D simple2

DTASelect v1.9
/home/51n/myMS/article/dbdigger/nathanPSM/tryptic/simple2
/home/51n/myMS/db/psmDB/20040623-Scale-8956.fasta
DBDigger 0.5 in SQT format.
-1 25.081 -2 30.84645 -3 31.30806 --DB -d 0.1 -p 2
Jump to the summary table.

sequest.params modifications:

true	Use criteria
25.081	Minimum +1 XCorr
30.84645	Minimum +2 XCorr
31.30806	Minimum +3 XCorr
0.1	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
true	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
false	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

std_gi|2506462|sp|P02188|MYG_HORSE

100.0%

153

16951

7.8

MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1030.1030.1	46.7143	0.573334	1816.76	1817.01	1	144.0	78.3%	1	-.GLSDGEWQQVLNVWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1029.1029.2	75.5249	0.628626	1817.24	1817.01	1	239.0	91.7%	1	-.GLSDGEWQQVLNVWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1190.1190.2	49.0407	0.498082	3404.12	3405.8	1	109.0	61.5%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1186.1186.3	45.1688	0.394983	3406.3	3405.8	1	229.0	63.8%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.730.730.1	44.7754	0.437745	1606.92	1607.81	1	161.0	69.6%	1	K.VEADIAGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.729.729.2	72.0304	0.507047	1608.1	1607.81	1	232.0	88.0%	1	K.VEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.660.660.1	43.4274	0.354898	1271.7	1272.44	1	226.0	81.2%	1	R.LFTGHPETLEK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.662.662.2	50.0784	0.495725	1274.1	1272.44	1	172.0	75.0%	1	R.LFTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.726.726.2	35.8428	0.255694	1663.62	1662.88	1	164.0	53.8%	1	R.LFTGHPETLEKFDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.754.754.2	58.2318	0.502961	1938.0	1938.23	1	162.0	80.8%	1	R.LFTGHPETLEKFDKFK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.396.396.2	64.1778	0.54926	1363.88	1362.64	1	236.0	94.4%	1	K.FKHLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.400.400.3	45.2589	0.424564	1364.05	1362.64	1	250.0	61.1%	1	K.FKHLKTEAEMK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.268.268.1	40.8241	0.392672	1086.6	1087.29	1	227.0	92.3%	2	K.HLKTEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.273.273.2	54.277	0.516775	1088.0	1087.29	1	237.0	100.0%	1	K.HLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.494.494.2	58.0275	0.571331	1858.6	1859.15	1	6.0	77.8%	1	K.HLKTEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.146.146.1	30.3292	0.38825	708.59	708.81	1	184.0	90.0%	1	K.TEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.421.421.1	46.5011	0.557767	1479.68	1480.68	1	166.0	75.0%	1	K.TEAEMKASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.419.419.2	70.2662	0.595649	1480.76	1480.68	1	186.0	95.2%	1	K.TEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.420.420.3	41.4086	0.379849	1481.77	1480.68	1	234.0	68.3%	1	K.TEAEMKASEDLKK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.929.929.1	53.9155	0.514555	1378.86	1379.69	1	203.0	81.0%	1	K.HGTVVLTALGGILK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.930.930.2	86.2231	0.640807	1379.72	1379.69	1	47.0	100.0%	1	K.HGTVVLTALGGILK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.935.935.3	53.2299	0.299788	1380.16	1379.69	1	63.0	60.9%	1	K.HGTVVLTALGGILK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.854.854.1	