Primary Evidence: Gonzalez CF, Stonestrom AJ, Lorca GL, Saier MH. Biochemical characterization of phosphoryl transfer involving HPr of the phosphoenolpyruvate-dependent phosphotransferase system in treponema denticola, an organism that lacks PTS permeases. Biochemistry. 2005 Jan;44(2):598-608. PMID: 15641785
Secondary Evidence: Dobrynina OIu, Erlagaeva RS, Umiarov AM, Bol'shakova TN. [The multifunctional fructose-specific component of the phosphoenolpyruvate-dependent phosphotransferase system of Escherichia coli K12--fruA gene product]. Mol Gen Mikrobiol Virusol. 2001;(4):18-22. PMID: 11816114
Sergeev KV, Umiarov AM, Dobrynina OIu, Bol'shakova TN, Gershanovich VN. [Isolation and properties of mutants devoid of pseudo-HPr activity of the fructose transfer system in Escherichia coli K12]. Genetika. 1997 Mar;33(3):321-7. PMID: 9244762
Feldheim DA, Chin AM, Nierva CT, Feucht BU, Cao YW, Xu YF, Sutrina SL, Saier MH. Physiological consequences of the complete loss of phosphoryl-transfer proteins HPr and FPr of the phosphoenolpyruvate:sugar phosphotransferase system and analysis of fructose (fru) operon expression in Salmonella typhimurium. J Bacteriol. 1990 Sep;172(9):5459-69. PMID: 220375
Comment: Related 'pts' genes are the HPr(Ser) kinase/phosphatase (ptsK) TDE1295 and TD2331, phosphoenolpyruvate-protein kinase (PTS system, enzyme I) ptsI TDE0084, and the PTS system nitrogen regulatory IIA component ptsN TDE0062 and ptsN2 TDE1079. There are no genes corresponding to the previously reported nucleotide sequences for the IIB, IIC, IID, IIBC, IIABC, or III components in GenBank.
Blast Summary:PSI-Blast Search TDE1294 has significant similarity to the Treponema pallidum gene TP0589 (5e-25).
TDE1294 has significant similarity to the Borrelia burgdorferi gene 15594902 (1e-07).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to clades of COG1925
COG name: Phosphotransferase system, HPr-related proteins
Functional Class: G
The phylogenetic pattern of COG1925 is ---------d-lb-efghsn-j-itw
Number of proteins in this genome belonging to this COG is
Blocks Summary:Blocks Search Significant hit ( 1e-25) to 2/2 blocks of the IPB001020 family, which is described as "Histidine phosphorylation site in HPr protein". Interpro entry for IPR001020. IPB001020A 8-35 3.4e-10 IPB001020B 39-77 4.4e-14 Significant hit ( 2.7e-16) to 3/3 blocks of the PR00107 family, which is described as "Phosphocarrier protein signature". Prints database entry for PR00107. PR00107A 13-29 2.5e-07 PR00107B 38-53 0.85 PR00107C 53-70 0.00016 Significant hit ( 1.1e-13) to 2/2 blocks of the IPB002114 family, which is described as "Serine phosphorylation site in HPr protein". Interpro entry for IPR002114. IPB002114A 2-32 5.7e-05 IPB002114B 44-87 4.5e-07
ProDom Summary:Protein Domain Search Residues 1 to 81 match (9e-19) PD:PD002238 which is described as HPR PHOSPHOTRANSFERASE PHOSPHOCARRIER PROTEOME COMPLETE SYSTEM PHOSPHORYLATION HISTIDINE-CONTAINING SUGAR PTS
Paralogs:Local Blast Search TDE1294 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 1 to 84 (E-value = 4.4e-24) place TDE1294 in the PTS-HPr family which is described as PTS HPr component phosphorylation site (PF00381)
Top PDB Hits: PDB hits to TDE1294 from Psi-BLAST round 5 vs. nr database
27.7% similar to PDB:1POH Phosphotransferase (Histidine-Containing Phosphocarrier Protein) (Hpr) (6e-23) 27.7% similar to PDB:1HDN Histidine-Containing Phosphocarrier Protein (Hpr) (Nmr, 30 Structures) (6e-23) 27.7% similar to PDB:1PFH The Phosphorylated Form Of The Histidine-Containing Phosphocarrier Protein Hpr (6e-23) 33.0% similar to PDB:1KKL L.Casei HprkP IN COMPLEX WITH B.SUBTILIS HPR (Chain H,I,J; 9e-23) 32.1% similar to PDB:1QR5 Solution Structure Of Histidine Containing Protein (Hpr) From Staphylococcus Car (Chain A; 1e-22) 26.5% similar to PDB:1OPD Histidine-Containing Protein (Hpr), Mutant With Ser 46 Replaced By Asp (S46d) (3e-22) 31.8% similar to PDB:1SPH Phosphocarrier Protein (Hpr, Histidine-Containing Protein) Mutant With Ser A 46 (Chain A,B; 5e-22) 31.8% similar to PDB:1KKM L.Casei HprkP IN COMPLEX WITH B.SUBTILIS P-Ser-Hpr (Chain H,I,J; 5e-22) 31.7% similar to PDB:1KA5 Refined Solution Structure Of Histidine Containing Phosphocarrier Protein From S (Chain A; 1e-21) 26.5% similar to PDB:1CM2 Structure Of His15asp Hpr After Hydrolysis Of Ringed Species (Chain A; 2e-21)
Gene Protein Sequence:
MISKTIKVQNRAGIHARPAALIAQKSNNFSSEIFLCKEDAKINAKSVIGI ITMAAAYGTELTLTCDGPDEKEASEAIETIFNNKFEEE