pir||S04129 phenylalanine ammonia-lyase (EC 4.3.1.5) class I - kidney bean (fragment) Length = 506 Frame 1 hits (HSPs): ______ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 506 0 150 300 450 __________________ Annotated Domains: PFAM PAL: Phenylalanine and histidine ammonia 1..496 __________________ Plus Strand HSPs: Score = 293 (103.1 bits), Expect = 2.2e-24, P = 2.2e-24 Identities = 53/60 (88%), Positives = 57/60 (95%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE+V SPGEE DK+FTA+CQGKIIDPLLECLGEWNGAPLPIC Sbjct: 447 SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC 506
>gi|1172002|sp|P45732|PALY_STYHU PHENYLALANINE AMMONIA-LYASE >gi|556424|gb|AAA99500.1| (L36822) phenylalanine ammonia lyase [Stylosanthes humilis] Length = 715 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 715 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 99..143 BLOCKS BL00488B: Phenylalanine and histidine am 175..228 BLOCKS BL00488C: Phenylalanine and histidine am 279..326 BLOCKS BL00488D: Phenylalanine and histidine am 360..413 BLOCKS BL00488E: Phenylalanine and histidine am 435..489 BLOCKS BL00488F: Phenylalanine and histidine am 493..545 BLOCKS BL00488G: Phenylalanine and histidine am 553..605 BLOCKS BL00488H: Phenylalanine and histidine am 641..690 Entrez active site: BY SIMILARITY. 202 PFAM PAL: Phenylalanine and histidine ammonia 24..705 PRODOM PD143668: PALY_STYHU 1..29 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 31..52 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 55..569 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 571..667 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 669..696 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 197..212 __________________ Plus Strand HSPs: Score = 297 (104.5 bits), Expect = 2.4e-24, P = 2.4e-24 Identities = 51/60 (85%), Positives = 58/60 (96%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT +LTGE+V SPGEECDK+FTA+CQGKIIDPLLEC+GEWNGAPLP+C Sbjct: 656 SYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPLC 715
>gi|2285893|dbj|BAA21643.1| (D30656) phenylalanine ammonia-lyase [Populus kitakamiensis] Length = 715 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 715 0 150 300 450 600 Plus Strand HSPs: Score = 292 (102.8 bits), Expect = 8.2e-24, P = 8.2e-24 Identities = 53/60 (88%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE V SPGEE DKVFTA+CQGKIIDP+LECLGEWNGAPLPIC Sbjct: 656 SYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC 715
>gi|1172001|sp|P45730|PALY_POPTR PHENYLALANINE AMMONIA-LYASE >gi|541843|pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar x cottonwood >gi|169454|gb|AAA33805.1| (L11747) phenylalanine ammonia lyase [Populus x generosa] Length = 715 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 715 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 99..143 BLOCKS BL00488B: Phenylalanine and histidine am 175..228 BLOCKS BL00488C: Phenylalanine and histidine am 279..326 BLOCKS BL00488D: Phenylalanine and histidine am 360..413 BLOCKS BL00488E: Phenylalanine and histidine am 435..489 BLOCKS BL00488F: Phenylalanine and histidine am 493..545 BLOCKS BL00488G: Phenylalanine and histidine am 553..605 BLOCKS BL00488H: Phenylalanine and histidine am 641..690 Entrez active site: BY SIMILARITY. 202 PFAM PAL: Phenylalanine and histidine ammonia 23..705 PRODOM PD043218: O24266(1) PALY(1) 1..27 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 29..52 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 54..569 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 571..667 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 669..696 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 197..212 __________________ Plus Strand HSPs: Score = 291 (102.4 bits), Expect = 1.0e-23, P = 1.0e-23 Identities = 52/60 (86%), Positives = 57/60 (95%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE+V SPGEE DKVFTA+CQGKIIDP+LECLGEWNG+PLPIC Sbjct: 656 SYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC 715
>gi|266731|sp|Q01861|PAL1_PEA PHENYLALANINE AMMONIA-LYASE 1 >gi|282927|pir||S25303 phenylalanine ammonia-lyase (EC 4.3.1.5) - garden pea >gi|217980|dbj|BAA00885.1| (D10001) phenylalanine ammonia-lyase [Pisum sativum] >gi|217982|dbj|BAA00886.1| (D10002) phenylalanine ammonia-lyase [Pisum sativum] Length = 723 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 723 0 150 300 450 600 __________________ Annotated Domains: Entrez active site: BY SIMILARITY. 210 PFAM PAL: Phenylalanine and histidine ammonia 33..713 PRODOM PD018374: PALY(2) PAL1(1) PAL2(1) 1..37 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 39..62 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 64..577 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 579..675 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 677..704 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 205..220 __________________ Plus Strand HSPs: Score = 290 (102.1 bits), Expect = 1.4e-23, P = 1.4e-23 Identities = 50/59 (84%), Positives = 58/59 (98%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI 180 +YPLY+FVR+ELGT LLTGE+VISPGEECDK+FTA+CQGKIIDPLL+CLG+WNGAPLPI Sbjct: 664 SYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI 722
>gi|738926|prf||2001451A Phe ammonia lyase [Pisum sativum] Length = 723 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 723 0 150 300 450 600 Plus Strand HSPs: Score = 290 (102.1 bits), Expect = 1.4e-23, P = 1.4e-23 Identities = 50/59 (84%), Positives = 58/59 (98%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI 180 +YPLY+FVR+ELGT LLTGE+VISPGEECDK+FTA+CQGKIIDPLL+CLG+WNGAPLPI Sbjct: 664 SYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI 722