56.5563	0.558263	1506.89	1507.86	1	224.0	78.3%	1	K.HGTVVLTALGGILKK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.855.855.2	79.7181	0.724093	1508.36	1507.86	1	118.0	92.0%	1	K.HGTVVLTALGGILKK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.856.856.3	68.4337	0.597798	1508.56	1507.86	1	186.0	79.6%	1	K.HGTVVLTALGGILKK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.319.319.2	63.1093	0.552705	2110.94	2111.41	1	208.0	73.3%	2	K.KKGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.303.303.3	66.3732	0.589503	2112.19	2111.41	1	191.0	60.0%	1	K.KKGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.324.324.1	63.1589	0.597643	1982.0	1983.24	1	44.0	80.8%	1	K.KGHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.323.323.3	65.4288	0.445171	1983.19	1983.24	1	189.0	71.9%	1	K.KGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.343.343.2	57.4269	0.509812	1983.86	1983.24	1	225.0	71.4%	2	K.KGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.348.348.1	62.4866	0.636079	1853.86	1855.06	1	52.0	84.0%	1	K.GHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.373.373.2	49.9343	0.582854	1854.18	1855.06	1	171.0	65.4%	3	K.GHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.349.349.3	42.3913	0.546438	1855.72	1855.06	1	169.0	54.9%	1	K.GHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1111.1111.2	74.0332	0.619356	2602.1	2603.13	1	208.0	88.9%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1109.1109.3	51.619	0.508204	2603.53	2603.13	1	94.0	72.3%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1055.1055.3	33.1323	0.386414	4087.42	4087.74	1	172.0	48.8%	1	K.HKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1097.1097.3	39.0121	0.477308	1886.95	1886.2	1	197.0	53.2%	1	K.YLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1094.1094.2	77.5591	0.675741	1887.3	1886.2	1	222.0	88.5%	2	K.YLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1106.1106.1	64.7517	0.629985	1887.82	1886.2	1	164.0	95.8%	2	K.YLEFISDAIIHVLHSK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1052.1052.2	55.0611	0.533039	3369.6	3370.81	1	200.0	75.0%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1049.1049.3	55.5282	0.605881	3370.69	3370.81	1	216.0	66.7%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.639.639.1	45.2231	0.538119	1502.58	1503.64	1	173.0	81.0%	1	K.HPGDFGADAQGAMTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.642.642.3	59.2433	0.632683	1505.14	1503.64	1	255.0	60.9%	1	K.HPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.640.640.2	63.2358	0.636831	1505.38	1503.64	1	40.0	80.8%	1	K.HPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.769.769.1	26.9437	0.277364	748.93	748.901	1	135.0	88.9%	1	K.ALELFR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.787.787.1	36.2048	0.244305	1360.72	1361.58	1	45.0	72.2%	1	K.ALELFRNDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.937.937.2	47.1659	0.525367	2284.52	2284.62	1	212.0	62.1%	1	K.ALELFRNDIAAKYKELGFQG.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.155.155.1	34.5707	0.102445	631.7	631.707	1	174.0	90.0%	3	R.NDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.687.687.1	32.3131	0.48831	941.59	942.059	1	193.0	76.9%	1	K.YKELGFQG.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.689.689.2	42.8707	0.554425	942.38	942.059	1	168.0	84.6%	1	K.YKELGFQG.-	2

