KPY2_MOUSE - (P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 1 || ambiguous || 99.6% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q8R2X0 - (Q8R2X0) Similar to EH-domain containing 2 || Number of peptides = 1 || ambiguous || 99.6% Confident
PMGE_MOUSE - (P15327) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q8VC30 - (Q8VC30) Similar to DKFZP586B1621 protein || Number of peptides = 1 || unambiguous || 99.6% Confident
GTP1_MOUSE - (P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) || Number of peptides = 5 || ambiguous || 99.6% Confident
TAG2_MOUSE - (Q9WVA4) Transgelin 2 || Number of peptides = 12 || unambiguous || 99.6% Confident
SPCN_HUMAN - (Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q8VDM4 - (Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q91Y37 - (Q91Y37) Cytosolic aminopeptidase P || Number of peptides = 2 || unambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 35 || unambiguous || 99.6% Confident
MYO6_MOUSE - (Q64331) Myosin VI || Number of peptides = 3 || unambiguous || 99.6% Confident
CAP1_MOUSE - (P40124) Adenylyl cyclase-associated protein 1 (CAP 1) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9ER68 - (Q9ER68) CysRS protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q91YL6 - (Q91YL6) Hypothetical 34.0 kDa protein || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9JJH0 - (Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase || Number of peptides = 2 || ambiguous || 99.6% Confident
RHOA_MOUSE - (Q9QUI0) Transforming protein RhoA || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9QYS9 - (Q9QYS9) QKI-5 protein || Number of peptides = 2 || ambiguous || 99.6% Confident
TRXB_MOUSE - (Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR) || Number of peptides = 2 || unambiguous || 99.6% Confident
MDHC_MOUSE - (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) || Number of peptides = 4 || ambiguous || 99.6% Confident
IDE_HUMAN - (P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 1 || unambiguous || 99.6% Confident
ACLY_MOUSE - (Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q99LE7 - (Q99LE7) Similar to paxillin (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
PRS4_HUMAN - (Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q91VW3 - (Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3 || Number of peptides = 2 || unambiguous || 99.6% Confident
IF6_MOUSE - (O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP)) || Number of peptides = 1 || ambiguous || 99.6% Confident
ST13_MOUSE - (Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) || Number of peptides = 1 || ambiguous || 99.6% Confident
O88738 - (O88738) Ubiquitin-conjugating enzyme || Number of peptides = 1 || unambiguous || 99.6% Confident
A1B1_MOUSE - (O35643) Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta large chain) || Number of peptides = 1 || unambiguous || 99.6% Confident
TBA1_HUMAN - (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) || Number of peptides = 19 || ambiguous || 99.6% Confident
IRE1_MOUSE - (P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) || Number of peptides = 4 || ambiguous || 99.6% Confident
COF1_MOUSE - (P18760) Cofilin, non-muscle isoform || Number of peptides = 22 || unambiguous || 99.6% Confident
SAHH_MOUSE - (P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) || Number of peptides = 2 || unambiguous || 99.6% Confident
PDL1_MOUSE - (O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) || Number of peptides = 1 || ambiguous || 99.6% Confident
GC1_MOUSE - (P01868) Ig gamma-1 chain C region || Number of peptides = 3 || ambiguous || 99.6% Confident
CYTB_MOUSE - (Q62426) Cystatin B (Stefin B) || Number of peptides = 2 || unambiguous || 99.6% Confident
TKT_MOUSE - (P40142) Transketolase (EC 2.2.1.1) (TK) (P68) || Number of peptides = 16 || unambiguous || 99.6% Confident
TCPD_MOUSE - (P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9NRF8 - (Q9NRF8) CTP synthetase isoform (EC 6.3.4.2) || Number of peptides = 1 || ambiguous || 99.6% Confident
ALFA_MOUSE - (P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) || Number of peptides = 9 || unambiguous || 99.6% Confident
PSD1_HUMAN - (Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) || Number of peptides = 1 || unambiguous || 99.6% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 11 || unambiguous || 99.6% Confident
HBA_HUMAN - (P01922) Hemoglobin alpha chain || Number of peptides = 13 || unambiguous || 99.6% Confident
RAN_HUMAN - (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) || Number of peptides = 6 || ambiguous || 99.6% Confident
PCB1_HUMAN - (Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) || Number of peptides = 1 || unambiguous || 99.6% Confident
K22E_HUMAN - (P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9DCC4 - (Q9DCC4) 1110058B13Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q8VCC9 - (Q8VCC9) Similar to spondin 1a || Number of peptides = 1 || ambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 13 || ambiguous || 99.6% Confident
DPY2_MOUSE - (O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) || Number of peptides = 9 || unambiguous || 99.6% Confident
O54807 - (O54807) Ankhzn protein || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9DCZ7 - (Q9DCZ7) WD40 protein Ciao1 || Number of peptides = 2 || ambiguous || 99.6% Confident
BUB3_MOUSE - (Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9D096 - (Q9D096) 2610034N03Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
VTDB_MOUSE - (P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q8VCM7 - (Q8VCM7) Similar to fibrinogen, gamma polypeptide || Number of peptides = 3 || ambiguous || 99.6% Confident
Q91VC7 - (Q91VC7) PKC-potentiated PP1 inhibitory protein (RIKEN cDNA 1110001M11 gene) || Number of peptides = 1 || unambiguous || 99.6% Confident
APA4_MOUSE - (P06728) Apolipoprotein A-IV precursor (Apo-AIV) || Number of peptides = 3 || unambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 42 || unambiguous || 99.6% Confident
Q9DCG9 - (Q9DCG9) 0610038D11Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9DD21 - (Q9DD21) 0610006A11Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
GFA1_MOUSE - (P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) || Number of peptides = 4 || unambiguous || 99.6% Confident
ARF1_HUMAN - (P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 || Number of peptides = 4 || ambiguous || 99.6% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 15 || ambiguous || 99.6% Confident
O89112 - (O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9CR86 - (Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q91VC3 - (Q91VC3) Unknown (Protein for MGC:6715) (Hypothetical 46.8 kDa protein) || Number of peptides = 1 || ambiguous || 99.6% Confident
AR20_HUMAN - (O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4) (O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4) || Number of peptides = 4 || ambiguous || 99.6% Confident
SAD1_MOUSE - (Q60710) SAM domain and HD domain-containing protein 1 (Interferon-gamma inducible protein Mg11) || Number of peptides = 1 || unambiguous || 99.6% Confident
TCPZ_MOUSE - (P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) || Number of peptides = 6 || unambiguous || 99.6% Confident
UBA1_MOUSE - (Q02053) Ubiquitin-activating enzyme E1 1 || Number of peptides = 9 || unambiguous || 99.6% Confident
PAK2_HUMAN - (Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) || Number of peptides = 7 || unambiguous || 99.6% Confident
PMG1_MOUSE - (Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9D910 - (Q9D910) 1810013B01Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
ATPB_MOUSE - (P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 1 || ambiguous || 99.6% Confident
A1T3_MOUSE - (Q00896) Alpha-1-antitrypsin 1-3 precursor (Serine protease inhibitor 1-3) (Alpha-1 protease inhibitor 3) || Number of peptides = 11 || ambiguous || 99.6% Confident
DYNA_MOUSE - (O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) || Number of peptides = 3 || unambiguous || 99.6% Confident
PUA2_MOUSE - (P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase) || Number of peptides = 2 || ambiguous || 99.6% Confident
SRC8_MOUSE - (Q60598) Src substrate cortactin || Number of peptides = 1 || ambiguous || 99.6% Confident
A2MG_MOUSE - (Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) || Number of peptides = 7 || unambiguous || 99.6% Confident
PPS1_MOUSE - (Q60967) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1 (PAPS synthethase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (Sulfate adenylate transferase) (SAT) (ATP-sulfurylase); Adenylylsulfate kinase (EC 2.7.1.25) (Adenylylsulfate 3'-phosphotransferase) (APS kinase) (Adenosine-5'-phosphosulfate 3'-phosphotransferase) (3'-phosphoadenosine-5'-phosphosulfate synthetase)] || Number of peptides = 2 || ambiguous || 99.6% Confident
O88306 - (O88306) DJ-1 || Number of peptides = 4 || ambiguous || 99.6% Confident
HS74_MOUSE - (Q61316) Heat shock 70-related protein APG-2 || Number of peptides = 1 || unambiguous || 99.6% Confident
URL1_HUMAN - (Q9NWZ5) Uridine kinase-like 1 || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9Z1R2 - (Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CZ56 - (Q9CZ56) 2810405J23Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9CT05 - (Q9CT05) 2610027H02Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CYX9 - (Q9CYX9) 2810431D22Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9DAS8 - (Q9DAS8) 1600029N02Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
PSDB_HUMAN - (O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) || Number of peptides = 1 || unambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 11 || ambiguous || 99.6% Confident
Q9D8X5 - (Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) || Number of peptides = 19 || ambiguous || 99.6% Confident
SPEE_HUMAN - (P19623) Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) || Number of peptides = 2 || unambiguous || 99.6% Confident
TBCA_MOUSE - (P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9QYB1 - (Q9QYB1) Intracellular chloride channel protein || Number of peptides = 2 || unambiguous || 99.6% Confident
WDR1_MOUSE - (O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q91YR5 - (Q91YR5) Hypothetical 78.8 kDa protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D6F9 - (Q9D6F9) Tubulin, beta 4 || Number of peptides = 1 || ambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 8 || ambiguous || 99.6% Confident
TCPY_MOUSE - (Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) || Number of peptides = 1 || unambiguous || 99.6% Confident
HS9B_MOUSE - (P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) || Number of peptides = 10 || unambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 65 || unambiguous || 99.6% Confident
O08795 - (O08795) Alpha glucosidase II, beta subunit || Number of peptides = 2 || ambiguous || 99.6% Confident
EZRI_MOUSE - (P26040) Ezrin (p81) (Cytovillin) (Villin 2) || Number of peptides = 7 || ambiguous || 99.6% Confident
PDX4_MOUSE - (O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) || Number of peptides = 2 || unambiguous || 99.6% Confident
STA3_MOUSE - (P42227) Signal transducer and activator of transcription 3 (Acute-phase response factor) || Number of peptides = 2 || ambiguous || 99.6% Confident
ITH2_MOUSE - (Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q8VDP3 - (Q8VDP3) Similar to hypothetical protein FLJ11937 || Number of peptides = 1 || unambiguous || 99.6% Confident
FKB4_MOUSE - (P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9CST4 - (Q9CST4) 5830445C04Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
GBLP_HUMAN - (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) || Number of peptides = 1 || ambiguous || 99.6% Confident
HNT1_MOUSE - (P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9CWE4 - (Q9CWE4) 2410153K17Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
Q91ZP1 - (Q91ZP1) Fibrinogen B-beta-chain (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
DHCA_MOUSE - (P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
THIO_MOUSE - (P10639) Thioredoxin (ATL-derived factor) (ADF) || Number of peptides = 19 || unambiguous || 99.6% Confident
HBB0_MOUSE - (P04443) Hemoglobin beta-H0 chain || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9D7P7 - (Q9D7P7) 2300003G24Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
HS9A_MOUSE - (P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) || Number of peptides = 9 || unambiguous || 99.6% Confident
RET1_MOUSE - (Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI) || Number of peptides = 1 || ambiguous || 99.6% Confident
DYHC_MOUSE - (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) || Number of peptides = 8 || unambiguous || 99.6% Confident
143Z_MOUSE - (P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q8VDD5 - (Q8VDD5) Nonmuscle heavy chain myosin II-A || Number of peptides = 3 || unambiguous || 99.6% Confident
Q8R016 - (Q8R016) Similar to bleomycin hydrolase || Number of peptides = 4 || unambiguous || 99.6% Confident
ANX5_MOUSE - (P48036) Annexin V (Lipocortin V) (Endonexin II) (Calphobindin I) (CBP-I) (Placental anticoagulant protein I) (PAP-I) (PP4) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) (Anchorin CII) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9Z0P5 - (Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) || Number of peptides = 2 || ambiguous || 99.6% Confident
TALI_MOUSE - (P26039) Talin || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9D7Y0 - (Q9D7Y0) Bisphosphate 3'-nucleotidase 1 || Number of peptides = 1 || ambiguous || 99.6% Confident
O08817 - (O08817) CW17 protein || Number of peptides = 2 || ambiguous || 99.6% Confident
Q921Q5 - (Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1 || Number of peptides = 1 || unambiguous || 99.6% Confident
PLSL_MOUSE - (Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65) || Number of peptides = 2 || unambiguous || 99.6% Confident
P97825 - (P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) || Number of peptides = 2 || unambiguous || 99.6% Confident
PMGE_HUMAN - (P07738) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM) || Number of peptides = 2 || unambiguous || 99.6% Confident
UBC7_HUMAN - (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) || Number of peptides = 5 || ambiguous || 99.6% Confident
WDR1_HUMAN - (O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1) || Number of peptides = 2 || unambiguous || 99.6% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 8 || unambiguous || 99.6% Confident
ACF7_MOUSE - (Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) || Number of peptides = 7 || unambiguous || 99.6% Confident
ENOA_MOUSE - (P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) || Number of peptides = 33 || unambiguous || 99.6% Confident
TBA6_MOUSE - (P05216) Tubulin alpha-6 chain (Alpha-tubulin 6) || Number of peptides = 1 || ambiguous || 99.6% Confident
PGK1_MOUSE - (P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) || Number of peptides = 10 || unambiguous || 99.6% Confident
EF1G_MOUSE - (Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) || Number of peptides = 2 || unambiguous || 99.6% Confident
A1T2_MOUSE - (P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 14 || ambiguous || 99.6% Confident
FCL_MOUSE - (P23591) GDP-fucose synthetase (FX protein) (Red cell NADP(H)-binding protein) (Transplantation antigen P35B) (Tum-P35B antigen) [Includes: GDP-mannose-4-keto-6-D epimerase (EC 5.1.3.-); GDP-4-keto-6-L-galactose reductase (EC 1.-.-.-)] || Number of peptides = 1 || unambiguous || 99.6% Confident
LKHA_MOUSE - (P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 6 || unambiguous || 99.6% Confident
O94888 - (O94888) Hypothetical protein KIAA0794 (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
HEM3_MOUSE - (P22907) Porphobilinogen deaminase (EC 4.3.1.8) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) (PBG-D) || Number of peptides = 1 || unambiguous || 99.6% Confident
CAZ1_MOUSE - (P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D4Y8 - (Q9D4Y8) 4930538K18Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9D892 - (Q9D892) 2010016I08Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
EML4_HUMAN - (Q9HC35) Echinoderm microtubule-associated protein-like 4 (EMAP-4) (Restrictedly overexpressed proliferation-associated protein) (Ropp 120) || Number of peptides = 1 || unambiguous || 99.6% Confident
DCUP_MOUSE - (P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q99KS1 - (Q99KS1) Hypothetical 16.5 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9CRE7 - (Q9CRE7) 2410174K12Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q99L20 - (Q99L20) Similar to glutathione S-transferase theta 1 || Number of peptides = 1 || unambiguous || 99.6% Confident
CABA_MOUSE - (Q99020) CARG-binding factor-A (CBF-A) || Number of peptides = 3 || unambiguous || 99.6% Confident
COTR_MOUSE - (P07759) Contrapsin precursor || Number of peptides = 1 || ambiguous || 99.6% Confident
FAS_MOUSE - (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) || Number of peptides = 6 || unambiguous || 99.6% Confident
DYI2_MOUSE - (O88487) Dynein intermediate chain 2, cytosolic (DH IC-2) (Cytoplasmic dynein intermediate chain 2) || Number of peptides = 3 || unambiguous || 99.6% Confident
PHS_HUMAN - (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q8R5F2 - (Q8R5F2) Hypothetical 31.3 kDa protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D3B7 - (Q9D3B7) 6330404L05Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
NDKA_MOUSE - (P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) || Number of peptides = 2 || unambiguous || 99.6% Confident
ASNS_MOUSE - (Q61024) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Glutamine-dependent asparagine synthetase) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9CZK1 - (Q9CZK1) 1300012C15Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
SODC_MOUSE - (P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) || Number of peptides = 2 || unambiguous || 99.6% Confident
CO3_MOUSE - (P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] || Number of peptides = 3 || unambiguous || 99.6% Confident
VAB2_MOUSE - (P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) || Number of peptides = 3 || ambiguous || 99.6% Confident
PE15_MOUSE - (Q62048) Astrocytic phosphoprotein PEA-15 || Number of peptides = 1 || ambiguous || 99.6% Confident
FETA_MOUSE - (P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) || Number of peptides = 71 || unambiguous || 99.6% Confident
HBAZ_MOUSE - (P06467) Hemoglobin zeta chain || Number of peptides = 3 || unambiguous || 99.6% Confident
K6A3_MOUSE - (P18654) Ribosomal protein S6 kinase alpha 3 (EC 2.7.1.-) (S6K-alpha 3) (90 kDa ribosomal protein S6 kinase 3) (p90-RSK 3) (Ribosomal S6 kinase 2) (RSK-2) (pp90RSK2) (Protein-tyrosine kinase MPK-9) (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q922P1 - (Q922P1) RIKEN cDNA 2010012F05 gene || Number of peptides = 5 || ambiguous || 99.6% Confident
SERA_MOUSE - (Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
TRFE_MOUSE - (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) || Number of peptides = 33 || unambiguous || 99.6% Confident
Q99KD0 - (Q99KD0) Hypothetical 24.4 kDa protein (Fragment) || Number of peptides = 2 || ambiguous || 99.6% Confident
TES_MOUSE - (P47226) Testin (TES1/TES2) || Number of peptides = 1 || ambiguous || 99.6% Confident
ITH3_MOUSE - (Q61704) Inter-alpha-trypsin inhibitor heavy chain H3 precursor (ITI heavy chain H3) || Number of peptides = 2 || unambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 2 || unambiguous || 99.6% Confident
MCM6_MOUSE - (P97311) DNA replication licensing factor MCM6 (Mis5 homolog) || Number of peptides = 2 || unambiguous || 99.6% Confident
PEBP_MOUSE - (P70296) Phosphatidylethanolamine-binding protein (PEBP) || Number of peptides = 3 || unambiguous || 99.6% Confident
AOP2_MOUSE - (O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) || Number of peptides = 4 || ambiguous || 99.6% Confident
GTM5_MOUSE - (P48774) Glutathione S-transferase Mu 5 (EC 2.5.1.18) (GST class-mu 5) (Fibrous sheath component 2) (Fsc2) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 11 || ambiguous || 99.6% Confident
Q8R3V9 - (Q8R3V9) Hypothetical 52.0 kDa protein || Number of peptides = 3 || unambiguous || 99.6% Confident
ATPA_MOUSE - (Q03265) ATP synthase alpha chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 1 || unambiguous || 99.6% Confident
143E_HUMAN - (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) || Number of peptides = 5 || ambiguous || 99.6% Confident
HXB3_MOUSE - (P09026) Homeobox protein Hox-B3 (Hox-2.7) (MH-23) || Number of peptides = 17 || unambiguous || 99.6% Confident
O89055 - (O89055) Nonmuscle myosin heavy chain-A (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
G6PI_MOUSE - (P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9ESF7 - (Q9ESF7) Sep2 (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9Z1F9 - (Q9Z1F9) ARX || Number of peptides = 2 || unambiguous || 99.6% Confident
ICAL_MOUSE - (P51125) Calpain inhibitor (Calpastatin) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q8R1H0 - (Q8R1H0) Hypothetical 8.3 kDa protein || Number of peptides = 1 || unambiguous || 99.6% Confident
FKB3_MOUSE - (Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) || Number of peptides = 2 || unambiguous || 99.6% Confident
A2HS_MOUSE - (P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q9D4G6 - (Q9D4G6) 4932434F09Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
DD15_MOUSE - (O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15) || Number of peptides = 1 || ambiguous || 99.6% Confident
FKB1_MOUSE - (P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) || Number of peptides = 1 || ambiguous || 99.6% Confident
PPI1_MOUSE - (P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) || Number of peptides = 1 || ambiguous || 99.6% Confident
XDH_MOUSE - (Q00519) Xanthine dehydrogenase/oxidase [Includes: Xanthine dehydrogenase (EC 1.1.1.204) (XD); Xanthine oxidase (EC 1.1.3.22) (XO) (Xanthine oxidoreductase)] || Number of peptides = 1 || unambiguous || 99.6% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 2 || ambiguous || 99.6% Confident
ADFP_HUMAN - (Q99541) Adipophilin (Adipose differentiation-related protein) (ADRP) || Number of peptides = 1 || unambiguous || 99.6% Confident
ZYX_MOUSE - (Q62523) Zyxin || Number of peptides = 1 || unambiguous || 99.6% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 6 || unambiguous || 99.6% Confident
NTF2_HUMAN - (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) || Number of peptides = 3 || ambiguous || 99.6% Confident
GDIR_MOUSE - (Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) || Number of peptides = 4 || unambiguous || 99.6% Confident
MCM2_MOUSE - (P97310) DNA replication licensing factor MCM2 || Number of peptides = 3 || unambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 62 || ambiguous || 99.6% Confident
PHS3_HUMAN - (P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) || Number of peptides = 1 || unambiguous || 99.6% Confident
VAA1_MOUSE - (P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CXT4 - (Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence || Number of peptides = 4 || ambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 121 || unambiguous || 99.6% Confident
NED4_MOUSE - (P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9CRK7 - (Q9CRK7) 9430095H01Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 99.6% Confident
PUR9_MOUSE - (Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] || Number of peptides = 4 || unambiguous || 99.6% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 55 || unambiguous || 99.6% Confident
143B_MOUSE - (Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 9 || unambiguous || 99.6% Confident
FABE_MOUSE - (Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q8VCI5 - (Q8VCI5) Peroxisomal farnesylated protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9D9F9 - (Q9D9F9) C330027I04Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
IF5A_HUMAN - (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) || Number of peptides = 11 || ambiguous || 99.6% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 33 || unambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 46 || ambiguous || 99.6% Confident
PDX1_MOUSE - (P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) || Number of peptides = 6 || unambiguous || 99.6% Confident
K2C1_HUMAN - (P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) || Number of peptides = 1 || unambiguous || 99.6% Confident
ILK1_HUMAN - (Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) || Number of peptides = 1 || ambiguous || 99.6% Confident
2AAA_HUMAN - (P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) || Number of peptides = 2 || ambiguous || 99.6% Confident
RAC1_HUMAN - (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q8R5B9 - (Q8R5B9) Hypothetical 33.2 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
CLH1_HUMAN - (Q00610) Clathrin heavy chain 1 (CLH-17) || Number of peptides = 8 || unambiguous || 99.6% Confident
ADHA_MOUSE - (P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) || Number of peptides = 17 || unambiguous || 99.6% Confident
Q9D7B2 - (Q9D7B2) 2310016J22Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
TCPH_MOUSE - (P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) || Number of peptides = 5 || unambiguous || 99.6% Confident
IQG1_MOUSE - (Q9JKF1) Ras GTPase-activating-like protein IQGAP1 || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 4 || unambiguous || 99.6% Confident
HBD_HUMAN - (P02042) Hemoglobin delta chain || Number of peptides = 13 || unambiguous || 99.6% Confident
PIMT_MOUSE - (P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) || Number of peptides = 4 || ambiguous || 99.6% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 25 || unambiguous || 99.6% Confident
K6PL_MOUSE - (P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) || Number of peptides = 3 || unambiguous || 99.6% Confident
CA14_MOUSE - (P02463) Collagen alpha 1(IV) chain precursor || Number of peptides = 1 || unambiguous || 99.6% Confident
PDX2_MOUSE - (Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) || Number of peptides = 4 || unambiguous || 99.6% Confident
HS71_MOUSE - (P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q925K4 - (Q925K4) Copine 1 protein (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9NYE5 - (Q9NYE5) Gamma-filamin || Number of peptides = 1 || ambiguous || 99.6% Confident
TPIS_MOUSE - (P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) || Number of peptides = 7 || unambiguous || 99.6% Confident
ANX1_MOUSE - (P10107) Annexin I (Lipocortin I) (Calpactin II) (Chromobindin 9) (P35) (Phospholipase A2 inhibitory protein) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9DCL8 - (Q9DCL8) 0610025N14Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
G25B_HUMAN - (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) || Number of peptides = 1 || ambiguous || 99.6% Confident
TAGL_MOUSE - (P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27) || Number of peptides = 1 || ambiguous || 99.6% Confident
A1T1_MOUSE - (P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 12 || ambiguous || 99.6% Confident
LIS1_MOUSE - (P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9CXA2 - (Q9CXA2) 2810055F11Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
KPYR_MOUSE - (P53657) Pyruvate kinase, isozymes R/L (EC 2.7.1.40) (L-PK) || Number of peptides = 2 || unambiguous || 99.6% Confident
HBB2_MOUSE - (P02089) Hemoglobin beta-2 chain (B2) (Minor) || Number of peptides = 17 || unambiguous || 99.6% Confident
GTA4_MOUSE - (P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q99K88 - (Q99K88) Hypothetical 38.1 kDa protein || Number of peptides = 2 || ambiguous || 99.6% Confident
CAZ2_MOUSE - (P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9D1P4 - (Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) || Number of peptides = 3 || unambiguous || 99.6% Confident
ALDR_MOUSE - (P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) || Number of peptides = 4 || ambiguous || 99.6% Confident
BAG3_MOUSE - (Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) || Number of peptides = 1 || unambiguous || 99.6% Confident
A2A2_MOUSE - (P17427) Adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) || Number of peptides = 1 || ambiguous || 99.6% Confident
O54988 - (O54988) Serine/threonine protein kinase || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CTB9 - (Q9CTB9) 1110030K07Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9BW18 - (Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit || Number of peptides = 1 || ambiguous || 99.6% Confident
O55181 - (O55181) RBP associated molecule RAM14-1 || Number of peptides = 5 || unambiguous || 99.5% Confident
PYR1_HUMAN - (P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] || Number of peptides = 3 || unambiguous || 99.5% Confident
PAC2_MOUSE - (Q9WVE8) Protein kinase C and casein kinase substrate in neurons protein 2 || Number of peptides = 1 || ambiguous || 99.5% Confident
Q93052 - (Q93052) LIPOMA PREFERRED partner (LPP) || Number of peptides = 3 || unambiguous || 99.5% Confident
Q9D6E6 - (Q9D6E6) 2900073G15Rik protein || Number of peptides = 1 || unambiguous || 99.5% Confident
PSA1_MOUSE - (Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) || Number of peptides = 2 || ambiguous || 99.5% Confident
CAH2_MOUSE - (P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) || Number of peptides = 7 || ambiguous || 99.5% Confident
CUL1_MOUSE - (Q9WTX6) Cullin homolog 1 (CUL-1) || Number of peptides = 2 || ambiguous || 99.5% Confident
MCM3_MOUSE - (P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) || Number of peptides = 2 || unambiguous || 99.5% Confident
SYD_MOUSE - (Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) || Number of peptides = 5 || ambiguous || 99.5% Confident
O88701 - (O88701) Nucleosome assembly protein 1-like protein 4 || Number of peptides = 1 || unambiguous || 99.5% Confident
PRS8_HUMAN - (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) || Number of peptides = 2 || ambiguous || 99.5% Confident
Q921M5 - (Q921M5) Unknown (Protein for IMAGE:3597757) (Fragment) || Number of peptides = 1 || unambiguous || 99.4% Confident
PRO1_MOUSE - (P10924) Profilin I || Number of peptides = 4 || unambiguous || 99.4% Confident
O88558 - (O88558) SHYC || Number of peptides = 2 || ambiguous || 99.4% Confident
Q924P4 - (Q924P4) Ribonuclease/angiogenesis inhibitor || Number of peptides = 1 || ambiguous || 99.4% Confident
TRAL_MOUSE - (Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) || Number of peptides = 2 || unambiguous || 99.4% Confident
TAL1_MOUSE - (Q93092) Transaldolase (EC 2.2.1.2) || Number of peptides = 2 || unambiguous || 99.4% Confident