>gi|1172004|sp|P45735|PALY_VITVI PHENYLALANINE AMMONIA-LYASE >gi|1345583|emb|CAA53581.1| (X75967) phenylalanine ammonium lyase [Vitis vinifera] Length = 416 Frame 1 hits (HSPs): ________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | 416 0 150 300 __________________ Annotated Domains: PFAM PAL: Phenylalanine and histidine ammonia 1..406 __________________ Plus Strand HSPs: Score = 275 (96.8 bits), Expect = 7.0e-23, P = 7.0e-23 Identities = 49/60 (81%), Positives = 55/60 (91%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE+V SPGE+ DKVFTA+C+GKIIDPLL+CL WNGAPLPIC Sbjct: 357 SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 416
>gi|129584|sp|P27991|PAL1_SOYBN PHENYLALANINE AMMONIA-LYASE 1 >gi|99944|pir||S22991 phenylalanine ammonia-lyase (EC 4.3.1.5) 1 - soybean >gi|18377|emb|CAA37129.1| (X52953) phenylalanine ammonia-lyase [Glycine max] Length = 713 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 713 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 97..141 BLOCKS BL00488B: Phenylalanine and histidine am 173..226 BLOCKS BL00488C: Phenylalanine and histidine am 277..324 BLOCKS BL00488D: Phenylalanine and histidine am 358..411 BLOCKS BL00488E: Phenylalanine and histidine am 433..487 BLOCKS BL00488F: Phenylalanine and histidine am 491..543 BLOCKS BL00488G: Phenylalanine and histidine am 551..603 BLOCKS BL00488H: Phenylalanine and histidine am 639..688 Entrez active site: BY SIMILARITY. 200 PFAM PAL: Phenylalanine and histidine ammonia 22..703 PRODOM PD143666: PAL1_SOYBN 1..27 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 29..51 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 53..567 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 569..665 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 667..694 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 195..210 __________________ Plus Strand HSPs: Score = 282 (99.3 bits), Expect = 9.7e-23, P = 9.7e-23 Identities = 51/59 (86%), Positives = 56/59 (94%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI 180 +YPLYKFVREELGT LLTGE+V SPGEE DK+FTA+CQGKIIDPL+ECLGEWNGAPLPI Sbjct: 654 SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPI 712
>gi|1171991|sp|P35510|PAL1_ARATH PHENYLALANINE AMMONIA-LYASE 1 >gi|1076369|pir||S52990 phenylalanine ammonia-lyase (EC 4.3.1.5) 1 - Arabidopsis thaliana >gi|497419|gb|AAC18870.1| (L33677) phenylalanine ammonia lyase [Arabidopsis thaliana] Length = 725 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 725 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 109..153 BLOCKS BL00488B: Phenylalanine and histidine am 185..238 BLOCKS BL00488C: Phenylalanine and histidine am 289..336 BLOCKS BL00488D: Phenylalanine and histidine am 370..423 BLOCKS BL00488E: Phenylalanine and histidine am 445..499 BLOCKS BL00488F: Phenylalanine and histidine am 503..555 BLOCKS BL00488G: Phenylalanine and histidine am 563..615 BLOCKS BL00488H: Phenylalanine and histidine am 651..700 DOMO DM01898: PHENYLALANINEANDHISTIDINEAMMONI 1..60 DOMO DM00721: PHENYLALANINEANDHISTIDINEAMMONI 62..575 DOMO DM03479: HISTIDINEAMMONIA-LYASE 577..724 Entrez active site: BY SIMILARITY. 212 PFAM PAL: Phenylalanine and histidine ammonia 34..715 PRODOM PD143674: PAL1_ARATH 1..39 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 41..63 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 65..582 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 584..677 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 679..706 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 207..222 __________________ Plus Strand HSPs: Score = 279 (98.2 bits), Expect = 2.1e-22, P = 2.1e-22 Identities = 48/60 (80%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+FVREELGT LLTGE+V SPGEE DKVFTA+C+GKIIDP++ECL EWNGAP+PIC Sbjct: 666 SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC 725
>gi|6598547|gb|AAD18156.2| (AC006260) phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana] Length = 725 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 725 0 150 300 450 600 Plus Strand HSPs: Score = 279 (98.2 bits), Expect = 2.1e-22, P = 2.1e-22 Identities = 48/60 (80%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+FVREELGT LLTGE+V SPGEE DKVFTA+C+GKIIDP++ECL EWNGAP+PIC Sbjct: 666 SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC 725
>gi|1171993|sp|P45724|PAL2_ARATH PHENYLALANINE AMMONIA-LYASE 2 >gi|1076370|pir||S52991 phenylalanine ammonia-lyase (EC 4.3.1.5) 2 - Arabidopsis thaliana >gi|497421|gb|AAC18871.1| (L33678) phenylalanine ammonia lyase [Arabidopsis thaliana] Length = 717 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 717 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 101..145 BLOCKS BL00488B: Phenylalanine and histidine am 177..230 BLOCKS BL00488C: Phenylalanine and histidine am 281..328 BLOCKS BL00488D: Phenylalanine and histidine am 362..415 BLOCKS BL00488E: Phenylalanine and histidine am 437..491 BLOCKS BL00488F: Phenylalanine and histidine am 495..547 BLOCKS BL00488G: Phenylalanine and histidine am 555..607 BLOCKS BL00488H: Phenylalanine and histidine am 643..692 Entrez active site: BY SIMILARITY. 204 PFAM PAL: Phenylalanine and histidine ammonia 26..707 PRODOM PD143670: PAL2_ARATH 1..30 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 32..55 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 57..574 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 576..669 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 671..698 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 199..214 __________________ Plus Strand HSPs: Score = 278 (97.9 bits), Expect = 2.7e-22, P = 2.7e-22 Identities = 47/60 (78%), Positives = 57/60 (95%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+FVREELGT LLTGE+V+SPGEE DKVFTA+C+GK+IDPL++CL EWNGAP+PIC Sbjct: 658 SYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC 717