std_gi|122572|sp|P02070|HBB_BOVIN

95.9%

145

15954

7.6

HEMOGLOBIN BETA CHAIN gi|70412|pir||HBBOB hemoglobin beta chain - bovine gi|576143|pdb|1HDA|B Bos taurus gi|576145|pdb|1HDA|D Bos taurus gi|395 (X00376) beta-globin [Bos taurus] gi|162741 (M63453) beta-globin [Bos taurus] [MASS=15954]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.289.289.1	32.2131	0.337931	821.44	821.97	1	193.0	83.3%	3	-.MLTAEEK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.294.294.2	37.9267	0.408203	823.22	821.97	1	149.0	83.3%	1	-.MLTAEEK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.917.917.2	72.386	0.689933	1753.92	1754.06	1	214.0	78.6%	1	-.MLTAEEKAAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.766.766.1	39.0343	0.43141	950.79	951.113	1	91.0	92.3%	1	K.AAVTAFWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.776.776.2	54.199	0.460826	952.76	951.113	1	232.0	93.3%	1	K.AAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.669.669.1	49.7315	0.388806	1328.84	1329.5	1	168.0	90.0%	1	K.VKVDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.670.670.2	77.209	0.53755	1330.0	1329.5	1	236.0	90.9%	1	K.VKVDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.629.629.1	32.9308	0.43923	1101.62	1102.19	1	169.0	64.7%	1	K.VDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.632.632.2	69.1014	0.516292	1102.62	1102.19	1	223.0	90.0%	1	K.VDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.894.894.1	28.8969	0.203434	1274.77	1275.54	1	10.0	80.0%	1	R.LLVVYPWTQR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.895.895.2	48.8856	0.50046	1275.96	1275.54	1	231.0	81.2%	1	R.LLVVYPWTQR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1169.1169.3	54.1485	0.542916	3348.55	3347.82	1	214.0	64.5%	1	R.LLVVYPWTQRFFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.939.939.2	81.8551	0.664923	2090.58	2091.31	1	247.0	80.6%	5	R.FFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.945.945.3	75.4724	0.538529	2091.79	2091.31	1	219.0	74.2%	1	R.FFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.672.672.1	31.391	0.429607	1225.59	1226.44	1	2.0	81.2%	1	K.KVLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.709.709.1	38.3366	0.385256	1097.45	1098.26	1	74.0	87.5%	1	K.VLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.711.711.2	38.1571	0.41376	1098.68	1098.26	1	48.0	66.7%	1	K.VLDSFSNGMK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.290.290.1	34.0335	0.387806	740.66	740.835	1	224.0	90.0%	1	K.HLDDLK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.931.931.3	63.5463	0.638777	3194.02	3194.6	1	212.0	67.6%	1	K.HLDDLKGTFAALSELHCDKLHVDPENFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.680.680.1	41.1257	0.470052	1098.65	1099.23	1	171.0	92.3%	1	K.LHVDPENFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1069.1069.1	29.0749	0.225026	1265.88	1266.61	1	5.0	68.4%	1	K.LLGNVLVVVLAR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1070.1070.2	66.8384	0.563342	1267.9	1266.61	1	234.0	86.4%	1	K.LLGNVLVVVLAR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.852.852.1	49.1575	0.532334	1869.79	1870.12	1	40.0	72.0%	1	R.NFGKEFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.850.850.2	83.0714	0.71115	1870.06	1870.12	1	185.0	92.6%	1	R.NFGKEFTPVLQADFQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1156.1156.2	38.4617	0.446215	3328.38	3329.79	1	132.0	57.1%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1149.1149.3	49.882	0.540315	3330.76	3329.79	1	178.0	64.1%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.829.829.1	44.0746	0.528604	1422.66	1423.61	1	179.0	78.9%	1	K.EFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.684.684.1	30.9862	0.112118	1177.55	1178.38	1	68.0	66.7%	1	K.VVAGVANALAHR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.685.685.2	75.7945	0.564844	1178.9	1178.38	1	122.0	100.0%	1	K.VVAGVANALAHR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.710.710.2	69.3296	0.681876	1478.84	1478.7	1	120.0	84.0%	1	K.VVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.707.707.3	45.3617	0.487365	1480.09	1478.7	1	189.0	62.2%	1	K.VVAGVANALAHRYH.-	3