P70445 - (P70445) PHAS-II (Eukaryotic translation initiation factor 4E binding protein 2) || Number of peptides = 1 || unambiguous || 99.4% Confident
P97315 - (P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) || Number of peptides = 3 || ambiguous || 99.4% Confident
VINC_MOUSE - (Q64727) Vinculin (Metavinculin) || Number of peptides = 4 || unambiguous || 99.4% Confident
STRN_MOUSE - (O55106) Striatin || Number of peptides = 3 || unambiguous || 99.4% Confident
Q60817 - (Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) || Number of peptides = 1 || ambiguous || 99.4% Confident
O70379 - (O70379) Thioredoxin-related protein || Number of peptides = 1 || unambiguous || 99.4% Confident
PCB2_MOUSE - (Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) || Number of peptides = 1 || ambiguous || 99.4% Confident
Q9D1L4 - (Q9D1L4) 0610039D01Rik protein (RIKEN cDNA 0610039D01 gene) || Number of peptides = 1 || unambiguous || 99.4% Confident
GDE_HUMAN - (P35573) Glycogen debranching enzyme (Glycogen debrancher) [Includes: 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (EC 3.2.1.33) (Amylo-1,6-glucosidase) (Dextrin 6-alpha-D-glucosidase)] || Number of peptides = 2 || unambiguous || 99.4% Confident
TF1B_MOUSE - (Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) || Number of peptides = 1 || unambiguous || 99.4% Confident
O09132 - (O09132) A6 gene product || Number of peptides = 1 || ambiguous || 99.4% Confident
Q9DCY2 - (Q9DCY2) 2310045J23Rik protein || Number of peptides = 1 || ambiguous || 99.4% Confident
QOR_MOUSE - (P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin) || Number of peptides = 1 || unambiguous || 99.4% Confident
APA1_MOUSE - (Q00623) Apolipoprotein A-I precursor (Apo-AI) || Number of peptides = 7 || unambiguous || 99.3% Confident
Q9CXZ2 - (Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence || Number of peptides = 6 || unambiguous || 99.3% Confident
MAP4_MOUSE - (P27546) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 3 || unambiguous || 99.3% Confident
Q9D071 - (Q9D071) 2610042O15Rik protein || Number of peptides = 1 || unambiguous || 99.3% Confident
Q9D6U5 - (Q9D6U5) 2310057C03Rik protein || Number of peptides = 1 || ambiguous || 99.3% Confident
Q9D436 - (Q9D436) 2610529H08Rik protein || Number of peptides = 1 || ambiguous || 99.3% Confident
MY9B_HUMAN - (Q13459) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 1 || unambiguous || 99.2% Confident
TCP1_MOUSE - (P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) || Number of peptides = 3 || ambiguous || 99.2% Confident
SEP2_MOUSE - (P42208) Septin 2 (NEDD5 protein) || Number of peptides = 3 || ambiguous || 99.2% Confident
SEP7_MOUSE - (O55131) Septin 7 (CDC10 protein homolog) || Number of peptides = 1 || ambiguous || 99.2% Confident
Q62009 - (Q62009) Osteoblast specific factor 2 precursor (OSF-2) || Number of peptides = 1 || unambiguous || 99.2% Confident
TERA_MOUSE - (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] || Number of peptides = 6 || ambiguous || 99.2% Confident
LGUL_MOUSE - (Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) || Number of peptides = 2 || ambiguous || 99.2% Confident
Q9Z1Y4 - (Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) || Number of peptides = 1 || unambiguous || 99.2% Confident
HBE_MOUSE - (P02104) Hemoglobin epsilon-Y2 chain || Number of peptides = 3 || ambiguous || 99.2% Confident
Q8VED5 - (Q8VED5) Similar to keratin 6A (Fragment) || Number of peptides = 1 || unambiguous || 99.2% Confident
PDA4_MOUSE - (P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) || Number of peptides = 1 || unambiguous || 99.1% Confident
ARI1_MOUSE - (Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment) || Number of peptides = 1 || ambiguous || 99.1% Confident
CAPB_MOUSE - (P47757) F-actin capping protein beta subunit (CapZ beta) || Number of peptides = 3 || ambiguous || 99.1% Confident
PPI2_MOUSE - (P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) || Number of peptides = 2 || ambiguous || 99.1% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 4 || unambiguous || 99.1% Confident
RBB7_MOUSE - (Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7) || Number of peptides = 2 || ambiguous || 99.1% Confident
Q8WVG2 - (Q8WVG2) Similar to KIAA0982 protein || Number of peptides = 1 || unambiguous || 99.1% Confident
Y982_HUMAN - (Q9Y2I8) Hypothetical protein KIAA0982 || Number of peptides = 1 || unambiguous || 99.1% Confident
Q9H2L5 - (Q9H2L5) AD037 || Number of peptides = 1 || unambiguous || 99.1% Confident
Q8VEH5 - (Q8VEH5) Similar to KIAA0766 gene product || Number of peptides = 2 || ambiguous || 99.1% Confident
BIN1_MOUSE - (O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) || Number of peptides = 2 || ambiguous || 99.1% Confident
LEG1_MOUSE - (P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) || Number of peptides = 5 || ambiguous || 99.1% Confident
RBB9_MOUSE - (O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) || Number of peptides = 2 || unambiguous || 99.0% Confident
DHA1_MOUSE - (P24549) Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Aldehyde dehydrogenase, cytosolic) (ALDH class 1) (ALHDII) (ALDH-E1) || Number of peptides = 2 || unambiguous || 99.0% Confident
Q9CWI4 - (Q9CWI4) Esterase 10 || Number of peptides = 2 || unambiguous || 98.9% Confident
KAC_MOUSE - (P01837) Ig kappa chain C region || Number of peptides = 3 || ambiguous || 98.9% Confident
CRKL_MOUSE - (P47941) Crk-like protein || Number of peptides = 1 || unambiguous || 98.9% Confident
CRKL_HUMAN - (P46109) Crk-like protein || Number of peptides = 1 || unambiguous || 98.9% Confident
Q99K86 - (Q99K86) Lutheran blood group (Auberger b antigen included) || Number of peptides = 1 || ambiguous || 98.8% Confident
CLI1_MOUSE - (Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) || Number of peptides = 3 || unambiguous || 98.8% Confident
IF4G_HUMAN - (Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) || Number of peptides = 1 || unambiguous || 98.8% Confident
Q9D7E3 - (Q9D7E3) 2310011M22Rik protein (OVCA2) || Number of peptides = 1 || unambiguous || 98.6% Confident
Q9ERD3 - (Q9ERD3) Telokin || Number of peptides = 2 || unambiguous || 98.6% Confident
Q9CQR6 - (Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit) || Number of peptides = 2 || ambiguous || 98.6% Confident
Q9JHJ3 - (Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) || Number of peptides = 39 || unambiguous || 98.6% Confident
Q9D4H8 - (Q9D4H8) 4932411N15Rik protein || Number of peptides = 2 || unambiguous || 98.6% Confident
MBNL_MOUSE - (Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein) || Number of peptides = 3 || ambiguous || 98.6% Confident
Q96JF0 - (Q96JF0) Hypothetical protein KIAA1877 (Fragment) || Number of peptides = 1 || unambiguous || 98.6% Confident
Q99PL5 - (Q99PL5) Ribosome binding protein 1 (Ribosome receptor protein) (RRp) (P180) || Number of peptides = 2 || unambiguous || 98.6% Confident
IDHC_MOUSE - (O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) || Number of peptides = 1 || ambiguous || 98.6% Confident
Q9CPY0 - (Q9CPY0) 2310037B18Rik protein || Number of peptides = 1 || unambiguous || 98.6% Confident
PTPA_MOUSE - (P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) || Number of peptides = 1 || ambiguous || 98.6% Confident
Q9CQ60 - (Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) || Number of peptides = 1 || unambiguous || 98.5% Confident
IF2A_HUMAN - (P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) || Number of peptides = 1 || unambiguous || 98.5% Confident
ENOB_HUMAN - (P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) || Number of peptides = 2 || unambiguous || 98.5% Confident
AAC1_HUMAN - (P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein) || Number of peptides = 1 || ambiguous || 98.5% Confident
RTC1_MOUSE - (Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase) || Number of peptides = 1 || unambiguous || 98.4% Confident
GIPC_MOUSE - (Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) || Number of peptides = 1 || unambiguous || 98.3% Confident
Q8VBV7 - (Q8VBV7) Hypothetical 23.3 kDa protein (Similar to COP9 homolog) (Expressed sequence AA408242) || Number of peptides = 1 || unambiguous || 98.2% Confident
IF2G_MOUSE - (Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X) || Number of peptides = 1 || ambiguous || 98.1% Confident
Q8VDX0 - (Q8VDX0) Hypothetical 22.6 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 98.1% Confident
Q9CZP1 - (Q9CZP1) 2700038L12Rik protein || Number of peptides = 1 || ambiguous || 98.1% Confident
PTB_MOUSE - (P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) || Number of peptides = 1 || ambiguous || 98.0% Confident
TPP2_MOUSE - (Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) || Number of peptides = 1 || unambiguous || 98.0% Confident
Q91V76 - (Q91V76) Hypothetical 35.0 kDa protein (Unknown) (Protein for MGC:6803) || Number of peptides = 1 || unambiguous || 98.0% Confident
AMPB_MOUSE - (Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV) || Number of peptides = 1 || unambiguous || 98.0% Confident
Q60848 - (Q60848) Lymphocyte specific helicase (Proliferation associated SNF2-like protein) || Number of peptides = 1 || ambiguous || 97.9% Confident
P97412 - (P97412) Lysosomal trafficking regulator (CHS1 homolog) || Number of peptides = 3 || unambiguous || 97.9% Confident
CDNB_MOUSE - (P46414) Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) || Number of peptides = 1 || unambiguous || 97.9% Confident
RSU1_MOUSE - (Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1) || Number of peptides = 1 || ambiguous || 97.9% Confident
K1CJ_HUMAN - (P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) || Number of peptides = 1 || ambiguous || 97.9% Confident
TTHY_MOUSE - (P07309) Transthyretin precursor (Prealbumin) || Number of peptides = 3 || unambiguous || 97.9% Confident
PYRG_MOUSE - (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) || Number of peptides = 1 || unambiguous || 97.9% Confident
Q8WZ42 - (Q8WZ42) Titin || Number of peptides = 2 || ambiguous || 97.8% Confident
Q9Y6V0 - (Q9Y6V0) Piccolo protein (Aczonin) (DJ0897G10.1) (Fragments) || Number of peptides = 1 || unambiguous || 97.8% Confident
MOES_MOUSE - (P26041) Moesin (Membrane-organizing extension spike protein) || Number of peptides = 4 || ambiguous || 97.8% Confident
FUMH_MOUSE - (P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) || Number of peptides = 2 || unambiguous || 97.8% Confident
SBP2_MOUSE - (Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56) || Number of peptides = 2 || ambiguous || 97.8% Confident
PSA4_MOUSE - (Q9R1P0) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome component C9) (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome subunit L) || Number of peptides = 1 || ambiguous || 97.8% Confident
Q9EQR0 - (Q9EQR0) Fatty acid synthase || Number of peptides = 10 || unambiguous || 97.7% Confident
CIW2_MOUSE - (P97438) Potassium channel subfamily K member 2 (Outward rectifying potassium channel protein TREK-1) (Two-pore potassium channel TPKC1) (TREK-1 K+ channel subunit) || Number of peptides = 1 || unambiguous || 97.7% Confident
Q9JJ28 - (Q9JJ28) Fliih protein || Number of peptides = 1 || unambiguous || 97.6% Confident
Q61167 - (Q61167) APC-binding protein EB2 (Fragment) || Number of peptides = 1 || ambiguous || 97.6% Confident
DPY3_MOUSE - (Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein) || Number of peptides = 1 || unambiguous || 97.4% Confident
EHD1_MOUSE - (Q9WVK4) EH-domain containing protein 1 (mPAST1) || Number of peptides = 1 || unambiguous || 97.4% Confident
RB35_HUMAN - (Q15286) Ras-related protein Rab-35 (RAB-1C) (GTP-binding protein RAY) || Number of peptides = 1 || unambiguous || 97.2% Confident
RB1A_HUMAN - (P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein) || Number of peptides = 1 || ambiguous || 97.2% Confident
Q9EQJ5 - (Q9EQJ5) Striated muscle-specific serine/threonine protein kinase || Number of peptides = 1 || unambiguous || 97.2% Confident
PRS6_MOUSE - (P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21) || Number of peptides = 3 || unambiguous || 97.2% Confident
STN1_MOUSE - (P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) || Number of peptides = 1 || unambiguous || 97.2% Confident
LAS1_MOUSE - (Q61792) LIM and SH3 domain protein 1 (LASP-1) (MLN 50) || Number of peptides = 2 || ambiguous || 97.2% Confident
Q9D8S9 - (Q9D8S9) 1810037G04Rik protein || Number of peptides = 1 || unambiguous || 97.2% Confident
PFD1_MOUSE - (Q9CWM4) Prefoldin subunit 1 || Number of peptides = 1 || ambiguous || 97.2% Confident
CDK4_MOUSE - (P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) || Number of peptides = 1 || ambiguous || 97.1% Confident
Q8TDG4 - (Q8TDG4) DNA helicase HEL308 || Number of peptides = 1 || unambiguous || 97.1% Confident
NAL2_HUMAN - (Q9NX02) NACHT-, LRR- and PYD-containing protein 2 (Nucleotide-binding site protein 1) || Number of peptides = 1 || unambiguous || 97.0% Confident
Q96L71 - (Q96L71) ARAP1 || Number of peptides = 1 || unambiguous || 97.0% Confident
ATOX_MOUSE - (O08997) Copper transport protein ATOX1 (Metal transport protein ATX1) || Number of peptides = 1 || unambiguous || 96.9% Confident
Q91VJ3 - (Q91VJ3) Similar to Adenosin kinase || Number of peptides = 2 || unambiguous || 96.9% Confident
Q9CZ44 - (Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence || Number of peptides = 3 || unambiguous || 96.8% Confident
UBPE_MOUSE - (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15) (Ubiquitin thiolesterase 14) (Ubiquitin-specific processing protease 14) (Deubiquitinating enzyme 14) || Number of peptides = 1 || unambiguous || 96.8% Confident
UBCG_HUMAN - (Q99462) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19) (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) (Q99462) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19) (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) || Number of peptides = 1 || ambiguous || 96.8% Confident
Q99K51 - (Q99K51) Hypothetical 70.7 kDa protein || Number of peptides = 1 || unambiguous || 96.8% Confident
GTM2_MOUSE - (P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5) || Number of peptides = 2 || unambiguous || 96.8% Confident
GMDS_HUMAN - (O60547) GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) (GMD) || Number of peptides = 1 || unambiguous || 96.4% Confident
Q96A90 - (Q96A90) G6b-C protein precursor || Number of peptides = 1 || unambiguous || 96.4% Confident
GYG2_HUMAN - (O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) || Number of peptides = 2 || unambiguous || 96.3% Confident
Q9R1D2 - (Q9R1D2) Cyclin-dependent kinase 6 || Number of peptides = 1 || ambiguous || 96.3% Confident
GLYG_MOUSE - (Q9R062) Glycogenin-1 (EC 2.4.1.186) || Number of peptides = 2 || unambiguous || 96.3% Confident
Q9NR99 - (Q9NR99) Adlican || Number of peptides = 4 || unambiguous || 96.3% Confident
Q9D157 - (Q9D157) 0610025K21Rik protein || Number of peptides = 1 || ambiguous || 96.3% Confident
A2M1_HUMAN - (P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain) (P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain) || Number of peptides = 1 || ambiguous || 96.3% Confident
Q9CVL3 - (Q9CVL3) 1810024J13Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 96.3% Confident
Q96QA1 - (Q96QA1) FKSG16 || Number of peptides = 1 || unambiguous || 96.3% Confident
HBB_HUMAN - (P02023) Hemoglobin beta chain || Number of peptides = 2 || unambiguous || 96.2% Confident
CERU_MOUSE - (Q61147) Ceruloplasmin precursor (EC 1.16.3.1) (Ferroxidase) || Number of peptides = 1 || unambiguous || 96.1% Confident
CIA1_HUMAN - (O76071) WD-repeat containing protein Ciao 1 || Number of peptides = 7 || unambiguous || 96.1% Confident
P2CG_MOUSE - (Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13) || Number of peptides = 1 || unambiguous || 96.1% Confident
Q9HCI5 - (Q9HCI5) Hypothetical protein KIAA1587 (Fragment) || Number of peptides = 1 || unambiguous || 96.1% Confident
Q91YD6 - (Q91YD6) Villin-like protein (Fragment) || Number of peptides = 1 || ambiguous || 96.0% Confident
Q9DBF1 - (Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1) || Number of peptides = 2 || unambiguous || 96.0% Confident
Q8TDG3 - (Q8TDG3) Zinc transporter ZTL1 || Number of peptides = 1 || ambiguous || 96.0% Confident
PA1G_MOUSE - (Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) || Number of peptides = 1 || unambiguous || 95.9% Confident
PSA7_MOUSE - (Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1) || Number of peptides = 1 || ambiguous || 95.9% Confident
Q9BVR5 - (Q9BVR5) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 95.8% Confident
GSH1_MOUSE - (P97494) Glutamate--cysteine ligase catalytic subunit (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS heavy chain) || Number of peptides = 1 || ambiguous || 95.8% Confident
DSC2_MOUSE - (P55292) Desmocollin 2A/2B precursor (Epithelial type 2 desmocollin) || Number of peptides = 1 || unambiguous || 95.8% Confident
APA2_MOUSE - (P09813) Apolipoprotein A-II precursor (Apo-AII) || Number of peptides = 2 || unambiguous || 95.7% Confident
Q8WZ73 - (Q8WZ73) Fring || Number of peptides = 1 || unambiguous || 95.7% Confident
SNXC_MOUSE - (O70493) Sorting nexin 12 (SDP8 protein) || Number of peptides = 1 || ambiguous || 95.6% Confident
O14584 - (O14584) WUGSC:H_GS034D21.1 protein (Fragment) || Number of peptides = 1 || unambiguous || 95.6% Confident
Q91YS8 - (Q91YS8) Similar to calcium/calmodulin-dependent protein kinase I || Number of peptides = 1 || ambiguous || 95.6% Confident
DLK_MOUSE - (Q09163) Delta-like protein precursor (DLK) (Preadipocyte factor 1) (Pref-1) (Adipocyte differentiation inhibitor protein) [Contains: Fetal antigen 1 (FA1)] || Number of peptides = 1 || unambiguous || 95.6% Confident
SH3L_MOUSE - (Q9JJU8) SH3 domain-binding glutamic acid-rich-like protein || Number of peptides = 1 || unambiguous || 95.6% Confident
Q9JM14 - (Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C) || Number of peptides = 1 || ambiguous || 95.6% Confident
RECK_HUMAN - (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) || Number of peptides = 1 || unambiguous || 95.5% Confident
LDHB_MOUSE - (P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H) || Number of peptides = 1 || ambiguous || 95.5% Confident
Q8QZU6 - (Q8QZU6) Similar to unknown (Protein for IMAGE:3534875) (Fragment) || Number of peptides = 3 || unambiguous || 95.4% Confident
Q8R2Q7 - (Q8R2Q7) Similar to hypothetical protein FLJ20318 || Number of peptides = 1 || unambiguous || 95.3% Confident
Q9CQM9 - (Q9CQM9) Thioredoxin-like 2 || Number of peptides = 1 || unambiguous || 95.0% Confident
O54865 - (O54865) Soluble guanylate cyclase beta-1 subunit || Number of peptides = 1 || ambiguous || 95.0% Confident
Q91V41 - (Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) || Number of peptides = 1 || ambiguous || 94.9% Confident
LDHA_MOUSE - (P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) || Number of peptides = 4 || unambiguous || 94.9% Confident
IKKB_MOUSE - (O88351) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1.-) (I-kappa-B-kinase beta) (IkBKB) (IKK-beta) (IKK-B) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB) || Number of peptides = 1 || ambiguous || 94.9% Confident
K1CS_MOUSE - (P19001) Keratin, type I cytoskeletal 19 (Cytokeratin 19) (K19) (CK 19) || Number of peptides = 1 || unambiguous || 94.9% Confident
GELS_MOUSE - (P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) || Number of peptides = 3 || unambiguous || 94.9% Confident
Q9CQF3 - (Q9CQF3) 3110048P04Rik protein (RIKEN cDNA 3110048P04 gene) || Number of peptides = 1 || ambiguous || 94.9% Confident
HP28_HUMAN - (Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) || Number of peptides = 1 || unambiguous || 94.9% Confident
O75152 - (O75152) Hypothetical protein KIAA0663 || Number of peptides = 1 || unambiguous || 94.9% Confident
Q9DBC7 - (Q9DBC7) 1300018C22Rik protein (Protein kinase, cAMP dependent regulatory, type 1, alpha) (RIKEN cDNA 1300018C22 gene) || Number of peptides = 2 || unambiguous || 94.9% Confident
P2CB_MOUSE - (P36993) Protein phosphatase 2C beta isoform (EC 3.1.3.16) (PP2C-beta) (IA) (Protein phosphatase 1B) || Number of peptides = 1 || ambiguous || 94.8% Confident
PLSI_HUMAN - (Q14651) I-plastin (Intestine-specific plastin) || Number of peptides = 5 || unambiguous || 94.7% Confident
Q96P88 - (Q96P88) Type II gonadotropin-releasing hormone receptor (Fragment) || Number of peptides = 1 || unambiguous || 94.7% Confident
Q9JII6 - (Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase) || Number of peptides = 3 || unambiguous || 94.6% Confident
Q924V8 - (Q924V8) Carboxylesterase MH1 (EC 3.1.1.1) || Number of peptides = 1 || unambiguous || 94.6% Confident
Q8WUC7 - (Q8WUC7) Hypothetical protein (Fragment) || Number of peptides = 4 || unambiguous || 94.6% Confident
Q9DBD0 - (Q9DBD0) 1300017J02Rik protein || Number of peptides = 1 || unambiguous || 94.6% Confident
Q9P0H7 - (Q9P0H7) TIP120 protein || Number of peptides = 1 || ambiguous || 94.6% Confident
Q9ULK8 - (Q9ULK8) Hypothetical protein KIAA1212 (Fragment) || Number of peptides = 1 || unambiguous || 94.5% Confident
Q9D633 - (Q9D633) 4833403I15Rik protein || Number of peptides = 2 || unambiguous || 94.5% Confident
ZF95_MOUSE - (Q9Z1D8) Zinc finger protein 95 (Zfp-95) || Number of peptides = 1 || unambiguous || 94.4% Confident
HMG4_MOUSE - (O54879) High mobility group protein 4 (HMG-4) (High mobility group protein 2a) (HMG-2a) || Number of peptides = 1 || ambiguous || 94.3% Confident
Q9H857 - (Q9H857) Hypothetical protein FLJ13933 || Number of peptides = 1 || unambiguous || 94.3% Confident
O15469 - (O15469) Monocyte inhibitory receptor precursor || Number of peptides = 1 || unambiguous || 94.3% Confident
PSPB_MOUSE - (P50405) Pulmonary surfactant-associated protein B precursor (SP-B) (Pulmonary surfactant-associated proteolipid SPL(Phe)) || Number of peptides = 3 || unambiguous || 94.3% Confident
Q8VFK8 - (Q8VFK8) Olfactory receptor MOR201-1 || Number of peptides = 1 || unambiguous || 94.1% Confident
M3K3_MOUSE - (Q61084) Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.1.-) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) || Number of peptides = 1 || unambiguous || 94.0% Confident
FSC1_HUMAN - (Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) || Number of peptides = 1 || ambiguous || 93.9% Confident
ENOG_MOUSE - (P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2) || Number of peptides = 2 || ambiguous || 93.8% Confident
Q922D8 - (Q922D8) Similar to C1-tetrahydrofolate synthase || Number of peptides = 2 || unambiguous || 93.8% Confident
Q8R0B1 - (Q8R0B1) Similar to gephyrin || Number of peptides = 1 || ambiguous || 93.5% Confident
Q99K30 - (Q99K30) Similar to hypothetical protein FLJ21935 || Number of peptides = 1 || unambiguous || 93.4% Confident
KINH_MOUSE - (Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) || Number of peptides = 1 || ambiguous || 93.4% Confident
2ABA_HUMAN - (Q00007) Serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alpha isoform (PP2A, subunit B, B-alpha isoform) (PP2A, subunit B, B55-alpha isoform) (PP2A, subunit B, PR55-alpha isoform) (PP2A, subunit B, R2-alpha isoform) || Number of peptides = 1 || unambiguous || 93.3% Confident
Q921J0 - (Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) || Number of peptides = 1 || ambiguous || 93.2% Confident
MTAP_MOUSE - (Q9CQ65) 5'-methylthioadenosine phosphorylase (EC 2.4.2.28) (MTA phosphorylase) (MTAPase) || Number of peptides = 2 || unambiguous || 93.2% Confident
COQ6_HUMAN - (Q9Y2Z9) Putative ubiquinone biosynthesis monooxgenase COQ6 (EC 1.14.13.-) (CGI-10) || Number of peptides = 1 || unambiguous || 93.1% Confident
SERC_MOUSE - (Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) || Number of peptides = 1 || unambiguous || 93.0% Confident
Q9DBT2 - (Q9DBT2) 1200014H24Rik protein || Number of peptides = 1 || unambiguous || 93.0% Confident
O35727 - (O35727) Factor XII || Number of peptides = 1 || unambiguous || 93.0% Confident
Q9HD44 - (Q9HD44) Arsenite related gene 1 || Number of peptides = 1 || ambiguous || 92.7% Confident
Q9JIX4 - (Q9JIX4) DNA binding protein DESRT || Number of peptides = 1 || unambiguous || 92.6% Confident
Q9EQ00 - (Q9EQ00) cAMP-dependent protein kinase regulatory subunit || Number of peptides = 1 || unambiguous || 92.6% Confident
Q9D1G1 - (Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) || Number of peptides = 1 || ambiguous || 92.6% Confident
Q9CXN1 - (Q9CXN1) 3110052N05Rik protein || Number of peptides = 1 || ambiguous || 92.6% Confident
CSE1_MOUSE - (Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) || Number of peptides = 2 || ambiguous || 92.5% Confident
Q9EP94 - (Q9EP94) Natural killer cell receptor Ly-49P3 (Natural killer cell receptor Ly49P3 isoform) || Number of peptides = 1 || ambiguous || 92.5% Confident
Q99P31 - (Q99P31) Hsp70 binding protein (RIKEN cDNA 1500019G21 gene) || Number of peptides = 1 || unambiguous || 92.4% Confident
Q9QZM1 - (Q9QZM1) PLIC-1 || Number of peptides = 1 || ambiguous || 92.4% Confident
O88207 - (O88207) Collagen a1(V) || Number of peptides = 1 || unambiguous || 92.3% Confident
KNG_MOUSE - (O08677) Kininogen precursor [Contains: Bradykinin] || Number of peptides = 1 || ambiguous || 92.3% Confident
M1A2_HUMAN - (O60476) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2) || Number of peptides = 1 || ambiguous || 92.2% Confident
Q9HCE9 - (Q9HCE9) Hypothetical protein KIAA1623 (Fragment) || Number of peptides = 1 || unambiguous || 92.2% Confident
O88443 - (O88443) SWAP-70 || Number of peptides = 1 || unambiguous || 92.1% Confident
Q96JH2 - (Q96JH2) Hypothetical protein KIAA1855 (Fragment) || Number of peptides = 1 || unambiguous || 92.1% Confident
FACC_MOUSE - (P50652) Fanconi anemia group C protein homolog (FACC protein) || Number of peptides = 1 || unambiguous || 91.8% Confident
RPA5_MOUSE - (P52432) DNA-directed RNA polymerase I 40 kDa polypeptide (EC 2.7.7.6) (RPA40) || Number of peptides = 1 || ambiguous || 91.8% Confident
PNPH_MOUSE - (P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) || Number of peptides = 1 || ambiguous || 91.5% Confident
Q9BYW2 - (Q9BYW2) Huntingtin interacting protein 1 || Number of peptides = 1 || ambiguous || 91.4% Confident
Q9DBV3 - (Q9DBV3) 1200013B07Rik protein || Number of peptides = 1 || unambiguous || 91.4% Confident
Q969J2 - (Q969J2) P373c6.1 (Novel C2H2 type zinc finger protein) (Similar to hypothetical protein P1 p373c6) || Number of peptides = 1 || unambiguous || 91.1% Confident
O88653 - (O88653) MEK binding partner 1 (Mitogen-activated protein kinase kinase 1 interacting protein 1) || Number of peptides = 1 || unambiguous || 91.1% Confident
PSB2_MOUSE - (Q9R1P3) Proteasome subunit beta type 2 (EC 3.4.25.1) (Proteasome component C7-I) (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I) || Number of peptides = 1 || unambiguous || 91.1% Confident
KAPA_MOUSE - (P05132) cAMP-dependent protein kinase, alpha-catalytic subunit (EC 2.7.1.37) (PKA C-alpha) || Number of peptides = 1 || ambiguous || 91.1% Confident
Q8R1Q8 - (Q8R1Q8) Hypothetical 56.6 kDa protein || Number of peptides = 1 || unambiguous || 91.0% Confident
PFD6_MOUSE - (Q03958) Prefoldin subunit 6 (Protein Ke2) || Number of peptides = 1 || ambiguous || 90.9% Confident
Q9CZT3 - (Q9CZT3) 2610529C04Rik protein || Number of peptides = 1 || unambiguous || 90.9% Confident
PPCE_MOUSE - (Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) || Number of peptides = 1 || ambiguous || 90.8% Confident
FK79_HUMAN - (Q9BXC1) Putative P2Y purinoceptor FKSG79 || Number of peptides = 3 || unambiguous || 90.8% Confident
Q9DAH0 - (Q9DAH0) Four and a half LIM domains 4 || Number of peptides = 1 || ambiguous || 90.6% Confident
O55189 - (O55189) Ameloblastin || Number of peptides = 1 || unambiguous || 90.4% Confident
Y711_HUMAN - (O94819) Hypothetical protein KIAA0711 || Number of peptides = 1 || unambiguous || 90.2% Confident
RADI_MOUSE - (P26043) Radixin || Number of peptides = 3 || ambiguous || 90.2% Confident
O70576 - (O70576) Stag3 protein || Number of peptides = 1 || unambiguous || 90.0% Confident
Q9CRD8 - (Q9CRD8) C330008K14Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 90.0% Confident
NAL1_HUMAN - (Q9C000) NACHT-, LRR- and PYD-containing protein 2 (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) (Caspase recruitment domain protein 7) || Number of peptides = 3 || unambiguous || 90.0% Confident
Q8TEP4 - (Q8TEP4) FLJ00149 protein (Fragment) || Number of peptides = 1 || ambiguous || 89.8% Confident
Q8VCD7 - (Q8VCD7) Similar to gene amplified in squamous cell carcinoma 1 || Number of peptides = 2 || unambiguous || 89.8% Confident
KPCG_MOUSE - (P05697) Protein kinase C, gamma type (EC 2.7.1.-) (PKC-gamma) || Number of peptides = 1 || ambiguous || 89.7% Confident
BRF3_HUMAN - (Q9ULD4) Bromodomain and PHD finger-containing protein 3 (Fragment) || Number of peptides = 1 || unambiguous || 89.6% Confident
Q61627 - (Q61627) Glutamate receptor delta-1 subunit precursor || Number of peptides = 1 || unambiguous || 89.6% Confident
ADK_MOUSE - (P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment) || Number of peptides = 1 || unambiguous || 89.5% Confident
Q8QZT1 - (Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial || Number of peptides = 1 || unambiguous || 89.3% Confident
KEMK_MOUSE - (Q05512) Putative serine/threonine-protein kinase EMK (EC 2.7.1.-) || Number of peptides = 2 || unambiguous || 89.3% Confident
Q9HCE3 - (Q9HCE3) Hypothetical protein KIAA1629 (Zinc finger protein) (Fragment) || Number of peptides = 1 || unambiguous || 89.2% Confident
Q9D135 - (Q9D135) 2300003P22Rik protein || Number of peptides = 1 || unambiguous || 89.1% Confident
PCNA_MOUSE - (P17918) Proliferating cell nuclear antigen (PCNA) (Cyclin) || Number of peptides = 1 || ambiguous || 89.1% Confident
Q9JIX7 - (Q9JIX7) Putative GTP-binding protein || Number of peptides = 2 || ambiguous || 89.1% Confident
Q99LS3 - (Q99LS3) Similar to phosphoserine phosphatase || Number of peptides = 1 || unambiguous || 88.7% Confident
Q99LN2 - (Q99LN2) Hypothetical 39.3 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 88.5% Confident
KF4A_HUMAN - (O95239) Chromosome-associated kinesin KIF4A (Chromokinesin) || Number of peptides = 1 || unambiguous || 88.5% Confident
Q15424 - (Q15424) HSP27 ERE-TATA-binding protein (HET) (Scaffold attachment factor B) || Number of peptides = 1 || unambiguous || 88.5% Confident
Q91WA3 - (Q91WA3) Similar to hypothetical protein FLJ22237 || Number of peptides = 1 || unambiguous || 88.4% Confident
Q9QZY2 - (Q9QZY2) GRIN1 || Number of peptides = 1 || unambiguous || 88.2% Confident
CYPB_MOUSE - (P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) || Number of peptides = 1 || ambiguous || 88.2% Confident
Q9D3K6 - (Q9D3K6) 9130005N14Rik protein || Number of peptides = 1 || ambiguous || 88.1% Confident
CAN2_MOUSE - (O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80) || Number of peptides = 2 || unambiguous || 87.8% Confident