>gi|11269670|pir||T46172 phenylalanine ammonia-lyase (EC 4.3.1.5) 2 [similarity] - Arabidopsis thaliana >gi|6630746|emb|CAB64229.1| (AL132958) phenylalanine ammonia-lyase [Arabidopsis thaliana] Length = 717 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 717 0 150 300 450 600 Plus Strand HSPs: Score = 278 (97.9 bits), Expect = 2.7e-22, P = 2.7e-22 Identities = 47/60 (78%), Positives = 57/60 (95%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+FVREELGT LLTGE+V+SPGEE DKVFTA+C+GK+IDPL++CL EWNGAP+PIC Sbjct: 658 SYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC 717
>gi|3024362|sp|Q43052|PAL2_POPKI PHENYLALANINE AMMONIA-LYASE G2B >gi|2118317|pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen x large-toothed aspen >gi|1109641|dbj|BAA07860.1| (D43802) phenylalanine ammonia-lyase [Populus kitakamiensis] Length = 710 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 710 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 95..139 BLOCKS BL00488B: Phenylalanine and histidine am 171..224 BLOCKS BL00488C: Phenylalanine and histidine am 275..322 BLOCKS BL00488D: Phenylalanine and histidine am 356..409 BLOCKS BL00488E: Phenylalanine and histidine am 431..485 BLOCKS BL00488F: Phenylalanine and histidine am 489..541 BLOCKS BL00488G: Phenylalanine and histidine am 548..600 BLOCKS BL00488H: Phenylalanine and histidine am 636..685 Entrez active site: BY SIMILARITY. 198 PFAM PAL: Phenylalanine and histidine ammonia 20..700 PRODOM PD143661: PAL2_POPKI 1..24 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 26..49 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 51..564 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 566..662 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 664..691 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 193..208 __________________ Plus Strand HSPs: Score = 276 (97.2 bits), Expect = 4.3e-22, P = 4.3e-22 Identities = 50/60 (83%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT+LLTGE+V SPGEE DKVFTA+C GK+IDPLLECL EW+GAPLPIC Sbjct: 651 SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC 710
>gi|1172000|sp|P45731|PAL1_POPKI PHENYLALANINE AMMONIA-LYASE G1 >gi|485810|dbj|BAA06337.1| (D30657) phenylalanine ammonia-lyase [Populus kitakamiensis] Length = 682 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 682 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 66..110 BLOCKS BL00488B: Phenylalanine and histidine am 142..195 BLOCKS BL00488C: Phenylalanine and histidine am 246..293 BLOCKS BL00488D: Phenylalanine and histidine am 327..380 BLOCKS BL00488E: Phenylalanine and histidine am 402..456 BLOCKS BL00488F: Phenylalanine and histidine am 460..512 BLOCKS BL00488G: Phenylalanine and histidine am 520..572 BLOCKS BL00488H: Phenylalanine and histidine am 608..657 Entrez active site: BY SIMILARITY. 169 PFAM PAL: Phenylalanine and histidine ammonia 1..672 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 1..24 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 26..536 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 539..634 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 636..662 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 164..179 __________________ Plus Strand HSPs: Score = 275 (96.8 bits), Expect = 5.0e-22, P = 5.0e-22 Identities = 49/60 (81%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT+LLTGE+V SPGE+ DKVFTA+C GK++DPLLECL EWNGAPLPIC Sbjct: 623 SYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLPIC 682
>gi|1171999|sp|P45727|PALY_PERAE PHENYLALANINE AMMONIA-LYASE >gi|563243|gb|AAA51873.1| (U16130) phenylalanine ammonia lyase [Persea americana] Length = 620 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 620 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 3..47 BLOCKS BL00488B: Phenylalanine and histidine am 79..132 BLOCKS BL00488C: Phenylalanine and histidine am 183..230 BLOCKS BL00488D: Phenylalanine and histidine am 265..318 BLOCKS BL00488E: Phenylalanine and histidine am 340..394 BLOCKS BL00488F: Phenylalanine and histidine am 398..450 BLOCKS BL00488G: Phenylalanine and histidine am 458..510 BLOCKS BL00488H: Phenylalanine and histidine am 546..595 Entrez active site: BY SIMILARITY. 106 PFAM PAL: Phenylalanine and histidine ammonia 1..610 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 1..474 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 477..571 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 573..601 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 101..116 __________________ Plus Strand HSPs: Score = 274 (96.5 bits), Expect = 5.1e-22, P = 5.1e-22 Identities = 49/60 (81%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREEL T+LLTGE+V SPGEE DKVF+A+CQGK+IDPLLECL EWNGAP+PIC Sbjct: 561 SYPLYKFVREELKTSLLTGEKVRSPGEEFDKVFSAICQGKVIDPLLECLREWNGAPIPIC 620