std_gi|122361|sp|P01966|HBA_BOVIN

95.0%

141

15053

8.4

HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.249.249.1	37.5333	0.357429	703.59	703.814	1	237.0	91.7%	1	-.VLSAADK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.278.278.1	49.0956	0.468608	1101.62	1102.28	1	209.0	93.8%	2	-.VLSAADKGNVK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.281.281.2	49.7811	0.47048	1102.62	1102.28	1	79.0	77.8%	1	-.VLSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.296.296.2	37.9675	0.312789	1006.04	1003.14	1	0.0	76.5%	1	V.LSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.675.675.1	51.1047	0.490988	1529.73	1530.64	1	172.0	81.8%	1	K.VGGHAAEYGAEALER.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.671.671.2	72.8971	0.671626	1531.3	1530.64	1	253.0	87.5%	1	K.VGGHAAEYGAEALER.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.676.676.3	48.3029	0.453354	1531.33	1530.64	1	247.0	63.8%	1	K.VGGHAAEYGAEALER.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.861.861.2	45.3367	0.535279	1073.02	1072.31	1	227.0	85.7%	1	R.MFLSFPTTK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.865.865.1	36.2059	0.410165	1074.59	1072.31	1	180.0	78.6%	2	R.MFLSFPTTK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.782.782.1	61.6508	0.616263	1833.78	1835.03	1	83.0	87.0%	2	K.TYFPHFDLSHGSAQVK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.779.779.2	66.0048	0.591218	1834.72	1835.03	1	23.0	88.5%	1	K.TYFPHFDLSHGSAQVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.780.780.3	49.0287	0.434411	1836.22	1835.03	1	202.0	64.0%	1	K.TYFPHFDLSHGSAQVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.781.781.3	35.2167	0.243302	2939.5	2940.34	1	0.0	49.3%	1	K.TYFPHFDLSHGSAQVKGHGAKVAAALTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.280.280.1	38.7064	0.22959	675.68	673.831	1	170.0	100.0%	1	K.VAAALTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.879.879.2	86.8138	0.667822	2367.96	2368.61	1	178.0	90.3%	1	K.AVEHLDDLPGALSELSDLHAHK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.880.880.3	79.7881	0.601629	2370.16	2368.61	1	253.0	69.1%	1	K.AVEHLDDLPGALSELSDLHAHK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.869.869.2	92.0881	0.634459	2636.82	2637.96	1	214.0	93.3%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.870.870.3	74.7218	0.564491	2638.36	2637.96	1	124.0	73.8%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.927.927.3	32.0203	0.236313	3439.06	3437.88	1	217.0	52.6%	1	K.AVEHLDDLPGALSELSDLHAHKLRVDPVNFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.721.721.2	47.7905	0.342658	1088.7	1088.3	1	206.0	92.3%	1	K.LRVDPVNFK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.644.644.1	33.1629	0.388778	818.59	818.948	1	168.0	90.9%	1	R.VDPVNFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1020.1020.2	62.8788	0.649785	2970.3	2971.43	1	52.0	70.0%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1019.1019.3	72.8086	0.625032	2971.51	2971.43	1	230.0	74.3%	2	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1240.1240.3	69.5215	0.609926	4231.87	4232.91	1	59.0	65.2%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.849.849.1	34.9741	0.344555	1279.71	1280.51	1	75.0	77.8%	1	K.FLANVSTVLTSK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.851.851.2	65.8458	0.602251	1281.66	1280.51	1	203.0	86.4%	1	K.FLANVSTVLTSK.Y	2

std_sp|P00698|LYC_CHICK

84.5%

129

14313

9.0

Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.263.263.1	27.2633	0.123965	606.82	606.746	1	32.0	88.9%	1	-.KVFGR.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.604.604.1	39.1991	0.443635	836.57	837.051	1	218.0	84.6%	1	R.CELAAAMK.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.538.538.1	28.792	0.324694	992.65	993.239	1	140.0	66.7%	1	R.CELAAAMKR.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.540.540.2	56.0614	0.470861	993.8	993.239	1	221.0	86.7%	1	R.CELAAAMKR.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.283.283.1	31.3199	0.371511	874.65	874.932	1	176.0	81.8%	1	R.HGLDNYR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.299.299.2	51.7071	0.405793	875.44	874.932	1	215.0	100.0%	1	R.HGLDNYR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.836.836.2	44.8078	0.501051	2125.38	2125.38	1	2.0	66.7%	1	R.HGLDNYRGYSLGNWVCAAK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.857.857.1	32.3947	0.275551	1268.48	1269.47	1	44.0	72.2%	1	R.GYSLGNWVCAAK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.650.650.2	60.8061	0.60039	1429.56	1429.49	1	250.0	86.4%	1	K.FESNFNTQATNR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.805.805.2	78.3018	0.634636	1754.84	1754.85	1	244.0	92.0%	1	R.NTDGSTDYGILQINSR.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1079.1079.2	104.259	0.712574	2337.8	2338.73	1	171.0	90.6%	7	R.NLCNIPCSALLSSDITASVNCAK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.999.999.2	69.5467	0.687419	2465.9	2466.91	1	152.0	78.1%	2	R.NLCNIPCSALLSSDITASVNCAKK.I	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.847.847.2	91.0454	0.686654	1806.76	1805.07	1	187.0	92.3%	1	K.KIVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.914.914.1	28.8221	0.414283	1675.69	1676.9	1	132.0	54.5%	1	K.IVSDGNGMNAWVAWR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.910.910.2	60.6847	0.255379	1677.92	1676.9	1	186.0	70.4%	1	K.IVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.759.759.1	30.6806	0.41081	1045.58	1046.17	1	144.0	76.9%	1	K.GTDVQAWIR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.767.767.2	58.8126	0.419096	1046.7	1046.17	1	172.0	93.3%	1	K.GTDVQAWIR.G	2