AAC2_MOUSE - (Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) || Number of peptides = 2 || ambiguous || 87.8% Confident
O88840 - (O88840) Mutant fibrillin-1 || Number of peptides = 1 || ambiguous || 87.7% Confident
Q9UQM8 - (Q9UQM8) CGI-44 protein || Number of peptides = 1 || ambiguous || 87.3% Confident
O35195 - (O35195) Putative pheromone receptor (Fragment) || Number of peptides = 1 || unambiguous || 87.2% Confident
DSC2_HUMAN - (Q02487) Desmocollin 2A/2B precursor (Desmosomal glycoprotein II and III) (Desmocollin-3) || Number of peptides = 1 || unambiguous || 87.2% Confident
Q9UPQ3 - (Q9UPQ3) Hypothetical protein KIAA1099 (Centaurin gamma2) || Number of peptides = 1 || unambiguous || 87.2% Confident
METH_HUMAN - (Q99707) 5-methyltetrahydrofolate--homocysteine methyltransferase (EC 2.1.1.13) (Methionine synthase, vitamin-B12 dependent) (MS) || Number of peptides = 1 || unambiguous || 87.1% Confident
CCAA_HUMAN - (O00555) Voltage-dependent P/Q-type calcium channel alpha-1A subunit (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) || Number of peptides = 1 || ambiguous || 87.1% Confident
SWS1_MOUSE - (Q9D8Y0) Swiprosin 1 || Number of peptides = 1 || unambiguous || 87.0% Confident
M3KC_MOUSE - (Q60700) Mitogen-activated protein kinase kinase kinase 12 (EC 2.7.1.37) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK) || Number of peptides = 1 || unambiguous || 86.9% Confident
CC04_MOUSE - (Q9CQX5) Protein C3orf4 homolog || Number of peptides = 1 || unambiguous || 86.8% Confident
Q9HCH0 - (Q9HCH0) Hypothetical protein KIAA1602 (Fragment) || Number of peptides = 1 || ambiguous || 86.6% Confident
Q9R166 - (Q9R166) Zinc finger protein ZFP109 || Number of peptides = 1 || unambiguous || 86.5% Confident
Q9CR16 - (Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) || Number of peptides = 1 || unambiguous || 86.5% Confident
MTPN_MOUSE - (P80144) Myotrophin (V-1 protein) (Granule cell differentiation protein) || Number of peptides = 1 || ambiguous || 86.4% Confident
IC1_MOUSE - (P97290) Plasma protease C1 inhibitor precursor (C1 Inh) (C1Inh) || Number of peptides = 1 || ambiguous || 86.1% Confident
Q9JLG7 - (Q9JLG7) Kiaa0575 || Number of peptides = 1 || unambiguous || 86.0% Confident
Q9Y372 - (Q9Y372) CGI-62 protein || Number of peptides = 1 || ambiguous || 85.7% Confident
AD20_HUMAN - (O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 20) || Number of peptides = 1 || unambiguous || 85.5% Confident
Q13147 - (Q13147) Abl interactor 2 || Number of peptides = 1 || unambiguous || 85.3% Confident
Q9EQ30 - (Q9EQ30) Ran binding protein 5 (Fragment) || Number of peptides = 1 || ambiguous || 85.2% Confident
Q91X94 - (Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) || Number of peptides = 1 || ambiguous || 85.2% Confident
GRA1_MOUSE - (Q64018) Glycine receptor alpha-1 chain precursor (Glycine receptor 48 kDa subunit) (Strychnine binding subunit) || Number of peptides = 1 || unambiguous || 85.1% Confident
Q8VDN3 - (Q8VDN3) Hypothetical 105.2 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 84.7% Confident
CTE1_MOUSE - (O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) || Number of peptides = 1 || ambiguous || 84.7% Confident
PCNT_MOUSE - (P48725) Pericentrin || Number of peptides = 1 || unambiguous || 84.5% Confident
Q9H917 - (Q9H917) Hypothetical protein FLJ13080 || Number of peptides = 1 || unambiguous || 84.5% Confident
PRSX_HUMAN - (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) || Number of peptides = 2 || ambiguous || 84.2% Confident
Q60864 - (Q60864) MSTI1 || Number of peptides = 2 || unambiguous || 84.1% Confident
TYB4_MOUSE - (P20065) Thymosin beta-4 (T beta 4) || Number of peptides = 2 || ambiguous || 84.0% Confident
Q9QXT0 - (Q9QXT0) Putative secreted protein ZSIG9 (5330432A10RIK protein) (Transmembrane protein 4) || Number of peptides = 3 || unambiguous || 83.9% Confident
O94927 - (O94927) Hypothetical protein KIAA0841 (Fragment) || Number of peptides = 1 || unambiguous || 83.9% Confident
ITAL_MOUSE - (P24063) Integrin alpha-L precursor (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (Leukocyte function associated molecule 1, alpha chain) (CD11a) || Number of peptides = 8 || ambiguous || 83.8% Confident
Q9ES65 - (Q9ES65) Harmonin isoform a1 || Number of peptides = 1 || ambiguous || 83.8% Confident
Q9DBH4 - (Q9DBH4) 1300010F03Rik protein || Number of peptides = 1 || ambiguous || 83.8% Confident
O95135 - (O95135) Ataxin-2-like protein A2LP || Number of peptides = 2 || unambiguous || 83.8% Confident
Q9CSN8 - (Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) || Number of peptides = 1 || ambiguous || 83.7% Confident
Q8VHQ0 - (Q8VHQ0) SPI3L2 || Number of peptides = 2 || unambiguous || 83.4% Confident
O00301 - (O00301) KSRP || Number of peptides = 1 || unambiguous || 83.3% Confident
PSB6_MOUSE - (Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y) || Number of peptides = 1 || unambiguous || 83.3% Confident
Q9CYP9 - (Q9CYP9) 3930402F23Rik protein || Number of peptides = 1 || unambiguous || 82.9% Confident
Q9H491 - (Q9H491) BA346K17.1.2 (Novel protein similar to MAP1ALC3 (Micotubule-associated proteins 1A/1B light chain 3) from Rat, isoform 2) (Fragment) || Number of peptides = 1 || unambiguous || 82.8% Confident
Q9BYZ4 - (Q9BYZ4) PRTD-NY2 || Number of peptides = 3 || unambiguous || 82.8% Confident
Q9H5M3 - (Q9H5M3) Hypothetical protein FLJ23305 || Number of peptides = 2 || unambiguous || 82.7% Confident
C2F2_MOUSE - (P33267) Cytochrome P450 2F2 (EC 1.14.14.-) (CYPIIF2) (Naphthalene dehydrogenase) (Naphthalene hydroxylase) (P450-NAH-2) || Number of peptides = 1 || unambiguous || 82.6% Confident
PGCV_MOUSE - (Q62059) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) || Number of peptides = 1 || unambiguous || 82.5% Confident
Q922K6 - (Q922K6) Unknown (Protein for MGC:7530) || Number of peptides = 1 || unambiguous || 82.4% Confident
Q9DB21 - (Q9DB21) 1500031A17Rik protein || Number of peptides = 1 || ambiguous || 82.4% Confident
RGS3_HUMAN - (P49796) Regulator of G-protein signaling 3 (RGS3) (RGP3) || Number of peptides = 1 || ambiguous || 82.4% Confident
PSD3_MOUSE - (P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen) || Number of peptides = 1 || unambiguous || 82.4% Confident
E2F5_HUMAN - (Q15329) Transcription factor E2F5 (E2F-5) || Number of peptides = 1 || unambiguous || 82.3% Confident
Q9WVQ5 - (Q9WVQ5) MMRP19 (Monocyte macrophage 19) || Number of peptides = 1 || unambiguous || 82.2% Confident
Q9JHU9 - (Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1) || Number of peptides = 1 || unambiguous || 82.0% Confident
NRTN_MOUSE - (P97463) Neurturin precursor || Number of peptides = 1 || unambiguous || 82.0% Confident
EF1D_MOUSE - (P57776) Elongation factor 1-delta (EF-1-delta) || Number of peptides = 3 || unambiguous || 81.8% Confident
MAP4_HUMAN - (P27816) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 3 || unambiguous || 81.7% Confident
Q9Z1K3 - (Q9Z1K3) Multiple PDZ domain protein || Number of peptides = 1 || ambiguous || 81.5% Confident
Q96DU7 - (Q96DU7) Inositol 1,4,5-trisphosphate 3-kinase C || Number of peptides = 1 || unambiguous || 81.4% Confident
Q9CPS7 - (Q9CPS7) 1810003N24Rik protein (Putative 25.7 kDa protein) (RIKEN cDNA 1810003N24 gene) || Number of peptides = 1 || unambiguous || 81.2% Confident
Q9D900 - (Q9D900) 1810014G04Rik protein || Number of peptides = 1 || unambiguous || 81.2% Confident
O35925 - (O35925) Beta1-syntrophin || Number of peptides = 2 || unambiguous || 81.1% Confident
CRP1_MOUSE - (P04006) Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP) || Number of peptides = 1 || unambiguous || 81.1% Confident
Q96NA8 - (Q96NA8) Hypothetical protein FLJ31164 || Number of peptides = 1 || unambiguous || 81.1% Confident
Q9NZC2 - (Q9NZC2) Triggering receptor expressed on myeloid cells 2 || Number of peptides = 1 || unambiguous || 81.1% Confident
IMA5_HUMAN - (O15131) Importin alpha-6 subunit (Karyopherin alpha-5 subunit) || Number of peptides = 1 || ambiguous || 81.1% Confident
Q8VDY2 - (Q8VDY2) Hypothetical 20.8 kDa protein || Number of peptides = 1 || unambiguous || 81.1% Confident
CA21_MOUSE - (Q01149) Collagen alpha 2(I) chain precursor || Number of peptides = 1 || unambiguous || 81.1% Confident
DDX9_MOUSE - (O70133) ATP-dependent RNA helicase A (Nuclear DNA helicase II) (NDH II) (DEAD-box protein 9) (mHEL-5) || Number of peptides = 1 || ambiguous || 81.0% Confident
Q91VN1 - (Q91VN1) Zinc finger protein ZF-12 || Number of peptides = 1 || unambiguous || 81.0% Confident
Q9UK23 - (Q9UK23) N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (EC 3.1.4.45) || Number of peptides = 1 || unambiguous || 81.0% Confident
Q9WV39 - (Q9WV39) Damage-specific DNA binding protein 1 || Number of peptides = 2 || ambiguous || 81.0% Confident
Q14185 - (Q14185) DOCK180 protein || Number of peptides = 1 || unambiguous || 80.7% Confident
RT21_MOUSE - (P58059) Mitochondrial 28S ribosomal protein S21 (MRP-S21) || Number of peptides = 1 || ambiguous || 80.3% Confident
Q8R3U2 - (Q8R3U2) Similar to hypothetical protein FLJ22693 (Fragment) || Number of peptides = 2 || unambiguous || 80.2% Confident
O95625 - (O95625) Zinc finger protein || Number of peptides = 1 || unambiguous || 80.2% Confident
O75042 - (O75042) Hypothetical protein KIAA0454 (Fragment) || Number of peptides = 1 || unambiguous || 79.8% Confident
Q9QZ13 - (Q9QZ13) Fatso protein || Number of peptides = 1 || unambiguous || 79.8% Confident
Q14789 - (Q14789) GIANTIN (GCP372) (MACROGOLGIN) (Golgi autoantigen, golgin subfamily B, 1) || Number of peptides = 1 || unambiguous || 79.7% Confident
Q9HBF9 - (Q9HBF9) Gag-pro-pol protein (Fragment) || Number of peptides = 2 || unambiguous || 79.7% Confident
HGFA_MOUSE - (Q9R098) Hepatocyte growth factor activator precursor (EC 3.4.21.-) (HGF activator) (HGFA) || Number of peptides = 1 || unambiguous || 79.6% Confident
INA7_HUMAN - (P01567) Interferon alpha-7 precursor (Interferon alpha-J1) (IFN-alpha-J1) (Interferon alpha-J) (LeIF J) || Number of peptides = 3 || unambiguous || 79.5% Confident
Q91Y16 - (Q91Y16) Protocadherin alpha 3 || Number of peptides = 1 || unambiguous || 79.5% Confident
Q9H7U3 - (Q9H7U3) Hypothetical protein FLJ14257 || Number of peptides = 1 || ambiguous || 79.4% Confident
Q96DQ1 - (Q96DQ1) Hypothetical protein FLJ30646 || Number of peptides = 1 || unambiguous || 79.4% Confident
Q9EQ18 - (Q9EQ18) SIR2L2 || Number of peptides = 1 || unambiguous || 79.2% Confident
Q9JJQ0 - (Q9JJQ0) Pig-b || Number of peptides = 2 || unambiguous || 79.2% Confident
Q91VR8 - (Q91VR8) Unknown (Protein for MGC:6981) || Number of peptides = 1 || ambiguous || 79.2% Confident
CIN6_HUMAN - (Q01118) Sodium channel protein, cardiac and skeletal muscle alpha-subunit || Number of peptides = 1 || unambiguous || 79.2% Confident
Q9HCL9 - (Q9HCL9) Hypothetical protein KIAA1553 (Fragment) || Number of peptides = 1 || unambiguous || 79.2% Confident
CDC2_MOUSE - (P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) || Number of peptides = 1 || ambiguous || 79.1% Confident
RS16_MOUSE - (P14131) 40S ribosomal protein S16 || Number of peptides = 1 || ambiguous || 78.8% Confident
O95072 - (O95072) Recombination and sister chromatid cohesion protein homolog (Similar to Rec8p, a meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family) (Fragment) || Number of peptides = 1 || ambiguous || 78.8% Confident
UBF1_MOUSE - (P25976) Nucleolar transcription factor 1 (Upstream binding factor 1) (UBF-1) || Number of peptides = 1 || ambiguous || 78.8% Confident
Q9NRT9 - (Q9NRT9) Protocadherin 13 (Fragment) || Number of peptides = 1 || unambiguous || 78.7% Confident
PSDD_MOUSE - (Q9WVJ2) 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) || Number of peptides = 1 || ambiguous || 78.6% Confident
Q9D1M2 - (Q9D1M2) 1110003E08Rik protein || Number of peptides = 1 || unambiguous || 78.5% Confident
SCP1_MOUSE - (Q62209) Synaptonemal complex protein 1 (SCP-1 protein) || Number of peptides = 1 || unambiguous || 78.4% Confident
NPHN_MOUSE - (Q9QZS7) Nephrin precursor (Renal glomerulus-specific cell adhesion receptor) || Number of peptides = 1 || unambiguous || 78.3% Confident
Q9CXF9 - (Q9CXF9) 4121402D02Rik protein || Number of peptides = 1 || unambiguous || 78.3% Confident
PMS2_MOUSE - (P54279) PMS1 protein homolog 2 (DNA mismatch repair protein PMS2) || Number of peptides = 1 || unambiguous || 78.3% Confident
AGM1_MOUSE - (Q9CYR6) Phosphoacetylglucosamine mutase (EC 5.4.2.3) (PAGM) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase) || Number of peptides = 1 || unambiguous || 78.2% Confident
ROA2_MOUSE - (O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) || Number of peptides = 2 || ambiguous || 78.2% Confident
FIBG_HUMAN - (P02679) Fibrinogen gamma chain precursor (PRO2061) || Number of peptides = 1 || unambiguous || 78.2% Confident
PMG2_MOUSE - (O70250) Phosphoglycerate mutase 2 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme M) (PGAM-M) (BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase) || Number of peptides = 1 || unambiguous || 78.2% Confident
GRG_MOUSE - (Q06195) GRG protein (ESP1 protein) (Amino enhancer of split) (AES-1/AES-2) || Number of peptides = 1 || ambiguous || 78.1% Confident
Q8VEK7 - (Q8VEK7) Hypothetical 27.3 kDa protein || Number of peptides = 2 || unambiguous || 78.1% Confident
Q99K48 - (Q99K48) Non-POU-domain-containing, octamer-binding protein || Number of peptides = 1 || ambiguous || 78.0% Confident
Q9ER65 - (Q9ER65) Calsyntenin-2 || Number of peptides = 1 || unambiguous || 77.7% Confident
Q96RU1 - (Q96RU1) Rhophilin-like protein || Number of peptides = 1 || unambiguous || 77.4% Confident
MIF_MOUSE - (P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) || Number of peptides = 1 || unambiguous || 77.4% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 1 || ambiguous || 77.4% Confident
Q9CSF2 - (Q9CSF2) 2810405K07Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 77.3% Confident
Q8R349 - (Q8R349) Similar to CDC16 cell division cycle 16 homolog (S. cerevisiae) || Number of peptides = 1 || unambiguous || 77.2% Confident
Q9BYT9 - (Q9BYT9) Hypothetical protein || Number of peptides = 1 || unambiguous || 77.2% Confident
PTPZ_HUMAN - (P23471) Protein-tyrosine phosphatase zeta precursor (EC 3.1.3.48) (R-PTP-zeta) || Number of peptides = 1 || unambiguous || 77.2% Confident
Q9CVA3 - (Q9CVA3) 2210415M20Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 77.1% Confident
AP19_MOUSE - (P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) || Number of peptides = 1 || ambiguous || 77.1% Confident
GHR_MOUSE - (P16882) Growth hormone receptor precursor (GH receptor) (GH binding protein) (GHBP) (Serum binding protein) || Number of peptides = 1 || unambiguous || 77.0% Confident
Q924K1 - (Q924K1) Aryl-hydrocarbon interacting protein-like 1 || Number of peptides = 1 || ambiguous || 76.9% Confident
MY1C_MOUSE - (Q9WTI7) Myosin Ic (Myosin I beta) (MMIb) || Number of peptides = 1 || ambiguous || 76.8% Confident
FCEB_HUMAN - (Q01362) High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-chain) || Number of peptides = 1 || unambiguous || 76.7% Confident
Q8R5L0 - (Q8R5L0) Age-related protein || Number of peptides = 1 || unambiguous || 76.5% Confident
Q9NVV7 - (Q9NVV7) Hypothetical protein FLJ10482 || Number of peptides = 1 || unambiguous || 76.4% Confident
CAG2_MOUSE - (Q09200) Beta-1,4 N-acetylgalactosaminyltransferase (EC 2.4.1.92) ((N-acetylneuraminyl)-galactosylglucosylceramide) (GM2/GD2 synthase) (GalNAc-T) || Number of peptides = 1 || unambiguous || 76.4% Confident
Q8TB80 - (Q8TB80) Hypothetical protein || Number of peptides = 1 || unambiguous || 76.4% Confident
MK06_MOUSE - (Q61532) Mitogen-activated protein kinase 6 (EC 2.7.1.-) (Extracellular signal-regulated kinase 3) (ERK-3) || Number of peptides = 1 || unambiguous || 76.3% Confident
SYG_MOUSE - (Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) || Number of peptides = 1 || unambiguous || 76.3% Confident
Q9H1Y1 - (Q9H1Y1) BA446H13.1.1 (Novel protein similar to KIAA1059 (Ortholog of mouse VPS10 domain receptor protein SORCS) (Isoform 1)) (Fragment) || Number of peptides = 1 || unambiguous || 76.1% Confident
LY9_HUMAN - (Q9HBG7) T-lymphocyte surface antigen Ly-9 precursor (Lymphocyte antigen 9) (Cell-surface molecule Ly-9) (CD229 antigen) || Number of peptides = 1 || unambiguous || 76.1% Confident
CH60_MOUSE - (P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65) || Number of peptides = 1 || unambiguous || 76.0% Confident
PLO2_HUMAN - (O00469) Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursor (EC 1.14.11.4) (Lysyl hydroxylase 2) (LH2) || Number of peptides = 2 || unambiguous || 76.0% Confident
ZF64_HUMAN - (P15622) Zinc finger protein clone 647 || Number of peptides = 1 || unambiguous || 76.0% Confident
O00319 - (O00319) WUGSC:H_DJ525N14.1 protein || Number of peptides = 1 || unambiguous || 75.9% Confident
PSD7_MOUSE - (P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) || Number of peptides = 4 || ambiguous || 75.7% Confident
Q99KJ9 - (Q99KJ9) Hypothetical 73.2 kDa protein || Number of peptides = 1 || unambiguous || 75.4% Confident
WDR8_MOUSE - (Q9JM98) WD-repeat protein 8 || Number of peptides = 2 || unambiguous || 75.2% Confident
Q9DAJ6 - (Q9DAJ6) 1500026J17Rik protein || Number of peptides = 1 || ambiguous || 75.2% Confident
CHM1_HUMAN - (O75829) Chondromodulin-I precursor (ChM-I) [Contains: Chondrosurfactant protein (CH-SP)] || Number of peptides = 1 || unambiguous || 75.2% Confident
Q8TCZ9 - (Q8TCZ9) Polycystic kidney and hepatic disease 1 || Number of peptides = 1 || unambiguous || 75.0% Confident
Q9UI01 - (Q9UI01) Hypothetical protein || Number of peptides = 1 || unambiguous || 74.8% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 2 || ambiguous || 74.7% Confident
AKT2_MOUSE - (Q60823) RAC-beta serine/threonine protein kinase (EC 2.7.1.-) (RAC-PK-beta) (Protein kinase Akt-2) (Protein kinase B, beta) (PKB beta) || Number of peptides = 1 || ambiguous || 74.7% Confident
CPN2_MOUSE - (P15539) Cytochrome P450 11B2, mitochondrial precursor (EC 1.14.15.4) (CYPXIB2) (P450C11) (Steroid 11-beta-hydroxylase) (Aldosterone synthase) || Number of peptides = 1 || unambiguous || 74.6% Confident
Q9BXT5 - (Q9BXT5) TEX15 || Number of peptides = 1 || unambiguous || 74.6% Confident
Q15170 - (Q15170) Transcription factor S-II-related protein (PP21) || Number of peptides = 2 || unambiguous || 74.3% Confident
PA2A_HUMAN - (P14555) Phospholipase A2, membrane associated precursor (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase) (Group IIA phospholipase A2) (GIIC sPLA2) (Non-pancreatic secretory phospholipase A2) (NPS-PLA2) || Number of peptides = 1 || unambiguous || 74.1% Confident
TBL3_HUMAN - (Q12788) WD-repeat protein SAZD (Transducin beta-like 3 protein) || Number of peptides = 2 || unambiguous || 74.0% Confident
Q8TDH1 - (Q8TDH1) CLL-associated antigen KW-13 (Fragment) || Number of peptides = 1 || unambiguous || 73.9% Confident
Q9Z2V7 - (Q9Z2V7) Lymphocyte specific formin related protein || Number of peptides = 1 || unambiguous || 73.9% Confident
Q9CQH2 - (Q9CQH2) 1810008A14Rik protein || Number of peptides = 1 || unambiguous || 73.8% Confident
Q9D0I8 - (Q9D0I8) 2610012O22Rik protein || Number of peptides = 1 || unambiguous || 73.7% Confident
Q9CR25 - (Q9CR25) 9130020C19Rik protein || Number of peptides = 2 || unambiguous || 73.7% Confident
Q91WD8 - (Q91WD8) Similar to sodium/calcium/potassium exchanger || Number of peptides = 1 || ambiguous || 73.7% Confident
Q8VIG8 - (Q8VIG8) Hypothetical 6.4 kDa protein || Number of peptides = 1 || unambiguous || 73.7% Confident
Q91WS7 - (Q91WS7) Hypothetical 58.5 kDa protein || Number of peptides = 2 || unambiguous || 73.7% Confident
Q8R2D9 - (Q8R2D9) Vomeronasal receptor V1RC15 || Number of peptides = 1 || unambiguous || 73.7% Confident
Q96SC3 - (Q96SC3) Fibulin-6 (Fragment) || Number of peptides = 1 || unambiguous || 73.7% Confident
EF1B_MOUSE - (O70251) Elongation factor 1-beta (EF-1-beta) || Number of peptides = 1 || ambiguous || 73.5% Confident
Y136_HUMAN - (Q14149) Hypothetical protein KIAA0136 (Fragment) || Number of peptides = 1 || unambiguous || 73.5% Confident
Q9CVM4 - (Q9CVM4) 1810012H02Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 73.4% Confident
Q9WUC2 - (Q9WUC2) SH2-containing inositol phosphatase || Number of peptides = 1 || ambiguous || 73.4% Confident
Q96T68 - (Q96T68) CLLL8 protein || Number of peptides = 1 || unambiguous || 73.4% Confident
TDT_MOUSE - (P09838) DNA nucleotidylexotransferase (EC 2.7.7.31) (Terminal addition enzyme) (Terminal deoxynucleotidyltransferase) (TDT) (Terminal transferase) || Number of peptides = 1 || unambiguous || 73.3% Confident
Q9HC73 - (Q9HC73) Cytokine receptor CRL2 PRECUSOR (IL-XR) (Thymic stromal LYMPHOPOIETIN protein receptor TSLPR) || Number of peptides = 1 || ambiguous || 73.2% Confident
Q91W50 - (Q91W50) Hypothetical 88.8 kDa protein || Number of peptides = 2 || unambiguous || 73.1% Confident
VAB1_HUMAN - (P15313) Vacuolar ATP synthase subunit B, kidney isoform (EC 3.6.3.14) (V-ATPase B1 subunit) (Vacuolar proton pump B isoform 1) (Endomembrane proton pump 58 kDa subunit) || Number of peptides = 1 || unambiguous || 72.9% Confident
DAG1_MOUSE - (Q62165) Dystroglycan precursor (Dystrophin-associated glycoprotein 1) [Contains: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)] || Number of peptides = 1 || unambiguous || 72.9% Confident
Q9BRG0 - (Q9BRG0) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 72.8% Confident
Q91ZJ5 - (Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2 || Number of peptides = 1 || unambiguous || 72.7% Confident
DNPE_MOUSE - (Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21) || Number of peptides = 1 || unambiguous || 72.7% Confident
PODX_HUMAN - (O00592) Podocalyxin-like protein 1 precursor || Number of peptides = 1 || unambiguous || 72.7% Confident
CA64_HUMAN - (Q14031) Collagen alpha 6(IV) chain precursor || Number of peptides = 1 || ambiguous || 72.6% Confident
ARD1_HUMAN - (P36406) GTP-binding protein ARD-1 (Tripartite motif protein 23) || Number of peptides = 1 || unambiguous || 72.5% Confident
ARI1_HUMAN - (Q9Y4X5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein) (HHARI) (H7-AP2) (HUSSY-27) (MOP-6) || Number of peptides = 1 || unambiguous || 72.5% Confident
143T_MOUSE - (P35216) 14-3-3 protein tau (14-3-3 protein theta) || Number of peptides = 1 || ambiguous || 72.3% Confident
APXL_HUMAN - (Q13796) Apical-like protein (APXL protein) || Number of peptides = 1 || unambiguous || 72.2% Confident
HBE_HUMAN - (P02100) Hemoglobin epsilon chain || Number of peptides = 3 || unambiguous || 72.1% Confident
Q9R0S4 - (Q9R0S4) NIK-related kinase || Number of peptides = 1 || unambiguous || 72.0% Confident
PGK2_MOUSE - (P09041) Phosphoglycerate kinase, testis specific (EC 2.7.2.3) || Number of peptides = 1 || ambiguous || 71.9% Confident
O89076 - (O89076) Ring canal protein (Fragment) || Number of peptides = 1 || unambiguous || 71.7% Confident
3BP1_HUMAN - (Q9Y3L3) SH3-domain binding protein 1 (3BP-1) || Number of peptides = 2 || unambiguous || 71.5% Confident
DD24_HUMAN - (Q9GZR7) ATP-dependent RNA helicase DDX24 (DEAD-box protein 24) || Number of peptides = 1 || unambiguous || 71.1% Confident
Q9Z2L7 - (Q9Z2L7) Cytokine receptor related protein 4 || Number of peptides = 1 || ambiguous || 71.1% Confident
Q9D2N7 - (Q9D2N7) 4631422O05Rik protein || Number of peptides = 1 || unambiguous || 70.9% Confident
Q92878 - (Q92878) RAD50 || Number of peptides = 1 || ambiguous || 70.9% Confident
O70140 - (O70140) Calcyclin binding protein (Fragment) || Number of peptides = 1 || ambiguous || 70.8% Confident
Q9CW64 - (Q9CW64) 1200003G01Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 70.7% Confident
RYR1_HUMAN - (P21817) Ryanodine receptor 1 (Skeletal muscle-type ryanodine receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) || Number of peptides = 1 || unambiguous || 70.7% Confident
Q99L28 - (Q99L28) Similar to 60S ribosomal protein L30 isolog || Number of peptides = 2 || ambiguous || 70.4% Confident
ADRO_MOUSE - (Q61578) NADPH:adrenodoxin oxidoreductase, mitochondrial precursor (EC 1.18.1.2) (Adrenodoxin reductase) (AR) (Ferredoxin-NADP(+) reductase) || Number of peptides = 1 || unambiguous || 70.3% Confident
SBP1_MOUSE - (P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56) || Number of peptides = 2 || unambiguous || 70.3% Confident
O43792 - (O43792) Steroid receptor coactivator || Number of peptides = 1 || ambiguous || 70.1% Confident
Q9D4M7 - (Q9D4M7) 4931400A14Rik protein || Number of peptides = 1 || unambiguous || 70.0% Confident
Q9H0E3 - (Q9H0E3) Hypothetical protein || Number of peptides = 1 || ambiguous || 70.0% Confident
Q9R0R5 - (Q9R0R5) Transcription factor CA150b || Number of peptides = 3 || unambiguous || 70.0% Confident
Q9CVB6 - (Q9CVB6) 2210023N03Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 69.8% Confident
RGSE_MOUSE - (P97492) Regulator of G-protein signaling 14 (RGS14) (RAP1/RAP2 interacting protein) || Number of peptides = 1 || unambiguous || 69.8% Confident
Q9CRA9 - (Q9CRA9) 1500031J01Rik protein || Number of peptides = 1 || ambiguous || 69.8% Confident
DPP6_HUMAN - (P42658) Dipeptidyl peptidase IV like protein (Dipeptidyl aminopeptidase-related protein) (Dipeptidylpeptidase VI) (DPPX) || Number of peptides = 1 || unambiguous || 69.8% Confident
Q9DA37 - (Q9DA37) 1700010P07Rik protein || Number of peptides = 1 || unambiguous || 69.8% Confident
FINC_MOUSE - (P11276) Fibronectin precursor (FN) (Fragments) || Number of peptides = 1 || unambiguous || 69.7% Confident
ORP5_HUMAN - (Q9H0X9) Oxysterol binding protein-related protein 5 (OSBP-related protein 5) (ORP-5) || Number of peptides = 1 || unambiguous || 69.7% Confident
PGTB_MOUSE - (P53612) Geranylgeranyl transferase type II beta subunit (EC 2.5.1.-) (RAB geranylgeranyltransferase beta subunit) (RAB geranyl-geranyltransferase beta subunit) (RAB GG transferase beta) (RAB GGTase beta) || Number of peptides = 1 || ambiguous || 69.4% Confident
Q8TAD8 - (Q8TAD8) Smad nuclear interacting protein (Smad nuclear-interacting protein 1) || Number of peptides = 1 || unambiguous || 69.4% Confident
Q99JG5 - (Q99JG5) Nuclear export factor-a isoform 2 (Fragment) || Number of peptides = 1 || unambiguous || 69.4% Confident
Q9DA30 - (Q9DA30) 1700021P04Rik protein || Number of peptides = 1 || unambiguous || 69.3% Confident
FOH1_HUMAN - (Q04609) Glutamate carboxypeptidase II (EC 3.4.17.21) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Pteroylpoly-gamma-glutamate carboxypeptidase) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Folate hydrolase 1) (Prostate-specific membrane antigen) (PSMA) (PSM) || Number of peptides = 1 || ambiguous || 69.2% Confident
Q8R509 - (Q8R509) Polypirimidine tract binding protein || Number of peptides = 1 || ambiguous || 69.2% Confident
Q15154 - (Q15154) Pericentriol material 1 || Number of peptides = 1 || unambiguous || 69.2% Confident
AOC3_HUMAN - (Q16853) Membrane copper amine oxidase (EC 1.4.3.6) (Vascular adhesion protein-1) (VAP-1) (HPAO) || Number of peptides = 1 || unambiguous || 69.1% Confident
O15013 - (O15013) Hypothetical protein KIAA0294 || Number of peptides = 1 || ambiguous || 69.1% Confident
ZP3_MOUSE - (P10761) Zona pellucida sperm-binding protein 3 precursor (Zona pellucida glycoprotein ZP3) (Sperm receptor) (Zona pellucida protein C) || Number of peptides = 1 || unambiguous || 69.0% Confident
SM3C_HUMAN - (Q99985) Semaphorin 3C precursor (Semaphorin E) (Sema E) || Number of peptides = 2 || unambiguous || 68.9% Confident
Q9CWK1 - (Q9CWK1) 2410026J11Rik protein || Number of peptides = 1 || ambiguous || 68.8% Confident
Q96L50 - (Q96L50) 4-1BB-mediated signaling molecule || Number of peptides = 1 || unambiguous || 68.8% Confident
NOA1_HUMAN - (P51513) Onconeural ventral antigen-1 (NOVA-1) (Paraneoplastic Ri antigen) (Ventral neuron-specific protein 1) || Number of peptides = 1 || unambiguous || 68.8% Confident
Q9EPK6 - (Q9EPK6) Sil1 protein precursor || Number of peptides = 2 || unambiguous || 68.8% Confident
Q924S6 - (Q924S6) Zinc finger protein 219 || Number of peptides = 1 || unambiguous || 68.8% Confident
ST31_HUMAN - (Q9BXU1) Serine/threonine protein kinase 31 (EC 2.7.1.37) (Serine/threonine-protein kinase NYD-SPK) || Number of peptides = 1 || unambiguous || 68.8% Confident
O43432 - (O43432) EIF4GII || Number of peptides = 1 || unambiguous || 68.6% Confident
Q9ULH0 - (Q9ULH0) Hypothetical protein KIAA1250 (Fragment) || Number of peptides = 1 || unambiguous || 68.5% Confident
Q96RY6 - (Q96RY6) Hypothetical protein || Number of peptides = 1 || unambiguous || 68.4% Confident
COXZ_HUMAN - (Q9Y6N1) Cytochrome c oxidase assembly protein COX11, mitochondrial precursor || Number of peptides = 1 || unambiguous || 68.3% Confident
CU18_MOUSE - (P58467) Protein C21orf18 homolog || Number of peptides = 1 || unambiguous || 68.2% Confident
Q9D7A0 - (Q9D7A0) Adult male tongue cDNA, RIKEN full-length enriched library, clone:2310020N01, full insert sequence || Number of peptides = 1 || unambiguous || 68.0% Confident
O00261 - (O00261) Collagen type XIV (Fragment) || Number of peptides = 1 || unambiguous || 68.0% Confident
Q9UI45 - (Q9UI45) PHD finger protein 3 || Number of peptides = 1 || unambiguous || 68.0% Confident
REST_HUMAN - (P30622) Restin (Cytoplasmic linker protein-170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament associated protein) || Number of peptides = 1 || unambiguous || 67.9% Confident
Q9ERS9 - (Q9ERS9) (N6-adenosine) (Unknown) (Protein for MGC:18732) || Number of peptides = 1 || unambiguous || 67.8% Confident
Q9CT68 - (Q9CT68) 1190005F20Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 67.7% Confident
Q9DA18 - (Q9DA18) 1700023B23Rik protein || Number of peptides = 1 || unambiguous || 67.7% Confident
CLAT_HUMAN - (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase) (Choline acetylase) (ChAT) || Number of peptides = 1 || unambiguous || 67.6% Confident
O43304 - (O43304) Hypothetical protein KIAA0420 (Fragment) || Number of peptides = 1 || unambiguous || 67.4% Confident
Q99LN8 - (Q99LN8) Similar to hypothetical protein FLJ20411 || Number of peptides = 1 || unambiguous || 67.4% Confident
DHAM_MOUSE - (P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2) || Number of peptides = 1 || unambiguous || 67.4% Confident
ACDL_MOUSE - (P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD) || Number of peptides = 1 || unambiguous || 67.4% Confident
Q9H009 - (Q9H009) Alpha-NAC protein || Number of peptides = 1 || unambiguous || 67.4% Confident
Q9DC45 - (Q9DC45) 1200003J11Rik protein || Number of peptides = 1 || unambiguous || 67.3% Confident
Q8TC28 - (Q8TC28) Similar to RIKEN cDNA 2010208K18 gene || Number of peptides = 1 || unambiguous || 67.3% Confident
Q92549 - (Q92549) Hypothetical protein KIAA0261 (Fragment) || Number of peptides = 1 || unambiguous || 67.1% Confident
Q9BX66 - (Q9BX66) Sorbin and SH3 domain containing 1 || Number of peptides = 1 || unambiguous || 67.1% Confident
Q96P26 - (Q96P26) Cytosolic nucleotidase Ib alpha || Number of peptides = 1 || ambiguous || 67.1% Confident