>gi|129594|sp|P25872|PAL1_TOBAC PHENYLALANINE AMMONIA-LYASE >gi|2146799|pir||S66343 phenylalanine ammonia-lyase (EC 4.3.1.5) 1 - common tobacco >gi|170350|gb|AAA34122.1| (M84466) phenylalanine ammonia lyase [Nicotiana tabacum] >gi|2564057|dbj|BAA22948.1| (AB008200) phenylalanine ammonia-lyase [Nicotiana tabacum] Length = 715 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 715 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 99..143 BLOCKS BL00488B: Phenylalanine and histidine am 175..228 BLOCKS BL00488C: Phenylalanine and histidine am 279..326 BLOCKS BL00488D: Phenylalanine and histidine am 360..413 BLOCKS BL00488E: Phenylalanine and histidine am 435..489 BLOCKS BL00488F: Phenylalanine and histidine am 493..545 BLOCKS BL00488G: Phenylalanine and histidine am 553..605 BLOCKS BL00488H: Phenylalanine and histidine am 641..690 Entrez active site: BY SIMILARITY. 202 PFAM PAL: Phenylalanine and histidine ammonia 21..705 PRODOM PD143662: PAL1_TOBAC 1..25 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 27..49 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 52..564 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 571..667 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 669..696 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 197..212 PROSITE PHOSPHOPANTETHEINE: Phosphopantetheine a 53..68 __________________ Plus Strand HSPs: Score = 275 (96.8 bits), Expect = 5.6e-22, P = 5.6e-22 Identities = 48/60 (80%), Positives = 55/60 (91%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+FVR+ELGT LLTGE+V SPGEECDKVFTA+C G+IIDP+LECL WNGAPLPIC Sbjct: 656 SYPLYRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC 715
>gi|9910836|sp|Q9SMK9|PAL2_CICAR PHENYLALANINE AMMONIA-LYASE 2 >gi|6433808|emb|CAB60719.1| (AJ250836) phenylalanine ammonia-lyase [Cicer arietinum] Length = 718 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 718 0 150 300 450 600 Plus Strand HSPs: Score = 274 (96.5 bits), Expect = 7.2e-22, P = 7.2e-22 Identities = 47/60 (78%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVRE LGT+LLTGE++ SPGEECDKVF ALC G+ IDP+L+CL EWNGAPLPIC Sbjct: 659 SYPLYKFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGAPLPIC 718
>gi|548457|sp|P35512|PALY_MALDO PHENYLALANINE AMMONIA-LYASE >gi|99858|pir||S25538 phenylalanine ammonia-lyase (EC 4.3.1.5) - apple tree (fragment) >gi|19652|emb|CAA48231.1| (X68126) phenylalanine ammonia-lyase [Malus sp.] Length = 235 Frame 1 hits (HSPs): _____________ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 235 0 50 100 150 200 __________________ Annotated Domains: PFAM PAL: Phenylalanine and histidine ammonia 3..225 __________________ Plus Strand HSPs: Score = 264 (92.9 bits), Expect = 7.9e-22, P = 7.9e-22 Identities = 48/60 (80%), Positives = 52/60 (86%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELG LTGE+V SPGEECDKVF A+CQGKIIDP+L CL WNGAPLPIC Sbjct: 176 SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC 235
>gi|129589|sp|P14166|PAL1_IPOBA PHENYLALANINE AMMONIA-LYASE >gi|322798|pir||S29029 phenylalanine ammonia-lyase (EC 4.3.1.5) - sweet potato >gi|168272|gb|AAA33389.1| (M29232) phenylalanine ammonia-lyase [Ipomoea batatas] Length = 707 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 707 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 90..134 BLOCKS BL00488B: Phenylalanine and histidine am 166..219 BLOCKS BL00488C: Phenylalanine and histidine am 271..318 BLOCKS BL00488D: Phenylalanine and histidine am 352..405 BLOCKS BL00488E: Phenylalanine and histidine am 427..481 BLOCKS BL00488F: Phenylalanine and histidine am 485..537 BLOCKS BL00488G: Phenylalanine and histidine am 545..597 BLOCKS BL00488H: Phenylalanine and histidine am 633..682 DOMO DM01898: PHENYLALANINEANDHISTIDINEAMMONI 1..41 DOMO DM00721: PHENYLALANINEANDHISTIDINEAMMONI 43..557 Entrez active site: BY SIMILARITY. 193 PFAM PAL: Phenylalanine and histidine ammonia 15..230 PFAM PAL: Phenylalanine and histidine ammonia 257..697 PRODOM PD143655: PAL1_IPOBA 1..19 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 21..43 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 46..561 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 563..659 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 661..688 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 188..203 __________________ Plus Strand HSPs: Score = 273 (96.1 bits), Expect = 8.9e-22, P = 8.9e-22 Identities = 49/60 (81%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVRE LGT LLTGE+V SPGEECDKVFTA+C+G IIDPLLECL W+GAPLPIC Sbjct: 648 SYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC 707
>gi|12240240|gb|AAG49585.1|AF325496_1 (AF325496) phenylalanine ammonia-lyase [Ipomoea nil] Length = 711 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 711 0 150 300 450 600 Plus Strand HSPs: Score = 273 (96.1 bits), Expect = 9.0e-22, P = 9.0e-22 Identities = 49/60 (81%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVRE LGT LLTGE+V SPGEECDKVFTA+C+G IIDPLLECL W+GAPLPIC Sbjct: 652 SYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC 711