std_gi|2190337|gnl|PID|e321614

79.2%

607

69324

6.2

(X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.223.223.1	38.2432	0.485448	1193.62	1194.29	1	152.0	87.5%	3	R.DTHKSEIAHR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.205.205.2	56.8498	0.484654	1194.28	1194.29	1	153.0	88.2%	5	R.DTHKSEIAHR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.635.635.1	46.0359	0.513823	1249.64	1250.4	1	226.0	86.7%	1	R.FKDLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.636.636.2	65.8764	0.513981	1250.54	1250.4	1	216.0	100.0%	1	R.FKDLGEEHFK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1145.1145.3	50.1991	0.577168	4812.7	4813.53	1	156.0	62.5%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.477.477.1	32.1709	0.214184	974.5	975.046	1	204.0	69.2%	1	K.DLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1129.1129.2	72.5643	0.6659	2436.22	2436.84	1	201.0	81.5%	1	K.GLVLIAFSQYLQQCPFDEHVK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1181.1181.3	47.5733	0.459241	3581.65	3582.16	1	229.0	66.7%	1	K.GLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.814.814.2	57.1295	0.602932	1164.62	1164.34	1	187.0	88.9%	1	K.LVNELTEFAK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.270.270.1	48.5165	0.567094	1349.59	1350.47	1	216.0	84.2%	1	K.TCVADESHAGCEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.831.831.1	55.2263	0.566849	1362.68	1363.58	1	244.0	88.9%	1	K.SLHTLFGDELCK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.835.835.2	60.5233	0.57021	1363.88	1363.58	1	46.0	81.8%	1	K.SLHTLFGDELCK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.699.699.2	37.9097	0.326761	2484.82	2485.69	1	0.0	59.3%	1	K.QEPERNECFLSHKDDSPDLPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.450.450.1	36.0616	0.439847	886.43	886.934	1	186.0	83.3%	1	K.DDSPDLPK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.716.716.1	26.7464	0.213401	927.59	928.076	1	53.0	81.8%	1	K.YLYEIAR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1076.1076.3	45.2614	0.469323	4343.95	4344.98	1	90.0	63.6%	1	R.RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.358.358.1	26.9091	0.179218	918.88	919.136	1	10.0	78.6%	1	R.LRCASIQK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.361.361.2	36.7452	0.173383	919.96	919.136	1	208.0	76.9%	1	R.LRCASIQK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.655.655.1	28.3943	0.346689	1001.75	1002.21	1	68.0	71.4%	1	R.ALKAWSVAR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.363.363.1	33.0134	0.351088	847.71	848.033	1	148.0	81.8%	2	R.LSQKFPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.367.367.2	44.7435	0.407514	848.06	848.033	1	30.0	100.0%	1	R.LSQKFPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.634.634.1	43.683	0.535719	922.68	923.054	1	224.0	100.0%	1	K.AEFVEVTK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.637.637.2	53.8103	0.51447	923.6	923.054	1	211.0	100.0%	1	K.AEFVEVTK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.584.584.1	35.0314	0.330135	789.68	789.948	1	207.0	81.8%	1	K.LVTDLTK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.714.714.2	50.0527	0.500706	2441.8	2442.76	1	87.0	64.5%	1	K.VHKECCHGDLLECADDRADLAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.715.715.3	32.3069	0.105179	2442.73	2442.76	1	66.0	50.7%	1	K.VHKECCHGDLLECADDRADLAK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.622.622.1	37.2267	0.557046	1386.61	1387.51	1	169.0	72.2%	1	K.YICDNQDTISSK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.626.626.2	71.1827	0.637875	1387.74	1387.51	1	143.0	95.0%	1	K.YICDNQDTISSK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.620.620.1	41.2669	0.435926	1418.62	1419.75	1	104.0	77.8%	1	K.LKECCDKPLLEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.621.621.2	58.8423	0.537798	1419.8	1419.75	1	244.0	85.0%	1	K.LKECCDKPLLEK.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.630.630.3	41.9713	0.337452	1420.33	1419.75	1	181.0	59.0%	1	K.LKECCDKPLLEK.