Q9DC14 - (Q9DC14) 1200007H22Rik protein || Number of peptides = 2 || ambiguous || 67.0% Confident
Q9QYZ6 - (Q9QYZ6) Hypothetical 56.8 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 67.0% Confident
TIAM_MOUSE - (Q60610) T-lymphoma invasion and metastasis inducing protein 1 (TIAM1 protein) || Number of peptides = 1 || unambiguous || 66.9% Confident
Q99MP0 - (Q99MP0) T-box 1 || Number of peptides = 1 || unambiguous || 66.9% Confident
CDC7_HUMAN - (O00311) Cell division cycle 7-related protein kinase (EC 2.7.1.-) (CDC7-related kinase) (HsCdc7) (huCdc7) || Number of peptides = 1 || unambiguous || 66.9% Confident
O88349 - (O88349) Latent TGF beta binding protein || Number of peptides = 1 || unambiguous || 66.8% Confident
SYS_MOUSE - (P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) || Number of peptides = 1 || unambiguous || 66.6% Confident
O54806 - (O54806) Huntingtin interacting protein-2 || Number of peptides = 1 || ambiguous || 66.6% Confident
UDB4_HUMAN - (P06133) UDP-glucuronosyltransferase 2B4 precursor, microsomal (EC 2.4.1.17) (UDPGT) (Hyodeoxycholic acid) (HLUG25) (UDPGTH-1) || Number of peptides = 1 || unambiguous || 66.6% Confident
DRI1_MOUSE - (Q62431) Dead ringer like-1 protein (B-cell regulator of IgH transcription) (Bright) || Number of peptides = 1 || unambiguous || 66.5% Confident
Q8TEV8 - (Q8TEV8) Smith-Magenis syndrome chromosome region candidate 5 protein || Number of peptides = 1 || unambiguous || 66.5% Confident
Q9HBY1 - (Q9HBY1) Actin filament associated protein || Number of peptides = 1 || unambiguous || 66.4% Confident
Q9JLH8 - (Q9JLH8) Tropomodulin 4 || Number of peptides = 1 || unambiguous || 66.4% Confident
Q9BYC7 - (Q9BYC7) Mitochondrial ribosomal protein bMRP36a || Number of peptides = 1 || ambiguous || 66.4% Confident
EZH2_MOUSE - (Q61188) Enhancer of zeste homolog 2 (ENX-1) || Number of peptides = 1 || ambiguous || 66.4% Confident
Q9P2F6 - (Q9P2F6) Hypothetical protein KIAA1391 (Fragment) || Number of peptides = 1 || unambiguous || 66.2% Confident
Q9DAM2 - (Q9DAM2) 1700007I06Rik protein || Number of peptides = 1 || ambiguous || 66.2% Confident
Q9BTP4 - (Q9BTP4) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 66.1% Confident
RFX5_HUMAN - (P48382) DNA-binding protein RFX5 (Regulatory factor X subunit 5) || Number of peptides = 2 || unambiguous || 66.1% Confident
P2YR_HUMAN - (P47900) P2Y purinoceptor 1 (ATP receptor) (P2Y1) (Purinergic receptor) || Number of peptides = 1 || unambiguous || 66.0% Confident
PM5P_HUMAN - (Q15155) Protein pM5 precursor || Number of peptides = 1 || ambiguous || 66.0% Confident
Q9CT58 - (Q9CT58) 2600001J17Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 66.0% Confident
O94986 - (O94986) Hypothetical protein KIAA0912 (Fragment) || Number of peptides = 1 || unambiguous || 65.9% Confident
Q14221 - (Q14221) Endosome-associated protein || Number of peptides = 1 || ambiguous || 65.9% Confident
Q925M9 - (Q925M9) DNA-dependent ATPase SNF2H || Number of peptides = 1 || unambiguous || 65.9% Confident
HRX_HUMAN - (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein) || Number of peptides = 1 || unambiguous || 65.9% Confident
EFTU_HUMAN - (P49411) Elongation factor Tu, mitochondrial precursor (P43) || Number of peptides = 1 || unambiguous || 65.9% Confident
SPB8_HUMAN - (P50452) Cytoplasmic antiproteinase 2 (CAP2) (CAP-2) (Protease inhibitor 8) (Serpin B8) || Number of peptides = 1 || unambiguous || 65.8% Confident
MLEN_MOUSE - (Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) || Number of peptides = 1 || ambiguous || 65.7% Confident
Q9HAW1 - (Q9HAW1) RNA polymerase III transcription initiation factor B'' short || Number of peptides = 1 || ambiguous || 65.6% Confident
Q8WWL2 - (Q8WWL2) Spir-2 protein (Fragment) || Number of peptides = 3 || unambiguous || 65.6% Confident
Q9HCM2 - (Q9HCM2) Hypothetical protein KIAA1550 (Fragment) || Number of peptides = 1 || unambiguous || 65.6% Confident
SGCA_MOUSE - (P82350) Alpha-sarcoglycan precursor (Alpha-SG) (Adhalin) (50 kDa dystrophin-associated glycoprotein) (50DAG) || Number of peptides = 1 || unambiguous || 65.5% Confident
Q96SY5 - (Q96SY5) Hypothetical protein FLJ14564 (Fragment) || Number of peptides = 1 || ambiguous || 65.5% Confident
Q63953 - (Q63953) Interferon gamma receptor 2 (Interferon gamma receptor beta subunit) || Number of peptides = 1 || unambiguous || 65.5% Confident
O60379 - (O60379) R29381_1 (Fragment) || Number of peptides = 1 || ambiguous || 65.5% Confident
Q9CZ85 - (Q9CZ85) 2810038F24Rik protein || Number of peptides = 3 || unambiguous || 65.5% Confident
Q9JIH8 - (Q9JIH8) Canalicular multispecific organic anion transporter cMOAT || Number of peptides = 1 || unambiguous || 65.5% Confident
Q8VCB3 - (Q8VCB3) Hypothetical 80.9 kDa protein || Number of peptides = 1 || unambiguous || 65.5% Confident
Q8R3K8 - (Q8R3K8) Hypothetical 18.3 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 65.5% Confident
CADH_MOUSE - (Q9R100) Cadherin-17 precursor (Liver-intestine-cadherin) (LI-cadherin) (BILL-cadherin) (P130) || Number of peptides = 1 || unambiguous || 65.5% Confident
Q9Y364 - (Q9Y364) CGI-50 protein || Number of peptides = 1 || ambiguous || 65.5% Confident
Q99LC3 - (Q99LC3) RIKEN cDNA 2900053E13 gene || Number of peptides = 1 || unambiguous || 65.4% Confident
Q9Z0H4 - (Q9Z0H4) Apoptosis-related RNA binding protein (CUG triplet repeat,RNA binding protein 2) || Number of peptides = 1 || ambiguous || 65.3% Confident
Q91XU3 - (Q91XU3) Phosphatidyl inositol phosphate kinase type II gamma (Phosphatidylinositol-4-phosphate 5-kinase, type II, gamma) || Number of peptides = 1 || ambiguous || 65.2% Confident
Q9Y238 - (Q9Y238) Deleted in lung and ESOPHAGEAL cancer 1 || Number of peptides = 1 || unambiguous || 65.2% Confident
Q9EPS3 - (Q9EPS3) D-glucuronyl C5-epimerase (EC 5.1.3.-) (Heparin/heparan sulfate:glucuronic acid C5 epimerase) || Number of peptides = 1 || unambiguous || 65.1% Confident
O95790 - (O95790) Neuroblastoma-amplified protein || Number of peptides = 1 || ambiguous || 65.1% Confident
Q91WJ9 - (Q91WJ9) Reduced in osteosclerosis transporter || Number of peptides = 1 || ambiguous || 65.0% Confident
Q91VX3 - (Q91VX3) Similar to topoisomerase (DNA) II binding protein (Fragment) || Number of peptides = 1 || unambiguous || 65.0% Confident
O08847 - (O08847) RNA polymerase II largest subunit || Number of peptides = 1 || unambiguous || 64.9% Confident
O75499 - (O75499) B cell linker protein BLNK-S || Number of peptides = 1 || ambiguous || 64.8% Confident
Q9H3K0 - (Q9H3K0) My023 protein || Number of peptides = 1 || unambiguous || 64.7% Confident
ARP2_HUMAN - (O15142) Actin-like protein 2 (Actin-related protein 2) || Number of peptides = 1 || unambiguous || 64.7% Confident
O75116 - (O75116) Hypothetical protein KIAA0619 || Number of peptides = 1 || unambiguous || 64.7% Confident
Q9Y2V1 - (Q9Y2V1) Hypothetical protein || Number of peptides = 1 || ambiguous || 64.6% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 1 || ambiguous || 64.3% Confident
RASH_MOUSE - (Q61411) Transforming protein P21/H-RAS-1 (C-H-RAS) || Number of peptides = 1 || ambiguous || 64.1% Confident
Q9P280 - (Q9P280) Hypothetical protein KIAA1448 (Fragment) || Number of peptides = 1 || unambiguous || 64.1% Confident
Q9NZB6 - (Q9NZB6) Retinoblastoma-binding protein 1-like 1 || Number of peptides = 1 || ambiguous || 64.1% Confident
PSE1_MOUSE - (P97371) Proteasome activator complex subunit 1 (Proteasome activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) || Number of peptides = 1 || unambiguous || 64.1% Confident
Q9JJG5 - (Q9JJG5) Brain cDNA, clone MNCb-1504, similar to D50917 KIAA0127 protein (Homo sapiens) || Number of peptides = 1 || ambiguous || 64.0% Confident
Q9ULQ2 - (Q9ULQ2) Hypothetical protein KIAA1168 (Fragment) || Number of peptides = 1 || unambiguous || 64.0% Confident
Q8VIM6 - (Q8VIM6) Stereocilin || Number of peptides = 1 || unambiguous || 64.0% Confident
O75427 - (O75427) Leucin rich neuronal protein || Number of peptides = 1 || unambiguous || 64.0% Confident
Q15598 - (Q15598) Titin (Fragment) || Number of peptides = 1 || ambiguous || 63.9% Confident
GR78_MOUSE - (P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) || Number of peptides = 1 || ambiguous || 63.9% Confident
Q9D6M0 - (Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene) || Number of peptides = 2 || unambiguous || 63.5% Confident
Q9CWV1 - (Q9CWV1) 5730432L01Rik protein || Number of peptides = 1 || unambiguous || 63.4% Confident
U183_MOUSE - (Q922R1) UPF0183 protein || Number of peptides = 1 || unambiguous || 63.4% Confident
Q9BXU6 - (Q9BXU6) Testis protein TEX11 || Number of peptides = 1 || ambiguous || 63.4% Confident
Q91W78 - (Q91W78) Similar to hypothetical protein FLJ13154 || Number of peptides = 1 || unambiguous || 63.4% Confident
NEC2_HUMAN - (P16519) Neuroendocrine convertase 2 precursor (EC 3.4.21.94) (NEC 2) (PC2) (Prohormone convertase 2) (Proprotein convertase 2) (KEX2-like endoprotease 2) || Number of peptides = 1 || unambiguous || 63.4% Confident
K052_HUMAN - (P42285) Protein KIAA0052 (Fragment) || Number of peptides = 1 || unambiguous || 63.4% Confident
ADO_HUMAN - (Q06278) Aldehyde oxidase (EC 1.2.3.1) || Number of peptides = 1 || ambiguous || 63.3% Confident
Q15361 - (Q15361) Transcription factor || Number of peptides = 1 || unambiguous || 63.3% Confident
Q9NX08 - (Q9NX08) Hypothetical protein FLJ20502 || Number of peptides = 1 || ambiguous || 63.0% Confident
Q96N52 - (Q96N52) Hypothetical protein FLJ31400 || Number of peptides = 1 || unambiguous || 62.8% Confident
O89032 - (O89032) Fish protein || Number of peptides = 1 || ambiguous || 62.7% Confident
Q96QA0 - (Q96QA0) FKSG24 || Number of peptides = 1 || ambiguous || 62.7% Confident
HV04_MOUSE - (P01748) Ig heavy chain V region 23 precursor || Number of peptides = 1 || unambiguous || 62.5% Confident
Q8VE33 - (Q8VE33) Hypothetical 42.3 kDa protein || Number of peptides = 1 || ambiguous || 62.5% Confident
KF5C_MOUSE - (P28738) Kinesin heavy chain isoform 5C (Kinesin heavy chain neuron-specific 2) || Number of peptides = 1 || unambiguous || 62.4% Confident
OXRP_HUMAN - (Q9Y4L1) 150 kDa oxygen-regulated protein precursor (Orp150) (Hypoxia up-regulated 1) || Number of peptides = 1 || unambiguous || 62.4% Confident
Q9D2M6 - (Q9D2M6) 4632407K17Rik protein || Number of peptides = 1 || ambiguous || 62.2% Confident
PUR8_MOUSE - (P54822) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylosuccinase) (ASL) (ASASE) || Number of peptides = 1 || unambiguous || 62.2% Confident
O35600 - (O35600) ATP-binding cassette transporter || Number of peptides = 1 || unambiguous || 62.1% Confident
P97390 - (P97390) Vacuolar protein sorting homolog || Number of peptides = 2 || unambiguous || 62.1% Confident
Q99ML0 - (Q99ML0) Blu protein || Number of peptides = 1 || unambiguous || 62.0% Confident
IRF1_HUMAN - (P10914) Interferon regulatory factor 1 (IRF-1) || Number of peptides = 1 || unambiguous || 61.9% Confident
Q9NXZ1 - (Q9NXZ1) Putative tumor antigen || Number of peptides = 1 || unambiguous || 61.9% Confident
Q9CXU3 - (Q9CXU3) 3110003A17Rik protein || Number of peptides = 1 || unambiguous || 61.9% Confident
P300_HUMAN - (Q09472) E1A-associated protein p300 || Number of peptides = 1 || unambiguous || 61.9% Confident
Q9R0B7 - (Q9R0B7) Double-stranded RNA-binding zinc finger protein JAZ || Number of peptides = 1 || unambiguous || 61.9% Confident
Q62028 - (Q62028) Phospholipase A2 receptor precursor || Number of peptides = 1 || unambiguous || 61.9% Confident
DHAX_HUMAN - (P49419) Antiquitin (EC 1.2.1.-) || Number of peptides = 1 || unambiguous || 61.6% Confident
O70259 - (O70259) Voltage-gated potassium channel KV1.7 || Number of peptides = 1 || unambiguous || 61.6% Confident
TEA2_MOUSE - (P48301) Transcriptional enhancer factor TEF-4 (TEA domain family member 2) (TEAD-2) (Embryonic TEA domain-containing factor) (ETF) (ETEF-1) || Number of peptides = 2 || ambiguous || 61.5% Confident
Q9JLN5 - (Q9JLN5) Erythroid membrane-associated protein ERMAP || Number of peptides = 1 || unambiguous || 61.5% Confident
Q9UMC5 - (Q9UMC5) Zinc finger 2.2 (Fragment) || Number of peptides = 1 || ambiguous || 61.5% Confident
ANX3_MOUSE - (O35639) Annexin III (Lipocortin III) (Placental anticoagulant protein III) (PAP-III) (35-alpha calcimedin) || Number of peptides = 1 || unambiguous || 61.5% Confident
Q9D5V5 - (Q9D5V5) 4921514I20Rik protein || Number of peptides = 2 || ambiguous || 61.5% Confident
Q9CVI6 - (Q9CVI6) 1200015E15Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 61.4% Confident
Q9D0N4 - (Q9D0N4) 1110001I24Rik protein || Number of peptides = 1 || unambiguous || 61.4% Confident
Q9D9X5 - (Q9D9X5) 1700026A16Rik protein || Number of peptides = 1 || unambiguous || 61.4% Confident
Q9D8P9 - (Q9D8P9) 1810047K05Rik protein || Number of peptides = 2 || ambiguous || 61.4% Confident
Q96CR1 - (Q96CR1) Hypothetical protein || Number of peptides = 1 || unambiguous || 61.4% Confident
PSDC_MOUSE - (Q9D8W5) 26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit p55) || Number of peptides = 1 || ambiguous || 61.4% Confident
DHI1_HUMAN - (P28845) Corticosteroid 11-beta-dehydrogenase, isozyme 1 (EC 1.1.1.146) (11-DH) (11-beta-hydroxysteroid dehydrogenase 1) (11-beta-HSD1) || Number of peptides = 1 || unambiguous || 61.4% Confident
PTPB_HUMAN - (P23467) Protein-tyrosine phosphatase beta precursor (EC 3.1.3.48) (R-PTP-beta) || Number of peptides = 1 || unambiguous || 61.4% Confident
CYC_HUMAN - (P00001) Cytochrome c || Number of peptides = 1 || unambiguous || 61.4% Confident
Q9DAV8 - (Q9DAV8) 1600017L04Rik protein || Number of peptides = 1 || ambiguous || 61.3% Confident
MEPA_MOUSE - (P28825) Meprin A alpha-subunit precursor (EC 3.4.24.18) (Endopeptidase-2) (MEP-1) || Number of peptides = 1 || unambiguous || 61.2% Confident
Q9NP73 - (Q9NP73) DJ298J18.2.1 (Novel protein similar to predicted yeast and plant proteins (Isoform 1)) (Uncharacterized hematopoietic stem/progenitor cells protein MDS031) || Number of peptides = 1 || unambiguous || 61.2% Confident
AD15_MOUSE - (O88839) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) (AD56) || Number of peptides = 1 || unambiguous || 61.1% Confident
Q62219 - (Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5) || Number of peptides = 1 || unambiguous || 61.1% Confident
MY5C_HUMAN - (Q9NQX4) Myosin Vc (Myosin 5C) || Number of peptides = 1 || unambiguous || 61.1% Confident
Q922Y3 - (Q922Y3) Unknown (Protein for IMAGE:3498575) (Fragment) || Number of peptides = 1 || ambiguous || 61.1% Confident
CHD1_HUMAN - (O14646) Chromodomain-helicase-DNA-binding protein 1 (CHD-1) || Number of peptides = 1 || unambiguous || 61.1% Confident
Q9D5Y6 - (Q9D5Y6) 4921506D17Rik protein || Number of peptides = 1 || ambiguous || 61.1% Confident
Q8WXA6 - (Q8WXA6) AF15q14 isoform 2 || Number of peptides = 1 || unambiguous || 61.1% Confident
SHK1_HUMAN - (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1) (Somatostatin receptor interacting protein) (SSTR interacting protein) (SSTRIP) || Number of peptides = 1 || unambiguous || 61.0% Confident
Q9CZY6 - (Q9CZY6) 2610312C03Rik protein (26S proteasome-associated pad1 homolog) || Number of peptides = 1 || ambiguous || 60.9% Confident
MGE1_HUMAN - (Q9UBF1) Melanoma-associated antigen E1 (MAGE-E1 antigen) (MAGE-C2 antigen) (Hepatocellular cancer antigen 587) (Cancer-testis antigen CT10) || Number of peptides = 1 || unambiguous || 60.9% Confident
Q8R3P6 - (Q8R3P6) Similar to hypothetical protein DKFZp564O1664 || Number of peptides = 1 || ambiguous || 60.8% Confident
Q9NYU1 - (Q9NYU1) UDP-glucose:glycoprotein glucosyltransferase 2 precursor || Number of peptides = 1 || unambiguous || 60.7% Confident
FZD6_HUMAN - (O60353) Frizzled 6 precursor (Frizzled-6) (Fz-6) (hFz6) || Number of peptides = 1 || ambiguous || 60.5% Confident
ALFA_HUMAN - (P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1) || Number of peptides = 1 || unambiguous || 60.4% Confident
O14940 - (O14940) Molybdenum cofactor biosynthesis protein A || Number of peptides = 1 || ambiguous || 60.3% Confident
Q8WYP5 - (Q8WYP5) Transcription factor ELYS || Number of peptides = 1 || unambiguous || 60.3% Confident
O95458 - (O95458) Beta-tubulin cofactor D || Number of peptides = 1 || ambiguous || 60.2% Confident
Q9QYK9 - (Q9QYK9) MCAMK1-BETA2 protein (Pregnancy upregulated NONUBIQUITOUS CA2+/calmodulin-dependent kinase PNCK) || Number of peptides = 1 || ambiguous || 60.2% Confident
ZO1_MOUSE - (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) || Number of peptides = 2 || unambiguous || 60.1% Confident
Q9NVM6 - (Q9NVM6) Hypothetical protein FLJ10634 || Number of peptides = 1 || unambiguous || 60.1% Confident
Q8VCR2 - (Q8VCR2) Similar to hydroxysteroid 17-beta dehydrogenase 11 || Number of peptides = 1 || unambiguous || 60.1% Confident
CALU_MOUSE - (O35887) Calumenin precursor || Number of peptides = 1 || ambiguous || 60.1% Confident
Q9DBY8 - (Q9DBY8) 1200009I24Rik protein || Number of peptides = 1 || unambiguous || 60.0% Confident
Q8R0L6 - (Q8R0L6) Similar to coronin, actin binding protein, 2A (Fragment) || Number of peptides = 1 || unambiguous || 60.0% Confident
Q8TCD5 - (Q8TCD5) 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C || Number of peptides = 1 || ambiguous || 60.0% Confident
Q9CQ26 - (Q9CQ26) 5330424L14Rik protein (5730422L11Rik protein) (RIKEN cDNA 5730422L11 gene) (AMSH) (Associated molecule with the SH3 domain of STAM) || Number of peptides = 1 || unambiguous || 59.8% Confident
O00420 - (O00420) F19541_1 (Fragment) || Number of peptides = 1 || unambiguous || 59.8% Confident
CATC_MOUSE - (P97821) Dipeptidyl-peptidase I precursor (EC 3.4.14.1) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) || Number of peptides = 1 || unambiguous || 59.6% Confident
Q9CQR1 - (Q9CQR1) DNA segment, Chr 6, Wayne state University 157, expressed || Number of peptides = 1 || ambiguous || 59.6% Confident
Q925I4 - (Q925I4) Candidate taste receptor T1R2 || Number of peptides = 1 || unambiguous || 59.5% Confident
Q9D3Z1 - (Q9D3Z1) 4933426K21Rik protein || Number of peptides = 1 || ambiguous || 59.5% Confident
Q8R5C8 - (Q8R5C8) Similar to adenovirus 5 E1A binding protein || Number of peptides = 1 || ambiguous || 59.5% Confident
ANPA_MOUSE - (P18293) Atrial natriuretic peptide receptor A precursor (ANP-A) (ANPRA) (GC-A) (Guanylate cyclase) (EC 4.6.1.2) (NPR-A) (Atrial natriuretic peptide A-type receptor) || Number of peptides = 1 || unambiguous || 59.5% Confident
KMLS_HUMAN - (Q15746) Myosin light chain kinase, smooth muscle and non-muscle isozymes (EC 2.7.1.117) (MLCK) [Contains: Telokin (Kinase related protein) (KRP)] || Number of peptides = 1 || ambiguous || 59.4% Confident
Q96EC3 - (Q96EC3) Similar to adrenergic, beta-2-, receptor, surface || Number of peptides = 1 || unambiguous || 59.4% Confident
Q920Z0 - (Q920Z0) BM332P19.1 (Novel 7 transmembrane receptor (Rhodopsin family) (Olfactory receptor like) protein (Mm17M1-12)) (Olfactory receptor MOR250-2) || Number of peptides = 1 || unambiguous || 59.4% Confident
EF2K_MOUSE - (O08796) Elongation factor 2 kinase (EC 2.7.1.-) (eEF-2 kinase) (eEF-2K) (Calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase) || Number of peptides = 1 || ambiguous || 59.3% Confident
Q9NQZ7 - (Q9NQZ7) Lysosomal apyrase-like protein 1 || Number of peptides = 1 || unambiguous || 59.2% Confident
O55129 - (O55129) Microtubule-associated protein (STOP protein) || Number of peptides = 1 || unambiguous || 59.0% Confident
Q9CS05 - (Q9CS05) 2510002A14Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 59.0% Confident
Q9QZJ4 - (Q9QZJ4) TPR-containing protein involved in spermatogenesis TPIS || Number of peptides = 1 || unambiguous || 59.0% Confident
Q9H5F4 - (Q9H5F4) Hypothetical protein FLJ23495 || Number of peptides = 1 || unambiguous || 58.9% Confident
Q9CVX3 - (Q9CVX3) 2410004D18Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 58.9% Confident
Q9Y4D4 - (Q9Y4D4) Hypothetical protein KIAA0648 (Fragment) || Number of peptides = 1 || unambiguous || 58.7% Confident
Q9Z189 - (Q9Z189) Macrophage actin-associated-tyrosine-phosphorylated protein || Number of peptides = 1 || unambiguous || 58.7% Confident
O95206 - (O95206) Protocadherin || Number of peptides = 1 || unambiguous || 58.5% Confident
KLKF_HUMAN - (Q9H2R5) Kallikrein 15 precursor (EC 3.4.21.-) (ACO protease) || Number of peptides = 1 || unambiguous || 58.4% Confident
SHK2_HUMAN - (Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2) || Number of peptides = 1 || unambiguous || 58.4% Confident
NCR1_MOUSE - (Q60974) Nuclear receptor co-repressor 1 (N-CoR1) (N-CoR) (Retinoid X receptor interacting protein 13) (RIP13) || Number of peptides = 1 || unambiguous || 58.3% Confident
IRKA_MOUSE - (Q9JM63) ATP-sensitive inward rectifier potassium channel 10 (Potassium channel, inwardly rectifying, subfamily J, member 10) (Inward rectifier K+ channel Kir4.1) || Number of peptides = 1 || ambiguous || 58.3% Confident
Q96T08 - (Q96T08) Hypothetical protein FLJ14526 || Number of peptides = 1 || unambiguous || 58.2% Confident
Q15058 - (Q15058) Hypothetical protein KIAA0042 || Number of peptides = 1 || unambiguous || 58.2% Confident
UBL1_MOUSE - (Q9R0P9) Ubiquitin carboxyl-terminal hydrolase isozyme L1 (EC 3.4.19.12) (UCH-L1) (Ubiquitin thiolesterase L1) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5) || Number of peptides = 1 || unambiguous || 58.1% Confident
Q8WXG9 - (Q8WXG9) Very large G protein-coupled receptor 1b || Number of peptides = 1 || unambiguous || 58.0% Confident
HEPS_MOUSE - (O35453) Serine protease hepsin (EC 3.4.21.-) || Number of peptides = 1 || ambiguous || 58.0% Confident
PESC_MOUSE - (Q9EQ61) Pescadillo homolog 1 || Number of peptides = 1 || unambiguous || 57.9% Confident
Q8R0Y3 - (Q8R0Y3) Similar to 5-methyltetrahydrofolate-homocysteine methyltransferase reductase || Number of peptides = 1 || unambiguous || 57.9% Confident
Q9CRI0 - (Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) || Number of peptides = 1 || ambiguous || 57.9% Confident
PRSA_MOUSE - (O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1) || Number of peptides = 1 || ambiguous || 57.9% Confident
Q9Y6X0 - (Q9Y6X0) SET-binding protein (SEB) (Hypothetical protein KIAA0437) || Number of peptides = 1 || unambiguous || 57.8% Confident
Q9D5Z0 - (Q9D5Z0) 4921504E14Rik protein || Number of peptides = 1 || unambiguous || 57.7% Confident
OM40_MOUSE - (Q9QYA2) Probable mitochondrial import receptor subunit TOM40 homolog (Translocase of outer membrane 40 kDa subunit homolog) || Number of peptides = 1 || ambiguous || 57.4% Confident
Q9NRZ2 - (Q9NRZ2) Envelope protein || Number of peptides = 1 || ambiguous || 57.4% Confident
TDR1_HUMAN - (Q9BXT4) Tudor domain containing protein 1 || Number of peptides = 1 || unambiguous || 57.3% Confident
VGR1_MOUSE - (P35969) Vascular endothelial growth factor receptor 1 precursor (EC 2.7.1.112) (VEGFR-1) (Tyrosine-protein kinase receptor FLT) (FLT-1) (Embryonic receptor kinase 2) || Number of peptides = 1 || unambiguous || 57.3% Confident
Q9UJR5 - (Q9UJR5) LST-1/M protein || Number of peptides = 1 || unambiguous || 57.2% Confident
MATK_MOUSE - (P41242) Megakaryocyte-associated tyrosine-protein kinase (EC 2.7.1.112) (Tyrosine-protein kinase CTK) (Protein kinase NTK) || Number of peptides = 1 || unambiguous || 57.1% Confident
GAA1_MOUSE - (P18504) Gamma-aminobutyric-acid receptor alpha-1 subunit precursor (GABA(A) receptor) || Number of peptides = 1 || ambiguous || 57.1% Confident
Q9CVT3 - (Q9CVT3) 1700037H04Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 57.1% Confident
BM8B_MOUSE - (P55105) Bone morphogenetic protein 8B precursor (BMP-8B) || Number of peptides = 1 || unambiguous || 57.0% Confident
Q96M12 - (Q96M12) Hypothetical protein FLJ32908 || Number of peptides = 1 || unambiguous || 57.0% Confident
Q96P64 - (Q96P64) MRIP2 || Number of peptides = 1 || unambiguous || 57.0% Confident
HXDD_HUMAN - (P35453) Homeobox protein Hox-D13 (Hox-4I) || Number of peptides = 1 || unambiguous || 57.0% Confident
Q8TAN8 - (Q8TAN8) Dynactin 4 (p62) || Number of peptides = 1 || ambiguous || 56.9% Confident
FOLC_MOUSE - (P48760) Folylpolyglutamate synthase, mitochondrial precursor (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (FPGS) || Number of peptides = 1 || unambiguous || 56.9% Confident
Q9WTR2 - (Q9WTR2) Apoptosis signal-regulating kinase 2 || Number of peptides = 1 || unambiguous || 56.9% Confident
Q92738 - (Q92738) Hypothetical protein KIAA0019 || Number of peptides = 1 || unambiguous || 56.9% Confident
Q9UIF8 - (Q9UIF8) Bromodomain adjacent to zinc finger domain 2B || Number of peptides = 1 || ambiguous || 56.8% Confident
Q9UG97 - (Q9UG97) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 56.8% Confident
TEBP_MOUSE - (Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23) || Number of peptides = 1 || ambiguous || 56.8% Confident
CGL_HUMAN - (P32929) Cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-cystathionase) || Number of peptides = 1 || unambiguous || 56.7% Confident
APG1_MOUSE - (Q62407) Aortic preferentially expressed protein 1 (APEG-1) || Number of peptides = 1 || ambiguous || 56.7% Confident
Q9H2Y7 - (Q9H2Y7) Zinc finger protein 106 (ZFP106) || Number of peptides = 1 || unambiguous || 56.6% Confident
E4L2_MOUSE - (O70318) Band 4.1-like protein 2 (Generally expressed protein 4.1) (4.1G) || Number of peptides = 3 || ambiguous || 56.5% Confident
Q9WU78 - (Q9WU78) ALG-2 interacting protein AIP1 || Number of peptides = 1 || ambiguous || 56.4% Confident
H2AW_HUMAN - (Q9P0M6) Core histone macro-H2A.2 (Histone macroH2A2) (mH2A2) || Number of peptides = 1 || unambiguous || 56.4% Confident
GALT_HUMAN - (O60755) Galanin receptor type 3 (GAL3-R) (GALR3) || Number of peptides = 1 || unambiguous || 56.3% Confident
TIAR_MOUSE - (P70318) Nucleolysin TIAR (TIA-1 related protein) || Number of peptides = 1 || unambiguous || 56.3% Confident
IL6B_HUMAN - (P40189) Interleukin-6 receptor beta chain precursor (IL-6R-beta) (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (GP130) (Oncostatin M receptor) (CDw130) (CD130 antigen) || Number of peptides = 1 || unambiguous || 56.3% Confident
CLC6_MOUSE - (O35454) Chloride channel protein 6 (ClC-6) || Number of peptides = 1 || ambiguous || 56.2% Confident
Q16821 - (Q16821) Type-1 protein phosphatase skeletal muscle glycogen targeting subunit (EC 3.1.3.16) (Serine /threonine specific protein phosphatase) || Number of peptides = 1 || unambiguous || 56.2% Confident
SYT1_MOUSE - (P46096) Synaptotagmin I (SytI) (p65) || Number of peptides = 1 || unambiguous || 56.1% Confident
Q9Y4A4 - (Q9Y4A4) F22162_1 (Fragment) || Number of peptides = 1 || unambiguous || 56.1% Confident
MCT9_MOUSE - (O35164) Mast cell protease 9 precursor (EC 3.4.21.-) (MMCP-9) || Number of peptides = 1 || ambiguous || 56.0% Confident
ACH9_HUMAN - (Q9UGM1) Neuronal acetylcholine receptor protein, alpha-9 chain precursor || Number of peptides = 1 || unambiguous || 55.9% Confident
Q9BVV2 - (Q9BVV2) Hypothetical protein || Number of peptides = 1 || unambiguous || 55.8% Confident
Q9D4H7 - (Q9D4H7) 4932412G04Rik protein (BM145O4.1) (Novel protein) || Number of peptides = 1 || unambiguous || 55.8% Confident
Q9QWY8 - (Q9QWY8) ADP-ribosylation factor-directed GTPase activating protein isoform a || Number of peptides = 1 || ambiguous || 55.7% Confident
Q9BZ71 - (Q9BZ71) NIR1 || Number of peptides = 1 || unambiguous || 55.7% Confident
Q9QZR9 - (Q9QZR9) Alpha 4 collagen IV || Number of peptides = 1 || unambiguous || 55.6% Confident
MOT4_MOUSE - (P57787) Monocarboxylate transporter 4 (MCT 4) || Number of peptides = 2 || unambiguous || 55.6% Confident
MTTF_HUMAN - (Q99551) Transcription termination factor, mitochondrial precursor (mTERF) || Number of peptides = 1 || unambiguous || 55.6% Confident
O88622 - (O88622) Poly(ADP-ribose) glycohydrolase || Number of peptides = 1 || unambiguous || 55.6% Confident
Q9DBU5 - (Q9DBU5) 1200013I08Rik protein || Number of peptides = 1 || unambiguous || 55.6% Confident
Q12965 - (Q12965) Myosin-IC || Number of peptides = 1 || unambiguous || 55.5% Confident
AD07_MOUSE - (O35227) ADAM 7 precursor (A disintegrin and metalloproteinase domain 7) || Number of peptides = 1 || unambiguous || 55.4% Confident
Q91XL3 - (Q91XL3) UDP-glucuronic acid decarboxylase || Number of peptides = 1 || unambiguous || 55.4% Confident
Q9D654 - (Q9D654) 4633401C23Rik protein || Number of peptides = 1 || unambiguous || 55.3% Confident
OSTP_HUMAN - (P10451) Osteopontin precursor (Bone sialoprotein 1) (Urinary stone protein) (Secreted phosphoprotein 1) (SPP-1) (Nephropontin) (Uropontin) || Number of peptides = 1 || unambiguous || 55.2% Confident
PIP3_HUMAN - (Q01970) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 3 (EC 3.1.4.11) (PLC-beta-3) (Phospholipase C-beta-3) || Number of peptides = 1 || unambiguous || 55.1% Confident
CAH8_MOUSE - (P28651) Carbonic anhydrase-related protein (CARP) (CA-VIII) || Number of peptides = 1 || ambiguous || 55.1% Confident
O75685 - (O75685) GNAS1 protein (DJ806M20.3.2) (Fragment) || Number of peptides = 1 || ambiguous || 55.0% Confident
Q99MS7 - (Q99MS7) Tangerin A || Number of peptides = 1 || unambiguous || 55.0% Confident
ZPR1_MOUSE - (Q62384) Zinc-finger protein ZPR1 (Zinc finger protein 259) || Number of peptides = 1 || ambiguous || 54.9% Confident
ACPM_MOUSE - (Q9CR21) Acyl carrier protein, mitochondrial precursor (ACP) (NADH-ubiquinone oxidoreductase 9.6 kDa subunit) (CI-SDAP) || Number of peptides = 1 || unambiguous || 54.9% Confident
Y212_HUMAN - (Q92611) Putative alpha-mannosidase KIAA0212 (EC 3.2.1.-) || Number of peptides = 1 || unambiguous || 54.9% Confident
Q9QXL0 - (Q9QXL0) DBCCR1 || Number of peptides = 1 || unambiguous || 54.9% Confident
Q8TBD9 - (Q8TBD9) Similar to KIAA0800 gene product || Number of peptides = 1 || ambiguous || 54.9% Confident
TNP3_MOUSE - (Q60769) Tumor necrosis factor, alpha-induced protein 3 (Putative DNA binding protein A20) (Zinc finger protein A20) || Number of peptides = 1 || ambiguous || 54.9% Confident
EGFR_HUMAN - (P00533) Epidermal growth factor receptor precursor (EC 2.7.1.112) (Receptor protein-tyrosine kinase ErbB-1) || Number of peptides = 1 || unambiguous || 54.8% Confident
CPSA_HUMAN - (Q10570) Cleavage and polyadenylation specificity factor, 160 kDa subunit (CPSF 160 kDa subunit) || Number of peptides = 1 || ambiguous || 54.8% Confident
DEST_MOUSE - (Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) || Number of peptides = 1 || unambiguous || 54.8% Confident
ZN08_HUMAN - (P17098) Zinc finger protein 8 (Zinc finger protein HF.18) (Fragment) || Number of peptides = 1 || unambiguous || 54.8% Confident
O60622 - (O60622) Protocadherin 43 || Number of peptides = 1 || ambiguous || 54.8% Confident
SNC3_HUMAN - (Q92966) snRNA activating protein complex 50 kDa subunit (SNAPc 50 kDa subunit) (Proximal sequence element-binding transcription factor beta subunit) (PSE-binding factor beta subunit) (PTF beta subunit) || Number of peptides = 1 || unambiguous || 54.8% Confident
Q9D0S0 - (Q9D0S0) 1190017B18Rik protein || Number of peptides = 1 || ambiguous || 54.8% Confident