>gi|1171997|sp|P45733|PAL3_TOBAC PHENYLALANINE AMMONIA-LYASE >gi|7437117|pir||T03663 phenylalanine ammonia-lyase (EC 4.3.1.5) - common tobacco >gi|633597|emb|CAA55075.1| (X78269) phenylalanine ammonia-lyase [Nicotiana tabacum] Length = 712 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 712 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 96..140 BLOCKS BL00488B: Phenylalanine and histidine am 172..225 BLOCKS BL00488C: Phenylalanine and histidine am 276..323 BLOCKS BL00488D: Phenylalanine and histidine am 357..410 BLOCKS BL00488E: Phenylalanine and histidine am 432..486 BLOCKS BL00488F: Phenylalanine and histidine am 490..542 BLOCKS BL00488G: Phenylalanine and histidine am 550..602 BLOCKS BL00488H: Phenylalanine and histidine am 638..687 Entrez active site: BY SIMILARITY. 199 PFAM PAL: Phenylalanine and histidine ammonia 19..702 PRODOM PD043217: PAL2(1) PAL3(1) 1..23 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 25..48 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 50..566 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 568..664 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 667..693 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 194..209 __________________ Plus Strand HSPs: Score = 273 (96.1 bits), Expect = 9.0e-22, P = 9.0e-22 Identities = 49/60 (81%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+FVREELG LLTGE+V SPGEECDKVFTA+C G+IID LLECL EWNGAPLPIC Sbjct: 653 SYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC 712
>gi|1171998|sp|P45726|PALY_CAMSI PHENYLALANINE AMMONIA-LYASE >gi|662271|dbj|BAA05643.1| (D26596) phenylalanine ammonia-lyase [Camellia sinensis] Length = 714 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 714 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 98..142 BLOCKS BL00488B: Phenylalanine and histidine am 174..227 BLOCKS BL00488C: Phenylalanine and histidine am 278..325 BLOCKS BL00488D: Phenylalanine and histidine am 359..412 BLOCKS BL00488E: Phenylalanine and histidine am 434..488 BLOCKS BL00488F: Phenylalanine and histidine am 492..544 BLOCKS BL00488G: Phenylalanine and histidine am 552..604 BLOCKS BL00488H: Phenylalanine and histidine am 640..689 Entrez active site: BY SIMILARITY. 201 PFAM PAL: Phenylalanine and histidine ammonia 23..704 PRODOM PD143667: PALY_CAMSI 1..27 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 29..52 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 54..568 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 570..666 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 668..695 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 196..211 __________________ Plus Strand HSPs: Score = 273 (96.1 bits), Expect = 9.1e-22, P = 9.1e-22 Identities = 49/60 (81%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE+V SPGEE DKVFTALC+G++IDPL++CL EWNGAPLPIC Sbjct: 655 SYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC 714
>gi|6647711|sp|O64963|PAL1_PRUAV PHENYLALANINE AMMONIA-LYASE 1 >gi|2935294|gb|AAC78457.1| (AF036948) phenylalanine ammonia-lyase; PAL1 [Prunus avium] Length = 717 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 717 0 150 300 450 600 Plus Strand HSPs: Score = 273 (96.1 bits), Expect = 9.2e-22, P = 9.2e-22 Identities = 48/60 (80%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELG LTGE+V SPGEECDKVFTA+C+GKIIDP+L+CL WNGAPLPIC Sbjct: 658 SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC 717
>gi|3024360|sp|Q42667|PALY_CITLI PHENYLALANINE AMMONIA-LYASE >gi|1276903|gb|AAB67733.1| (U43338) phenylalanine ammonia-lyase [Citrus limon] Length = 722 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 722 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 104..148 BLOCKS BL00488B: Phenylalanine and histidine am 180..233 BLOCKS BL00488C: Phenylalanine and histidine am 284..331 BLOCKS BL00488D: Phenylalanine and histidine am 365..418 BLOCKS BL00488E: Phenylalanine and histidine am 440..494 BLOCKS BL00488F: Phenylalanine and histidine am 498..550 BLOCKS BL00488G: Phenylalanine and histidine am 558..610 BLOCKS BL00488H: Phenylalanine and histidine am 646..695 Entrez active site: BY SIMILARITY. 207 PFAM PAL: Phenylalanine and histidine ammonia 29..710 PRODOM PD143673: PALY_CITLI 1..33 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 35..58 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 60..574 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 576..672 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 674..701 PRODOM PD143683: PALY_CITLI 703..721 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 202..217 __________________ Plus Strand HSPs: Score = 271 (95.4 bits), Expect = 1.5e-21, P = 1.5e-21 Identities = 47/60 (78%), Positives = 56/60 (93%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYK VRE++GT+LLTGE+V SPGEE DKVFTA+C+GK+IDP+LECL EWNGAPLPIC Sbjct: 661 SYPLYKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPIC 720
>gi|3914261|sp|O49835|PAL1_LITER PHENYLALANINE AMMONIA-LYASE 1 (PAL-1) >gi|7437120|pir||JC5872 phenylalanine ammonia-lyase (EC 4.3.1.5) 1 - Lithospermum erythrorhizon >gi|2911122|dbj|BAA24928.1| (D83075) phenylalanine ammonia-lyase [Lithospermum erythrorhizon] Length = 710 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 710 0 150 300 450 600 __________________ Annotated Domains: Entrez active site: BY SIMILARITY. 197 PFAM PAL: Phenylalanine and histidine ammonia 19..700 PRODOM PD143660: PAL1_LITER 1..23 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 25..48 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 50..564 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 566..662 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 664..691 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 192..207 __________________ Plus Strand HSPs: Score = 270 (95.0 bits), Expect = 1.9e-21, P = 1.9e-21 Identities = 48/60 (80%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LLTGE+V SPGEE DKVFTA+C+GK++DPLL CL WNGAPLPIC Sbjct: 651 SYPLYKFVREELGTELLTGEKVRSPGEELDKVFTAMCEGKLVDPLLACLEAWNGAPLPIC 710
>gi|4808126|emb|CAB42793.1| (AJ238753) phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata] Length = 721 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 721 0 150 300 450 600 Plus Strand HSPs: Score = 269 (94.7 bits), Expect = 2.5e-21, P = 2.5e-21 Identities = 48/60 (80%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+ VREELGT LTGE+V SPGE+ DKVFTA+CQGKIIDP+LECL EWNGAPLPIC Sbjct: 662 SYPLYRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC 721