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.353.353.1	41.4493	0.41205	1015.53	1016.16	1	228.0	85.7%	1	K.SHCIAEVEK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.911.911.3	76.4799	0.665255	3398.86	3399.82	1	240.0	73.8%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.889.889.3	42.3091	0.50531	4133.08	4133.6	1	228.0	60.7%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAK.D	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1026.1026.1	38.1141	0.384603	1567.74	1568.73	1	136.0	73.7%	1	K.DAFLGSFLYEYSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.744.744.2	59.9955	0.575655	1441.2	1440.69	1	164.0	86.4%	1	R.RHPEYAVSVLLR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.752.752.3	48.3442	0.49432	1441.69	1440.69	1	233.0	65.8%	1	R.RHPEYAVSVLLR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.906.906.3	38.2211	0.367548	3421.96	3422.88	1	208.0	56.4%	1	R.LAKEYEATLEECCAKDDPHACYSTVFDKLK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.724.724.1	42.0054	0.41354	1305.72	1306.51	1	205.0	81.2%	1	K.HLVDEPQNLIK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.725.725.2	61.2466	0.598454	1308.14	1306.51	1	190.0	88.9%	1	K.HLVDEPQNLIK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.811.811.2	76.7163	0.657476	2299.84	2299.57	1	225.0	89.3%	1	K.HLVDEPQNLIKQNCDQFEK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1044.1044.3	52.2706	0.578844	3760.54	3761.25	1	174.0	65.0%	1	K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.959.959.2	48.8654	0.504514	2473.0	2473.77	1	37.0	64.3%	1	K.QNCDQFEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.881.881.1	36.2	0.474392	1479.68	1480.71	1	136.0	70.0%	1	K.LGEYGFQNALIVR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.882.882.2	69.8211	0.6544	1481.72	1480.71	1	234.0	82.6%	1	K.LGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.749.749.1	36.4322	0.346743	1639.92	1640.92	1	16.0	69.6%	1	R.KVPQVSTPTLVEVSR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.745.745.2	66.2781	0.621237	1640.64	1640.92	1	106.0	87.5%	1	R.KVPQVSTPTLVEVSR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.751.751.3	45.7976	0.492316	1641.16	1640.92	1	252.0	65.3%	1	R.KVPQVSTPTLVEVSR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1051.1051.1	33.5923	0.51449	1667.7	1668.97	1	192.0	76.2%	1	R.MPCTEDYLSLILNR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1050.1050.2	76.0292	0.567656	1668.92	1668.97	1	246.0	95.7%	1	R.MPCTEDYLSLILNR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.441.441.1	30.1928	0.189959	841.56	842.05	1	184.0	81.8%	2	R.LCVLHEK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.445.445.2	47.5733	0.393511	842.54	842.05	1	244.0	100.0%	1	R.LCVLHEK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.657.657.2	59.555	0.510113	1484.22	1483.77	1	252.0	86.4%	1	R.LCVLHEKTPVSEK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.265.265.1	29.6507	0.212079	990.69	989.158	1	24.0	71.4%	1	K.TPVSEKVTK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.799.799.2	50.6921	0.531327	1825.74	1825.09	1	153.0	64.3%	1	R.RPCFSALTPDETYVPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.800.800.3	38.9432	0.195572	1826.89	1825.09	1	189.0	58.0%	1	R.RPCFSALTPDETYVPK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.941.941.2	95.6942	0.7336	2441.8	2442.75	1	201.0	86.2%	1	K.AFDEKLFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.920.920.2	67.5318	0.586863	2811.82	2812.22	1	201.0	78.6%	1	K.AFDEKLFTFHADICTLPDTEKQIK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.912.912.1	64.7564	0.529733	1850.74	1852.12	1	138.0	91.7%	1	K.LFTFHADICTLPDTEK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.909.909.2	84.3468	0.626235	1852.1	1852.12	1	250.0	96.3%	1	K.LFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.770.770.1	38.9355	0.387631	1142.76	1143.41	1	169.0	81.2%	1	K.KQTALVELLK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.238.238.1	35.1644	0.235013	818.59	818.903	1	156.0	90.9%	2	K.ATEEQLK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1134.1134.2	73.6449	0.663977	2199.94	2200.52	1	178.0	82.1%	1	K.ATEEQLKTVMENFVAFVDK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1142.1142.3	56.7911	0.559442	2201.83	2200.52	1	247.0	63.8%	1	K.ATEEQLKTVMENFVAFVDK.C	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1220.1220.3	57.1223	0.614431	3938.41	3939.5	1	107.0	65.1%	1	K.ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1175.1175.2	54.7826	0.560868	3138.04	3139.62	1	217.0	65.5%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1174.1174.3	52.7543	0.53988	3138.76	3139.62	1	224.0	66.2%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	3