AMBP_MOUSE - (Q07456) AMBP protein precursor [Contains: Alpha-1-microglobulin; Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (HI-30)] || Number of peptides = 1 || unambiguous || 54.6% Confident
Q96SN1 - (Q96SN1) Hypothetical protein FLJ14744 || Number of peptides = 1 || unambiguous || 54.5% Confident
ESTN_MOUSE - (P23953) Liver carboxylesterase precursor (EC 3.1.1.1) (PES-N) || Number of peptides = 1 || unambiguous || 54.5% Confident
Q96PZ0 - (Q96PZ0) Hypothetical protein KIAA1897 (Fragment) || Number of peptides = 1 || unambiguous || 54.5% Confident
Q8TDQ6 - (Q8TDQ6) C-type lectin protein CLL-1 || Number of peptides = 1 || unambiguous || 54.4% Confident
Q9BQW9 - (Q9BQW9) DJ782G3.1 (LISCH7 (Liver-specific BHLH-ZIP transcription factor)) (Fragment) || Number of peptides = 1 || unambiguous || 54.2% Confident
Q8VDF5 - (Q8VDF5) Hypothetical 36.6 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 54.1% Confident
SYN2_HUMAN - (Q92777) Synapsin II || Number of peptides = 1 || unambiguous || 54.0% Confident
Q8TC81 - (Q8TC81) Hypothetical protein || Number of peptides = 1 || unambiguous || 54.0% Confident
PHS1_MOUSE - (Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) || Number of peptides = 1 || unambiguous || 54.0% Confident
Q99LJ3 - (Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 53.9% Confident
Q9D0R9 - (Q9D0R9) 2600001A11Rik protein || Number of peptides = 1 || unambiguous || 53.9% Confident
Q96BW5 - (Q96BW5) Phosphotriesterase related || Number of peptides = 1 || unambiguous || 53.9% Confident
Q9CZ01 - (Q9CZ01) 2810426N06Rik protein || Number of peptides = 1 || unambiguous || 53.9% Confident
ML1A_HUMAN - (P48039) Melatonin receptor type 1A (Mel-1A-R) || Number of peptides = 1 || unambiguous || 53.8% Confident
O60284 - (O60284) Hypothetical protein KIAA0535 || Number of peptides = 1 || unambiguous || 53.8% Confident
Q96DQ8 - (Q96DQ8) Hypothetical protein FLJ30619 || Number of peptides = 1 || unambiguous || 53.8% Confident
UTRO_HUMAN - (P46939) Utrophin (Dystrophin-related protein 1) (DRP1) (DRP) || Number of peptides = 1 || unambiguous || 53.7% Confident
Q13088 - (Q13088) ZEB (Fragment) || Number of peptides = 1 || unambiguous || 53.7% Confident
Q9UFA4 - (Q9UFA4) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 53.6% Confident
Z298_HUMAN - (P57071) Zinc finger protein 298 (PR-domain zinc finger protein 15) (Fragment) || Number of peptides = 1 || unambiguous || 53.5% Confident
Q61625 - (Q61625) Glutamate receptor delta-2 subunit precursor || Number of peptides = 1 || unambiguous || 53.5% Confident
CA1A_MOUSE - (Q05306) Collagen alpha 1(X) chain precursor || Number of peptides = 1 || unambiguous || 53.4% Confident
ARSF_HUMAN - (P54793) Arylsulfatase F precursor (EC 3.1.6.-) (ASF) || Number of peptides = 1 || ambiguous || 53.4% Confident
TCO1_HUMAN - (P20061) Transcobalamin I precursor (TCI) (TC I) || Number of peptides = 1 || unambiguous || 53.3% Confident
Q9H9L6 - (Q9H9L6) Hypothetical protein FLJ12668 || Number of peptides = 1 || unambiguous || 53.3% Confident
HO2_MOUSE - (O70252) Heme oxygenase 2 (EC 1.14.99.3) (HO-2) || Number of peptides = 1 || unambiguous || 53.3% Confident
Q9C0B6 - (Q9C0B6) Hypothetical protein KIAA1747 (Fragment) || Number of peptides = 1 || unambiguous || 53.2% Confident
E2K3_MOUSE - (Q9Z2B5) Eukaryotic translation initiation factor 2-alpha kinase 3 precursor (EC 2.7.1.-) (PRKR-like endoplasmic reticulum kinase) (Pancreatic eIF2-alpha kinase) || Number of peptides = 1 || unambiguous || 53.2% Confident
ATX7_HUMAN - (O15265) Ataxin-7 (Spinocerebellar ataxia type 7 protein) || Number of peptides = 1 || unambiguous || 53.2% Confident
Q8VCJ5 - (Q8VCJ5) Hypothetical 61.5 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 53.1% Confident
Q9CWM7 - (Q9CWM7) 2410017I18Rik protein || Number of peptides = 1 || unambiguous || 53.1% Confident
CDB5_HUMAN - (Q9Y5E4) Protocadherin beta 5 precursor (PCDH-beta5) || Number of peptides = 1 || unambiguous || 53.0% Confident
RGSI_HUMAN - (Q9NS28) Regulator of G-protein signaling 18 (RGS18) || Number of peptides = 1 || unambiguous || 53.0% Confident
Q64706 - (Q64706) Tenascin C precursor || Number of peptides = 1 || unambiguous || 53.0% Confident
Q9NXX8 - (Q9NXX8) FLJ00007 protein (Fragment) || Number of peptides = 1 || unambiguous || 53.0% Confident
Q96JB1 - (Q96JB1) Axonemal dynein heavy chain 8 || Number of peptides = 2 || unambiguous || 53.0% Confident
Q9D9R1 - (Q9D9R1) Adult male testis cDNA, RIKEN full-length enriched library, clone:1700030N20, full insert sequence || Number of peptides = 2 || ambiguous || 52.9% Confident
O00188 - (O00188) LLGL protein || Number of peptides = 1 || unambiguous || 52.9% Confident
Q61480 - (Q61480) TRAF5 || Number of peptides = 1 || ambiguous || 52.9% Confident
Q9CSW1 - (Q9CSW1) 2610111I01Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 52.8% Confident
MAP2_HUMAN - (P11137) Microtubule-associated protein 2 (MAP 2) (MAP2B) [Contains: MAP2C] || Number of peptides = 1 || unambiguous || 52.8% Confident
MTN4_MOUSE - (O89029) Matrilin-4 precursor (MAT-4) || Number of peptides = 1 || unambiguous || 52.8% Confident
C1QA_HUMAN - (P02745) Complement C1q subcomponent, A chain precursor || Number of peptides = 1 || unambiguous || 52.8% Confident
Q96M04 - (Q96M04) Hypothetical protein FLJ32933 || Number of peptides = 1 || unambiguous || 52.8% Confident
PSD4_MOUSE - (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) || Number of peptides = 1 || ambiguous || 52.8% Confident
Q9H7C4 - (Q9H7C4) Hypothetical protein FLJ21054 || Number of peptides = 1 || unambiguous || 52.8% Confident
GIT1_HUMAN - (Q9Y2X7) ARF GTPase-activating protein GIT1 (G protein-coupled receptor kinase-interactor 1) || Number of peptides = 1 || unambiguous || 52.7% Confident
O14637 - (O14637) Laminin alpha 3b chain (Fragment) || Number of peptides = 1 || unambiguous || 52.7% Confident
Q96L91 - (Q96L91) P400 SWI2/SNF2-related protein || Number of peptides = 1 || unambiguous || 52.7% Confident
PTND_HUMAN - (Q12923) Protein tyrosine phosphatase, non-receptor type 13 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (PTP-BAS) (Protein-tyrosine phosphatase PTPL1) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1) || Number of peptides = 1 || unambiguous || 52.6% Confident
CA44_HUMAN - (P53420) Collagen alpha 4(IV) chain precursor || Number of peptides = 1 || unambiguous || 52.6% Confident
FMN1_MOUSE - (Q05860) Formin 1 isoforms I/II/III (Limb deformity protein) || Number of peptides = 1 || unambiguous || 52.6% Confident
Q8TED9 - (Q8TED9) FLJ00258 protein (Fragment) || Number of peptides = 1 || unambiguous || 52.5% Confident
SOX1_HUMAN - (O00570) SOX-1 protein || Number of peptides = 1 || unambiguous || 52.5% Confident
Q8TBM9 - (Q8TBM9) Hypothetical protein || Number of peptides = 1 || unambiguous || 52.5% Confident
CADD_MOUSE - (Q9WTR5) Cadherin-13 precursor (Truncated-cadherin) (T-cadherin) (T-cad) (Heart-cadherin) (H-cadherin) || Number of peptides = 1 || unambiguous || 52.5% Confident
Q8TAP6 - (Q8TAP6) Hypothetical protein || Number of peptides = 1 || unambiguous || 52.5% Confident
CALG_MOUSE - (P52194) Calmegin precursor (MEG 1 antigen) (Calnexin-T) (A2/6) || Number of peptides = 1 || unambiguous || 52.5% Confident
Q9D0L4 - (Q9D0L4) 2610005A10Rik protein (RIKEN cDNA 2610005A10 gene) || Number of peptides = 1 || unambiguous || 52.5% Confident
O14712 - (O14712) Cell cycle progression restoration 8 protein || Number of peptides = 1 || ambiguous || 52.4% Confident
FA5_HUMAN - (P12259) Coagulation factor V precursor (Activated protein C cofactor) || Number of peptides = 1 || unambiguous || 52.4% Confident
CAP2_HUMAN - (P40123) Adenylyl cyclase-associated protein 2 (CAP 2) || Number of peptides = 1 || unambiguous || 52.4% Confident
S11Y_HUMAN - (Q9UDP3) Putative S100 calcium-binding protein H_NH0456N16.1 || Number of peptides = 1 || unambiguous || 52.4% Confident
IF41_HUMAN - (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) || Number of peptides = 1 || ambiguous || 52.4% Confident
Q96QH2 - (Q96QH2) Adaptor molecule-1 || Number of peptides = 1 || unambiguous || 52.3% Confident
SPCA_HUMAN - (P02549) Spectrin alpha chain, erythrocyte (Erythroid alpha-spectrin) || Number of peptides = 1 || unambiguous || 52.3% Confident
O95381 - (O95381) Connector enhancer of KSR-like protein CNK1 || Number of peptides = 1 || unambiguous || 52.2% Confident
NCR2_HUMAN - (Q9Y618) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC) (CTG26) || Number of peptides = 1 || unambiguous || 52.2% Confident
Q9NV14 - (Q9NV14) Hypothetical protein FLJ10997 || Number of peptides = 1 || unambiguous || 52.2% Confident
TRFE_HUMAN - (P02787) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) (PRO1400) || Number of peptides = 1 || unambiguous || 52.2% Confident
DVL2_MOUSE - (Q60838) Segment polarity protein dishevelled homolog DVL-2 (Dishevelled-2) (DSH homolog 2) || Number of peptides = 1 || unambiguous || 52.2% Confident
Q9QWR8 - (Q9QWR8) Alpha-N-acetylgalactosaminidase (EC 3.2.1.49) || Number of peptides = 1 || ambiguous || 52.1% Confident
PSB4_MOUSE - (P99026) Proteasome subunit beta type 4 precursor (EC 3.4.25.1) (Proteasome beta chain) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome chain 3) || Number of peptides = 1 || unambiguous || 52.0% Confident
Q9CXG8 - (Q9CXG8) 3322402E17Rik protein || Number of peptides = 1 || unambiguous || 52.0% Confident
Q92815 - (Q92815) Cytoplasmic dynein 2 heavy chain (Fragment) || Number of peptides = 1 || unambiguous || 51.9% Confident
FZD3_MOUSE - (Q61086) Frizzled 3 precursor (Frizzled-3) (Fz-3) (mFz3) || Number of peptides = 1 || ambiguous || 51.9% Confident
DEK_HUMAN - (P35659) DEK protein || Number of peptides = 1 || unambiguous || 51.9% Confident
Q9H6L0 - (Q9H6L0) Hypothetical protein FLJ22170 || Number of peptides = 1 || unambiguous || 51.9% Confident
ARRS_HUMAN - (P10523) S-arrestin (Retinal S-antigen) (48 kDa protein) (S-AG) (Rod photoreceptor arrestin) || Number of peptides = 1 || unambiguous || 51.9% Confident
NAC1_MOUSE - (P70414) Sodium/calcium exchanger 1 precursor (Na(+)/Ca(2+)-exchange protein 1) || Number of peptides = 1 || unambiguous || 51.9% Confident
Q9D693 - (Q9D693) 4631423C22Rik protein || Number of peptides = 1 || ambiguous || 51.9% Confident
O2H2_HUMAN - (O95918) Olfactory receptor 2H2 (Hs6M1-12) || Number of peptides = 1 || ambiguous || 51.7% Confident
Q9H2T8 - (Q9H2T8) Ribeye || Number of peptides = 1 || unambiguous || 51.7% Confident
PGCV_HUMAN - (P13611) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP) || Number of peptides = 1 || unambiguous || 51.6% Confident
K6B2_HUMAN - (Q9UBS0) Ribosomal protein S6 kinase beta 2 (EC 2.7.1.-) (S6K-beta 2) (70 kDa ribosomal protein S6 kinase 2) (p70-S6KB) (p70 ribosomal S6 kinase beta) (p70 S6Kbeta) (S6K2) (S6 kinase-related kinase) (SRK) (Serine/threonine-protein kinase 14 beta) || Number of peptides = 1 || unambiguous || 51.6% Confident
TRFL_MOUSE - (P08071) Lactotransferrin precursor (Lactoferrin) || Number of peptides = 1 || unambiguous || 51.6% Confident
GFAP_MOUSE - (P03995) Glial fibrillary acidic protein, astrocyte (GFAP) || Number of peptides = 1 || unambiguous || 51.5% Confident
Q9P0T3 - (Q9P0T3) HSPC190 || Number of peptides = 1 || unambiguous || 51.5% Confident
Q9CVT4 - (Q9CVT4) 1700037B06Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 51.5% Confident
Z268_HUMAN - (Q14587) Zinc finger protein 268 (Zinc finger protein HZF3) || Number of peptides = 1 || unambiguous || 51.4% Confident
PUR6_MOUSE - (Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)] || Number of peptides = 1 || unambiguous || 51.4% Confident
HME2_MOUSE - (P09066) Homeobox protein engrailed-2 (Mo-En-2) || Number of peptides = 1 || unambiguous || 51.4% Confident
Q9D3C5 - (Q9D3C5) 5830493J20Rik protein || Number of peptides = 1 || unambiguous || 51.4% Confident
WDRB_HUMAN - (Q9BZH6) WD-repeat protein 11 || Number of peptides = 1 || unambiguous || 51.4% Confident
Q9DBK7 - (Q9DBK7) 1300004C08Rik protein || Number of peptides = 1 || unambiguous || 51.4% Confident
Q9H760 - (Q9H760) Hypothetical protein FLJ21277 || Number of peptides = 1 || unambiguous || 51.3% Confident
Q62029 - (Q62029) POLY A binding protein 2 (POLYA binding protein, testis-enriched isoform) || Number of peptides = 1 || unambiguous || 51.3% Confident
AS15_HUMAN - (Q8WXK1) Ankyrin repeat and SOCS box containing protein 15 (ASB-15) (Fragment) || Number of peptides = 1 || unambiguous || 51.3% Confident
Q9D3F6 - (Q9D3F6) 5830413L19Rik protein (MS4A4C protein) || Number of peptides = 1 || unambiguous || 51.3% Confident
SH31_MOUSE - (Q62419) SH3-containing GRB2-like protein 1 (SH3 domain protein 2B) (SH3p8) || Number of peptides = 1 || unambiguous || 51.1% Confident
Q9BZF9 - (Q9BZF9) Uveal autoantigen || Number of peptides = 1 || unambiguous || 51.1% Confident
Q99J62 - (Q99J62) Similar to replication factor C (Activator 1) 4 (37kD) || Number of peptides = 1 || unambiguous || 51.1% Confident
SN1L_MOUSE - (Q60670) Probable serine/threonine protein kinase SNF1LK (EC 2.7.1.-) (HRT-20) (Myocardial SNF1-like kinase) || Number of peptides = 1 || unambiguous || 51.1% Confident
Q8VDQ1 - (Q8VDQ1) Similar to RIKEN cDNA B830026H24 gene || Number of peptides = 1 || unambiguous || 51.1% Confident
RAG2_MOUSE - (P21784) V(D)J recombination activating protein 2 (RAG-2) || Number of peptides = 1 || unambiguous || 51.1% Confident
Q9NSJ3 - (Q9NSJ3) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 51.0% Confident
NETR_MOUSE - (O08762) Neurotrypsin precursor (EC 3.4.21.-) (Motopsin) (Brain-specific serine protease 3) (BSSP-3) || Number of peptides = 1 || unambiguous || 51.0% Confident
RBL2_HUMAN - (Q08999) Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (PRB2) (P130) (RBR-2) || Number of peptides = 1 || unambiguous || 51.0% Confident
Q9GZQ3 - (Q9GZQ3) Hypothetical protein FLJ13008 (HT002 protein, hypertension-related calcium-regulated gene) || Number of peptides = 1 || unambiguous || 51.0% Confident
SHH_HUMAN - (Q15465) Sonic hedgehog protein precursor (SHH) (HHG-1) || Number of peptides = 1 || unambiguous || 51.0% Confident
Q8TAC1 - (Q8TAC1) Hypothetical gene supported by XM_059671 || Number of peptides = 1 || unambiguous || 51.0% Confident
GLP1_HUMAN - (P43220) Glucagon-like peptide 1 receptor precursor (GLP-1 receptor) (GLP-1-R) (GLP-1R) || Number of peptides = 1 || unambiguous || 51.0% Confident
MLEV_HUMAN - (P08590) Myosin light chain 1, slow-twitch muscle B/ventricular isoform (MLC1SB) (Alkali) || Number of peptides = 1 || unambiguous || 50.9% Confident
Q96NJ6 - (Q96NJ6) Hypothetical protein FLJ30726 || Number of peptides = 1 || unambiguous || 50.9% Confident
AAC4_MOUSE - (P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) || Number of peptides = 1 || unambiguous || 50.9% Confident
Q9GZW2 - (Q9GZW2) Hypothetical protein FLJ23544 || Number of peptides = 1 || unambiguous || 50.8% Confident
PRDG_HUMAN - (Q9HAZ2) PR-domain zinc finger protein 16 || Number of peptides = 1 || ambiguous || 50.7% Confident
Q9QUS3 - (Q9QUS3) BAMACAN || Number of peptides = 1 || ambiguous || 50.7% Confident
KIT_HUMAN - (P10721) Mast/stem cell growth factor receptor precursor (EC 2.7.1.112) (SCFR) (Proto-oncogene tyrosine-protein kinase Kit) (c-kit) (CD117 antigen) || Number of peptides = 1 || unambiguous || 50.7% Confident
BMP5_MOUSE - (P49003) Bone morphogenetic protein 5 precursor (BMP-5) || Number of peptides = 1 || unambiguous || 50.7% Confident
Q9D2E0 - (Q9D2E0) 2310005B10Rik protein || Number of peptides = 1 || unambiguous || 50.7% Confident
Q9R004 - (Q9R004) Breast cancer resistance protein 1 || Number of peptides = 1 || unambiguous || 50.7% Confident
DDB2_HUMAN - (Q92466) DNA damage binding protein 2 (Damage-specific DNA binding protein 2) (DDB p48 subunit) (DDBb) (UV-damaged DNA-binding protein 2) (UV-DDB 2) || Number of peptides = 1 || unambiguous || 50.7% Confident
Q15662 - (Q15662) Transformation-related protein (Fragment) || Number of peptides = 1 || unambiguous || 50.7% Confident
Q8VDC1 - (Q8VDC1) FYVE and coiled-coil domain containing 1 || Number of peptides = 1 || unambiguous || 50.6% Confident
Q99N54 - (Q99N54) Synaptotagmin-like protein 3-a || Number of peptides = 1 || unambiguous || 50.6% Confident
M3K2_HUMAN - (Q9Y2U5) Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.1.-) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2) || Number of peptides = 1 || unambiguous || 50.6% Confident
EAR2_HUMAN - (P10588) Orphan nuclear receptor EAR-2 (V-erbA related protein EAR-2) || Number of peptides = 1 || unambiguous || 50.5% Confident
CYH1_MOUSE - (Q9QX11) Cytohesin 1 (CLM1) || Number of peptides = 1 || ambiguous || 50.5% Confident
Q9BTR0 - (Q9BTR0) Hypothetical protein || Number of peptides = 1 || unambiguous || 50.4% Confident
BMP4_MOUSE - (P21275) Bone morphogenetic protein 4 precursor (BMP-4) (BMP-2B) || Number of peptides = 1 || unambiguous || 50.4% Confident
GNL1_MOUSE - (P36916) Guanine nucleotide-binding protein-like 1 (GTP-binding protein MMR1) || Number of peptides = 1 || unambiguous || 50.4% Confident
Q8VGQ4 - (Q8VGQ4) Olfactory receptor MOR184-7 || Number of peptides = 1 || unambiguous || 50.4% Confident
Q9R1J1 - (Q9R1J1) Serine/threonine-protein kinase NEK4 || Number of peptides = 1 || ambiguous || 50.3% Confident
CGD3_MOUSE - (P30282) G1/S-specific cyclin D3 || Number of peptides = 1 || unambiguous || 50.2% Confident
Q99LJ7 - (Q99LJ7) Similar to chromosome condensation 1-like || Number of peptides = 1 || ambiguous || 50.2% Confident
RN14_HUMAN - (Q9UBS8) RING finger protein 14 (Androgen receptor-associated protein 54) (Triad2 protein) (HFB30) || Number of peptides = 1 || unambiguous || 50.1% Confident
HB2D_MOUSE - (P01921) H-2 class II histocompatibility antigen, A-D beta chain precursor || Number of peptides = 1 || unambiguous || 50.1% Confident
Q9BZ66 - (Q9BZ66) Cytochrome P450 2S1 || Number of peptides = 1 || ambiguous || 50.1% Confident
Q8VHE6 - (Q8VHE6) Axonemal dynein heavy chain 5 || Number of peptides = 1 || unambiguous || 50.1% Confident
Q9H0P0 - (Q9H0P0) Hypothetical protein || Number of peptides = 1 || unambiguous || 50.1% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/archive/2003/2002-TK-LungDevo/NMyc_cyto/lung_NMyc_cyto_1
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
UKPY2_MOUSE99.6%266619.4%530577567.5(P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40)
*	TK050203_NMyc_cyto1_step02.2908.2908.2	4.6658	0.6096	2302.85	1	5000.0%	1	R.RLAPITSDPTEAAAVGAVEASFK.C
	TK050203_NMyc_cyto1_step10.1867.1867.2	3.4127	0.604	1886.3	1	5670.0%	5	R.LNFSHGTHEYHAETIK.N
	TK050203_NMyc_cyto1_step01.2240.2240.1	1.4247	0.1586	935.51	2	5710.0%	2	R.GIFPVLCK.D
	TK050203_NMyc_cyto1_step01.2468.2468.1	2.1305	0.3076	1470.61	2	4500.0%	2	K.CDENILWLDYK.N
*	TK050203_NMyc_cyto1_step01.2860.2860.2	3.331	0.5299	2494.58	1	4320.0%	1	R.EATESFASDPILYRPVAVALDTK.G
	TK050203_NMyc_cyto1_step05.3090.3090.2	3.5814	0.4549	1933.96	1	5670.0%	2	R.EAEAAIYHLQLFEELR.R
	TK050203_NMyc_cyto1_step01.2626.2626.1	2.3851	0.4319	1466.66	1	4580.0%	4	K.IYVDDGLISLQVK.E
UQ922Y799.6%113%464510285.3(Q922Y7) Unknown (Protein for MGC:6388)
	TK050203_NMyc_cyto1_step05.2678.2678.1	3.0712	0.4926	1518.42	1	5710.0%	1	R.LLIHQSLAGGIIGVK.G
UCYPH_MOUSE99.6%146034.4%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18)
	TK050203_NMyc_cyto1_step06.2645.2645.2	4.0321	0.6526	2795.25	1	3850.0%	5	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
	TK050203_NMyc_cyto1_step01.2386.2386.1	2.0005	0.2756	1057.83	1	7500.0%	5	R.VSFELFADK.V
	TK050203_NMyc_cyto1_step03.1608.1608.1	1.6555	0.3718	687.37	1	8000.0%	3	K.HVVFGK.V
*	TK050203_NMyc_cyto1_step02.3129.3129.2	3.802	0.5645	2007.49	1	5880.0%	1	-.VNPTVFFDITADDEPLGR.V
UQ8R2X099.6%463.6%443500256.4(Q8R2X0) Similar to EH-domain containing 2
	TK050203_NMyc_cyto1_step05.1983.1983.2	3.7006	0.5159	2022.09	1	4690.0%	2	K.IQLEHHISPGDFPDCQK.M
UPMGE_MOUSE99.6%357%258298477.1(P15327) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM)
*	TK050203_NMyc_cyto1_step05.2385.2385.2	3.4676	0.2742	1992.64	1	5000.0%	2	R.AVGPHQFLGNQEAIQAAIK.K
UQ8VC3099.6%8103.5%578596916.9(Q8VC30) Similar to DKFZP586B1621 protein
	TK050203_NMyc_cyto1_step10.2267.2267.2	4.4798	0.6239	1962.6	1	5000.0%	1	R.VALLSGGGSGHEPAHAGFIGK.G
UGTP1_MOUSE99.6%5922.5%209234067.8(P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi)
	TK050203_NMyc_cyto1_step01.1723.1723.1	1.4717	0.1467	1279.74	3	4500.0%	1	R.MLLADQGQSWK.E
	TK050203_NMyc_cyto1_step12.2417.2417.2	5.1363	0.6012	2137.3	1	6050.0%	2	K.ALPGHLKPFETLLSQNQGGK.A
	TK050203_NMyc_cyto1_step03.1836.1836.2	2.489	0.4349	2068.03	1	4440.0%	2	K.AFLSSPEHVNRPINGNGKQ.-
UTAG2_MOUSE99.6%128622.6%212235977.1(Q9WVA4) Transgelin 2
*	TK050203_NMyc_cyto1_step01.1628.1628.1	2.5516	0.4774	1529.56	1	4620.0%	1	K.LINSLYPEGQAPVK.K
	TK050203_NMyc_cyto1_step01.3524.3524.2	4.2138	0.6184	2104.08	1	5880.0%	2	R.YGINTTDIFQTVDLWEGK.N
	TK050203_NMyc_cyto1_step06.3911.3911.2	4.0911	0.5884	2396.28	1	5830.0%	9	K.QYDADLEQILIQWITTQCR.E
USPCN_HUMAN99.6%990.7%24722842815.3(Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
	TK050203_NMyc_cyto1_step08.1992.1992.1	1.4866	0.2816	847.52	1	8000.0%	1	R.LHQFFR.D
*	TK050203_NMyc_cyto1_step07.1690.1690.2	3.5904	0.5871	1557.72	1	7690.0%	1	K.HQALQAEIAGHEPR.I
UQ8VDM499.6%682%9081002035.2(Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2)
	TK050203_NMyc_cyto1_step10.3618.3618.2	2.9892	0.441	2017.51	1	5000.0%	2	K.GEAIEAILAALEVVSEPFR.S
UQ91Y3799.6%465.3%623695665.6(Q91Y37) Cytosolic aminopeptidase P
	TK050203_NMyc_cyto1_step11.3132.3132.3	6.7029	0.6633	3633.15	1	2880.0%	2	R.SALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYK.T
UG3P_MOUSE99.6%4132538.6%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH)
	TK050203_NMyc_cyto1_step10.2711.2711.2	4.277	0.5508	2370.55	1	5000.0%	2	K.RVIISAPSADAPMFVMGVNHEK.Y
*	TK050203_NMyc_cyto1_step02.3004.3004.2	4.348	0.6275	2293.6	1	4750.0%	7	K.WGEAGAEYVVESTGVFTTMEK.A
*	TK050203_NMyc_cyto1_step01.1019.1019.1	2.1671	0.4203	1371.67	2	4290.0%	11	R.GAAQNIIPASTGAAK.A
*	TK050203_NMyc_cyto1_step02.3881.3881.3	4.1005	0.3623	4053.44	1	2030.0%	8	K.GILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVK.L
	TK050203_NMyc_cyto1_step01.1886.1886.1	1.8462	0.31	1558.67	1	4620.0%	2	R.VPTPNVSVVDLTCR.L
	TK050203_NMyc_cyto1_step07.3543.3543.2	4.6063	0.5605	2599.87	1	4780.0%	9	K.VIHDNFGIVEGLMTTVHAITATQK.T
UMYO6_MOUSE99.6%682.9%12651464098.8(Q64331) Myosin VI
*	TK050203_NMyc_cyto1_step10.1786.1786.2	4.1732	0.445	1850.18	1	5670.0%	1	R.LPQPSDQHFTSVVHQK.H
*	TK050203_NMyc_cyto1_step02.1477.1477.1	1.6956	0.1533	1286.6	3	5000.0%	1	K.DGKPEVNRQIK.N
	TK050203_NMyc_cyto1_step07.2511.2511.2	3.7107	0.5855	1587.72	1	8330.0%	1	K.TVYSHLFDHVVNR.V
UCAP1_MOUSE99.6%6811.6%474515757.5(P40124) Adenylyl cyclase-associated protein 1 (CAP 1)
	TK050203_NMyc_cyto1_step02.1750.1750.1	1.4554	0.2802	811.53	4	6000.0%	1	K.HVDWVR.A
	TK050203_NMyc_cyto1_step07.1559.1559.1	2.1929	0.358	1124.47	1	6670.0%	2	K.HAEMVHTGLK.L
	TK050203_NMyc_cyto1_step02.2693.2693.2	3.9103	0.5528	1930.4	1	6180.0%	1	R.SALFAQINQGESITHALK.H
	TK050203_NMyc_cyto1_step01.3068.3068.2	2.4902	0.4356	2814.41	1	3120.0%	1	K.SSEMNVLIPTEGGDFNEFPVPEQFK.T
UQ9ER6899.6%112.5%831948606.8(Q9ER68) CysRS protein
	TK050203_NMyc_cyto1_step06.2682.2682.2	3.0486	0.5393	2766.06	1	4520.0%	1	R.FPHHDNELAQSEAYFENDCWVR.Y
UQ91YL699.6%246.3%300340484.8(Q91YL6) Hypothetical 34.0 kDa protein
*	TK050203_NMyc_cyto1_step08.2033.2033.2	3.0501	0.5375	2261.72	1	3420.0%	2	R.LAAAEQYHQILCPGPSHDPR.H
UQ9JJH099.6%228.1%359399947.1(Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase
	TK050203_NMyc_cyto1_step05.1643.1643.1	2.2297	0.3939	1303.54	1	6670.0%	1	R.HLEFSHDQYK.E
	TK050203_NMyc_cyto1_step07.2615.2615.2	2.8299	0.5534	2363.11	1	3500.0%	1	K.HPCFIIAEIGQNHQGDIDVAK.R
URHOA_MOUSE99.6%51124.4%193217826.1(Q9QUI0) Transforming protein RhoA
	TK050203_NMyc_cyto1_step03.1736.1736.1	1.8239	0.3743	1216.45	1	5910.0%	1	K.KLVIVGDGACGK.T
	TK050203_NMyc_cyto1_step01.4083.4083.2	2.7166	0.1084	2776.12	1	2830.0%	3	K.DQFPEVYVPTVFENYVADIEVDGK.Q
	TK050203_NMyc_cyto1_step10.2635.2635.2	4.0285	0.6156	1610.07	1	8080.0%	1	K.HFCPNVPIILVGNK.K
UQ9QYS999.6%246.7%341376718.5(Q9QYS9) QKI-5 protein
	TK050203_NMyc_cyto1_step10.3062.3062.2	4.2672	0.4232	2830.14	1	4130.0%	2	R.GKPNWEHLNEDLHVLITVEDAQNR.A
UTRXB_MOUSE99.6%464.4%499544976.3(Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR)
	TK050203_NMyc_cyto1_step05.3041.3041.2	5.0701	0.7079	2284.93	1	5910.0%	2	R.VVGFHVLGPNAGEVTQGFAAALK.C
UMDHC_MOUSE99.6%5139%333363466.6(P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)
	TK050203_NMyc_cyto1_step02.2264.2264.2	4.9126	0.6163	2281.53	1	6580.0%	3	K.NVIIWGNHSSTQYPDVNHAK.V
	TK050203_NMyc_cyto1_step01.2272.2272.1	1.8962	0.2884	1395.72	3	4550.0%	2	K.FVEGLPINDFSR.E
UIDE_HUMAN99.6%332.3%10181178906.8(P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease)
*	TK050203_NMyc_cyto1_step12.2613.2613.2	4.5545	0.6155	2515.07	1	4350.0%	1	K.SNPGHYLGHLIGHEGPGSLLSELK.S
UACLY_MOUSE99.6%10167.1%10911197287.4(Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme)
*	TK050203_NMyc_cyto1_step07.3599.3599.2	3.046	0.5381	2158.22	1	4720.0%	3	R.SFDELGEIIQSVYEDLVAK.G
*	TK050203_NMyc_cyto1_step08.1722.1722.1	1.5388	0.1859	1158.56	1	7220.0%	1	R.HLLVHAPEDK.K
	TK050203_NMyc_cyto1_step10.2536.2536.2	2.1621	0.3163	1873.22	1	3610.0%	1	K.GVTIIGPATVGGIKPGCFK.I
	TK050203_NMyc_cyto1_step05.1381.1381.1	1.6022	0.2911	1246.59	1	5500.0%	1	R.RGGPNYQEGLR.V
	TK050203_NMyc_cyto1_step01.2914.2914.1	1.6597	0.2612	1569.82	3	3210.0%	1	R.TIAIIAEGIPEALTR.K
*	TK050203_NMyc_cyto1_step02.1252.1252.1	1.4442	0.2612	911.48	1	6250.0%	1	R.LGHEATVGK.A
UQ99LE799.6%354.8%378417827.5(Q99LE7) Similar to paxillin (Fragment)
	TK050203_NMyc_cyto1_step10.2142.2142.2	3.4302	0.5743	2410.25	1	5280.0%	2	K.TWHPEHFVCTHCQEEIGSR.N
UPRS4_HUMAN99.6%114.5%440491856.2(Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4)
	TK050203_NMyc_cyto1_step02.3228.3228.2	3.2986	0.5325	2254.91	1	4750.0%	1	R.VAEEHAPSIVFIDEIDAIGTK.R
UQ91VW399.6%3934.4%93104775.1(Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3
*	TK050203_NMyc_cyto1_step11.3659.3659.3	4.464	0.5195	3828.4	1	2340.0%	3	K.ATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLK.L
UIF6_MOUSE99.6%116.9%245265114.7(O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP))
	TK050203_NMyc_cyto1_step08.2213.2213.2	4.2883	0.5809	2085.78	1	6470.0%	1	R.HGLLVPNNTTDQELQHIR.N
UST13_MOUSE99.6%114.3%371416565.3(Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13)
	TK050203_NMyc_cyto1_step05.2773.2773.2	5.2833	0.6725	1936.23	1	7500.0%	1	R.LLGHWEEAAHDLALACK.L
UO8873899.6%15170.8%48455284296.1(O88738) Ubiquitin-conjugating enzyme
	TK050203_NMyc_cyto1_step10.2956.2956.3	3.9366	0.5826	4351.26	1	2010.0%	1	R.ILASEPDNAEGIHNFAPLGTITSSSPTAQPAEVLLQATPPHR.R
UA1B1_MOUSE99.6%333.8%9431039795.1(O35643) Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta large chain)
*	TK050203_NMyc_cyto1_step11.3528.3528.3	4.1401	0.5618	3810.69	1	2290.0%	1	R.NSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLK.M
UTBA1_HUMAN99.6%289629.7%451501525.1(P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1)
	TK050203_NMyc_cyto1_step01.2694.2694.1	2.2778	0.452	1585.73	1	4580.0%	1	R.SIQFVDWCPTGFK.V
	TK050203_NMyc_cyto1_step02.2885.2885.2	2.1359	0.2937	2754.41	1	2830.0%	4	K.AYHEQLSVAEITNACFEPANQMVK.C
	TK050203_NMyc_cyto1_step06.2722.2722.2	4.2407	0.5624	2333.47	1	5790.0%	4	R.AFVHWYVGEGMEEGEFSEAR.E
	TK050203_NMyc_cyto1_step05.2842.2842.2	3.6775	0.6216	1758.95	1	6000.0%	4	R.IHFPLATYAPVISAEK.A
	TK050203_NMyc_cyto1_step10.3975.3975.2	3.0753	0.4761	2412.26	1	3750.0%	3	R.FDGALNVDLTEFQTNLVPYPR.I
	TK050203_NMyc_cyto1_step01.2691.2691.1	2.1476	0.2981	1087.68	1	6880.0%	1	K.EIIDLVLDR.I
	TK050203_NMyc_cyto1_step07.3086.3086.3	5.8483	0.5975	4301.03	1	2090.0%	3	R.ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDK.T
UIRE1_MOUSE99.6%576%889981407.5(P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase)
	TK050203_NMyc_cyto1_step10.2878.2878.2	1.9902	0.373	2091.98	1	4170.0%	2	R.IIPPGSGIIHQVNLEYLAR.V
	TK050203_NMyc_cyto1_step02.3065.3065.2	2.153	0.4297	2422.96	1	3250.0%	1	K.INPVCPADLVIDHSIQVDFNR.R
	TK050203_NMyc_cyto1_step05.2929.2929.2	4.631	0.5393	1997.36	1	6330.0%	1	K.KNDIENILNWNVMQHK.N
UCOF1_MOUSE99.6%2637826.5%166185608.1(P18760) Cofilin, non-muscle isoform
	TK050203_NMyc_cyto1_step05.1378.1378.1	1.655	0.1047	661.41	1	7000.0%	3	K.KLTGIK.H
	TK050203_NMyc_cyto1_step01.2352.2352.1	1.5109	0.2286	1342.35	1	4230.0%	2	K.LGGSAVISLEGKPL.-
	TK050203_NMyc_cyto1_step01.1446.1446.1	2.0038	0.3959	1339.63	1	5500.0%	2	R.YALYDATYETK.E
*	TK050203_NMyc_cyto1_step07.3355.3355.2	5.439	0.6027	2021.24	1	6560.0%	19	K.KEDLVFIFWAPENAPLK.S
USAHH_MOUSE99.6%462.8%431475576.5(P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP)
	TK050203_NMyc_cyto1_step03.1760.1760.1	2.4929	0.4628	1382.66	1	6250.0%	2	K.KLDEAVAEAHLGK.L
UPDL1_MOUSE99.6%115.5%326357176.8(O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin)
	TK050203_NMyc_cyto1_step07.2431.2431.2	4.4846	0.5577	2105.03	1	5000.0%	1	K.MNLASEPQEVLHIGSAHNR.S
UGC1_MOUSE99.6%5117.1%324357057.4(P01868) Ig gamma-1 chain C region
	TK050203_NMyc_cyto1_step02.3305.3305.2	3.1041	0.4732	2847.96	1	3260.0%	3	K.DDPEVQFSWFVDDVEVHTAQTQPR.E
UCYTB_MOUSE99.6%2420.4%98110467.4(Q62426) Cystatin B (Stefin B)
*	TK050203_NMyc_cyto1_step11.1971.1971.2	3.3296	0.4949	2443.57	1	4250.0%	2	R.VFQPLPHENKPLTLSSYQTNK.E
UTKT_MOUSE99.6%237720.4%623676317.5(P40142) Transketolase (EC 2.2.1.1) (TK) (P68)
*	TK050203_NMyc_cyto1_step08.1529.1529.1	2.2597	0.3456	1164.6	1	7220.0%	2	K.EAWHGKPLPK.N
*	TK050203_NMyc_cyto1_step01.0111.0111.1	1.6481	0.1523	843.52	1	7860.0%	1	K.DAIVQAVK.G
	TK050203_NMyc_cyto1_step05.1422.1422.1	1.6294	0.2917	980.58	3	5000.0%	2	K.HQPTAIIAK.T
	TK050203_NMyc_cyto1_step05.1474.1474.1	2.3713	0.4414	1392.57	1	5420.0%	1	R.KISSDLDGHPVPK.Q
	TK050203_NMyc_cyto1_step02.3441.3441.3	2.7339	0.2909	3973.01	9	1320.0%	1	R.MAAISESNINLCGSHCGVSIGEDGPSQMALEDLAMFR.S
*	TK050203_NMyc_cyto1_step02.3526.3526.2	3.7054	0.6604	2409.63	1	3910.0%	1	K.DDQVTVIGAGVTLHEALAAAESLK.K
*	TK050203_NMyc_cyto1_step01.3439.3439.2	1.9413	0.3831	3193.33	1	2000.0%	6	R.ILTVEDHYYEGGIGEAVSAAVVGEPGVTVTR.L
*	TK050203_NMyc_cyto1_step05.3519.3519.2	1.9225	0.3032	2627.56	1	2400.0%	5	K.SKDDQVTVIGAGVTLHEALAAAESLK.K
UTCPD_MOUSE99.6%71114.8%539580668.0(P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45)
	TK050203_NMyc_cyto1_step01.3816.3816.2	4.2721	0.5974	3030.91	1	3750.0%	2	R.AFADAMEVIPSTLAENAGLNPISTVTELR.N
	TK050203_NMyc_cyto1_step01.3379.3379.1	2.2073	0.2695	1458.94	3	4170.0%	2	R.DALSDLALHFLNK.M
*	TK050203_NMyc_cyto1_step01.2635.2635.1	2.2846	0.2836	1550.69	1	4000.0%	1	R.ALIAGGGAPEIELALR.L
	TK050203_NMyc_cyto1_step02.3212.3212.2	2.5165	0.3514	2624.27	1	3400.0%	1	K.AQDIEAGDGTTSVVIIAGSLLDSCTK.L
UQ9NRF899.6%223.6%586656786.9(Q9NRF8) CTP synthetase isoform (EC 6.3.4.2)
	TK050203_NMyc_cyto1_step08.2305.2305.2	3.7123	0.0476	2530.62	1	3330.0%	1	K.RENFCNIHVSLVPQLSATGEQK.T
UALFA_MOUSE99.6%122422%363392258.1(P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase)
	TK050203_NMyc_cyto1_step01.1303.1303.1	1.4669	0.2987	763.54	1	7500.0%	1	K.VLAAVYK.A
	TK050203_NMyc_cyto1_step02.1469.1469.2	3.4015	0.4428	1648.05	1	6150.0%	2	K.RLQSIGTENTEENR.R