>gi|5690433|gb|AAD47085.1|AF167487_1 (AF167487) phenylalanine ammonia lyase [Eucalyptus globulus] Length = 398 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 398 0 150 300 Plus Strand HSPs: Score = 260 (91.5 bits), Expect = 2.8e-21, P = 2.8e-21 Identities = 48/58 (82%), Positives = 52/58 (89%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLP 177 +YPLYK VREELGTALLTGE VISPGE+ DKVFTA+C GK+IDPLLECL WNGAPLP Sbjct: 341 SYPLYKLVREELGTALLTGEGVISPGEDFDKVFTAICAGKLIDPLLECLSGWNGAPLP 398
>gi|7208616|gb|AAF40224.1|AF237955_1 (AF237955) phenylalanine ammonia-lyase 2 [Rubus idaeus] Length = 730 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 730 0 150 300 450 600 Plus Strand HSPs: Score = 267 (94.0 bits), Expect = 4.2e-21, P = 4.2e-21 Identities = 47/60 (78%), Positives = 52/60 (86%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELG LTGE+V SPGEECDKVFTA+CQG IIDP+L+CL WNG PLPIC Sbjct: 671 SYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGNIIDPILDCLSGWNGEPLPIC 730
>gi|3024361|sp|Q42858|PAL2_IPOBA PHENYLALANINE AMMONIA-LYASE >gi|7437130|pir||T10909 phenylalanine ammonia-lyase (EC 4.3.1.5) - sweet potato >gi|1122743|dbj|BAA11459.1| (D78640) Phenylalanine Ammonia-Lyase [Ipomoea batatas] Length = 708 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 708 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 92..136 BLOCKS BL00488B: Phenylalanine and histidine am 168..221 BLOCKS BL00488C: Phenylalanine and histidine am 272..319 BLOCKS BL00488D: Phenylalanine and histidine am 353..406 BLOCKS BL00488E: Phenylalanine and histidine am 428..482 BLOCKS BL00488F: Phenylalanine and histidine am 486..538 BLOCKS BL00488G: Phenylalanine and histidine am 546..598 BLOCKS BL00488H: Phenylalanine and histidine am 634..683 Entrez active site: BY SIMILARITY. 195 PFAM PAL: Phenylalanine and histidine ammonia 18..698 PRODOM PD143658: PAL2_IPOBA 1..22 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 24..46 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 49..562 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 564..660 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 662..689 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 190..205 __________________ Plus Strand HSPs: Score = 266 (93.6 bits), Expect = 5.1e-21, P = 5.1e-21 Identities = 48/60 (80%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL W+GAPLPIC Sbjct: 649 SYPLYKFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGAPLPIC 708
>gi|3123241|sp|P35513|PAL2_TOBAC PHENYLALANINE AMMONIA-LYASE >gi|7437118|pir||T01858 phenylalanine ammonia-lyase (EC 4.3.1.5) - common tobacco >gi|2564055|dbj|BAA22947.1| (AB008199) phenylalanine ammonia-lyase [Nicotiana tabacum] >gi|2570156|dbj|BAA22963.1| (D17467) phenylalanine ammonia-lyase [Nicotiana tabacum] Length = 712 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 712 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 96..140 BLOCKS BL00488B: Phenylalanine and histidine am 172..225 BLOCKS BL00488C: Phenylalanine and histidine am 276..323 BLOCKS BL00488D: Phenylalanine and histidine am 357..410 BLOCKS BL00488E: Phenylalanine and histidine am 432..486 BLOCKS BL00488F: Phenylalanine and histidine am 490..542 BLOCKS BL00488G: Phenylalanine and histidine am 550..602 BLOCKS BL00488H: Phenylalanine and histidine am 638..687 Entrez active site: BY SIMILARITY. 199 PFAM PAL: Phenylalanine and histidine ammonia 19..702 PRODOM PD043217: PAL2(1) PAL3(1) 1..23 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 25..48 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 50..566 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 568..664 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 667..693 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 194..209 __________________ Plus Strand HSPs: Score = 266 (93.6 bits), Expect = 5.1e-21, P = 5.1e-21 Identities = 48/60 (80%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+FVR ELG LLTGE+V SPGEECDKVFTA+C G+IID LLECL EWNGAPLPIC Sbjct: 653 SYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC 712
>gi|3513758|gb|AAC33966.1| (AF081215) phenylalanine ammonia-lyase [Capsicum chinense] Length = 532 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 532 0 150 300 450 Plus Strand HSPs: Score = 263 (92.6 bits), Expect = 5.3e-21, P = 5.3e-21 Identities = 47/60 (78%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+ VR+ELGT LLTGERV SPGEE DKVFTA+C G++IDPLLECL WNGAPLPIC Sbjct: 473 SYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQVIDPLLECLKSWNGAPLPIC 532
>gi|548454|sp|P35511|PAL1_LYCES PHENYLALANINE AMMONIA-LYASE (PAL) Length = 704 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 704 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 88..132 BLOCKS BL00488B: Phenylalanine and histidine am 164..217 BLOCKS BL00488C: Phenylalanine and histidine am 268..315 BLOCKS BL00488D: Phenylalanine and histidine am 349..402 BLOCKS BL00488E: Phenylalanine and histidine am 424..478 BLOCKS BL00488F: Phenylalanine and histidine am 482..534 BLOCKS BL00488G: Phenylalanine and histidine am 542..594 BLOCKS BL00488H: Phenylalanine and histidine am 630..679 Entrez active site: BY SIMILARITY. 191 PFAM PAL: Phenylalanine and histidine ammonia 10..694 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 16..39 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 41..558 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 560..656 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 658..685 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 186..201 __________________ Plus Strand HSPs: Score = 265 (93.3 bits), Expect = 6.4e-21, P = 6.4e-21 Identities = 48/60 (80%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+ VREELGT LLTGE+V SPGEE DKVFTA+C G+IIDPLLECL WNGAPLPIC Sbjct: 645 SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC 704