std_gi|1168350|sp|P00330|ADH1_YEAST

64.1%

348

36823

6.7

ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.619.619.1	40.9672	0.349812	1136.59	1137.28	1	208.0	85.7%	1	K.GVIFYESHGK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.624.624.2	48.1017	0.510672	1137.64	1137.28	1	196.0	100.0%	1	K.GVIFYESHGK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.549.549.1	34.9736	0.334415	893.68	894.102	1	224.0	91.7%	3	K.DIPVPKPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.761.761.2	55.0284	0.354177	1014.24	1014.21	1	252.0	82.4%	1	K.ANELLINVK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.762.762.1	38.4118	0.331114	1016.48	1014.21	1	136.0	92.9%	3	K.ANELLINVK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.824.824.2	91.5702	0.69735	2021.08	2020.36	1	253.0	82.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.827.827.3	46.1301	0.420871	2022.67	2020.36	1	109.0	52.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.614.614.2	44.8667	0.422204	838.04	836.964	1	205.0	84.6%	1	K.IGDYAGIK.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.616.616.1	34.0679	0.308352	839.46	836.964	1	184.0	84.6%	1	K.IGDYAGIK.W	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.986.986.2	59.9826	0.477087	3013.38	3014.52	1	125.0	67.6%	1	K.ALKSANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1034.1034.2	94.293	0.748586	2701.16	2702.11	1	174.0	85.7%	11	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.997.997.3	35.9655	0.363974	2701.99	2702.11	1	2.0	43.4%	1	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.809.809.1	33.8532	0.369052	1618.85	1619.82	1	168.0	60.9%	1	R.VLGIDGGEGKEELFR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.804.804.2	70.2778	0.607254	1619.38	1619.82	1	104.0	77.8%	1	R.VLGIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.807.807.3	37.6125	0.330196	1622.32	1619.82	1	187.0	44.7%	1	R.VLGIDGGEGKEELFR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.949.949.1	49.1976	0.50359	1312.64	1313.49	1	216.0	83.3%	2	R.SIGGEVFIDFTK.E	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1059.1059.2	74.4819	0.607975	2366.32	2366.76	1	145.0	86.2%	2	R.SIGGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1072.1072.3	42.2639	0.450084	2369.47	2366.76	1	143.0	54.0%	1	R.SIGGEVFIDFTKEKDIVGAVLK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.719.719.1	33.142	0.154088	1071.74	1072.29	1	177.0	68.8%	1	K.EKDIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.722.722.2	47.354	0.423996	1073.02	1072.29	1	120.0	83.3%	1	K.EKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.784.784.1	35.7955	0.252808	814.69	815.001	1	210.0	78.6%	1	K.DIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.786.786.2	39.6792	0.266918	815.62	815.001	1	204.0	84.6%	1	K.DIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.846.846.2	92.5054	0.697195	2312.98	2313.49	1	213.0	85.7%	3	K.ATDGGAHGVINVSVSEAAIEASTR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.839.839.3	38.3988	0.352579	2313.61	2313.49	1	211.0	48.5%	1	K.ATDGGAHGVINVSVSEAAIEASTR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.737.737.2	32.9009	0.259048	1805.72	1806.14	1	172.0	44.8%	1	R.YVRANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.739.739.2	50.3211	0.513099	1388.18	1387.64	1	236.0	72.0%	1	R.ANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.740.740.1	42.2832	0.374626	1389.64	1387.64	1	206.0	72.7%	2	R.ANGTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.789.789.1	35.2107	0.437958	1251.72	1252.41	1	66.0	72.2%	1	K.SISIVGSYVGNR.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.771.771.2	66.7166	0.613846	1252.66	1252.41	1	231.0	95.0%	1	K.SISIVGSYVGNR.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.844.844.1	29.0655	0.182323	968.6	969.085	1	176.0	81.8%	1	R.EALDFFAR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.845.845.2	41.4116	0.218407	969.64	969.085	1	156.0	92.3%	1	R.EALDFFAR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.580.580.1	38.0641	0.415029	841.81	842.07	1	235.0	84.6%	1	R.GLVKSPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.919.919.2	67.4166	0.621881	2271.2	2271.75	1	248.0	71.9%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.915.915.3	57.4076	0.569374	2272.75	2271.75	1	236.0	62.5%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.975.975.3	33.189	0.303245	3271.15	3270.95	1	22.0	56.6%	1	R.GLVKSPIKVVGLSTLPEIYEKMEKGQIVGR.Y	3
2	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.204.204.1	25.3712	0.175463	444.55	444.552	1	175.0	85.7%	3	K.SPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.904.904.1	53.5894	0.66526	1872.91	1874.23	1	162.0	84.0%	1	K.SPIKVVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.905.905.3	43.7661	0.399624	1874.71	1874.23	1	160.0	56.9%	1	K.SPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.901.901.2	95.6016	0.716075	1875.28	1874.23	1	249.0	96.2%	1	K.SPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.874.874.1	46.2227	0.59111	1447.8	1448.7	1	189.0	73.7%	1	K.VVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.875.875.2	61.3315	0.435523	1448.96	1448.7	1	207.0	90.0%	1	K.VVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.304.304.1	29.2525	0.303964	1017.71	1018.23	1	140.0	78.6%	1	K.MEKGQIVGR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.313.313.1	39.3421	0.314226	811.59	811.91	1	236.0	91.7%	2	R.YVVDTSK.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.295.295.2	44.5286	0.572421	812.68	811.91	1	161.0	100.0%	1	R.YVVDTSK.-	2