	TK050203_NMyc_cyto1_step02.3017.3017.2	4.1013	0.6161	2109.55	1	6320.0%	2	K.IGEHTPSALAIMENANVLAR.Y
*	TK050203_NMyc_cyto1_step07.1627.1627.1	2.3896	0.371	1379.68	1	6360.0%	3	-.PHPYPALTPEQK.K
	TK050203_NMyc_cyto1_step01.2734.2734.2	3.9086	0.5602	3023.42	1	3650.0%	1	R.YASICQQNGIVPIVEPEILPDGDHDLK.R
	TK050203_NMyc_cyto1_step01.0696.0696.1	1.5024	0.1763	584.22	1	8000.0%	2	R.IVAPGK.G
UPSD1_HUMAN99.6%552.1%9531058665.4(Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112)
*	TK050203_NMyc_cyto1_step02.2853.2853.2	4.3201	0.576	2400.29	1	5000.0%	1	R.TPEQCPSVVSLLSESYNPHVR.Y
UG3P1_HUMAN99.6%121224.2%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12)
*	TK050203_NMyc_cyto1_step01.1019.1019.1	2.1671	0.4203	1371.67	2	4290.0%	11	R.GAAQNLIPASTGAAK.A
UHBA_HUMAN99.6%162569.9%141151268.7(P01922) Hemoglobin alpha chain
*	TK050203_NMyc_cyto1_step01.4650.4650.1	2.7312	0.0048	1531.78	2	6070.0%	16	K.VGAHAGEYGAEALER.M
URAN_HUMAN99.6%92122.2%216244237.5(P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24)
	TK050203_NMyc_cyto1_step10.2706.2706.2	4.375	0.726	2056.16	1	5590.0%	4	K.YVATLGVEVHPLVFHTNR.G
	TK050203_NMyc_cyto1_step12.2313.2313.2	2.653	0.5052	2181.89	1	5280.0%	1	K.KYVATLGVEVHPLVFHTNR.G
	TK050203_NMyc_cyto1_step01.1339.1339.1	1.7635	0.3126	1015.53	1	6500.0%	1	K.LVLVGDGGTGK.T
	TK050203_NMyc_cyto1_step01.1795.1795.1	2.1328	0.2104	1516.58	1	5420.0%	1	R.VCENIPIVLCGNK.V
	TK050203_NMyc_cyto1_step08.1554.1554.1	1.5922	0.2408	1117.59	4	5620.0%	1	K.RHLTGEFEK.K
UPCB1_HUMAN99.6%226.7%356375267.1(Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3)
*	TK050203_NMyc_cyto1_step08.2309.2309.2	2.8675	0.5581	2607.46	1	3540.0%	1	R.QQSHFAMMHGGTGFAGIDSSSPEVK.G
UK22E_HUMAN99.6%102810.7%645658658.0(P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e)
*	TK050203_NMyc_cyto1_step12.2981.2981.3	4.1955	0.5363	4094.2	1	1690.0%	1	R.FGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVK.V
*	TK050203_NMyc_cyto1_step03.1503.1503.1	2.3023	0.3063	1391.56	1	5000.0%	1	R.SKEEAEALYHSK.Y
*	TK050203_NMyc_cyto1_step08.1569.1569.1	2.4299	0.4899	1322.79	1	5000.0%	4	R.HGGGGGGFGGGGFGSR.S
UQ9DCC499.6%116.6%274286947.3(Q9DCC4) 1110058B13Rik protein
	TK050203_NMyc_cyto1_step06.2410.2410.2	4.8487	0.5582	2003.29	1	6110.0%	1	R.TDVLTPAGTTIHGLHALER.G
UQ8VCC999.6%241.6%807908216.0(Q8VCC9) Similar to spondin 1a
	TK050203_NMyc_cyto1_step10.2090.2090.1	2.6869	0.4272	1465.66	1	6540.0%	2	R.ANHWSAIIGGSHSK.N
UHMG1_MOUSE99.6%154315%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30)
	TK050203_NMyc_cyto1_step07.1978.1978.1	1.7599	0.2132	1279.69	1	5000.0%	3	K.GEHPGLSIGDVAK.K
	TK050203_NMyc_cyto1_step08.1928.1928.1	3.289	0.5091	1522.71	1	6430.0%	3	K.IKGEHPGLSIGDVAK.K
	TK050203_NMyc_cyto1_step01.1007.1007.1	1.4308	0.1799	708.45	2	7000.0%	1	K.DIAAYR.A
	TK050203_NMyc_cyto1_step06.1921.1921.1	2.984	0.344	1594.62	1	5380.0%	4	K.KHPDASVNFSEFSK.K
	TK050203_NMyc_cyto1_step02.2088.2088.1	1.6099	0.2515	1465.38	1	5000.0%	2	K.HPDASVNFSEFSK.K
UDPY2_MOUSE99.6%141629.4%572621716.4(O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein)
	TK050203_NMyc_cyto1_step02.2424.2424.2	4.2925	0.4964	2170.78	1	5790.0%	1	R.NLHQSGFSLSGAQIDDNIPR.R
	TK050203_NMyc_cyto1_step01.4579.4579.2	2.2	0.2353	3140.08	1	2240.0%	1	K.AALAGGTTMIIDHVVPEPGTSLLAAFDQWR.E
	TK050203_NMyc_cyto1_step02.2186.2186.1	2.0598	0.2152	1296.53	1	5450.0%	2	R.MVIPGGIDVHTR.F
	TK050203_NMyc_cyto1_step02.2988.2988.2	2.0665	0.3971	2349.04	1	3950.0%	1	K.IVNDDQSFYADIYMEDGLIK.Q
	TK050203_NMyc_cyto1_step05.2514.2514.2	3.6576	0.5447	2554.43	1	3700.0%	1	K.KGTVVYGEPITASLGTDGSHYWSK.N
	TK050203_NMyc_cyto1_step01.1491.1491.1	1.8678	0.0538	1084.64	1	6500.0%	1	R.GSPLVVISQGK.I
*	TK050203_NMyc_cyto1_step02.2844.2844.2	5.4412	0.6239	2072.03	1	6880.0%	1	K.THNSALEYNIFEGMECR.G
*	TK050203_NMyc_cyto1_step06.2329.2329.2	3.3581	0.4831	2050.03	1	5670.0%	1	K.SCCDYSLHVDITEWHK.G
	TK050203_NMyc_cyto1_step02.2834.2834.2	1.7097	0.2751	2902.58	1	2310.0%	1	R.ILDLGITGPEGHVLSRPEEVEAEAVNR.S
UO5480799.6%442.5%11841298006.2(O54807) Ankhzn protein
	TK050203_NMyc_cyto1_step02.2981.2981.2	3.7695	0.6254	2081.76	1	4440.0%	1	K.ANALHATNNLQIIPDFSLK.D
	TK050203_NMyc_cyto1_step07.2262.2262.1	1.8516	0.1871	1455.84	2	5830.0%	1	R.RLESIATTLVSHK.A
UQ9DCZ799.6%355.9%339376354.8(Q9DCZ7) WD40 protein Ciao1
	TK050203_NMyc_cyto1_step07.2530.2530.2	3.7983	0.6299	2382.77	1	5000.0%	2	K.HVVWHPSQELLASASYDDTVK.L
UBUB3_MOUSE99.6%248.3%326369856.7(Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5)
	TK050203_NMyc_cyto1_step06.2774.2774.2	4.5156	0.6593	3190.95	1	3890.0%	2	K.YQHTGAVLDCAFYDPTHAWSGGLDHQLK.M
UQ9D09699.6%227.3%177193188.2(Q9D096) 2610034N03Rik protein
*	TK050203_NMyc_cyto1_step01.2979.2979.1	2.3067	0.4264	1583.83	1	4230.0%	1	R.ILGIPVIITEQYPK.G
UVTDB_MOUSE99.6%114.4%472530865.3(P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment)
*	TK050203_NMyc_cyto1_step01.3983.3983.2	4.0466	0.5066	2442.41	1	4050.0%	1	K.VPTANLENVLPLAEDFTEILSR.C
UQ8VCM799.6%577.1%436493915.9(Q8VCM7) Similar to fibrinogen, gamma polypeptide
	TK050203_NMyc_cyto1_step08.1524.1524.1	2.6955	0.4458	1565.51	1	3930.0%	1	R.LSIGEGQQHHMGGSK.Q
	TK050203_NMyc_cyto1_step10.1638.1638.2	3.8674	0.6112	1989.1	1	6180.0%	2	K.CHAGHLNGVYHQGGTYSK.S
UQ91VC799.6%1114.3%147166497.3(Q91VC7) PKC-potentiated PP1 inhibitory protein (RIKEN cDNA 1110001M11 gene)
*	TK050203_NMyc_cyto1_step01.3708.3708.2	3.943	0.5807	2460.69	1	4760.0%	1	K.IQGLLEACANPTEDFVQELLAK.L
UAPA4_MOUSE99.6%8165.6%395450295.6(P06728) Apolipoprotein A-IV precursor (Apo-AIV)
*	TK050203_NMyc_cyto1_step01.1596.1596.1	2.5347	0.4501	1244.47	3	5000.0%	2	R.SLAPLTVGVQEK.L
*	TK050203_NMyc_cyto1_step01.1698.1698.1	1.7646	0.1784	1312.74	1	6820.0%	1	K.NLAPLVEDVQSK.V
UHS7C_MOUSE99.6%59114717.6%646708715.5(P08109) Heat shock cognate 71 kDa protein
	TK050203_NMyc_cyto1_step02.1385.1385.2	2.9251	0.469	1743.95	1	6540.0%	1	K.NQTAEKEEFEHQQK.E
	TK050203_NMyc_cyto1_step02.2144.2144.1	2.8519	0.5179	1483.76	1	6540.0%	2	K.SQIHDIVLVGGSTR.I
	TK050203_NMyc_cyto1_step02.3194.3194.2	4.0618	0.5828	2260.7	1	5230.0%	1	K.SINPDEAVAYGAAVQAAILSGDK.S
	TK050203_NMyc_cyto1_step01.1340.1340.1	1.6055	0.1535	994.67	3	6250.0%	1	K.EIAEAYLGK.T
	TK050203_NMyc_cyto1_step10.3702.3702.2	3.5127	0.5427	3002.2	1	3650.0%	29	R.TLSSSTQASIEIDSLYEGIDFYTSITR.A
*	TK050203_NMyc_cyto1_step01.2582.2582.1	2.096	0.3564	1280.6	5	5560.0%	1	K.CNEIISWLDK.N
	TK050203_NMyc_cyto1_step06.3542.3542.2	3.1962	0.4834	2517.32	1	3700.0%	17	R.GVPQIEVTFDIDANGILNVSAVDK.S
UQ9DCG999.6%3325.6%125141415.3(Q9DCG9) 0610038D11Rik protein
	TK050203_NMyc_cyto1_step11.1896.1896.1	2.0142	0.3179	1389.63	1	5450.0%	1	K.LLTHNLLSSHVR.G
	TK050203_NMyc_cyto1_step10.2988.2988.2	4.8602	0.6071	2521.71	1	5710.0%	1	K.MHHVLLEVDVLEGTLQCPESGR.L
UQ9DD2199.6%115.6%303344927.3(Q9DD21) 0610006A11Rik protein
	TK050203_NMyc_cyto1_step10.3522.3522.2	4.1255	0.5164	2287.61	1	5880.0%	1	R.VLHEEHIELLMEEFEFLK.R
UGFA1_MOUSE99.6%465.6%680765926.8(P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1)
	TK050203_NMyc_cyto1_step07.1702.1702.1	1.4286	0.2936	1255.36	1	5000.0%	1	K.SVHFPGQAVGTR.R
*	TK050203_NMyc_cyto1_step10.1574.1574.2	3.6183	0.5442	1830.88	1	6000.0%	2	R.WATHGEPNPVNSHPQR.S
	TK050203_NMyc_cyto1_step02.2252.2252.1	2.427	0.4426	1483.59	1	5830.0%	1	R.GYHYATCLEGALK.I
UARF1_HUMAN99.6%6269.4%180205666.8(P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1
	TK050203_NMyc_cyto1_step07.2658.2658.2	3.5561	0.521	2155.3	1	5880.0%	5	R.HYFQNTQGLIFVVDSNDR.E
UTBBX_HUMAN99.6%198719.8%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain
	TK050203_NMyc_cyto1_step10.3276.3276.2	3.519	0.5154	1961.03	1	5000.0%	3	K.GHYTEGAELVDSVLDVVR.K
	TK050203_NMyc_cyto1_step01.2714.2714.2	3.014	0.3804	3105.32	1	2880.0%	3	K.FWEVISDEHGIDPTGTYHGDSDLQLDR.I
	TK050203_NMyc_cyto1_step01.2364.2364.1	1.6532	0.2884	1231.82	1	6110.0%	1	R.ISEQFTAMFR.R
	TK050203_NMyc_cyto1_step06.3089.3089.2	3.9268	0.5314	2800.97	1	4200.0%	8	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK050203_NMyc_cyto1_step01.1271.1271.1	2.0474	0.0021	1446.38	1	6360.0%	1	K.EVDEQMLNVQNK.N
UO8911299.6%225.3%399453417.8(O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1)
*	TK050203_NMyc_cyto1_step05.2805.2805.2	4.7994	0.6043	2539.07	1	5000.0%	1	K.IPQSHIQQICENILTSGENLSR.K
UQ9CR8699.6%1110.1%148160628.2(Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene)
	TK050203_NMyc_cyto1_step05.2865.2865.2	3.7905	0.4951	1677.97	1	5330.0%	1	K.LQAVEVVITHLAPGTK.H
UQ91VC399.6%113.4%411468406.7(Q91VC3) Unknown (Protein for MGC:6715) (Hypothetical 46.8 kDa protein)
	TK050203_NMyc_cyto1_step07.1587.1587.2	3.4357	0.4159	1599.77	1	6070.0%	1	R.KLDYGQHVVAGTPGR.V
UAR20_HUMAN99.6%61417.3%168196678.4(O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4) (O15509) ARP2/3 complex 20 kDa subunit (P20-ARC) (Actin-related protein 2/3 complex subunit 4)
	TK050203_NMyc_cyto1_step07.1342.1342.1	2.2255	0.3027	1109.62	1	6250.0%	2	R.HNKPEVEVR.S
	TK050203_NMyc_cyto1_step07.3163.3163.2	3.2317	0.5866	2663.3	1	3570.0%	3	R.KPVEGYDISFLITNFHTEQMYK.H
USAD1_MOUSE99.6%222.7%627726508.0(Q60710) SAM domain and HD domain-containing protein 1 (Interferon-gamma inducible protein Mg11)
*	TK050203_NMyc_cyto1_step12.2643.2643.2	3.6657	0.5783	2157.21	1	5000.0%	1	K.VFNDPIHGHIEFHPLLIR.I
UTCPZ_MOUSE99.6%72112.1%531580047.1(P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1)
	TK050203_NMyc_cyto1_step01.3270.3270.2	2.7265	0.4656	2546.02	1	3330.0%	2	K.VATAQDDITGDGTTSNVLIIGELLK.Q
*	TK050203_NMyc_cyto1_step10.3595.3595.2	5.8473	0.4619	2238.16	1	6750.0%	4	K.VHAELADVLTEAVVDSILAIR.K
	TK050203_NMyc_cyto1_step05.2666.2666.2	4.148	0.5816	2316.64	1	4250.0%	1	K.DGNVLLHEMQIQHPTASLIAK.V
UUBA1_MOUSE99.6%14406.9%10581178095.7(Q02053) Ubiquitin-activating enzyme E1 1
*	TK050203_NMyc_cyto1_step02.3620.3620.2	2.7194	0.5043	2618.23	1	3860.0%	3	R.IYDDDFFQNLDGVANALDNIDAR.M
	TK050203_NMyc_cyto1_step05.2977.2977.2	2.5027	0.444	2526.07	1	3640.0%	5	R.QLLHNFPPDQLTSSGAPFWSGPK.R
	TK050203_NMyc_cyto1_step03.1868.1868.1	2.7766	0.4388	1244.52	1	5910.0%	1	R.KPLLESGTLGTK.G
	TK050203_NMyc_cyto1_step01.1591.1591.1	1.6728	0.103	813.56	3	7140.0%	1	K.NIILGGVK.A
	TK050203_NMyc_cyto1_step02.1429.1429.1	1.7177	0.1127	1401.55	1	5450.0%	1	K.VVQGHQQLDSYK.N
UPAK2_HUMAN99.6%81614.5%524580056.0(Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase)
*	TK050203_NMyc_cyto1_step06.3418.3418.3	3.8233	0.5079	3974.27	1	1990.0%	1	K.ERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWAR.L
*	TK050203_NMyc_cyto1_step06.1915.1915.2	3.0638	0.4283	2059.07	1	4720.0%	2	K.DPLSANHSLKPLPSVPEEK.K
*	TK050203_NMyc_cyto1_step01.2303.2303.1	1.6009	0.1797	1083.73	2	6250.0%	1	K.YLSFTPPEK.D
*	TK050203_NMyc_cyto1_step07.2742.2742.2	3.4305	0.4121	2081.7	1	5310.0%	3	R.ECLQALEFLHANQVIHR.D
UPMG1_MOUSE99.6%101813.8%253287017.2(Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1)
	TK050203_NMyc_cyto1_step03.1703.1703.1	2.2403	0.3167	1061.56	1	6110.0%	3	R.HYGGLTGLNK.A
	TK050203_NMyc_cyto1_step05.3614.3614.2	3.9065	0.4025	3025.96	1	4040.0%	2	K.HLEGLSEEAIMELNLPTGIPIVYELDK.N
UQ9D91099.6%119.5%210224516.5(Q9D910) 1810013B01Rik protein
*	TK050203_NMyc_cyto1_step06.2326.2326.2	3.2522	0.499	2481.88	1	4250.0%	1	R.VLVMEGAGHPCYLDKPDEWHK.G
UATPB_MOUSE99.6%356.8%529563015.3(P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14)
	TK050203_NMyc_cyto1_step05.3083.3083.3	5.3216	0.5476	3843.85	1	2920.0%	2	K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.A
UA1T3_MOUSE99.6%131455.1%413458545.5(Q00896) Alpha-1-antitrypsin 1-3 precursor (Serine protease inhibitor 1-3) (Alpha-1 protease inhibitor 3)
	TK050203_NMyc_cyto1_step11.4204.4204.2	2.6986	0.4459	2651.76	1	3810.0%	12	R.FDHPFLFIIFEEHTQSPLFVGK.V
UDYNA_MOUSE99.6%333%12811417276.0(O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued)
*	TK050203_NMyc_cyto1_step11.1933.1933.1	1.8099	0.0603	1572.36	7	4170.0%	1	K.VQTRLDETQTLLR.K
*	TK050203_NMyc_cyto1_step10.2318.2318.2	4.2662	0.6212	1688.61	1	6540.0%	1	R.LHISQLQHENSILR.G
	TK050203_NMyc_cyto1_step08.1966.1966.2	3.2401	0.5436	1702.42	1	6150.0%	1	R.LVLTQEQLHQLHSR.L
UPUA2_MOUSE99.6%243.9%456501506.6(P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase)
	TK050203_NMyc_cyto1_step05.2465.2465.2	6.119	0.3793	2211.52	1	7220.0%	2	R.AHIVFDFHQAADGIQEQQR.Q
USRC8_MOUSE99.6%222.6%546612605.4(Q60598) Src substrate cortactin
	TK050203_NMyc_cyto1_step10.1466.1466.2	3.5125	0.4691	1685.91	1	5360.0%	1	K.TVQGSGHQEHINIHK.L
UA2MG_MOUSE99.6%11194.5%14951658276.7(Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M)
*	TK050203_NMyc_cyto1_step02.2132.2132.1	2.2567	0.1268	1188.71	5	6670.0%	1	K.RSELLESLNK.D
*	TK050203_NMyc_cyto1_step05.1327.1327.1	1.5231	0.2672	1031.47	1	5620.0%	1	K.TFHVNSGNR.L
*	TK050203_NMyc_cyto1_step06.3063.3063.2	3.5126	0.494	2604.63	1	3910.0%	3	K.HSLGDNDAHSIFQSVGINIFTNSK.I
*	TK050203_NMyc_cyto1_step05.2827.2827.2	2.5308	0.3584	2348.68	1	3250.0%	1	K.VNTNYRPGLPFSGQVLLVDEK.G
*	TK050203_NMyc_cyto1_step06.1574.1574.1	2.493	0.379	1118.51	1	6880.0%	2	K.KIEHSFEVK.E
UPPS1_MOUSE99.6%353.8%624707946.8(Q60967) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1 (PAPS synthethase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (Sulfate adenylate transferase) (SAT) (ATP-sulfurylase); Adenylylsulfate kinase (EC 2.7.1.25) (Adenylylsulfate 3'-phosphotransferase) (APS kinase) (Adenosine-5'-phosphosulfate 3'-phosphotransferase) (3'-phosphoadenosine-5'-phosphosulfate synthetase)]
	TK050203_NMyc_cyto1_step07.3524.3524.2	2.8475	0.4306	2930.0	1	2710.0%	2	R.QIHEGASLPFFEVFVDAPLHVCEQR.D
UO8830699.6%61414.5%173183526.3(O88306) DJ-1
	TK050203_NMyc_cyto1_step03.1346.1346.1	1.6267	0.2543	866.45	1	7140.0%	2	K.VTTHPLAK.D
	TK050203_NMyc_cyto1_step07.3610.3610.2	2.1599	0.4049	1909.46	1	3060.0%	3	R.GPGTSFEFALAIVEALVGK.D
UHS74_MOUSE99.6%222.1%841941335.2(Q61316) Heat shock 70-related protein APG-2
*	TK050203_NMyc_cyto1_step02.2648.2648.2	4.7901	0.6203	2169.96	1	5830.0%	1	K.KPVVDCVVSVPSFYTDAER.R
UURL1_HUMAN99.6%113.8%548611407.6(Q9NWZ5) Uridine kinase-like 1
*	TK050203_NMyc_cyto1_step05.3133.3133.2	3.442	0.0095	2402.99	2	3810.0%	1	R.GSGNTVAINLIVQHVHSQLEER.E
UQ9Z1R299.6%552.6%11541210375.7(Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3)
*	TK050203_NMyc_cyto1_step10.1542.1542.2	3.2279	0.6359	2818.06	1	3830.0%	1	R.APPQTQLPSGASSGTGSASATHGGAPLPGTR.G
UQ9CZ5699.6%3319.7%132141939.2(Q9CZ56) 2810405J23Rik protein
	TK050203_NMyc_cyto1_step11.3079.3079.2	3.2997	0.5337	2852.85	1	3080.0%	1	K.GAHNGQGLGNAFLSHISACDGIFHLTR.K
UQ9CT0599.6%224.4%654753955.3(Q9CT05) 2610027H02Rik protein (Fragment)
	TK050203_NMyc_cyto1_step07.2520.2520.2	2.9771	0.4624	2241.79	1	4410.0%	1	R.QEFAQHANAFHQWIQETR.T
	TK050203_NMyc_cyto1_step07.2040.2040.1	2.3629	0.5135	1588.53	1	4580.0%	1	K.KHEAFETDFTVHK.D
UQ9CYX999.6%118.2%267302945.0(Q9CYX9) 2810431D22Rik protein
	TK050203_NMyc_cyto1_step05.3015.3015.2	3.6948	0.4304	2636.14	1	3640.0%	1	K.AIGNEVTVDKWEPLLNNLGHVCR.K
UQ9DAS899.6%442.4%637693016.0(Q9DAS8) 1600029N02Rik protein
*	TK050203_NMyc_cyto1_step11.2331.2331.2	4.1489	0.5901	1961.49	1	6670.0%	1	K.LVHLWSSETHQPVWSR.S
UPSDB_HUMAN99.6%225.2%422474646.5(O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5)
*	TK050203_NMyc_cyto1_step10.3308.3308.2	3.225	0.4521	2567.79	1	4090.0%	1	K.KFHGILDQGEGVLIIFDEPPVDK.T
UACTA_HUMAN99.6%185413.8%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2)
	TK050203_NMyc_cyto1_step01.1398.1398.1	2.2893	0.3371	1162.62	1	7000.0%	2	K.EITALAPSTMK.I
	TK050203_NMyc_cyto1_step02.2588.2588.2	3.7494	0.4595	1961.49	1	5670.0%	1	K.YPIEHGIITNWDDMEK.I
	TK050203_NMyc_cyto1_step01.2090.2090.1	1.8094	0.2406	1000.5	1	7140.0%	2	R.DLTDYLMK.I
	TK050203_NMyc_cyto1_step11.2017.2017.1	1.6257	0.1273	1502.88	1	4500.0%	1	K.IWHHSFYNELR.V
	TK050203_NMyc_cyto1_step05.1494.1494.1	2.4352	0.4866	1173.44	1	7500.0%	6	R.HQGVMVGMGQK.D
UQ9D8X599.6%317458.2%292335744.8(Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene)
	TK050203_NMyc_cyto1_step06.3987.3987.2	2.4957	0.0572	2881.99	1	2710.0%	27	K.FNLTEDMYSQDSIDLLANSGLQFQK.H
USPEE_HUMAN99.6%246.6%302338255.5(P19623) Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY)
*	TK050203_NMyc_cyto1_step05.3054.3054.2	3.0832	0.1206	2400.06	1	3750.0%	2	K.HPSVESVVQCEIDEDVIQVSK.K
UTBCA_MOUSE99.6%1115%107126265.3(P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A)
*	TK050203_NMyc_cyto1_step02.3016.3016.2	4.6694	0.5451	2007.16	1	6250.0%	1	R.RLEAAYTDLQQILESEK.D
UQ9QYB199.6%4613.8%253287295.6(Q9QYB1) Intracellular chloride channel protein
	TK050203_NMyc_cyto1_step12.2361.2361.2	4.5857	0.5844	2622.35	1	5000.0%	2	R.KPADLQNLAPGTHPPFITFNSEVK.T
	TK050203_NMyc_cyto1_step01.2988.2988.1	1.6537	0.2019	1588.76	1	5000.0%	1	K.EEDKEPLIELFVK.A
UWDR1_MOUSE99.6%143017.5%606664076.6(O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1)
	TK050203_NMyc_cyto1_step02.2776.2776.2	4.8184	0.5725	2585.89	1	4790.0%	1	K.AHDGGIYAISWSPDSTHLLSASGDK.T
	TK050203_NMyc_cyto1_step11.2784.2784.2	4.4298	0.57	2787.26	1	4380.0%	4	R.LHHVSSLAWLDEHTLVTTSHDASVK.E
	TK050203_NMyc_cyto1_step05.2030.2030.1	1.6968	0.1197	1275.73	1	6000.0%	1	K.KVFASLPQVER.G
*	TK050203_NMyc_cyto1_step02.2513.2513.2	4.1083	0.6123	2422.51	1	4290.0%	2	R.NIDNPAIADIYTEHAHQVVVAK.Y
*	TK050203_NMyc_cyto1_step02.2385.2385.2	3.0239	0.5062	3154.92	1	2780.0%	1	K.SYIYSGSHDGHINYWDSETGENDSFSGK.G
UQ91YR599.6%112.6%698787576.8(Q91YR5) Hypothetical 78.8 kDa protein
	TK050203_NMyc_cyto1_step05.2791.2791.2	3.3813	0.4694	2339.31	1	4440.0%	1	R.RIEGEVNEILFCQLHPEQK.L
UQ9D6F999.6%115.9%444495284.9(Q9D6F9) Tubulin, beta 4
	TK050203_NMyc_cyto1_step02.2842.2842.2	3.376	0.4196	3118.78	1	3080.0%	1	K.FWEVISDEHGIDPTGTYHGDSDLQLER.I
UPDI_MOUSE99.6%133513.4%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59)
	TK050203_NMyc_cyto1_step01.2479.2479.1	1.9728	0.3287	1203.66	1	5560.0%	1	R.EADDIVNWLK.K
	TK050203_NMyc_cyto1_step02.2061.2061.2	2.0446	0.2955	1743.68	1	5000.0%	1	K.LGETYKDHENIIIAK.M
	TK050203_NMyc_cyto1_step07.3546.3546.2	4.6602	0.5937	2987.91	1	3970.0%	5	R.TGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK050203_NMyc_cyto1_step05.2957.2957.2	4.2914	0.6595	1965.78	1	5940.0%	1	K.HNQLPLVIEFTEQTAPK.I
UTCPY_MOUSE99.6%113.8%531581847.7(Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2)
*	TK050203_NMyc_cyto1_step05.2666.2666.2	4.148	0.5816	2316.64	1	4250.0%	1	K.DGNVLLHEMQIQHPTASIIAK.V
UHS9B_MOUSE99.6%162413.3%723831945.0(P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA)
	TK050203_NMyc_cyto1_step06.2342.2342.2	4.1109	0.5011	1783.7	1	8210.0%	2	K.HLEINPDHPIVETLR.Q
	TK050203_NMyc_cyto1_step10.2370.2370.2	4.0542	0.484	1913.03	1	7000.0%	1	K.KHLEINPDHPIVETLR.Q
	TK050203_NMyc_cyto1_step01.3862.3862.2	2.9997	0.507	2374.91	1	5000.0%	1	R.VFIMDSCDELIPEYLNFIR.G
	TK050203_NMyc_cyto1_step05.2002.2002.1	1.5564	0.1136	886.72	1	7500.0%	1	R.RLSELLR.Y
	TK050203_NMyc_cyto1_step02.2946.2946.2	2.1876	0.3941	2603.78	1	3250.0%	1	K.RGFEVVYMTEPIDEYCVQQLK.E
	TK050203_NMyc_cyto1_step02.3150.3150.2	3.8342	0.4894	1810.4	1	6430.0%	1	K.HSQFIGYPITLYLEK.E
	TK050203_NMyc_cyto1_step01.2775.2775.1	1.841	0.309	1456.69	1	5450.0%	1	K.CLELFSELAEDK.E
	TK050203_NMyc_cyto1_step01.2064.2064.1	1.9818	0.376	1351.57	1	5420.0%	3	R.TLTLVDTGIGMTK.A
UHBB1_MOUSE99.6%103142782.9%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major)
	TK050203_NMyc_cyto1_step01.4615.4615.1	1.9652	0.0921	1139.76	1	6360.0%	21	K.VVAGVATALAHK.Y
	TK050203_NMyc_cyto1_step01.2139.2139.2	3.5574	0.5166	1758.48	1	6330.0%	2	K.VITAFNDGLNHLDSLK.G
	TK050203_NMyc_cyto1_step01.1670.1670.1	2.674	0.4398	1468.54	1	4580.0%	9	K.GTFASLSELHCDK.L
	TK050203_NMyc_cyto1_step10.2103.2103.1	1.4594	0.1438	1435.96	2	4230.0%	1	K.VVAGVATALAHKYH.-
*	TK050203_NMyc_cyto1_step01.1542.1542.1	1.4436	0.3311	991.62	1	5620.0%	1	K.AAVSCLWGK.V
	TK050203_NMyc_cyto1_step02.1936.1936.1	1.8915	0.1916	1129.54	3	5620.0%	24	K.LHVDPENFR.L
	TK050203_NMyc_cyto1_step01.1366.1366.1	2.4256	0.2898	1294.46	1	5910.0%	1	K.DFTPAAQAAFQK.V
	TK050203_NMyc_cyto1_step06.2574.2574.2	4.2822	0.6668	2576.47	1	4760.0%	4	K.GTFASLSELHCDKLHVDPENFR.L
	TK050203_NMyc_cyto1_step12.3337.3337.2	2.6818	0.4428	1717.4	1	5000.0%	11	R.LLGNMIVIVLGHHLGK.D
	TK050203_NMyc_cyto1_step01.1111.1111.1	1.983	0.3565	914.48	1	7140.0%	9	-.VHLTDAEK.A
	TK050203_NMyc_cyto1_step02.2829.2829.2	5.5835	0.6496	1981.46	1	6940.0%	3	R.YFDSFGDLSSASAIMGNAK.V
	TK050203_NMyc_cyto1_step01.0108.0108.1	2.2559	0.2238	1304.59	1	6250.0%	7	K.VNSDEVGGEALGR.L
	TK050203_NMyc_cyto1_step06.2514.2514.2	4.3144	0.5412	1886.71	1	6560.0%	6	K.KVITAFNDGLNHLDSLK.G
UO0879599.6%353.8%521587934.5(O08795) Alpha glucosidase II, beta subunit
	TK050203_NMyc_cyto1_step07.2420.2420.2	4.8596	0.7077	2153.75	1	6000.0%	2	K.HGGSPTSLGTWGSWAGPDHDK.F
UEZRI_MOUSE99.6%7155%585692156.1(P26040) Ezrin (p81) (Cytovillin) (Villin 2)
	TK050203_NMyc_cyto1_step05.1467.1467.1	2.4742	0.3851	1493.49	1	5000.0%	1	R.THNDIIHNENMR.Q
	TK050203_NMyc_cyto1_step03.1940.1940.1	1.5868	0.1279	961.64	1	7140.0%	3	K.FVIKPIDK.K
	TK050203_NMyc_cyto1_step06.1487.1487.1	2.2594	0.3723	1473.88	1	5450.0%	2	R.RKPDTIEVQQMK.A
UPDX4_MOUSE99.6%2212.4%274310537.2(O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372)
	TK050203_NMyc_cyto1_step05.2295.2295.2	3.8634	0.5448	2405.33	1	5000.0%	1	K.HGEVCPAGWKPGSETIIPDPAGK.L
*	TK050203_NMyc_cyto1_step02.2696.2696.1	1.9038	0.1665	1477.62	1	5420.0%	1	R.IPLLSDLNHQISK.D
USTA3_MOUSE99.6%462.6%770880546.3(P42227) Signal transducer and activator of transcription 3 (Acute-phase response factor)
	TK050203_NMyc_cyto1_step06.3125.3125.2	2.8012	0.552	2459.34	1	3750.0%	2	K.ESHATLVFHNLLGEIDQQYSR.F
UITH2_MOUSE99.6%6123.9%9461059287.3(Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2)
*	TK050203_NMyc_cyto1_step10.2846.2846.2	4.1766	0.6455	2255.66	1	6050.0%	2	R.FLHVPDTFEGHFQGVPVISK.G
	TK050203_NMyc_cyto1_step11.1248.1248.1	2.4042	0.401	1470.23	1	5420.0%	2	K.AHVSFKPTVAQQR.K
*	TK050203_NMyc_cyto1_step07.1375.1375.1	1.3555	0.3187	792.53	1	7500.0%	2	K.IHLQPGK.L
UQ8VDP399.6%332.2%10481167856.1(Q8VDP3) Similar to hypothetical protein FLJ11937
*	TK050203_NMyc_cyto1_step05.2743.2743.2	3.5598	0.4315	2386.34	1	4130.0%	1	K.NTSHSSGLVSQPSGTPSAILFLGK.L
UFKB4_MOUSE99.6%5512.9%457514415.7(P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59)
*	TK050203_NMyc_cyto1_step02.3206.3206.2	2.6447	0.4528	2752.68	1	2830.0%	1	R.ELCFEVGEGESLDLPCGLEEAIQR.M
*	TK050203_NMyc_cyto1_step05.1770.1770.2	5.1655	0.6469	2492.48	1	5230.0%	1	K.VGEVCHITCKPEYAYGAAGSPPK.I
*	TK050203_NMyc_cyto1_step05.2106.2106.2	2.606	0.4614	1687.47	1	6790.0%	1	R.RGEAHLAVNDFDLAR.A
UQ9CST499.6%118.7%183195295.2(Q9CST4) 5830445C04Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step11.3217.3217.2	4.4648	0.6022	1894.43	1	7190.0%	1	R.VHVQPVITDLVHGLLPR.L
UGBLP_HUMAN99.6%228.2%317350777.7(P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase)
	TK050203_NMyc_cyto1_step08.2088.2088.2	4.0803	0.5751	2746.65	1	3460.0%	1	K.TNHIGHTGYLNTVTVSPDGSLCASGGK.D
UHNT1_MOUSE99.6%41033.6%125136466.9(P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)
	TK050203_NMyc_cyto1_step11.2744.2744.2	2.9975	0.3836	2292.27	1	4210.0%	3	R.CLAFHDISPQAPTHFLVIPK.K
*	TK050203_NMyc_cyto1_step05.3117.3117.2	3.267	0.3885	2594.87	1	3700.0%	1	K.HISQISVADDDDESLLGHLMIVGK.K
UQ9CWE499.6%247.7%271296556.5(Q9CWE4) 2410153K17Rik protein
	TK050203_NMyc_cyto1_step10.3203.3203.2	1.6358	0.4269	2269.25	1	2380.0%	2	K.AGVLPLLTAAITQHGQHADVVR.E
UQ91ZP199.6%395.5%236270548.1(Q91ZP1) Fibrinogen B-beta-chain (Fragment)
*	TK050203_NMyc_cyto1_step02.1650.1650.1	2.7459	0.4982	1510.5	1	5000.0%	3	K.AHYGGFTVQNEASK.Y
UDHCA_MOUSE99.6%3510.5%276305977.8(P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1)
*	TK050203_NMyc_cyto1_step02.2124.2124.1	2.2226	0.3949	1584.77	1	5420.0%	2	R.FHQLDIDNPQSIR.A
*	TK050203_NMyc_cyto1_step07.1926.1926.2	3.2069	0.5426	1932.58	1	4410.0%	1	K.KGVHAEEGWPNSAYGVTK.I
UTHIO_MOUSE99.6%2233033.7%104115444.9(P10639) Thioredoxin (ATL-derived factor) (ADF)
*	TK050203_NMyc_cyto1_step02.3528.3528.2	2.7964	0.3596	2792.75	1	3260.0%	18	K.YSNVVFLEVDVDDCQDVAADCEVK.C
*	TK050203_NMyc_cyto1_step01.1678.1678.1	2.5651	0.3851	1322.72	1	6250.0%	2	K.EAFQEALAAAGDK.L
UHBB0_MOUSE99.6%4413%146162818.6(P04443) Hemoglobin beta-H0 chain
	TK050203_NMyc_cyto1_step02.2077.2077.1	2.4724	0.4398	1588.38	1	5830.0%	1	K.ETFAHLSELHCDK.L
	TK050203_NMyc_cyto1_step02.1493.1493.1	1.8528	0.205	960.5	1	7860.0%	1	-.VHFTAEEK.A
UQ9D7P799.6%336.3%207235516.5(Q9D7P7) 2300003G24Rik protein
*	TK050203_NMyc_cyto1_step05.1943.1943.2	3.8368	0.5856	1626.8	1	7310.0%	1	R.APLDHELAQEPHLR.E
UHS9A_MOUSE99.6%18428.1%732846575.0(P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA)
	TK050203_NMyc_cyto1_step03.1740.1740.1	2.1326	0.3156	1078.45	1	6430.0%	2	K.KFYEQFSK.N
	TK050203_NMyc_cyto1_step01.1963.1963.1	1.9759	0.4117	1516.61	2	4620.0%	2	R.GVVDSEDLPLNISR.E
	TK050203_NMyc_cyto1_step01.3850.3850.2	2.1529	0.3913	2415.44	4	3060.0%	1	R.VFIMDNCEELIPEYLNFIR.G
*	TK050203_NMyc_cyto1_step02.2238.2238.1	2.5858	0.4609	1210.54	1	7780.0%	2	K.HIYFITGETK.D
	TK050203_NMyc_cyto1_step01.2064.2064.1	1.9818	0.376	1351.57	1	5420.0%	3	R.TLTIVDTGIGMTK.A
URET1_MOUSE99.6%1111.2%134157155.2(Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI)
	TK050203_NMyc_cyto1_step02.3241.3241.2	4.4233	0.5823	2000.9	1	6670.0%	1	R.GWTQWIEGDELHLEMR.A
UDYHC_MOUSE99.6%16262.2%46445320306.4(Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain)
	TK050203_NMyc_cyto1_step07.2846.2846.2	2.0755	0.4109	2532.21	1	2500.0%	1	K.TKPVTGNLRPEEALQALTIYEGK.F
	TK050203_NMyc_cyto1_step01.1054.1054.1	1.7309	0.1902	1199.6	6	5000.0%	2	K.TLMAQSIYGGR.V
	TK050203_NMyc_cyto1_step01.3451.3451.2	4.3418	0.5971	2600.82	1	4320.0%	1	R.FGNPLLVQDVESYDPVLNPVLNR.E
	TK050203_NMyc_cyto1_step03.1884.1884.1	1.7368	0.2849	1093.72	2	6880.0%	1	K.HLLPVETQR.F
	TK050203_NMyc_cyto1_step11.2493.2493.2	4.403	0.554	1616.31	1	7920.0%	1	R.KLEHLITELVHQR.D
*	TK050203_NMyc_cyto1_step10.3610.3610.2	3.2144	0.5868	2945.2	1	2880.0%	3	R.MPDGPVALEESYSAVMGIVTEVEQYVK.V
U143Z_MOUSE99.6%71915.9%245277714.8(P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit)
	TK050203_NMyc_cyto1_step01.3511.3511.1	2.3475	0.2856	1420.76	1	6360.0%	4	R.DICNDVLSLLEK.F
	TK050203_NMyc_cyto1_step01.3603.3603.2	4.2961	0.5802	2132.46	1	6110.0%	1	K.TAFDEAIAELDTLSEESYK.D
	TK050203_NMyc_cyto1_step01.1107.1107.1	1.8728	0.1457	1151.55	1	7500.0%	1	R.YLAEVAAGDDK.K
UQ8VDD599.6%661.8%19602263555.7(Q8VDD5) Nonmuscle heavy chain myosin II-A
	TK050203_NMyc_cyto1_step05.1982.1982.1	1.6416	0.1319	1585.67	4	3750.0%	1	K.NKHEAMITDLEER.L
	TK050203_NMyc_cyto1_step02.2344.2344.2	4.4302	0.5253	1770.82	1	7690.0%	1	K.KQELEEICHDLEAR.V
	TK050203_NMyc_cyto1_step02.1969.1969.1	2.4056	0.325	1412.64	1	5450.0%	1	K.KVEAQLQELQVK.F
UQ8R01699.6%6813%455525116.5(Q8R016) Similar to bleomycin hydrolase
	TK050203_NMyc_cyto1_step02.1433.1433.1	2.0542	0.3056	1394.77	1	5000.0%	1	R.VENSWGEDHGHK.G
*	TK050203_NMyc_cyto1_step11.1739.1739.2	3.2327	0.5494	2730.19	1	3540.0%	2	R.ATVQGAQHVFQHVVPQEGKPVTNQK.S
*	TK050203_NMyc_cyto1_step02.3232.3232.2	2.5515	0.3576	2840.72	1	2710.0%	1	K.LNSDPQFVLAQNVGTTHDLLDICLR.R
UANX5_MOUSE99.6%116711%319357525.0(P48036) Annexin V (Lipocortin V) (Endonexin II) (Calphobindin I) (CBP-I) (Placental anticoagulant protein I) (PAP-I) (PP4) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) (Anchorin CII)
*	TK050203_NMyc_cyto1_step02.3432.3432.2	2.2274	0.3037	2676.41	1	2710.0%	8	R.DPDTAIDDAQVELDAQALFQAGELK.W
*	TK050203_NMyc_cyto1_step01.1766.1766.1	1.5331	0.205	1269.68	3	4550.0%	1	R.GTVTDFPGFDGR.A
UQ9Z0P599.6%354.6%349394716.8(Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein)
	TK050203_NMyc_cyto1_step06.2513.2513.2	3.4688	0.4857	1935.17	1	5310.0%	2	K.HQTLQGLAFPLQPEAQR.A
UTALI_MOUSE99.6%16284.2%25412698316.1(P26039) Talin
*	TK050203_NMyc_cyto1_step02.3689.3689.2	2.5688	0.2822	2967.48	4	2120.0%	1	R.YDQATDTILTVTENIFSSMGDAGEMVR.Q
	TK050203_NMyc_cyto1_step02.3290.3290.2	2.3033	0.3211	2718.14	1	2920.0%	1	R.FGQDFSTFLEAGVEMAGQAPSQEDR.A
	TK050203_NMyc_cyto1_step01.3676.3676.2	5.1074	0.6303	2470.68	1	4580.0%	1	R.GVAALTSDPAVQAIVLDTASDVLDK.A
	TK050203_NMyc_cyto1_step06.1947.1947.1	2.6163	0.3595	1337.71	1	5830.0%	4	K.VSHVLAALQAGNR.G
	TK050203_NMyc_cyto1_step05.3657.3657.2	4.6272	0.6324	2092.58	1	5750.0%	1	R.GVGAAATAVTQALNELLQHVK.A
UQ9D7Y099.6%115.2%308331965.8(Q9D7Y0) Bisphosphate 3'-nucleotidase 1
	TK050203_NMyc_cyto1_step06.2758.2758.2	4.0306	0.5835	1883.39	1	6880.0%	1	K.KWDTCAPEVILHAVGGK.L
UO0881799.6%555.4%653704088.8(O08817) CW17 protein
	TK050203_NMyc_cyto1_step07.1908.1908.2	2.2714	0.4013	1373.5	1	7000.0%	1	R.ILRPWQSSETR.S
	TK050203_NMyc_cyto1_step11.2829.2829.2	3.6172	0.4886	2925.15	1	4200.0%	1	R.HTLITEMVALNPDFKPPADYKPPATR.V
UQ921Q599.6%443.2%558608155.6(Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1
	TK050203_NMyc_cyto1_step10.3574.3574.2	4.2054	0.6315	2183.85	1	6390.0%	1	K.LQLVEAGLVECLLEIVQQK.V
UPLSL_MOUSE99.6%795.4%627702025.4(Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65)
	TK050203_NMyc_cyto1_step05.2482.2482.2	4.1383	0.5889	2540.9	1	5240.0%	1	K.YPALHKPENQDIDWGALEGETR.E
	TK050203_NMyc_cyto1_step01.2246.2246.1	2.208	0.3019	1587.7	1	4620.0%	1	R.VYALPEDLVEVNPK.M
UP9782599.6%3914.9%154160815.3(P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1)
*	TK050203_NMyc_cyto1_step06.2458.2458.2	2.9948	0.5732	2530.59	1	3700.0%	3	R.VLRPPGGGSNFSLGFDEPAEQPVR.K
UPMGE_HUMAN99.6%357%258298746.5(P07738) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM)
*	TK050203_NMyc_cyto1_step05.2393.2393.2	2.5659	0.4352	1996.8	1	4170.0%	2	R.AVGPHQFLGDQEAIQAAIK.K
UUBC7_HUMAN99.6%5749.4%154178628.5(P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC)
	TK050203_NMyc_cyto1_step02.3537.3537.2	5.4497	0.6131	2487.77	1	5710.0%	2	K.TDQVIQSLIALVNDPQPEHPLR.A
	TK050203_NMyc_cyto1_step02.3300.3300.2	3.218	0.5075	2852.69	1	4170.0%	1	R.NIQVDEANLLTWQGLIVPDNPPYDK.G
	TK050203_NMyc_cyto1_step02.2668.2668.2	2.6731	0.414	1998.64	1	4410.0%	1	K.GQVCLPVISAENWKPATK.T
	TK050203_NMyc_cyto1_step02.2888.2888.2	3.6461	0.4602	1792.01	1	7500.0%	1	R.IEINFPAEYPFKPPK.I
UWDR1_HUMAN99.6%463.5%606661946.7(O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1)
*	TK050203_NMyc_cyto1_step02.2513.2513.2	4.1083	0.6123	2422.51	1	4290.0%	2	R.NIDNPALADIYTEHAHQVVVAK.Y
UHMG2_MOUSE99.6%94112%209240317.3(P30681) High mobility group protein 2 (HMG-2)
*	TK050203_NMyc_cyto1_step07.2075.2075.1	3.0342	0.418	1580.65	1	6070.0%	6	K.IKIEHPGLSIGDTAK.K
	TK050203_NMyc_cyto1_step02.1981.1981.1	2.284	0.3639	1395.58	1	5000.0%	2	K.KLGEMWSEQSAK.D
UACF7_MOUSE99.6%23351.7%53276079845.5(Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF)
	TK050203_NMyc_cyto1_step02.2294.2294.1	1.8045	0.2106	1480.6	1	4170.0%	1	R.IAQLQEALLHCGK.F
	TK050203_NMyc_cyto1_step02.2353.2353.1	1.846	0.1292	1476.32	1	4580.0%	1	R.YTALVTLTTQHVK.Y
*	TK050203_NMyc_cyto1_step12.2223.2223.2	1.8299	0.2502	2294.38	1	3750.0%	2	R.KGHFSSLELVPPSTLTTTHLK.A
*	TK050203_NMyc_cyto1_step12.2583.2583.3	3.8469	0.5532	4191.73	1	1860.0%	1	K.ARHQELLSQQQNFIVATQSAQSFLDQHSHNLTPEER.Q
	TK050203_NMyc_cyto1_step06.1363.1363.1	1.7596	0.3368	1407.38	1	5910.0%	3	R.ESIAEHKPHIDK.I
*	TK050203_NMyc_cyto1_step10.2698.2698.2	3.2448	0.4984	2166.7	3	4740.0%	1	K.GHFSSLELVPPSTLTTTHLK.A
UENOA_MOUSE99.6%4334528.9%433470106.8(P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1)
*	TK050203_NMyc_cyto1_step01.3347.3347.2	2.6666	0.2793	2971.91	1	3120.0%	2	K.SFVQNYPVVSIEDPFDQDDWGAWQK.F
*	TK050203_NMyc_cyto1_step02.3201.3201.2	2.6553	0.2259	2194.79	1	4210.0%	5	K.AGYTDQVVIGMDVAASEFYR.S
*	TK050203_NMyc_cyto1_step05.3174.3174.3	7.0847	0.0234	3026.01	1	3790.0%	4	R.HIADLAGNPEVILPVPAFNVINGGSHAGNK.L
*	TK050203_NMyc_cyto1_step01.2310.2310.1	2.1794	0.2069	1439.69	1	5450.0%	1	R.YITPDQLADLYK.S