>gi|5332353|gb|AAA34179.2| (M83314) phenylalanine ammonia lyase [Lycopersicon esculentum] Length = 704 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 704 0 150 300 450 600 Plus Strand HSPs: Score = 265 (93.3 bits), Expect = 6.4e-21, P = 6.4e-21 Identities = 48/60 (80%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+ VREELGT LLTGE+V SPGEE DKVFTA+C G+IIDPLLECL WNGAPLPIC Sbjct: 645 SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC 704
>gi|7208614|gb|AAF40223.1|AF237954_1 (AF237954) phenylalanine ammonia-lyase 1 [Rubus idaeus] Length = 710 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 710 0 150 300 450 600 Plus Strand HSPs: Score = 264 (92.9 bits), Expect = 8.4e-21, P = 8.4e-21 Identities = 46/59 (77%), Positives = 54/59 (91%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPI 180 +YPLY+FVREELGT+LLTGE++ SPGEEC KVF A+C GK++DPLLECL EWNGAPLPI Sbjct: 651 SYPLYRFVREELGTSLLTGEKIKSPGEECYKVFNAICAGKLVDPLLECLKEWNGAPLPI 709
>gi|5566388|gb|AAD45384.1| (AF165998) phenylalanine ammonia-lyase [Vigna unguiculata] Length = 655 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 655 0 150 300 450 600 Plus Strand HSPs: Score = 263 (92.6 bits), Expect = 9.0e-21, P = 9.0e-21 Identities = 45/60 (75%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVRE LGT+L GE+V SPGEECDKVFTALC+GK IDP+++CL +WNG+PLPIC Sbjct: 596 SYPLYKFVRESLGTSLQYGEKVKSPGEECDKVFTALCEGKFIDPMMDCLKKWNGSPLPIC 655
>gi|4808128|emb|CAB42794.1| (AJ238754) phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata] Length = 718 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 718 0 150 300 450 600 Plus Strand HSPs: Score = 262 (92.2 bits), Expect = 1.4e-20, P = 1.4e-20 Identities = 47/60 (78%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+ VRE LG+ LTGE+V SPGEE DKVFTA+CQGKIIDP+LECL EWNGAPLPIC Sbjct: 659 SYPLYRLVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC 718
>gi|3334286|sp|O23924|PALY_DIGLA PHENYLALANINE AMMONIA-LYASE >gi|2631995|emb|CAA05251.1| (AJ002221) phenylalanine ammonia lyase [Digitalis lanata] Length = 713 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 713 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 96..140 BLOCKS BL00488B: Phenylalanine and histidine am 172..225 BLOCKS BL00488C: Phenylalanine and histidine am 277..324 BLOCKS BL00488D: Phenylalanine and histidine am 358..411 BLOCKS BL00488E: Phenylalanine and histidine am 433..487 BLOCKS BL00488F: Phenylalanine and histidine am 491..543 BLOCKS BL00488G: Phenylalanine and histidine am 551..603 BLOCKS BL00488H: Phenylalanine and histidine am 639..688 Entrez active site: BY SIMILARITY. 199 PFAM PAL: Phenylalanine and histidine ammonia 21..703 PRODOM PD143665: PALY_DIGLA 1..26 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 28..50 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 52..567 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 569..665 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 667..694 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 194..209 __________________ Plus Strand HSPs: Score = 260 (91.5 bits), Expect = 2.3e-20, P = 2.3e-20 Identities = 45/60 (75%), Positives = 54/60 (90%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKF+REELGT LTGE+V+SPGEECD+VFTA+ +G I+DPLL+CL WNGAPLPIC Sbjct: 654 SYPLYKFIREELGTNFLTGEKVMSPGEECDRVFTAMSKGLIVDPLLKCLEGWNGAPLPIC 713
>gi|3914262|sp|O49836|PAL2_LITER PHENYLALANINE AMMONIA-LYASE 2 (PAL-2) >gi|7437121|pir||JC5873 phenylalanine ammonia-lyase (EC 4.3.1.5) 2 - Lithospermum erythrorhizon >gi|2911124|dbj|BAA24929.1| (D83076) phenylalanine ammonia-lyase [Lithospermum erythrorhizon] Length = 705 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 705 0 150 300 450 600 __________________ Annotated Domains: Entrez active site: BY SIMILARITY. 192 PFAM PAL: Phenylalanine and histidine ammonia 14..695 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 20..43 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 45..559 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 561..657 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 659..686 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 187..202 __________________ Plus Strand HSPs: Score = 256 (90.1 bits), Expect = 6.0e-20, P = 6.0e-20 Identities = 46/60 (76%), Positives = 52/60 (86%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVR ELGT LLTGE+V SPGEE D+VF ALC+GK++DPLL CL WNGAPLPIC Sbjct: 646 SYPLYKFVRGELGTELLTGEKVRSPGEELDQVFNALCEGKLVDPLLACLEAWNGAPLPIC 705
>gi|11761146|dbj|BAB19128.1| (AB041361) phenylalanine ammonia-lyase [Dianthus caryophyllus] Length = 618 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 618 0 150 300 450 600 Plus Strand HSPs: Score = 254 (89.4 bits), Expect = 7.5e-20, P = 7.5e-20 Identities = 49/60 (81%), Positives = 52/60 (86%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVRE L T LLTGE V SPGEE DKVFTAL +GKI+DPLLECL EWNGAPLPIC Sbjct: 559 SYPLYKFVREVLKTDLLTGEGVRSPGEEIDKVFTALNEGKIVDPLLECLQEWNGAPLPIC 618