std_tr|Q865Y7

54.6%

260

29114

6.9

Carbonic anhydrase II (EC 4.2.1.1) - Bos taurus (Bovine).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.253.253.1	33.1553	0.40259	1141.59	1142.22	1	90.0	83.3%	1	K.HNGPEHWHK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.654.654.2	71.6736	0.651503	2141.66	2142.3	1	163.0	85.7%	1	K.HNGPEHWHKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.674.674.1	28.8621	0.357878	1018.68	1019.1	1	129.0	73.3%	1	K.DFPIANGER.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.511.511.1	32.9311	0.377348	1002.53	1003.1	1	38.0	78.6%	2	R.QSPVDIDTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.512.512.2	47.125	0.488785	1005.06	1003.1	1	49.0	100.0%	2	R.QSPVDIDTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.961.961.2	65.7762	0.577156	2199.94	2199.56	1	132.0	75.0%	1	K.AVVQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.964.964.3	49.3874	0.46604	2201.83	2199.56	1	254.0	65.0%	1	K.AVVQDPALKPLALVYGEATSR.R	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.925.925.3	34.0928	0.358296	2358.43	2355.74	1	227.0	40.3%	1	K.AVVQDPALKPLALVYGEATSRR.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.756.756.1	52.7923	0.58422	1581.81	1582.8	1	120.0	93.3%	1	K.YAAELHLVHWNTK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1066.1066.2	70.204	0.567086	2255.12	2254.55	1	157.0	77.1%	1	K.YGDFGTAAQQPDGLAVVGVFLK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.338.338.1	34.3764	0.386268	1012.65	1013.14	1	242.0	80.0%	1	K.VGDANPALQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.339.339.2	59.8789	0.473198	1014.9	1013.14	1	217.0	88.9%	1	K.VGDANPALQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.775.775.1	40.5571	0.383422	973.64	974.143	1	172.0	85.7%	1	K.VLDALDSIK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.734.734.1	40.768	0.490591	1346.7	1347.58	1	178.0	68.4%	1	K.EPISVSSQQMLK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1064.1064.2	56.881	0.593905	2854.08	2854.3	1	93.0	70.4%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1065.1065.3	39.0519	0.398557	2855.32	2854.3	1	185.0	45.7%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1014.1014.3	36.1403	0.369557	3124.78	3124.59	1	81.0	47.9%	1	R.TLNFNAEGEPELLMLANWRPAQPLKNR.Q	3

	Proteins	Peptide IDs	Copies
Unfiltered	1804	2260	2629
Redundant	7	252	311
Nonredundant	7	252	311

/home/51n/myMS/article/dbdigger/nathanPSM/tryptic/simple2