	TK050203_NMyc_cyto1_step02.3964.3964.2	3.0285	0.4621	2357.56	1	4050.0%	12	R.SGETEDTFIADLVVGLCTGQIK.T
*	TK050203_NMyc_cyto1_step01.0903.0903.1	2.0285	0.2143	1072.52	1	6880.0%	2	K.KVNVVEQEK.I
	TK050203_NMyc_cyto1_step02.2210.2210.1	1.7761	0.0122	1542.75	7	3460.0%	1	K.LAQSNGWGVMVSHR.S
UTBA6_MOUSE99.6%115.1%449499095.1(P05216) Tubulin alpha-6 chain (Alpha-tubulin 6)
	TK050203_NMyc_cyto1_step02.2730.2730.2	3.9029	0.5043	2767.78	1	3700.0%	1	K.AYHEQLTVAEITNACFEPANQMVK.C
UPGK1_MOUSE99.6%112518.3%416444057.6(P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3)
	TK050203_NMyc_cyto1_step01.0015.0015.1	1.9735	0.1134	1101.49	1	6880.0%	1	K.NNQITNNQR.I
	TK050203_NMyc_cyto1_step02.3154.3154.2	4.2921	0.3394	1769.51	1	5620.0%	1	K.ALESPERPFLAILGGAK.V
	TK050203_NMyc_cyto1_step01.1947.1947.1	1.808	0.1361	734.5	1	8000.0%	1	K.DVLFLK.D
*	TK050203_NMyc_cyto1_step01.3235.3235.2	4.6097	0.659	2786.04	1	4800.0%	2	K.DCVGPEVENACANPAAGTVILLENLR.F
	TK050203_NMyc_cyto1_step06.1595.1595.1	2.4002	0.3389	1370.37	3	5420.0%	4	R.AHSSMVGVNLPQK.A
*	TK050203_NMyc_cyto1_step01.1846.1846.1	1.6274	0.1088	1219.92	2	5000.0%	1	K.YSLEPVAAELK.S
UEF1G_MOUSE99.6%793.2%437500616.7(Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma)
	TK050203_NMyc_cyto1_step12.1846.1846.2	3.1157	0.6077	1711.87	1	4640.0%	2	R.VLSAPPHFHFGQTNR.T
UA1T2_MOUSE99.6%171519%413459145.5(P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT)
	TK050203_NMyc_cyto1_step11.4204.4204.2	2.6986	0.4459	2651.76	1	3810.0%	12	R.FDHPFLFIIFEEHTQSPIFVGK.V
	TK050203_NMyc_cyto1_step08.2104.2104.1	1.7164	0.151	975.79	1	7860.0%	1	R.LVQIHIPR.L
	TK050203_NMyc_cyto1_step02.1558.1558.1	2.2426	0.1106	1243.52	1	7220.0%	2	K.MQHLEQTLNK.E
UFCL_MOUSE99.6%115.3%321358786.7(P23591) GDP-fucose synthetase (FX protein) (Red cell NADP(H)-binding protein) (Transplantation antigen P35B) (Tum-P35B antigen) [Includes: GDP-mannose-4-keto-6-D epimerase (EC 5.1.3.-); GDP-4-keto-6-L-galactose reductase (EC 1.-.-.-)]
*	TK050203_NMyc_cyto1_step06.2478.2478.2	5.266	0.6556	1992.86	1	7940.0%	1	K.NVHINDNVLHSAFEVGAR.K
ULKHA_MOUSE99.6%7910.5%610688906.4(P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase)
	TK050203_NMyc_cyto1_step11.2937.2937.2	2.6262	0.4068	2406.85	1	4290.0%	1	K.SLSNVIAHEISHSWTGNLVTNK.T
*	TK050203_NMyc_cyto1_step06.1193.1193.1	2.3879	0.2912	1581.62	1	5000.0%	2	K.SHDQAVHTYQEHK.A
	TK050203_NMyc_cyto1_step05.2942.2942.2	2.6859	0.4434	2203.58	1	3120.0%	1	K.TWDHFWLNEGHTVYLER.H
*	TK050203_NMyc_cyto1_step11.2473.2473.2	3.57	0.5625	1810.13	1	6000.0%	1	R.HFHALGGWGELQNTIK.T
UO9488899.6%113.3%490549915.2(O94888) Hypothetical protein KIAA0794 (Fragment)
*	TK050203_NMyc_cyto1_step06.2838.2838.2	3.5019	0.5514	2208.91	1	5940.0%	1	R.EHFIFWQVYHDSEEGQR.Y
UHEM3_MOUSE99.6%225.3%361393027.1(P22907) Porphobilinogen deaminase (EC 4.3.1.8) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) (PBG-D)
*	TK050203_NMyc_cyto1_step10.3566.3566.2	4.5225	0.6238	2201.7	1	5530.0%	1	R.KLDELQEFSAIVLAVAGLQR.M
UCAZ1_MOUSE99.6%225.6%284327525.6(P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment)
	TK050203_NMyc_cyto1_step05.1957.1957.2	5.1306	0.6684	2030.95	1	7500.0%	1	K.IQVHYYEDGNVQLVSHK.D
UQ9D4Y899.6%4616.5%254281988.1(Q9D4Y8) 4930538K18Rik protein
*	TK050203_NMyc_cyto1_step06.3254.3254.3	3.506	0.404	4575.53	2	1310.0%	2	K.LGLELNDFAIFTTFGLASALLLGVDGPLNGFLAIIYVLTTSFR.M
UQ9D89299.6%227.6%198219465.9(Q9D892) 2010016I08Rik protein
	TK050203_NMyc_cyto1_step10.2962.2962.2	3.2312	0.5433	1796.21	1	6330.0%	1	K.LKPEGLHQLLAGFEDK.S
UEML4_HUMAN99.6%222.5%9811089036.3(Q9HC35) Echinoderm microtubule-associated protein-like 4 (EMAP-4) (Restrictedly overexpressed proliferation-associated protein) (Ropp 120)
*	TK050203_NMyc_cyto1_step08.2109.2109.2	3.4853	0.5946	2717.77	1	3800.0%	1	R.LVDEPGHCADFHPSGTVVAIGTHSGR.W
UDCUP_MOUSE99.6%466.8%367405986.7(P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD)
	TK050203_NMyc_cyto1_step07.3551.3551.2	3.1001	0.4771	2817.36	1	2800.0%	2	K.DGHFALEELAQAGYEVVGLDWTVAPK.K
UQ99KS199.6%2215.3%144165117.8(Q99KS1) Hypothetical 16.5 kDa protein (Fragment)
	TK050203_NMyc_cyto1_step11.3055.3055.2	3.2665	0.4644	2553.13	1	3640.0%	1	K.NELHNLLDKPQLQGIPVLVLGNK.R
UQ9CRE799.6%229.6%354399855.5(Q9CRE7) 2410174K12Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step01.3767.3767.2	3.9799	0.4342	2510.95	1	4090.0%	1	R.LFQSFSDALIDGDPQAALEELTK.A
*	TK050203_NMyc_cyto1_step05.2469.2469.1	1.7882	0.2964	1522.64	1	4170.0%	1	R.LLHPIIPEQSTFK.V
UQ99L2099.6%2212%241274037.7(Q99L20) Similar to glutathione S-transferase theta 1
*	TK050203_NMyc_cyto1_step10.3519.3519.2	2.6369	0.5418	3167.78	1	2930.0%	1	R.NQAFLTGSHISVADLVAITELMHPVSAGCK.I
UCABA_MOUSE99.6%469.1%285308317.9(Q99020) CARG-binding factor-A (CBF-A)
*	TK050203_NMyc_cyto1_step02.3277.3277.2	2.8301	0.415	2196.48	1	4440.0%	1	R.EYFGQFGEIEAIELPIDPK.L
	TK050203_NMyc_cyto1_step10.1376.1376.1	2.1913	0.4265	992.5	1	7500.0%	2	K.KFHTVSGSK.C
UCOTR_MOUSE99.6%223.3%418468805.2(P07759) Contrapsin precursor
	TK050203_NMyc_cyto1_step05.2505.2505.2	3.4166	0.4467	1862.26	1	5710.0%	1	R.HFRDEELSCSVLELK.Y
UFAS_MOUSE99.6%9138.1%838912137.7(P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment)
	TK050203_NMyc_cyto1_step05.1885.1885.1	1.4788	0.2365	1073.45	5	6250.0%	2	K.YHGNVTLLR.A
	TK050203_NMyc_cyto1_step07.3548.3548.2	4.3408	0.6115	2449.43	1	5750.0%	1	K.NVTFHGILLDALFEEANDSWR.E
	TK050203_NMyc_cyto1_step05.1659.1659.1	1.6402	0.1838	1263.76	3	4500.0%	2	K.VSVHIIEGDHR.T
	TK050203_NMyc_cyto1_step01.2555.2555.1	1.7538	0.1479	995.98	1	6880.0%	1	K.VLEALLPLK.S
	TK050203_NMyc_cyto1_step02.3680.3680.2	3.0228	0.328	2449.85	1	3410.0%	1	R.TLLEGSGLESIINIIHSSLAEPR.V
UDYI2_MOUSE99.6%6122.8%612683945.3(O88487) Dynein intermediate chain 2, cytosolic (DH IC-2) (Cytoplasmic dynein intermediate chain 2)
	TK050203_NMyc_cyto1_step06.3049.3049.2	3.3771	0.555	2223.43	1	4410.0%	3	K.QQILHSEEFLSFFDHSTR.I
UPHS_HUMAN99.6%2214.6%103118686.8(P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH)
	TK050203_NMyc_cyto1_step07.2007.2007.2	3.8418	0.4531	1811.36	1	6330.0%	1	K.VHITLSTHECAGLSER.D
UQ8R5F299.6%1111.1%271312704.9(Q8R5F2) Hypothetical 31.3 kDa protein
	TK050203_NMyc_cyto1_step10.3572.3572.3	4.7404	0.6435	3681.85	1	3080.0%	1	K.SKEDLVSQGFTEFTIEDFHNTFMDLIEQVEK.Q
UQ9D3B799.6%222.9%445519396.3(Q9D3B7) 6330404L05Rik protein
	TK050203_NMyc_cyto1_step01.3976.3976.1	2.7051	0.3398	1562.05	1	5380.0%	1	R.SFFSEIISSISDVK.F
UNDKA_MOUSE99.6%5715.8%152172087.4(P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1)
	TK050203_NMyc_cyto1_step02.2093.2093.1	1.9363	0.3153	1347.69	1	5910.0%	2	R.TFIAIKPDGVQR.G
	TK050203_NMyc_cyto1_step01.1259.1259.1	2.8147	0.0754	1485.56	1	6150.0%	1	R.NIIHGSDSVKSAEK.E
UASNS_MOUSE99.6%353%560641526.6(Q61024) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Glutamine-dependent asparagine synthetase)
*	TK050203_NMyc_cyto1_step07.2459.2459.2	4.616	0.6274	2216.28	1	6470.0%	1	K.YHHCTDEPLHAIYDSVEK.L
UQ9CZK199.6%222.1%437472475.6(Q9CZK1) 1300012C15Rik protein
	TK050203_NMyc_cyto1_step07.1346.1346.1	2.851	0.095	1157.53	1	7220.0%	1	R.NHAYEHSLGK.L
USODC_MOUSE99.6%5117.8%153158116.5(P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1)
*	TK050203_NMyc_cyto1_step02.2232.2232.1	1.7876	0.2162	1369.87	2	4170.0%	3	R.VISLSGEHSIIGR.T
UCO3_MOUSE99.6%9113.4%16631864826.8(P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin]
*	TK050203_NMyc_cyto1_step07.3555.3555.2	4.2143	0.5982	2873.54	1	4570.0%	1	K.TELTNIKLLDDFDEYTMTIQQVIK.S
*	TK050203_NMyc_cyto1_step02.2434.2434.1	1.4926	0.2208	1404.63	1	4170.0%	1	K.AAVFNHFISDGVK.K
*	TK050203_NMyc_cyto1_step05.2637.2637.2	2.1489	0.3476	2584.69	1	2500.0%	1	K.QKPDGVFQEDGPVIHQEMIGGFR.N
UVAB2_MOUSE99.6%4103.7%511565515.8(P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit)
	TK050203_NMyc_cyto1_step05.2809.2809.2	3.8109	0.5802	2179.81	1	6050.0%	3	K.IPIFSAAGLPHNEIAAQICR.Q
UPE15_MOUSE99.6%2213.8%130150545.0(Q62048) Astrocytic phosphoprotein PEA-15
	TK050203_NMyc_cyto1_step02.3136.3136.2	3.9134	0.508	2170.5	1	6110.0%	1	K.SEEITTGSAWFSFLESHNK.L
UFETA_MOUSE99.6%101231532.1%605673375.9(P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein)
*	TK050203_NMyc_cyto1_step01.0407.0407.1	2.3428	0.3364	1369.4	1	6000.0%	1	K.ADNKEECFQTK.R
*	TK050203_NMyc_cyto1_step01.2340.2340.1	1.5322	0.152	1071.75	1	7500.0%	1	K.QELLINLVK.Q
*	TK050203_NMyc_cyto1_step08.1492.1492.1	1.4538	0.144	897.58	1	7500.0%	4	R.HQCLLAR.K
*	TK050203_NMyc_cyto1_step01.1747.1747.1	1.4962	0.1188	1548.59	1	4580.0%	1	K.QSCALYQTLGDYK.L
*	TK050203_NMyc_cyto1_step01.2182.2182.1	2.6118	0.5524	1559.83	1	5000.0%	8	K.APQLTSAELIDLTGK.M
*	TK050203_NMyc_cyto1_step01.1282.1282.1	1.9449	0.1297	1188.45	1	5560.0%	1	R.NFAQFSSEEK.I
*	TK050203_NMyc_cyto1_step12.3333.3333.2	2.4435	0.4858	2684.82	1	2610.0%	45	K.NVLSIATITFTQFVPEATEEEVNK.M
*	TK050203_NMyc_cyto1_step02.3633.3633.2	2.0233	0.4237	3085.97	3	1540.0%	9	K.NSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK050203_NMyc_cyto1_step10.2555.2555.1	2.4594	0.374	1347.95	1	5910.0%	6	R.THPNLPVSVILR.I
*	TK050203_NMyc_cyto1_step11.3033.3033.2	2.5366	0.4264	2520.85	1	3180.0%	7	K.QKPELTEEQLAAVTADFSGLLEK.C
*	TK050203_NMyc_cyto1_step01.1159.1159.1	2.78	0.4445	1143.67	1	6110.0%	3	K.HIEESQALSK.Q
*	TK050203_NMyc_cyto1_step01.1348.1348.1	1.9954	0.2473	1497.69	1	5000.0%	2	R.DETYAPPPFSEDK.F
*	TK050203_NMyc_cyto1_step02.2448.2448.2	3.6554	0.6024	3029.75	1	3400.0%	4	K.LALDVAHIHEECCQGNSLECLQDGEK.V
*	TK050203_NMyc_cyto1_step01.0067.0067.1	1.8078	0.1423	919.36	1	7140.0%	1	K.DLCQAQGK.A
UHBAZ_MOUSE99.6%4613.5%141161047.6(P06467) Hemoglobin zeta chain
*	TK050203_NMyc_cyto1_step12.2058.2058.2	2.6377	0.4829	1984.97	1	5000.0%	2	K.TYFPHFDLHHGSQQLR.A
*	TK050203_NMyc_cyto1_step05.1195.1195.1	1.3463	0.4573	559.3	2	6250.0%	1	R.AHGFK.I
UK6A3_MOUSE99.6%221.9%633719217.3(P18654) Ribosomal protein S6 kinase alpha 3 (EC 2.7.1.-) (S6K-alpha 3) (90 kDa ribosomal protein S6 kinase 3) (p90-RSK 3) (Ribosomal S6 kinase 2) (RSK-2) (pp90RSK2) (Protein-tyrosine kinase MPK-9) (Fragment)
	TK050203_NMyc_cyto1_step07.1788.1788.1	2.8044	0.4814	1508.63	1	5000.0%	1	K.TVEYLHAQGVVHR.D
UQ922P199.6%52522.4%116129094.1(Q922P1) RIKEN cDNA 2010012F05 gene
	TK050203_NMyc_cyto1_step07.2884.2884.2	2.1902	0.3751	2770.27	1	2120.0%	5	K.NLLEISGPETVPLPNVPSVALPSKPAK.K
USERA_MOUSE99.6%113.7%485514496.9(Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment)
	TK050203_NMyc_cyto1_step05.1967.1967.2	5.1129	0.6594	2049.84	1	5830.0%	1	R.ALVDHENVISCPHLGASTK.E
UTRFE_MOUSE99.6%4912325.5%697767247.2(Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin)
*	TK050203_NMyc_cyto1_step02.1464.1464.1	2.1473	0.4548	1113.5	1	6250.0%	3	K.KTSYPDCIK.A
*	TK050203_NMyc_cyto1_step02.2080.2080.1	1.837	0.3542	1479.72	1	4170.0%	3	K.KGTDFQLNQLEGK.K
	TK050203_NMyc_cyto1_step05.1137.1137.1	1.4337	0.1586	889.35	1	6430.0%	2	K.SCHTGLGR.S
*	TK050203_NMyc_cyto1_step01.2563.2563.1	2.6684	0.4154	1240.71	1	6000.0%	2	K.DFQLFSSPLGK.D
*	TK050203_NMyc_cyto1_step01.3011.3011.2	2.742	0.3103	2554.81	1	3180.0%	3	K.AVLTSQETLFGGSDCTGNFCLFK.S
*	TK050203_NMyc_cyto1_step01.1386.1386.1	1.7162	0.235	969.67	3	6250.0%	2	K.GYYAVAVVK.A
*	TK050203_NMyc_cyto1_step08.1810.1810.2	4.1719	0.5319	2010.46	1	6180.0%	5	K.DFASCHLAQAPNHVVVSR.K
	TK050203_NMyc_cyto1_step01.1944.1944.1	1.8057	0.2518	1542.62	2	4090.0%	1	R.DQYELLCLDNTR.K
*	TK050203_NMyc_cyto1_step01.1866.1866.1	1.712	0.3196	1581.71	2	4170.0%	1	K.QEDFELLCPDGTR.K
*	TK050203_NMyc_cyto1_step05.2162.2162.1	2.098	0.2766	1421.73	1	5450.0%	2	R.LYLGHNYVTAIR.N
*	TK050203_NMyc_cyto1_step01.3362.3362.1	1.8776	0.1015	1161.66	2	6250.0%	4	K.EDLIWEILK.V
*	TK050203_NMyc_cyto1_step01.3024.3024.1	2.3299	0.3239	1573.88	1	5000.0%	2	K.NNGKEDLIWEILK.V
*	TK050203_NMyc_cyto1_step02.2580.2580.1	2.1782	0.2013	1316.46	3	6500.0%	1	K.HTTIFEVLPEK.A
*	TK050203_NMyc_cyto1_step01.0542.0542.1	1.5729	0.2498	971.4	1	6250.0%	1	K.LPEGTTPEK.Y
*	TK050203_NMyc_cyto1_step01.1806.1806.1	1.8833	0.1897	1325.66	1	6000.0%	1	K.CDEWSIISEGK.I
*	TK050203_NMyc_cyto1_step01.1196.1196.1	1.93	0.2473	1243.61	1	6000.0%	2	K.HQTVLDNTEGK.N
*	TK050203_NMyc_cyto1_step01.1222.1222.1	1.8857	0.3652	1360.4	1	4500.0%	1	K.WCAVSEHENTK.C
UQ99KD099.6%2410.2%216244245.6(Q99KD0) Hypothetical 24.4 kDa protein (Fragment)
	TK050203_NMyc_cyto1_step07.1399.1399.2	2.7164	0.4312	2507.8	2	3180.0%	2	R.RPGAAEPSPDGTTGHTYNQYTQR.Y
UTES_MOUSE99.6%224.3%423479838.3(P47226) Testin (TES1/TES2)
	TK050203_NMyc_cyto1_step07.1567.1567.2	4.5903	0.5149	2204.57	1	6110.0%	1	K.NHAVVCQGCHNAIDPEVQR.V
UITH3_MOUSE99.6%333.3%886989776.0(Q61704) Inter-alpha-trypsin inhibitor heavy chain H3 precursor (ITI heavy chain H3)
*	TK050203_NMyc_cyto1_step02.2877.2877.2	3.3274	0.5044	2337.86	1	4760.0%	1	R.STSIIIMLTDGDANTGESRPEK.I
*	TK050203_NMyc_cyto1_step05.1386.1386.1	1.641	0.135	1044.66	1	7500.0%	1	R.FAHNVVTTR.A
UHS47_MOUSE99.6%449.8%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6)
*	TK050203_NMyc_cyto1_step01.4019.4019.2	3.7054	0.5396	2581.66	1	3800.0%	1	K.DQAVENILLSPLVVASSLGLVSLGGK.A
	TK050203_NMyc_cyto1_step11.2851.2851.2	2.6728	0.3879	1986.03	1	5000.0%	1	K.LSSLIILMPHHVEPLER.L
UMCM6_MOUSE99.6%444.4%821928675.5(P97311) DNA replication licensing factor MCM6 (Mis5 homolog)
	TK050203_NMyc_cyto1_step07.2863.2863.2	4.201	0.5245	2473.84	1	5250.0%	1	K.NLYHNLCTSLFPTIHGNDEVK.R
	TK050203_NMyc_cyto1_step07.2878.2878.2	3.9597	0.5741	1951.64	1	5940.0%	1	R.LTHYDHVLIELTQAGLK.G
UPEBP_MOUSE99.6%71323%187208605.4(P70296) Phosphatidylethanolamine-binding protein (PEBP)
*	TK050203_NMyc_cyto1_step02.2737.2737.2	2.5091	0.3254	2499.32	1	2500.0%	1	K.VLTPTQVMNRPSSISWDGLDPGK.L
*	TK050203_NMyc_cyto1_step01.2930.2930.2	3.9685	0.6005	2711.82	1	4290.0%	3	R.YVWLVYEQEQPLSCDEPILSNK.S
UAOP2_MOUSE99.6%4613%223247396.0(O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx)
	TK050203_NMyc_cyto1_step01.2307.2307.1	1.6274	0.2347	1057.71	1	5620.0%	1	K.LPFPIIDDK.G
	TK050203_NMyc_cyto1_step01.2315.2315.1	1.8117	0.4067	1021.63	1	7500.0%	1	R.VVFIFGPDK.K
	TK050203_NMyc_cyto1_step01.3948.3948.1	3.3811	0.5165	1528.66	1	6540.0%	2	R.DLAILLGMLDPVEK.D
UGTM5_MOUSE99.6%119.8%224266357.2(P48774) Glutathione S-transferase Mu 5 (EC 2.5.1.18) (GST class-mu 5) (Fibrous sheath component 2) (Fsc2)
*	TK050203_NMyc_cyto1_step07.2506.2506.2	3.8029	0.4286	2800.99	1	3860.0%	1	R.LCYNSNHENLKPQYLEQLPAQLK.Q
UQ9NPL899.6%1720110.5%285321938.2(Q9NPL8) C3orf1 hypothetical protein
	TK050203_NMyc_cyto1_step12.3170.3170.3	2.9501	0.047	3010.68	3	1920.0%	14	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
UQ8R3V999.6%394.9%469519767.9(Q8R3V9) Hypothetical 52.0 kDa protein
*	TK050203_NMyc_cyto1_step02.3305.3305.2	3.1041	0.4732	2847.96	1	3260.0%	3	K.DDPEVQFSWFVDDVEVHTAQTKPR.E
UATPA_MOUSE99.6%113.6%553597539.2(Q03265) ATP synthase alpha chain, mitochondrial precursor (EC 3.6.3.14)
*	TK050203_NMyc_cyto1_step11.3091.3091.2	5.0152	0.6257	2410.8	1	5250.0%	1	K.FENAFLSHVISQHQSLLGNIR.S
U143E_HUMAN99.6%8228.6%255291744.7(P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E)
	TK050203_NMyc_cyto1_step01.3020.3020.1	1.8353	0.0957	1479.98	1	4550.0%	1	K.LICCDILDVLDK.H
	TK050203_NMyc_cyto1_step03.1562.1562.1	2.499	0.4486	1239.59	1	6820.0%	4	K.HLIPAANTGESK.V
UHXB3_MOUSE99.6%264669.5%433443539.2(P09026) Homeobox protein Hox-B3 (Hox-2.7) (MH-23)
*	TK050203_NMyc_cyto1_step10.3347.3347.2	2.1891	0.2702	3124.9	1	1950.0%	21	K.LKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDK.S
UO8905599.6%1112.7%157181775.4(O89055) Nonmuscle myosin heavy chain-A (Fragment)
	TK050203_NMyc_cyto1_step02.3034.3034.2	3.3443	0.5225	2495.17	1	4500.0%	1	K.DFSALESQLQDTQELLQEENR.Q
UG6PI_MOUSE99.6%7715.3%557626377.9(P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK)
	TK050203_NMyc_cyto1_step10.2895.2895.3	5.1681	0.6415	3316.07	1	2840.0%	1	R.VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK.M
*	TK050203_NMyc_cyto1_step10.2663.2663.2	2.635	0.4867	2448.45	1	4750.0%	1	R.FNNFSLNLNTNHGHILVDYSK.N
*	TK050203_NMyc_cyto1_step02.2868.2868.2	2.8441	0.4586	2847.83	1	2880.0%	1	K.KIEPELEGSSAVTSHDSSTNGLISFIK.Q
	TK050203_NMyc_cyto1_step03.1742.1742.1	2.2322	0.3948	1188.47	1	6500.0%	1	K.HFVALSTNTAK.V
UQ9ESF799.6%113.6%419487386.1(Q9ESF7) Sep2 (Fragment)
*	TK050203_NMyc_cyto1_step07.1963.1963.2	3.7753	0.5219	1941.65	1	5330.0%	1	R.LRPQTYDLQESNVHLK.L
UQ9Z1F999.6%576.7%638705695.2(Q9Z1F9) ARX
*	TK050203_NMyc_cyto1_step06.2942.2942.3	5.2577	0.6575	3587.65	1	3280.0%	2	K.ESVLQFHPQANIEAHHDSIMNPDYNVEFFR.Q
	TK050203_NMyc_cyto1_step01.2570.2570.1	1.7904	0.2963	1484.6	1	4640.0%	1	R.VLVVGAGGIGCELLK.N
UICAL_MOUSE99.6%682.7%788849225.5(P51125) Calpain inhibitor (Calpastatin)
*	TK050203_NMyc_cyto1_step08.1424.1424.2	3.8239	0.5366	2124.49	1	3330.0%	1	K.AASLGSSQPSRPHVGEAATATK.V
UQ8R1H099.6%3930.1%7382824.9(Q8R1H0) Hypothetical 8.3 kDa protein
*	TK050203_NMyc_cyto1_step02.2920.2920.2	4.2862	0.5693	2526.95	1	5450.0%	3	K.HPDPTTLCLIAAEAGLTEEQTQK.W
UFKB3_MOUSE99.6%3318.3%224251489.3(Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase)
*	TK050203_NMyc_cyto1_step05.2733.2733.2	2.9091	0.5005	3129.84	1	2410.0%	1	K.KGDVVHCWYTGTLPDGTVFDTNIQTSSK.K
*	TK050203_NMyc_cyto1_step02.2193.2193.2	4.4328	0.6253	1731.48	1	7500.0%	1	K.FLQDHGSDSFLAEHK.L
UA2HS_MOUSE99.6%1811221.7%345373266.5(P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin)
*	TK050203_NMyc_cyto1_step05.1310.1310.2	4.604	0.6083	1970.26	1	6560.0%	1	R.VMHTQCHSTPDSAEDVR.K
*	TK050203_NMyc_cyto1_step02.2404.2404.2	2.6609	0.4197	2012.08	1	3440.0%	1	R.QLTEHAVEGDCDFHILK.Q
*	TK050203_NMyc_cyto1_step06.3574.3574.2	5.3907	0.6966	2548.71	1	5650.0%	9	R.AQNVPLPVSTLVEFVIAATDCTAK.E
*	TK050203_NMyc_cyto1_step07.2240.2240.2	5.6168	0.6774	2142.13	1	6250.0%	5	R.HAFSPVASVESASGETLHSPK.V
UQ9D4G699.6%242.5%8831012985.8(Q9D4G6) 4932434F09Rik protein
	TK050203_NMyc_cyto1_step11.3087.3087.2	3.6525	0.5801	2721.01	1	4090.0%	2	R.VPESGEHYELHLLHYLQENLGSR.I
UDD15_MOUSE99.6%442.4%758866117.2(O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15)
	TK050203_NMyc_cyto1_step11.2944.2944.2	4.6586	0.5849	2211.9	1	5000.0%	1	R.FAHIDGDHLTLLNVYHAFK.Q
UFKB1_MOUSE99.6%1115%107117918.2(P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12)
	TK050203_NMyc_cyto1_step07.2036.2036.2	4.4474	0.6522	1951.69	1	5940.0%	1	K.RGQTCVVHYTGMLEDGK.K
UPPI1_MOUSE99.6%335.9%270317626.4(P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha)
	TK050203_NMyc_cyto1_step06.1806.1806.2	3.9721	0.5938	2033.57	1	5940.0%	1	K.IETWHKPDLGTQENVHK.L
UXDH_MOUSE99.6%9131.6%13351465187.6(Q00519) Xanthine dehydrogenase/oxidase [Includes: Xanthine dehydrogenase (EC 1.1.1.204) (XD); Xanthine oxidase (EC 1.1.3.22) (XO) (Xanthine oxidoreductase)]
*	TK050203_NMyc_cyto1_step05.3021.3021.2	4.4837	0.6463	2483.63	1	5450.0%	1	K.DEVTCVGHIIGAVVADTPEHAHR.A
UTCPB_MOUSE99.6%223.9%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta)
	TK050203_NMyc_cyto1_step02.3068.3068.1	2.8062	0.3043	1555.71	1	4620.0%	1	R.SLHDALCVLAQTVK.D
	TK050203_NMyc_cyto1_step06.1790.1790.1	1.8189	0.2699	1131.57	1	5620.0%	1	K.HGINCFINR.Q
UADFP_HUMAN99.6%114.1%437480756.8(Q99541) Adipophilin (Adipose differentiation-related protein) (ADRP)
*	TK050203_NMyc_cyto1_step07.2734.2734.2	3.3559	0.0468	2198.15	1	4720.0%	1	K.SQQTISQLHSTVHLIEFAR.K
UZYX_MOUSE99.6%223.2%564607906.9(Q62523) Zyxin
*	TK050203_NMyc_cyto1_step03.1824.1824.2	3.2734	0.3825	1966.22	1	5560.0%	1	K.VNPFRPGDSEPPVAAGAQR.A
UQ99KQ299.6%82011.5%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment)
	TK050203_NMyc_cyto1_step06.2475.2475.2	5.3794	0.5942	2203.77	1	5530.0%	4	R.LVSNHSLHETSSVFVDSLTK.V
*	TK050203_NMyc_cyto1_step03.1370.1370.2	2.1442	0.4134	1819.83	1	3890.0%	1	K.VATVPQHATSGPGPADVSK.V
	TK050203_NMyc_cyto1_step12.2305.2305.2	3.9834	0.4931	2304.71	1	5230.0%	1	K.GQHVPGSPFQFTVGPLGEGGAHK.V
UNTF2_HUMAN99.6%5937.8%127144785.4(P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15)
	TK050203_NMyc_cyto1_step07.3166.3166.2	3.6825	0.5487	3008.37	1	2690.0%	2	K.IQHSITAQDHQPTPDSCIISMVVGQLK.A
	TK050203_NMyc_cyto1_step02.3020.3020.2	1.7164	0.35	2614.49	1	2730.0%	2	R.TQLGAIYIDASCLTWEGQQFQGK.A
UGDIR_MOUSE99.6%72520.1%204234075.2(Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1)
*	TK050203_NMyc_cyto1_step01.3598.3598.2	2.7397	0.3133	2577.41	1	2830.0%	3	R.LTLVCSTAPGPLELDLTGDLESFK.K
	TK050203_NMyc_cyto1_step02.2998.2998.2	4.0759	0.5925	2366.54	1	4170.0%	4	R.FTDDDKTDHLSWEWNLTIK.K
UMCM2_MOUSE99.6%571.2%9041020475.8(P97310) DNA replication licensing factor MCM2
	TK050203_NMyc_cyto1_step10.1608.1608.1	1.9285	0.269	1379.66	1	5450.0%	2	R.THVDSHGHNVFK.E
UACTB_HUMAN99.6%67129524%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin)
	TK050203_NMyc_cyto1_step10.2484.2484.2	2.4782	0.4672	1519.17	1	7000.0%	9	K.IWHHTFYNELR.V
	TK050203_NMyc_cyto1_step01.1247.1247.1	1.516	0.3338	1518.6	1	4580.0%	2	K.QEYDESGPSIVHR.K
	TK050203_NMyc_cyto1_step01.4383.4383.2	3.4023	0.4648	1955.65	1	5290.0%	4	R.VAPEEHPVLLTEAPLNPK.A
	TK050203_NMyc_cyto1_step01.4012.4012.2	4.0472	0.5666	2554.78	1	4770.0%	28	K.LCYVALDFEQEMATAASSSSLEK.S
	TK050203_NMyc_cyto1_step02.4133.4133.2	1.8152	0.3215	3188.5	1	1720.0%	3	R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L
UPHS3_HUMAN99.6%222.1%843966966.9(P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1)
*	TK050203_NMyc_cyto1_step10.2384.2384.2	3.8265	0.5204	2021.72	1	5280.0%	1	R.INMAHLCVIGSHAVNGVAR.I
UVAA1_MOUSE99.6%463.6%617682685.9(P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1)
	TK050203_NMyc_cyto1_step02.2356.2356.1	2.2559	0.3411	1308.75	1	5450.0%	1	R.VGHSELVGEIIR.L
	TK050203_NMyc_cyto1_step10.1739.1739.1	2.3415	0.4241	1318.68	1	5910.0%	2	K.LPANHPLLTGQR.V
UQ9CXT499.6%91917.5%200231614.4(Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence
	TK050203_NMyc_cyto1_step05.1398.1398.1	1.7766	0.0829	884.36	1	8570.0%	3	K.HLNLSGNK.I
	TK050203_NMyc_cyto1_step10.3567.3567.3	4.469	0.3408	3209.98	1	2770.0%	1	K.IEGLTDEFEELEFLSTINVGLTSISNLPK.L
UHBA_MOUSE99.6%146410061.7%141149548.2(P01942) Hemoglobin alpha chain
*	TK050203_NMyc_cyto1_step01.0282.0282.1	1.5846	0.1432	747.34	4	6670.0%	2	-.VLSGEDK.S
	TK050203_NMyc_cyto1_step01.3987.3987.1	1.6843	0.3579	1254.95	1	6360.0%	8	K.FLASVSTVLTSK.Y
	TK050203_NMyc_cyto1_step01.1618.1618.1	1.6422	0.342	1032.57	2	5620.0%	1	R.MFASFPTTK.T
	TK050203_NMyc_cyto1_step01.0534.0534.1	1.7473	0.1773	820.42	1	7500.0%	13	R.VDPVNFK.L
	TK050203_NMyc_cyto1_step05.2173.2173.2	2.7725	0.4292	1823.71	1	6000.0%	39	K.TYFPHFDVSHGSAQVK.G
	TK050203_NMyc_cyto1_step03.1710.1710.1	2.4751	0.1569	1533.59	1	6070.0%	42	K.IGGHGAEYGAEALER.M
	TK050203_NMyc_cyto1_step12.4006.4006.2	4.0027	0.6356	3055.25	1	3890.0%	15	K.LLSHCLLVTLASHHPADFTPAVHASLDK.F
UNED4_MOUSE99.6%6122.1%9571099685.6(P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment)
*	TK050203_NMyc_cyto1_step03.1451.1451.2	2.1204	0.1027	2174.11	3	2500.0%	3	R.LAVCGNPATSQPVTSSNHSSR.G
UQ9CRK799.6%3515.3%118128626.8(Q9CRK7) 9430095H01Rik protein (Fragment)
	TK050203_NMyc_cyto1_step10.2391.2391.2	3.7311	0.5568	2080.12	1	5560.0%	2	K.TITGFQTHTTPVLLAHGER.A
UPUR9_MOUSE99.6%6105.9%592641576.8(Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)]
*	TK050203_NMyc_cyto1_step01.3244.3244.2	2.969	0.4883	2578.75	1	3040.0%	2	K.RAEISNAIDQYVTGTIGEGEDLVK.W
	TK050203_NMyc_cyto1_step11.1691.1691.1	2.4073	0.4228	1358.65	1	5420.0%	2	K.TLHPAVHAGILAR.N
UALBU_MOUSE99.6%7526340.8%608686936.1(P07724) Serum albumin precursor
*	TK050203_NMyc_cyto1_step01.2966.2966.2	4.4496	0.6372	2950.9	1	3600.0%	1	K.CCAEANPPACYGTVLAEFQPLVEEPK.N
	TK050203_NMyc_cyto1_step01.1279.1279.1	2.0461	0.222	1077.59	1	7140.0%	2	R.NECFLQHK.D
*	TK050203_NMyc_cyto1_step02.1644.1644.1	1.9257	0.1288	1377.58	3	6500.0%	1	K.LQTCCDKPLLK.K
*	TK050203_NMyc_cyto1_step02.3392.3392.3	5.8459	0.5949	3499.74	1	3500.0%	1	K.AHCLSEVEHDTMPADLPAIAADFVEDQEVCK.N
*	TK050203_NMyc_cyto1_step01.0966.0966.1	1.5542	0.186	1069.42	1	6250.0%	1	K.CCSGSLVER.R
*	TK050203_NMyc_cyto1_step11.2836.2836.2	3.3086	0.4972	1955.9	1	4380.0%	1	K.SLHTLFGDKLCAIPNLR.E
*	TK050203_NMyc_cyto1_step01.1572.1572.1	2.1246	0.3541	1150.67	1	7220.0%	2	K.LVQEVTDFAK.T
*	TK050203_NMyc_cyto1_step01.1438.1438.1	2.4705	0.3327	1598.74	1	4620.0%	2	K.DTCFSTEGPNLVTR.C
*	TK050203_NMyc_cyto1_step01.1276.1276.1	2.5552	0.3903	1253.53	1	6110.0%	2	R.YNDLGEQHFK.G
*	TK050203_NMyc_cyto1_step02.4242.4242.1	1.6827	0.119	900.33	1	7500.0%	5	R.VCLLHEK.T
*	TK050203_NMyc_cyto1_step01.2319.2319.1	1.801	0.3165	1481.91	1	5000.0%	6	K.LGEYGFQNAILVR.Y
*	TK050203_NMyc_cyto1_step11.2156.2156.1	1.6883	0.3641	1458.7	1	5000.0%	5	R.RHPDYSVSLLLR.L
*	TK050203_NMyc_cyto1_step05.2682.2682.2	3.3756	0.5121	1904.67	1	6330.0%	4	K.ENPTTFMGHYLHEVAR.R
*	TK050203_NMyc_cyto1_step02.2681.2681.1	1.7187	0.3075	1301.6	1	6500.0%	2	R.HPDYSVSLLLR.L
*	TK050203_NMyc_cyto1_step02.2396.2396.2	3.8794	0.5185	1895.53	1	6330.0%	1	K.AETFTFHSDICTLPEK.E
*	TK050203_NMyc_cyto1_step02.2400.2400.2	4.8475	0.5353	2157.05	1	6180.0%	2	K.AETFTFHSDICTLPEKEK.Q
*	TK050203_NMyc_cyto1_step01.0275.0275.1	1.4921	0.1208	1010.31	3	5710.0%	1	K.CSYDEHAK.L
	TK050203_NMyc_cyto1_step02.2278.2278.1	2.2218	0.4358	1019.45	1	6880.0%	2	K.SLHTLFGDK.L
*	TK050203_NMyc_cyto1_step07.3318.3318.3	3.1775	0.4009	3630.67	1	2100.0%	5	K.KAHCLSEVEHDTMPADLPAIAADFVEDQEVCK.N
*	TK050203_NMyc_cyto1_step05.2437.2437.2	3.3937	0.4531	1886.92	1	5330.0%	4	R.RPCFSALTVDETYVPK.E
*	TK050203_NMyc_cyto1_step02.2188.2188.1	1.8782	0.2885	1101.62	1	7220.0%	1	K.KQTALAELVK.H
*	TK050203_NMyc_cyto1_step01.1099.1099.1	2.0701	0.1882	983.54	1	7140.0%	4	K.KYEATLEK.C
*	TK050203_NMyc_cyto1_step01.1431.1431.1	1.563	0.2612	1441.7	1	4230.0%	1	K.APQVSTPTLVEAAR.N
*	TK050203_NMyc_cyto1_step02.1260.1260.1	1.4088	0.181	999.48	4	5620.0%	3	K.TPVSEHVTK.C
U143B_MOUSE99.6%132928.6%245279554.8(Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1)
	TK050203_NMyc_cyto1_step01.1136.1136.1	2.1747	0.0714	1598.69	1	4230.0%	1	K.AVTEQGHELSNEER.N
	TK050203_NMyc_cyto1_step01.3022.3022.1	1.7546	0.1273	1192.81	1	6110.0%	2	K.DSTLIMQLLR.D
	TK050203_NMyc_cyto1_step01.3302.3302.2	2.4094	0.222	2160.59	1	4720.0%	1	K.TAFDEAIAELDTLNEESYK.D
*	TK050203_NMyc_cyto1_step01.1764.1764.1	2.0404	0.2651	1352.74	1	5000.0%	1	K.YLILNATQAESK.V
	TK050203_NMyc_cyto1_step07.3566.3566.2	5.0078	0.4806	2389.35	1	6320.0%	4	R.EKIEAELQDICNDVLELLDK.Y
UFABE_MOUSE99.6%51123.7%135151376.5(Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein)
*	TK050203_NMyc_cyto1_step01.1831.1831.1	1.6679	0.1308	1500.67	1	5000.0%	1	R.LMESHGFEEYMK.E
*	TK050203_NMyc_cyto1_step07.2110.2110.2	2.5792	0.4622	2578.68	1	3570.0%	3	R.KTETVCTFQDGALVQHQQWDGK.E
UQ8VCI599.6%116.7%299327334.3(Q8VCI5) Peroxisomal farnesylated protein
*	TK050203_NMyc_cyto1_step10.1490.1490.2	3.7661	0.6626	2086.84	1	5250.0%	1	K.AKPSPEHAPTISAPDASGPQK.R
UQ9D9F999.6%247.8%218252267.9(Q9D9F9) C330027I04Rik protein
	TK050203_NMyc_cyto1_step06.2871.2871.2	3.4902	0.4907	2312.32	1	4710.0%	2	K.ELTELFHHYYPIEIDPHR.T
UIF5A_HUMAN99.6%2114552.9%153167015.2(P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor)
	TK050203_NMyc_cyto1_step07.3603.3603.2	4.9365	0.4732	2629.42	1	5000.0%	11	K.YDCGEEILITVLSAMTEEAAVAIK.A
	TK050203_NMyc_cyto1_step02.4145.4145.1	1.933	0.2976	1300.67	1	5910.0%	2	K.VHLVGIDIFTGK.K
	TK050203_NMyc_cyto1_step06.3239.3239.2	2.2301	0.378	2738.88	1	2830.0%	3	K.RNDFQLIGIQDGYLSLLQDSGEVR.E
	TK050203_NMyc_cyto1_step02.2096.2096.2	3.7488	0.5678	2161.52	1	6470.0%	1	K.KYEDICPSTHNMDVPNIK.R
	TK050203_NMyc_cyto1_step02.3446.3446.2	4.7864	0.5929	2583.46	1	5680.0%	3	R.NDFQLIGIQDGYLSLLQDSGEVR.E
	TK050203_NMyc_cyto1_step01.1166.1166.1	1.5297	0.2036	828.42	1	7140.0%	1	R.LPEGDLGK.E
UQ91V8699.6%3511577.5%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence)
*	TK050203_NMyc_cyto1_step02.4324.4324.1	2.1542	0.2019	1108.77	4	5450.0%	34	K.VVAGVAAALAHK.Y
UEF11_MOUSE99.6%6199122.7%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu)
	TK050203_NMyc_cyto1_step02.3757.3757.2	5.0664	0.6338	2914.16	1	4290.0%	27	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK050203_NMyc_cyto1_step02.2890.2890.2	2.6012	0.5179	2518.69	1	2610.0%	4	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK050203_NMyc_cyto1_step12.2721.2721.3	3.4797	0.3081	4387.92	1	1500.0%	12	K.NDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK.F
	TK050203_NMyc_cyto1_step08.2356.2356.1	2.067	0.2606	1592.63	1	3930.0%	7	K.THINIVVIGHVDSGK.S
UPDX1_MOUSE99.6%81626.6%199221768.1(P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein)
	TK050203_NMyc_cyto1_step01.1860.1860.1	2.0599	0.3059	1198.64	2	6110.0%	2	R.LVQAFQFTDK.H
*	TK050203_NMyc_cyto1_step10.2827.2827.2	2.5627	0.3976	2770.58	1	3040.0%	1	K.LNCQVIGASVDSHFCHLAWINTPK.K
*	TK050203_NMyc_cyto1_step08.1866.1866.2	5.0355	0.6263	2396.56	1	5240.0%	3	K.HGEVCPAGWKPGSDTIKPDVNK.S
UK2C1_HUMAN99.6%224.7%643658868.1(P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein)
*	TK050203_NMyc_cyto1_step02.1185.1185.2	2.7325	0.5343	2384.76	1	2830.0%	1	R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G
UILK1_HUMAN99.6%114.2%452514198.1(Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK)
	TK050203_NMyc_cyto1_step12.2129.2129.2	3.264	0.4768	2143.15	1	4210.0%	1	K.VALEGLRPTIPPGISPHVCK.L
U2AAA_HUMAN99.6%445.8%588650925.1(P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein)
	TK050203_NMyc_cyto1_step10.2626.2626.2	4.4737	0.5923	2214.22	1	5790.0%	1	R.AISHEHSPSDLEAHFVPLVK.R
	TK050203_NMyc_cyto1_step01.3815.3815.1	1.7224	0.2981	1558.73	1	4000.0%	1	K.SALASVIMGLSPILGK.D
URAC1_HUMAN99.6%226.8%192214508.5(P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25)
	TK050203_NMyc_cyto1_step11.1827.1827.1	3.0431	0.3185	1586.64	1	5380.0%	1	R.HHCPNTPIILVGTK.L
UQ8R5B999.6%118.5%306332159.6(Q8R5B9) Hypothetical 33.2 kDa protein (Fragment)
*	TK050203_NMyc_cyto1_step12.2621.2621.2	2.7299	0.5386	2772.6	1	3270.0%	1	R.SLSFPILNPALSQSSQPSPPLPGSHGR.N
UCLH1_HUMAN99.6%12186%16751916135.7(Q00610) Clathrin heavy chain 1 (CLH-17)
*	TK050203_NMyc_cyto1_step02.3377.3377.2	2.3684	0.1422	2881.24	1	2600.0%	1	R.RPLIDQVVQTALSETQDPEEVSVTVK.A
*	TK050203_NMyc_cyto1_step07.3498.3498.2	5.2355	0.5846	2370.66	1	5000.0%	2	R.KFDVNTSAVQVLIEHIGNLDR.A
*	TK050203_NMyc_cyto1_step07.2415.2415.2	3.6516	0.5148	1946.1	1	5590.0%	2	K.LHIIEVGTPPTGNQPFPK.K
*	TK050203_NMyc_cyto1_step07.3586.3586.2	3.3353	0.4741	3073.12	1	3650.0%	2	R.LDNYDAPDIANIAISNELFEEAFAIFR.K
*	TK050203_NMyc_cyto1_step05.1923.1923.1	1.6041	0.0911	1518.9	5	3750.0%	1	R.HSSLAGCQIINYR.T
UADHA_MOUSE99.6%2411228.3%374396408.1(P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2)
	TK050203_NMyc_cyto1_step01.1416.1416.1	1.8645	0.1038	885.62	1	7860.0%	1	R.IIAVDINK.D
*	TK050203_NMyc_cyto1_step11.3444.3444.2	3.9019	0.5755	1898.13	1	8000.0%	8	K.KFPLDPLITHVLPFEK.I
*	TK050203_NMyc_cyto1_step05.3126.3126.2	3.6202	0.4463	2505.55	1	3810.0%	3	K.AAVLWELHKPFTIEDIEVAPPK.A
*	TK050203_NMyc_cyto1_step06.3213.3213.3	5.4959	0.6496	4086.2	1	2310.0%	4	R.SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK.V
*	TK050203_NMyc_cyto1_step06.2885.2885.2	3.9688	0.5239	2685.4	1	3910.0%	4	K.QIHNFISTSTFSQYTVVDDIAVAK.I
UQ9D7B299.6%226.3%334384948.0(Q9D7B2) 2310016J22Rik protein
	TK050203_NMyc_cyto1_step06.2642.2642.2	4.2212	0.6121	2762.51	1	4520.0%	1	K.GLAYCETHYNQLFGDVCFHCNR.V
UTCPH_MOUSE99.6%61212.5%544596527.8(P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta)
	TK050203_NMyc_cyto1_step07.3506.3506.2	4.3906	0.6339	2893.67	1	3910.0%	3	R.VHTVEDYQAIVDAEWNILYDKLEK.I
	TK050203_NMyc_cyto1_step02.3393.3393.2	2.7509	0.5227	2253.62	1	3330.0%	1	K.SQDAEVGDGTTSVTLLAAEFLK.Q
	TK050203_NMyc_cyto1_step11.3821.3821.3	2.7209	0.2862	2656.64	1	2400.0%	1	R.INALTAASEAACLIVSVDETIKNPR.S
UIQG1_MOUSE99.6%14144.1%16571887556.5(Q9JKF1) Ras GTPase-activating-like protein IQGAP1