>gi|1171996|sp|P45729|PAL3_PETCR PHENYLALANINE AMMONIA-LYASE 3 >gi|535008|emb|CAA57057.1| (X81159) phenylalanine ammonia-lyase 3 [Petroselinum crispum] Length = 718 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 718 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 101..145 BLOCKS BL00488B: Phenylalanine and histidine am 178..231 BLOCKS BL00488C: Phenylalanine and histidine am 282..329 BLOCKS BL00488D: Phenylalanine and histidine am 363..416 BLOCKS BL00488E: Phenylalanine and histidine am 438..492 BLOCKS BL00488F: Phenylalanine and histidine am 496..548 BLOCKS BL00488G: Phenylalanine and histidine am 556..608 BLOCKS BL00488H: Phenylalanine and histidine am 644..693 Entrez active site: BY SIMILARITY. 205 PFAM PAL: Phenylalanine and histidine ammonia 25..708 PRODOM PD025351: PAL1(1) PAL2(1) PAL3(1) 5..29 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 31..54 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 56..572 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 574..670 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 672..699 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 200..215 __________________ Plus Strand HSPs: Score = 255 (89.8 bits), Expect = 8.0e-20, P = 8.0e-20 Identities = 47/60 (78%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LTGE+V SPGEE +KVFTA+ +G+IIDPLLECL WNGAPLPIC Sbjct: 659 SYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGAPLPIC 718
>gi|1363495|pir||S48726 phenylalanine ammonia-lyase (EC 4.3.1.5) 3 - parsley Length = 718 Frame 1 hits (HSPs): _____ Annotated Domains: __ __________________________________________________ Database sequence: | | | | | | 718 0 150 300 450 600 __________________ Annotated Domains: PROSITE PAL_HISTIDASE: Phenylalanine and histidi 200..215 __________________ Plus Strand HSPs: Score = 255 (89.8 bits), Expect = 8.0e-20, P = 8.0e-20 Identities = 47/60 (78%), Positives = 53/60 (88%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLYKFVREELGT LTGE+V SPGEE +KVFTA+ +G+IIDPLLECL WNGAPLPIC Sbjct: 659 SYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGAPLPIC 718
>gi|129587|sp|P26600|PAL5_LYCES PHENYLALANINE AMMONIA-LYASE (PAL) >gi|170469|gb|AAA34176.1| (M90692) phenylalanine ammonia-lyase [Lycopersicon esculentum] Length = 721 Frame 1 hits (HSPs): _____ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 721 0 150 300 450 600 __________________ Annotated Domains: BLOCKS BL00488A: Phenylalanine and histidine am 105..149 BLOCKS BL00488B: Phenylalanine and histidine am 181..234 BLOCKS BL00488C: Phenylalanine and histidine am 285..332 BLOCKS BL00488D: Phenylalanine and histidine am 366..419 BLOCKS BL00488E: Phenylalanine and histidine am 441..495 BLOCKS BL00488F: Phenylalanine and histidine am 499..551 BLOCKS BL00488G: Phenylalanine and histidine am 559..611 BLOCKS BL00488H: Phenylalanine and histidine am 647..696 Entrez active site: BY SIMILARITY. 208 PFAM PAL: Phenylalanine and histidine ammonia 27..711 PRODOM PD143672: PAL5_LYCES 1..31 PRODOM PD001870: PAL1(12) PALY(10) PAL2(8) 33..56 PRODOM PD001290: PALY(14) PAL1(12) PAL2(9) 58..575 PRODOM PD001719: PALY(12) PAL1(12) PAL2(9) 577..673 PRODOM PD001814: PAL1(12) PALY(10) PAL2(9) 675..702 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 203..218 __________________ Plus Strand HSPs: Score = 255 (89.8 bits), Expect = 8.0e-20, P = 8.0e-20 Identities = 45/60 (75%), Positives = 52/60 (86%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+ VR+E+GT LLTGE+V SPGEE DKVFTA C G+IIDPLLECL WNGAP+PIC Sbjct: 662 SYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC 721
>gi|322743|pir||A44133 phenylalanine ammonia-lyase (EC 4.3.1.5) - tomato Length = 721 Frame 1 hits (HSPs): _____ Annotated Domains: __ __________________________________________________ Database sequence: | | | | | | 721 0 150 300 450 600 __________________ Annotated Domains: Entrez modified site: serine derivative (Ser) 208 PROSITE PAL_HISTIDASE: Phenylalanine and histidi 203..218 __________________ Plus Strand HSPs: Score = 255 (89.8 bits), Expect = 8.0e-20, P = 8.0e-20 Identities = 45/60 (75%), Positives = 52/60 (86%), Frame = +1 Query: 4 AYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC 183 +YPLY+ VR+E+GT LLTGE+V SPGEE DKVFTA C G+IIDPLLECL WNGAP+PIC Sbjct: 662 SYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC 721 WARNING: HSPs involving 30 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.99 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.358 0.161 0.653 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.358 0.158 0.605 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.337 0.150 0.522 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.336 0.144 0.474 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.340 0.146 0.523 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.333 0.142 0.480 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 149 148 10. 74 3 12 22 0.091 34 30 0.11 36 +2 0 150 149 10. 74 3 12 22 0.092 34 30 0.12 36 +1 0 150 149 10. 74 3 12 22 0.092 34 30 0.12 36 -1 0 150 149 10. 74 3 12 22 0.092 34 30 0.12 36 -2 0 150 149 10. 74 3 12 22 0.092 34 30 0.12 36 -3 0 149 149 10. 74 3 12 22 0.092 34 30 0.12 36 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 80 No. of states in DFA: 595 (59 KB) Total size of DFA: 214 KB (256 KB) Time to generate neighborhood: 0.00u 0.02s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 162.90u 0.93s 163.83t Elapsed: 00:00:47 Total cpu time: 162.92u 1.01s 163.93t Elapsed: 00:00:47 Start: Mon Feb 4 19:32:32 2002 End: Mon Feb 4 19:33:19 2002 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000