*	TK050203_NMyc_cyto1_step10.1834.1834.2	3.2598	0.4504	1540.03	1	7920.0%	1	R.LAYLHSHKDEVVK.I
*	TK050203_NMyc_cyto1_step10.3284.3284.3	7.3904	0.7054	3866.92	1	3200.0%	1	K.AQAHAENNAFITWNDIQACVDHVNLVVHEEHER.I
*	TK050203_NMyc_cyto1_step02.3381.3381.2	2.0601	0.2755	2845.35	1	2710.0%	1	K.AQETQDESAVLWLDEIQGGIWQSNK.D
UQ9CY4099.6%71323.8%122131848.8(Q9CY40) Hemoglobin, beta adult major chain
	TK050203_NMyc_cyto1_step11.3247.3247.3	5.3923	0.3927	2994.08	1	3100.0%	3	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK050203_NMyc_cyto1_step06.3214.3214.2	3.4831	0.5111	2865.29	1	3570.0%	1	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UHBD_HUMAN99.6%2016814.4%146159248.0(P02042) Hemoglobin delta chain
*	TK050203_NMyc_cyto1_step01.1695.1695.1	2.6601	0.2959	1525.55	2	4170.0%	8	K.GTFSQLSELHCDK.L
*	TK050203_NMyc_cyto1_step06.2557.2557.2	1.972	0.3108	2633.79	2	2620.0%	10	K.GTFSQLSELHCDKLHVDPENFR.L
UPIMT_MOUSE99.6%5115.8%226245037.6(P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase)
	TK050203_NMyc_cyto1_step07.1835.1835.1	2.7378	0.4285	1479.55	1	5000.0%	3	K.SGGASHSELIHNLR.K
UEF2_MOUSE99.6%4335517.4%857951836.8(P58252) Elongation factor 2 (EF-2)
	TK050203_NMyc_cyto1_step07.1879.1879.2	3.9776	0.5921	1615.9	1	6150.0%	1	K.TGTITTFEHAHNMR.V
	TK050203_NMyc_cyto1_step06.1591.1591.1	2.206	0.4773	1309.58	1	6820.0%	4	R.NMSVIAHVDHGK.S
	TK050203_NMyc_cyto1_step10.2543.2543.2	4.173	0.5727	2120.32	1	4720.0%	1	K.RGHVFEESQVAGTPMFVVK.A
	TK050203_NMyc_cyto1_step01.3775.3775.1	2.0275	0.1656	1447.7	1	5420.0%	1	K.EGIPALDNFLDKL.-
	TK050203_NMyc_cyto1_step02.3384.3384.2	2.1958	0.3415	2222.7	1	3530.0%	1	R.ALLELQLEPEELYQTFQR.I
	TK050203_NMyc_cyto1_step05.3777.3777.2	1.7571	0.3568	2580.6	1	3040.0%	16	R.VTDGALVVVDCVSGVCVQTETVLR.Q
	TK050203_NMyc_cyto1_step05.2446.2446.2	2.9685	0.4869	2144.77	1	4470.0%	2	K.ARPFPDGLAEDIDKGEVSAR.Q
*	TK050203_NMyc_cyto1_step01.4139.4139.2	3.1645	0.5082	2820.03	1	3460.0%	8	K.DGSGFLINLIDSPGHVDFSSEVTAALR.V
	TK050203_NMyc_cyto1_step05.1927.1927.1	1.7792	0.2716	1402.7	2	5000.0%	1	K.KEDLYLKPIQR.T
UK6PL_MOUSE99.6%775.6%780853017.1(P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B)
*	TK050203_NMyc_cyto1_step11.2481.2481.2	2.6923	0.3876	1730.9	1	5360.0%	1	R.TLPKPHLEAIVENLR.T
*	TK050203_NMyc_cyto1_step02.2620.2620.2	3.8643	0.5864	2230.88	1	4250.0%	1	R.TGISEGHTVYIVHDGFEGLAK.G
*	TK050203_NMyc_cyto1_step10.1498.1498.2	2.3719	0.5044	1203.2	1	6000.0%	1	R.HGKPISSSYVK.D
UCA14_MOUSE99.6%550.8%16691606808.2(P02463) Collagen alpha 1(IV) chain precursor
	TK050203_NMyc_cyto1_step02.1501.1501.1	2.3661	0.4503	1442.72	1	4620.0%	1	R.AHGQDLGTAGSCLR.K
UPDX2_MOUSE99.6%93511.6%198217795.4(Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA)
	TK050203_NMyc_cyto1_step05.3169.3169.2	2.9699	0.4662	2702.12	1	3040.0%	5	K.LGCEVLGVSVDSQFTHLAWINTPR.K
UHS71_MOUSE99.6%333.6%641699945.6(P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2)
	TK050203_NMyc_cyto1_step02.2641.2641.2	3.4773	0.6237	2775.26	1	3700.0%	1	K.QTQTFTTYSDNQPGVLIQVYEGER.A
UQ925K499.6%114.2%454499475.7(Q925K4) Copine 1 protein (Fragment)
*	TK050203_NMyc_cyto1_step02.2801.2801.2	3.8341	0.5627	2250.61	1	5000.0%	1	R.FSVSLQHFCGGDLSTPIQVR.C
UQ9NYE599.6%10100.7%27252910206.0(Q9NYE5) Gamma-filamin
	TK050203_NMyc_cyto1_step06.2325.2325.2	3.396	0.3037	2096.24	1	5000.0%	1	R.LSGGHSLHETSTVLVETVTK.S
UTPIS_MOUSE99.6%112126.2%248265817.3(P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM)
	TK050203_NMyc_cyto1_step01.0731.0731.1	1.9551	0.158	1466.59	4	4170.0%	2	K.TATPQQAQEVHEK.L
	TK050203_NMyc_cyto1_step01.1638.1638.1	2.5399	0.2986	1458.48	1	5420.0%	1	R.HVFGESDELIGQK.V
	TK050203_NMyc_cyto1_step07.2031.2031.2	4.0832	0.5083	1615.83	1	7310.0%	1	R.RHVFGESDELIGQK.V
	TK050203_NMyc_cyto1_step01.3446.3446.2	1.6959	0.278	3032.28	1	1960.0%	2	K.ELASQPDVDGFLVGGASLKPEFVDIINAK.Q
	TK050203_NMyc_cyto1_step01.0239.0239.1	1.7955	0.2938	1328.55	1	4580.0%	3	R.IIYGGSVTGATCK.E
UANX1_MOUSE99.6%116.7%345386037.4(P10107) Annexin I (Lipocortin I) (Calpactin II) (Chromobindin 9) (P35) (Phospholipase A2 inhibitory protein)
*	TK050203_NMyc_cyto1_step02.2573.2573.2	3.7007	0.5954	2344.91	1	4350.0%	1	K.GGPGSAVSPYPSFNVSSDVAALHK.A
UQ9DCL899.6%224.4%206231194.8(Q9DCL8) 0610025N14Rik protein
	TK050203_NMyc_cyto1_step03.1862.1862.1	2.692	0.3752	1202.71	1	7780.0%	1	K.LHYNEGLNIK.L
UG25B_HUMAN99.6%225.2%191213116.0(P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog)
	TK050203_NMyc_cyto1_step10.1891.1891.1	2.0145	0.4311	1403.67	1	5000.0%	1	K.WVPEITHHCPK.T
UTAGL_MOUSE99.6%245%200224458.8(P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27)
	TK050203_NMyc_cyto1_step05.1862.1862.1	2.243	0.4479	1212.49	1	7000.0%	2	K.HVIGLQMGSNR.G
UA1T1_MOUSE99.6%154519.1%413460035.7(P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT)
	TK050203_NMyc_cyto1_step02.1597.1597.1	2.2586	0.3401	1216.55	1	7220.0%	3	K.MQHLEQTLSK.E
	TK050203_NMyc_cyto1_step05.2458.2458.2	4.2414	0.5476	2201.03	1	5560.0%	5	K.NHYQAEVFSVNFAESEEAK.K
	TK050203_NMyc_cyto1_step06.3149.3149.3	7.2733	0.6478	3503.13	1	3580.0%	2	K.SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK.L
	TK050203_NMyc_cyto1_step02.3214.3214.2	4.0377	0.5161	2406.84	1	5240.0%	1	K.DQSPASHEIATNLGDFAISLYR.E
	TK050203_NMyc_cyto1_step05.2459.2459.2	3.8113	0.5715	2329.21	1	4470.0%	2	K.NHYQAEVFSVNFAESEEAKK.V
ULIS1_MOUSE99.6%223.7%409465397.4(P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1)
	TK050203_NMyc_cyto1_step10.2411.2411.2	3.4228	0.5249	1897.94	1	5330.0%	1	K.TLNAHEHFVTSLDFHK.T
UQ9CXA299.6%115.9%354378046.7(Q9CXA2) 2810055F11Rik protein
*	TK050203_NMyc_cyto1_step10.3151.3151.2	3.7943	0.5744	2295.29	1	5000.0%	1	R.FHSVPAFVLASDLTVDVPGHGK.V
UKPYR_MOUSE99.6%243.1%574623097.1(P53657) Pyruvate kinase, isozymes R/L (EC 2.7.1.40) (L-PK)
*	TK050203_NMyc_cyto1_step10.2256.2256.2	3.2368	0.5764	2185.15	1	4440.0%	2	R.LNFSHGSHEYHAESIANIR.E
UHBB2_MOUSE99.6%2123130.8%146157478.1(P02089) Hemoglobin beta-2 chain (B2) (Minor)
*	TK050203_NMyc_cyto1_step12.3033.3033.2	3.8393	0.5558	1657.72	1	5330.0%	15	R.LLGNAIVIVLGHHLGK.D
*	TK050203_NMyc_cyto1_step01.1234.1234.1	2.1567	0.1599	1314.52	1	6250.0%	1	K.VNPDEVGGEALGR.L
*	TK050203_NMyc_cyto1_step02.2814.2814.2	3.7229	0.5235	2008.49	1	6110.0%	1	R.YFDSFGDLSSASAIMGNPK.V
UGTA4_MOUSE99.6%3317.6%222255647.4(P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4)
*	TK050203_NMyc_cyto1_step02.3598.3598.2	2.3237	0.3953	2572.68	1	2950.0%	1	K.DGHLLFGQVPLVEIDGMMLTQTR.A
*	TK050203_NMyc_cyto1_step10.3563.3563.2	4.2707	0.5371	2112.28	1	6180.0%	1	R.WLLAAAGVEFEEEFLETR.E
UQ99K8899.6%466.8%365381477.7(Q99K88) Hypothetical 38.1 kDa protein
	TK050203_NMyc_cyto1_step07.3587.3587.2	3.1774	0.5451	2740.26	1	3200.0%	2	K.AGWSLEDVDLFEINEAFAAVSAAIAK.E
UCAZ2_MOUSE99.6%246.6%286329675.8(P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2)
*	TK050203_NMyc_cyto1_step06.2542.2542.2	4.8577	0.6532	2301.96	1	6320.0%	2	K.KVDGQQTIIACIESHQFQAK.N
UQ9D1P499.6%3511.8%331373517.9(Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene)
	TK050203_NMyc_cyto1_step10.1467.1467.2	2.7484	0.3555	1716.37	1	5710.0%	1	R.HNSEKPPEPVKPEVK.T
*	TK050203_NMyc_cyto1_step05.2959.2959.2	2.7733	0.1632	3013.31	1	3000.0%	2	K.TYQGLQSLEEVCVYHSGVPIFHEGMK.Y
UALDR_MOUSE99.6%81210.2%315356017.2(P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase)
	TK050203_NMyc_cyto1_step01.1528.1528.1	1.7124	0.1727	782.6	1	8330.0%	1	R.NLVVIPK.S
	TK050203_NMyc_cyto1_step07.1974.1974.1	1.8964	0.2581	1242.52	1	6110.0%	1	K.HKDYPFHAEV.-
	TK050203_NMyc_cyto1_step06.1883.1883.2	2.8025	0.3937	2221.52	1	4120.0%	2	K.YKPAVNQIECHPYLTQEK.L
UBAG3_MOUSE99.6%223.1%577618287.5(Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis)
*	TK050203_NMyc_cyto1_step07.1479.1479.2	3.6682	0.5875	2299.38	1	5560.0%	1	K.THYPAQQGEYQPQQPVYHK.I
UA2A2_MOUSE99.6%4102.7%9381041016.9(P17427) Adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit)
	TK050203_NMyc_cyto1_step11.3632.3632.2	3.2208	0.4661	2746.17	1	3400.0%	3	R.VVHLLNDQHLGVVTAATSLITTLAQK.N
UO5498899.6%681.5%12331414855.1(O54988) Serine/threonine protein kinase
	TK050203_NMyc_cyto1_step06.1562.1562.1	2.6294	0.405	1393.48	1	6000.0%	1	K.CHLLVEHETQK.L
	TK050203_NMyc_cyto1_step02.2268.2268.1	2.2684	0.2923	1296.06	1	6110.0%	1	R.KLQEQEVFFK.M
UQ9CTB999.6%117.7%195224399.6(Q9CTB9) 1110030K07Rik protein (Fragment)
	TK050203_NMyc_cyto1_step07.1999.1999.2	3.1665	0.5264	1867.93	1	4670.0%	1	R.TQIALSPNNHEVHIYK.K
UQ9BW1899.6%334.1%588634717.7(Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit
	TK050203_NMyc_cyto1_step02.3693.3693.2	3.152	0.5279	2453.63	1	3540.0%	1	R.AVSDASAGDYGSAIETLVTAISLIK.Q
UO5518199.5%83012.1%280318898.4(O55181) RBP associated molecule RAM14-1
*	TK050203_NMyc_cyto1_step02.2166.2166.1	2.5755	0.4187	1490.73	1	5830.0%	2	K.CLHPLASETFVSK.D
*	TK050203_NMyc_cyto1_step08.2053.2053.2	3.0518	0.4209	2072.72	1	5670.0%	1	K.RFVFHNEQVYCPDCAK.K
*	TK050203_NMyc_cyto1_step02.1184.1184.1	1.543	0.1848	831.56	1	5710.0%	5	R.KPISADAK.E
UPYR1_HUMAN99.5%792.1%22252429146.4(P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)]
*	TK050203_NMyc_cyto1_step11.3240.3240.2	3.0657	0.5309	2691.3	1	4170.0%	1	R.RPVINAGDGVGEHPTQALLDIFTIR.E
*	TK050203_NMyc_cyto1_step06.3059.3059.2	2.1471	0.395	2448.93	1	3180.0%	2	K.AIVHAVGQELQVTGPFNLQLIAK.D
UPAC2_MOUSE99.5%114.5%486558335.2(Q9WVE8) Protein kinase C and casein kinase substrate in neurons protein 2
	TK050203_NMyc_cyto1_step05.3075.3075.2	3.1985	0.3766	2659.02	1	3180.0%	1	R.ANHGPGMAMNWPQFEEWSADLNR.T
UQ9305299.5%4102.9%612657467.4(Q93052) LIPOMA PREFERRED partner (LPP)
*	TK050203_NMyc_cyto1_step02.1524.1524.1	1.5049	0.2101	1220.65	2	5450.0%	1	K.STGEPLGHVPAR.M
*	TK050203_NMyc_cyto1_step07.1530.1530.1	2.6141	0.3381	1135.59	1	7140.0%	3	R.DFHVHCYR.C
UQ9D6E699.5%1111%172198614.8(Q9D6E6) 2900073G15Rik protein
*	TK050203_NMyc_cyto1_step02.3281.3281.2	3.08	0.4924	2364.05	1	4740.0%	1	R.NAFACFDEEAIGTIQEDYLR.E
UPSA1_MOUSE99.5%687.2%263295476.4(Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain)
	TK050203_NMyc_cyto1_step02.2208.2208.1	2.5505	0.385	1431.62	1	5910.0%	1	R.IHQIEYAMEAVK.Q
	TK050203_NMyc_cyto1_step05.1986.1986.1	1.7975	0.1178	953.65	5	5620.0%	1	K.THAVLVALK.R
UCAH2_MOUSE99.5%113718.9%259289607.0(P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II)
	TK050203_NMyc_cyto1_step08.1312.1312.1	2.2185	0.3412	1120.58	1	5620.0%	3	K.HNGPENWHK.D
	TK050203_NMyc_cyto1_step02.2078.2078.1	1.6268	0.2494	1009.55	1	7500.0%	1	K.VLEALHSIK.T
	TK050203_NMyc_cyto1_step12.2355.2355.2	2.6752	0.4061	2513.85	1	3100.0%	5	R.LIQFHFHWGSSDGQGSEHTVNK.K
	TK050203_NMyc_cyto1_step10.2479.2479.2	3.0406	0.5076	1582.54	1	7080.0%	1	K.YAAELHLVHWNTK.Y
UCUL1_MOUSE99.5%352.8%776896918.0(Q9WTX6) Cullin homolog 1 (CUL-1)
	TK050203_NMyc_cyto1_step05.3139.3139.2	3.0269	0.4926	2756.83	1	3860.0%	2	K.HLEIFHTEFQNLLDADKNEDLGR.M
UMCM3_MOUSE99.5%552.5%812915465.6(P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3)
	TK050203_NMyc_cyto1_step07.1732.1732.1	2.4656	0.3984	1423.74	1	5420.0%	1	R.SLAPSIHGHDYVK.K
*	TK050203_NMyc_cyto1_step06.1410.1410.1	1.6001	0.2	1007.49	1	7500.0%	1	K.HDSLLHGTK.K
USYD_MOUSE99.5%596.4%501571176.5(Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS)
	TK050203_NMyc_cyto1_step05.2111.2111.1	1.5009	0.2034	1233.51	2	5000.0%	1	R.LQSGICHLFR.E
	TK050203_NMyc_cyto1_step08.1860.1860.1	2.3214	0.2573	1437.59	2	5000.0%	2	R.FGAPPHAGGGIGLER.V
	TK050203_NMyc_cyto1_step08.1680.1680.1	2.4323	0.4085	1134.51	1	6110.0%	2	R.ALHHGIDLEK.I
UO8870199.5%572.7%375426794.7(O88701) Nucleosome assembly protein 1-like protein 4
	TK050203_NMyc_cyto1_step01.2283.2283.1	2.447	0.419	1329.59	1	7000.0%	1	K.YAALYQPLFDK.R
UPRS8_HUMAN99.5%352.7%406456267.5(P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG)
	TK050203_NMyc_cyto1_step07.1710.1710.1	1.9701	0.2321	1429.61	1	5450.0%	2	R.AVAHHTDCTFIR.V
UQ921M599.4%571.8%10801201496.5(Q921M5) Unknown (Protein for IMAGE:3597757) (Fragment)
*	TK050203_NMyc_cyto1_step12.1206.1206.2	2.7335	0.509	2111.26	1	3680.0%	1	K.HASSGSTVHIHPQAAPVVCR.H
UPRO1_MOUSE99.4%61217.3%139148268.3(P10924) Profilin I
	TK050203_NMyc_cyto1_step01.1511.1511.1	1.633	0.3192	1213.35	1	5000.0%	1	K.DSPSVWAAVPGK.T
*	TK050203_NMyc_cyto1_step01.2578.2578.1	1.7249	0.4056	1457.62	1	4230.0%	3	R.SSFFVNGLTLGGQK.C
UO8855899.4%441.8%12531452077.0(O88558) SHYC
	TK050203_NMyc_cyto1_step01.1183.1183.1	1.7023	0.1345	971.45	3	7140.0%	1	R.MYLTPSEK.H
	TK050203_NMyc_cyto1_step11.3024.3024.2	2.857	0.5089	2039.07	1	5000.0%	1	R.HEYGSPGILEFFHHQLK.D
UQ924P499.4%115.3%456496294.7(Q924P4) Ribonuclease/angiogenesis inhibitor
	TK050203_NMyc_cyto1_step06.3541.3541.2	2.7286	0.5021	3128.06	1	2920.0%	1	K.QPSCTLQQLVLYDIYWTNEVEEQLR.A
UTRAL_MOUSE99.4%461.8%706802096.7(Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1)
	TK050203_NMyc_cyto1_step01.1963.1963.1	1.9759	0.4117	1516.61	2	4620.0%	2	R.GVVDSEDIPLNLSR.E
UTAL1_MOUSE99.4%335.9%337373877.0(Q93092) Transaldolase (EC 2.2.1.2)
*	TK050203_NMyc_cyto1_step03.1434.1434.1	1.8343	0.1151	1226.58	2	5000.0%	1	K.KLGGPQEEQIK.N
	TK050203_NMyc_cyto1_step01.1784.1784.1	2.3589	0.3953	1313.49	1	5500.0%	1	R.ILDWHVANTDK.K
UP7044599.4%2223.3%120128986.5(P70445) PHAS-II (Eukaryotic translation initiation factor 4E binding protein 2)
*	TK050203_NMyc_cyto1_step06.2678.2678.2	2.4313	0.5173	3029.93	1	1960.0%	1	R.NSPMAQTPPCHLPNIPGVTSPGALIEDSK.V
UP9731599.4%5118.3%193205838.6(P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein)
	TK050203_NMyc_cyto1_step07.1179.1179.2	2.567	0.4254	1844.23	1	4380.0%	3	K.HEEAPGHRPTTNPNASK.F
UVINC_MOUSE99.4%10126.7%10651166745.9(Q64727) Vinculin (Metavinculin)
	TK050203_NMyc_cyto1_step10.3615.3615.2	2.6105	0.5126	2618.55	1	3640.0%	2	K.GILEYLTVAEVVETMEDLVTYTK.N
	TK050203_NMyc_cyto1_step12.3508.3508.3	3.2232	0.324	3026.03	1	2410.0%	1	R.LTDELAPPKPPLPEGEVPPPRPPPPEEK.D
*	TK050203_NMyc_cyto1_step02.1221.1221.1	1.6643	0.3264	1102.62	1	5560.0%	1	R.AANFENHSGR.L
	TK050203_NMyc_cyto1_step01.2304.2304.1	2.0181	0.3286	1488.13	1	4620.0%	1	R.VDQLTAQLADLAAR.G
USTRN_MOUSE99.4%445.4%780860145.3(O55106) Striatin
	TK050203_NMyc_cyto1_step05.3025.3025.2	2.8712	0.5166	2303.61	1	3750.0%	1	R.ALAFHPIEPVLITASEDHTLK.M
	TK050203_NMyc_cyto1_step12.3313.3313.3	2.7124	0.0427	3106.43	1	2400.0%	1	R.ALAFHPIEPVLITASEDHTLKMWNLQK.T
*	TK050203_NMyc_cyto1_step10.2399.2399.2	2.0081	0.4523	1887.21	1	3440.0%	1	R.VISHPTLPISITAHEDR.H
UQ6081799.4%116%215233844.6(Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein)
	TK050203_NMyc_cyto1_step01.1879.1879.1	2.0711	0.4006	1484.68	1	5000.0%	1	K.SPASDTYIVFGEAK.I
UO7037999.4%227.6%289322515.0(O70379) Thioredoxin-related protein
	TK050203_NMyc_cyto1_step01.2806.2806.2	2.5079	0.5025	2570.2	1	3410.0%	1	R.SEPTQALELTEDDIKEDGIVPLR.Y
UPCB2_MOUSE99.4%113.6%362382226.8(Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP)
	TK050203_NMyc_cyto1_step01.1600.1600.1	2.2331	0.4108	1428.64	1	4620.0%	1	R.LVVPASQCGSLIGK.G
UQ9D1L499.4%1126%154164536.3(Q9D1L4) 0610039D01Rik protein (RIKEN cDNA 0610039D01 gene)
*	TK050203_NMyc_cyto1_step11.3641.3641.3	3.3483	0.374	4452.28	2	1310.0%	1	R.SVHPYEVAEVIALPVEQGNPPYLHWVHQVTESVSNSGTALP.-
UGDE_HUMAN99.4%880.8%15321746346.8(P35573) Glycogen debranching enzyme (Glycogen debrancher) [Includes: 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (EC 3.2.1.33) (Amylo-1,6-glucosidase) (Dextrin 6-alpha-D-glucosidase)]
*	TK050203_NMyc_cyto1_step10.1684.1684.2	2.4639	0.3911	1504.9	1	5770.0%	1	R.HSPSIHQSVVAVSR.T
UTF1B_MOUSE99.4%222.3%834888475.8(Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1)
*	TK050203_NMyc_cyto1_step10.1552.1552.2	3.1598	0.4293	2005.96	1	4210.0%	1	K.IVAERPGTNSTGPGPMAPPR.A
UO0913299.4%113.4%350401656.8(O09132) A6 gene product
	TK050203_NMyc_cyto1_step06.2029.2029.1	2.3628	0.3831	1453.69	5	3750.0%	1	K.HQTLQGVAFPISR.D
UQ9DCY299.4%226%233259318.2(Q9DCY2) 2310045J23Rik protein
	TK050203_NMyc_cyto1_step06.2839.2839.2	3.1351	0.4308	1859.85	1	5710.0%	1	R.VVYRPEHISFEELLK.V
UQOR_MOUSE99.4%113.9%331352698.1(P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin)
*	TK050203_NMyc_cyto1_step03.1455.1455.1	2.3391	0.3854	1433.49	1	5380.0%	1	K.AAQAHEDIIHGSGK.T
UAPA1_MOUSE99.3%92118.2%264305875.9(Q00623) Apolipoprotein A-I precursor (Apo-AI)
*	TK050203_NMyc_cyto1_step02.1428.1428.1	1.8787	0.142	1332.54	1	4500.0%	1	K.SNPTLNEYHTR.A
*	TK050203_NMyc_cyto1_step02.1424.1424.1	1.9488	0.2927	1299.63	1	5500.0%	4	R.TQLAPHSEQMR.E
*	TK050203_NMyc_cyto1_step02.1349.1349.1	1.5586	0.2125	828.63	1	7500.0%	1	R.THVDSLR.T
*	TK050203_NMyc_cyto1_step01.1483.1483.1	1.7462	0.1957	1341.79	5	4170.0%	1	K.VAPLGAELQESAR.Q
*	TK050203_NMyc_cyto1_step01.1818.1818.1	2.5285	0.3383	1240.56	1	7000.0%	1	K.DFANVYVDAVK.D
UQ9CXZ299.3%103612.3%163174037.1(Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence
	TK050203_NMyc_cyto1_step01.1550.1550.1	1.4839	0.1995	890.6	1	6250.0%	3	K.AAVSGLWGK.V
	TK050203_NMyc_cyto1_step01.1250.1250.1	2.2193	0.3819	1288.65	2	5420.0%	5	K.VNADEVGGEALGR.L
UMAP4_MOUSE99.3%11171.2%11251176755.0(P27546) Microtubule-associated protein 4 (MAP 4)
*	TK050203_NMyc_cyto1_step02.1293.1293.1	2.5555	0.3368	1355.66	1	5360.0%	3	K.AAGSIASAQKPPAGK.V
UQ9D07199.3%331.7%10311130896.2(Q9D071) 2610042O15Rik protein
*	TK050203_NMyc_cyto1_step07.3263.3263.2	3.0106	0.4805	2250.82	1	4440.0%	1	R.ACEHLTSNVLPLLLEQFHK.H
UQ9D6U599.3%1113.3%173197596.2(Q9D6U5) 2310057C03Rik protein
	TK050203_NMyc_cyto1_step07.3516.3516.2	2.5599	0.4942	2741.24	1	2390.0%	1	R.SVEGWILFVTGVHEEATEEDIHDK.F
UQ9D43699.3%229.7%290337447.1(Q9D436) 2610529H08Rik protein
	TK050203_NMyc_cyto1_step07.2843.2843.3	3.2732	0.3961	3383.72	1	2410.0%	1	R.DFAVLEDHTLAHSLQEQEIEHHLASNIQR.N
UMY9B_HUMAN99.2%220.4%21582435558.7(Q13459) Myosin IXb (Unconventional myosin-9b)
*	TK050203_NMyc_cyto1_step01.1918.1918.1	2.6301	0.1524	1156.62	2	7500.0%	1	K.YLDEFLLNK.I
UTCP1_MOUSE99.2%6103.8%556603416.1(P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A)
	TK050203_NMyc_cyto1_step06.1761.1761.1	1.4978	0.2757	1229.63	1	6000.0%	2	K.IHPTSVISGYR.L
	TK050203_NMyc_cyto1_step02.1421.1421.1	1.7792	0.2768	1413.71	1	5910.0%	2	R.AFHNEAQVNPER.K
USEP2_MOUSE99.2%469.1%361415266.5(P42208) Septin 2 (NEDD5 protein)
	TK050203_NMyc_cyto1_step01.1706.1706.1	1.649	0.236	952.84	1	6880.0%	1	K.VNIVPVIAK.A
	TK050203_NMyc_cyto1_step05.2622.2622.2	2.8724	0.4749	2955.08	1	3400.0%	2	K.QQPTQFINPETPGYVGFANLPNQVHR.K
USEP7_MOUSE99.2%225%436505508.6(O55131) Septin 7 (CDC10 protein homolog)
	TK050203_NMyc_cyto1_step02.3417.3417.2	2.8392	0.4681	2608.66	1	3640.0%	1	K.STLINSLFLTDLYSPEYPGPSHR.I
UQ6200999.2%332.5%811902557.3(Q62009) Osteoblast specific factor 2 precursor (OSF-2)
*	TK050203_NMyc_cyto1_step06.2931.2931.2	3.0497	0.4546	2347.72	1	4000.0%	1	R.GLENNVNVELLNALHSHMVNK.R
UTERA_MOUSE99.2%10126.6%806893085.3(Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
	TK050203_NMyc_cyto1_step01.1771.1771.1	1.8575	0.1341	1540.56	2	3850.0%	1	R.LGDVISIQPCPDVK.Y
	TK050203_NMyc_cyto1_step01.1807.1807.1	2.1061	0.3637	1253.84	1	4550.0%	1	K.GVLFYGPPGCGK.T
	TK050203_NMyc_cyto1_step01.2774.2774.1	1.9696	0.0332	1556.69	1	5000.0%	1	R.LDQLIYIPLPDEK.S
	TK050203_NMyc_cyto1_step07.1715.1715.1	1.6264	0.2272	712.45	2	8000.0%	2	R.HPALFK.A
	TK050203_NMyc_cyto1_step01.3582.3582.1	2.3122	0.353	1431.93	1	5420.0%	1	R.IVSQLLTLMDGLK.Q
ULGUL_MOUSE99.2%2212.6%183206785.5(Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase)
	TK050203_NMyc_cyto1_step02.1757.1757.1	1.7199	0.1107	977.57	2	7860.0%	1	K.RFEELGVK.F
	TK050203_NMyc_cyto1_step02.2682.2682.2	2.8349	0.4914	1791.86	1	4690.0%	1	R.GFGHIGIAVPDVYSACK.R
UQ9Z1Y499.2%223.5%480509347.3(Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6)
*	TK050203_NMyc_cyto1_step12.1217.1217.2	2.7959	0.4744	1779.03	1	4710.0%	1	R.GALGPPTAHGATLQPHPR.V
UHBE_MOUSE99.2%61020.5%146160058.2(P02104) Hemoglobin epsilon-Y2 chain
	TK050203_NMyc_cyto1_step01.0911.0911.1	1.5031	0.1315	1003.46	4	6430.0%	2	K.LSELHCDK.L
	TK050203_NMyc_cyto1_step02.2028.2028.1	2.3413	0.3627	1168.79	1	5910.0%	1	K.LVAGVATALSHK.Y
	TK050203_NMyc_cyto1_step01.1486.1486.1	1.5554	0.3024	1328.66	1	5000.0%	2	K.VNVEEVGGEALGR.L
UQ8VED599.2%222%547591807.4(Q8VED5) Similar to keratin 6A (Fragment)
	TK050203_NMyc_cyto1_step01.2967.2967.1	2.3051	0.3599	1329.61	1	5450.0%	1	R.NLDLDSIIAEVK.A
UPDA4_MOUSE99.1%221.6%638719735.3(P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72)
*	TK050203_NMyc_cyto1_step10.1890.1890.1	2.5557	0.3176	1313.32	1	6500.0%	1	K.FHHTFSPEIAK.F
UARI1_MOUSE99.1%112.3%469555677.2(Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment)
	TK050203_NMyc_cyto1_step07.1850.1850.1	2.2384	0.3658	1451.56	1	5450.0%	1	R.VLLQHVHEGYEK.D
UCAPB_MOUSE99.1%4611.9%277313455.7(P47757) F-actin capping protein beta subunit (CapZ beta)
	TK050203_NMyc_cyto1_step01.1828.1828.1	1.3784	0.2326	1172.62	2	5000.0%	1	R.STLNEIYFGK.T
	TK050203_NMyc_cyto1_step01.4007.4007.2	2.7491	0.4789	2787.95	1	3330.0%	2	K.NLSDLIDLVPSLCEDLLSSVDQPLK.I
UPPI2_MOUSE99.1%248.5%270313566.9(P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta)
	TK050203_NMyc_cyto1_step07.2774.2774.2	2.7401	0.473	2805.03	1	3480.0%	2	K.IETWHKPDLGTLENVHGLDPNTWK.T
UPDA3_MOUSE99.1%111911.9%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57)
	TK050203_NMyc_cyto1_step05.3231.3231.2	2.3178	0.0262	2465.1	5	2620.0%	3	K.VDCTANTNTCNKYGVSGYPTLK.I
*	TK050203_NMyc_cyto1_step05.2806.2806.2	2.7133	0.4913	2282.36	1	3890.0%	1	K.KFIQDSIFGLCPHMTEDNK.D
*	TK050203_NMyc_cyto1_step01.2134.2134.1	2.0758	0.3658	1394.79	1	5000.0%	1	R.DLFSDGHSEFLK.A
*	TK050203_NMyc_cyto1_step02.2274.2274.1	2.0613	0.2306	1260.45	1	6500.0%	2	R.FAHTNIESLVK.E
URBB7_MOUSE99.1%558.9%425477905.0(Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7)
	TK050203_NMyc_cyto1_step07.3000.3000.2	2.6084	0.3479	2775.1	1	3040.0%	1	K.DYALHWLVLGTHTSDEQNHLVVAR.V
	TK050203_NMyc_cyto1_step08.1290.1290.2	2.7172	0.4888	1790.82	1	4330.0%	1	K.HPAKPDPSGECNPDLR.L
UQ8WVG299.1%117.6%264292959.4(Q8WVG2) Similar to KIAA0982 protein
*	TK050203_NMyc_cyto1_step07.2500.2500.2	2.7238	0.4802	2367.13	1	4250.0%	1	K.FHPSEQLALTASGDKTAHIWR.Y
UY982_HUMAN99.1%114%494546497.2(Q9Y2I8) Hypothetical protein KIAA0982
*	TK050203_NMyc_cyto1_step07.2500.2500.2	2.7238	0.4802	2367.13	1	4250.0%	1	K.FHPSEQLALTASGDQTAHIWR.Y
UQ9H2L599.1%225.6%321367488.0(Q9H2L5) AD037
*	TK050203_NMyc_cyto1_step10.2036.2036.2	2.6138	0.4776	2128.23	1	3890.0%	1	R.EEEGTLIIEGLLNIAWGLR.R
UQ8VEH599.1%243%606700965.9(Q8VEH5) Similar to KIAA0766 gene product
	TK050203_NMyc_cyto1_step07.2719.2719.2	2.7167	0.4079	2251.09	1	3890.0%	2	R.NQHTLSQPLTDEHLQALFR.V
UBIN1_MOUSE99.1%241.5%588644705.0(O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9)
	TK050203_NMyc_cyto1_step08.1348.1348.1	1.8652	0.2586	1213.58	1	6110.0%	2	R.HHYESLQTAK.K
ULEG1_MOUSE99.1%1212218.7%134147355.5(P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin)
	TK050203_NMyc_cyto1_step06.3968.3968.2	2.3652	0.3797	2928.73	1	2400.0%	11	R.EPAFPFQPGSITEVCITFDQADLTIK.L
URBB9_MOUSE99.0%248.1%186209126.0(O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein)
*	TK050203_NMyc_cyto1_step07.2752.2752.2	3.0122	0.4532	1887.61	1	5670.0%	2	R.GHFQNTEFHELISVVK.S
UDHA1_MOUSE99.0%447.8%500543197.8(P24549) Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Aldehyde dehydrogenase, cytosolic) (ALDH class 1) (ALHDII) (ALDH-E1)
	TK050203_NMyc_cyto1_step05.2894.2894.2	3.1518	0.2691	2410.3	1	4750.0%	1	K.KFPVLNPATEEVICHVEEGDK.A
*	TK050203_NMyc_cyto1_step06.2291.2291.2	2.4056	0.3652	2154.12	1	3420.0%	1	K.KYVLGNPLTPGINQGPQIDK.E
UQ9CWI498.9%3513.8%312349088.2(Q9CWI4) Esterase 10
*	TK050203_NMyc_cyto1_step11.3540.3540.2	2.845	0.4589	2562.04	1	4750.0%	1	R.LQEGYDHSYYFIATFIADHIR.H
*	TK050203_NMyc_cyto1_step02.3097.3097.2	2.1612	0.4586	2668.69	1	2610.0%	2	K.GEDDSWDFGTGAGFYVNATEDPWK.A
UKAC_MOUSE98.9%4169.4%106117785.4(P01837) Ig kappa chain C region
	TK050203_NMyc_cyto1_step05.1121.1121.1	1.8259	0.3058	1349.59	1	4500.0%	4	R.HNSYTCEATHK.T
UCRKL_MOUSE98.9%225.9%303338176.7(P47941) Crk-like protein
*	TK050203_NMyc_cyto1_step07.3124.3124.2	3.09	0.3942	2311.87	1	4170.0%	1	K.KGELLVIIEKPEEQWWSAR.T
UCRKL_HUMAN98.9%115.9%303337776.7(P46109) Crk-like protein
*	TK050203_NMyc_cyto1_step07.3124.3124.2	3.09	0.3942	2311.87	1	4170.0%	1	K.KGEILVIIEKPEEQWWSAR.N
UQ99K8698.8%683.7%650708586.5(Q99K86) Lutheran blood group (Auberger b antigen included)
	TK050203_NMyc_cyto1_step06.3022.3022.2	2.7643	0.4627	2930.36	1	2920.0%	2	R.LTLHYPTEHVEFWVGSPSTTEGWVR.E
UCLI1_MOUSE98.8%5173.3%241270135.2(Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP)
	TK050203_NMyc_cyto1_step06.1863.1863.1	2.3487	0.2928	1097.53	1	7500.0%	4	K.LHIVQVVCK.K
UIF4G_HUMAN98.8%440.9%13951533615.2(Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220)
	TK050203_NMyc_cyto1_step02.1325.1325.1	2.286	0.3476	1477.62	1	5420.0%	1	K.IHNAENIQPGEQK.Y
UQ9D7E398.6%119.3%225242465.9(Q9D7E3) 2310011M22Rik protein (OVCA2)
*	TK050203_NMyc_cyto1_step12.2249.2249.2	2.2978	0.4707	2238.58	1	3330.0%	1	R.FLGAVTLTHSGGHFIPAAASQR.Q
UQ9ERD398.6%2224.5%159175434.2(Q9ERD3) Telokin
*	TK050203_NMyc_cyto1_step05.3047.3047.2	2.3005	0.4706	3192.65	1	2410.0%	1	K.LESEDDVSQAFLEAVAEEKPHVKPYFSK.T
	TK050203_NMyc_cyto1_step01.2731.2731.1	1.5831	0.2133	1579.67	3	3330.0%	1	K.IEGYPDPEVVWFK.D
UQ9CQR698.6%463%305351595.7(Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit)
	TK050203_NMyc_cyto1_step08.1428.1428.1	2.2379	0.3412	1183.54	1	7780.0%	2	R.AHQLVHEGYK.F
UQ9JHJ398.6%6229666.4%404438046.1(Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene)
*	TK050203_NMyc_cyto1_step06.4123.4123.2	2.6948	0.4554	2882.19	1	2880.0%	54	R.LLEFDSTNASEGAQPPGKPYPPYSLAK.F
UQ9D4H898.6%336.1%706822996.8(Q9D4H8) 4932411N15Rik protein
*	TK050203_NMyc_cyto1_step06.3155.3155.2	1.823	0.3349	2668.41	2	2390.0%	1	R.ATSNLTQEHMPTLFVESVLEVHGK.F
*	TK050203_NMyc_cyto1_step10.2575.2575.2	2.5403	0.4621	2582.14	1	3750.0%	1	R.MVADHLQFLHSECHSIIQQER.K
UMBNL_MOUSE98.6%352.9%341369768.6(Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein)
	TK050203_NMyc_cyto1_step11.1399.1399.1	1.9359	0.1693	1310.62	1	6000.0%	2	K.YFHPPAHLQAK.I
UQ96JF098.6%221.9%534607089.8(Q96JF0) Hypothetical protein KIAA1877 (Fragment)
*	TK050203_NMyc_cyto1_step10.1287.1287.1	1.7106	0.3478	1303.66	1	5500.0%	1	-.PQRPAMKPHLK.Q
UQ99PL598.6%151470.7%16051728789.3(Q99PL5) Ribosome binding protein 1 (Ribosome receptor protein) (RRp) (P180)
*	TK050203_NMyc_cyto1_step01.3086.3086.1	1.7022	0.3382	1309.76	1	4170.0%	12	K.EVPMVAVPPVGSK.A
UIDHC_MOUSE98.6%352.9%414466606.9(O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP)
	TK050203_NMyc_cyto1_step01.1163.1163.1	1.6743	0.3416	1343.14	1	5000.0%	2	K.TVEAEAAHGTVTR.H
UQ9CPY098.6%224.9%246271459.7(Q9CPY0) 2310037B18Rik protein
*	TK050203_NMyc_cyto1_step06.1590.1590.1	1.7298	0.3495	1364.68	1	5000.0%	1	-.MAGHLKLVGVPLK.V
UPTPA_MOUSE98.6%112.2%323367106.4(P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA)
	TK050203_NMyc_cyto1_step08.2118.2118.1	1.9368	0.3319	1017.57	1	7140.0%	1	K.FPVIQHFK.F
UQ9CQ6098.5%229.7%257272545.8(Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene)
*	TK050203_NMyc_cyto1_step01.3144.3144.2	3.0522	0.4097	2808.42	1	3400.0%	1	K.LPIPDSQVLTINPALPVEDAAEDYAR.K
UIF2A_HUMAN98.5%116.1%314359815.1(P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A)
*	TK050203_NMyc_cyto1_step05.2918.2918.2	3.0722	0.37	2435.67	1	4470.0%	1	R.HVAEVLEYTKDEQLESLFQR.T
UENOB_HUMAN98.5%246.7%433468567.7(P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3)
*	TK050203_NMyc_cyto1_step02.4268.4268.2	3.1264	0.0415	3025.15	1	2590.0%	2	R.HIADLAGNPDLILPVPAFNVINGGSHAGNK.L
UAAC1_HUMAN98.5%221%8921029745.4(P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein)
	TK050203_NMyc_cyto1_step08.1837.1837.1	1.627	0.3325	1229.73	5	4440.0%	1	R.HRPELIDYGK.L
URTC1_MOUSE98.4%225.2%366392267.9(Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase)
*	TK050203_NMyc_cyto1_step07.2771.2771.2	2.4652	0.4586	2156.36	1	3950.0%	1	K.TGSVTLHTQTAIHFAEQLAK.A
UGIPC_MOUSE98.3%114.5%333361295.9(Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1)
*	TK050203_NMyc_cyto1_step07.1263.1263.1	1.6077	0.3475	1436.64	1	4000.0%	1	R.SAGGHPGSGPQLGTGR.G
UQ8VBV798.2%225.7%209232565.2(Q8VBV7) Hypothetical 23.3 kDa protein (Similar to COP9 homolog) (Expressed sequence AA408242)
*	TK050203_NMyc_cyto1_step03.1728.1728.1	2.0907	0.3247	1357.67	1	5000.0%	1	R.KPASGTLDVSLNR.F
UIF2G_MOUSE98.1%223.2%471509348.4(Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X)
	TK050203_NMyc_cyto1_step10.2138.2138.2	2.4611	0.4521	1617.26	1	5000.0%	1	R.QATINIGTIGHVAHGK.S
UQ8VDX098.1%119.1%198226278.4(Q8VDX0) Hypothetical 22.6 kDa protein (Fragment)
*	TK050203_NMyc_cyto1_step02.3496.3496.2	2.4093	0.4435	2218.57	1	3890.0%	1	R.ASPRTEILHNIDPLYNHAR.H
UQ9CZP198.1%225.2%305337995.4(Q9CZP1) 2700038L12Rik protein
	TK050203_NMyc_cyto1_step05.2734.2734.2	2.6084	0.4363	2119.58	1	4060.0%	1	R.TCIHTFFDHQDQVWGVK.Y
UPTB_MOUSE98.0%223.6%527564788.3(P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)
	TK050203_NMyc_cyto1_step02.2992.2992.2	2.9697	0.3798	2243.93	1	4470.0%	1	K.NNQFQALLQYADPVSAQHAK.L
UTPP2_MOUSE98.0%571.5%12621398786.6(Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase)
*	TK050203_NMyc_cyto1_step05.2755.2755.2	3.1049	0.2752	2175.62	1	3680.0%	1	R.LSNTLSLDIHENHSLALLGK.K
UQ91V7698.0%116.7%315349966.3(Q91V76) Hypothetical 35.0 kDa protein (Unknown) (Protein for MGC:6803)
*	TK050203_NMyc_cyto1_step02.2394.2394.2	2.5906	0.4312	2435.86	1	3330.0%	1	R.QTLEEHYGDKPVGMGGTFIVQK.G
UAMPB_MOUSE98.0%332.6%650723435.3(Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV)
*	TK050203_NMyc_cyto1_step11.1413.1413.2	2.6012	0.4321	1899.8	1	5590.0%	1	R.RPLHSAQAVDVASASSFR.A
UQ6084897.9%111.5%821951268.0(Q60848) Lymphocyte specific helicase (Proliferation associated SNF2-like protein)
	TK050203_NMyc_cyto1_step01.3827.3827.1	1.6036	0.3256	1571.76	1	4580.0%	1	R.LQHLLEKSNIYSK.F
UP9741297.9%17890.6%37884252896.6(P97412) Lysosomal trafficking regulator (CHS1 homolog)
*	TK050203_NMyc_cyto1_step10.3346.3346.2	2.941	0.3952	2582.16	1	2830.0%	9	R.IIQADILLVLVNHPSPAIQQGVIK.L
UCDNB_MOUSE97.9%226.6%197222107.0(P46414) Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)
*	TK050203_NMyc_cyto1_step07.2496.2496.2	2.9358	0.3808	1788.19	1	6150.0%	1	K.WNFDFQNHKPLEGR.Y
URSU1_MOUSE97.9%468.3%277315508.9(Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1)
	TK050203_NMyc_cyto1_step01.3911.3911.2	2.9023	0.4228	2818.91	1	3700.0%	1	K.NLEVLNFFNNQIEELPTQISSLQK.L
UK1CJ_HUMAN97.9%223.4%593595195.2(P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10)
	TK050203_NMyc_cyto1_step02.3126.3126.2	2.916	0.4183	2368.25	1	3750.0%	1	K.NQILNLTTDNANILLQIDNAR.L
UTTHY_MOUSE97.9%41015%147157766.2(P07309) Transthyretin precursor (Prealbumin)
*	TK050203_NMyc_cyto1_step06.3225.3225.2	2.9086	0.3856	2520.03	1	2730.0%	3	K.TLGISPFHEFADVVFTANDSGHR.H
UPYRG_MOUSE97.9%551.9%591667116.6(P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase)
	TK050203_NMyc_cyto1_step07.1655.1655.1	2.1758	0.3184	1303.6	1	4550.0%	1	K.ALEHSALAINHK.L
UQ8WZ4297.8%72800.1%3435038161116.3(Q8WZ42) Titin
	TK050203_NMyc_cyto1_step06.2889.2889.2	2.2964	0.2442	2227.38	2	3420.0%	1	K.EPEPLEVLPGKNVTFTSVIR.G
	TK050203_NMyc_cyto1_step02.4148.4148.1	1.8018	0.3199	881.51	3	6430.0%	1	K.KVPLVVPK.K
UQ9Y6V097.8%440.2%51475635606.6(Q9Y6V0) Piccolo protein (Aczonin) (DJ0897G10.1) (Fragments)
*	TK050203_NMyc_cyto1_step01.2284.2284.1	1.6971	0.3196	1432.77	1	5000.0%	1	R.EPKPGQACFLGAR.N
UMOES_MOUSE97.8%7133.5%576676366.6(P26041) Moesin (Membrane-organizing extension spike protein)
	TK050203_NMyc_cyto1_step06.1587.1587.1	1.6932	0.2318	1235.63	3	5620.0%	3	R.IQVWHEEHR.G
	TK050203_NMyc_cyto1_step11.1723.1723.1	1.9231	0.0727	1531.53	1	5000.0%	1	K.KTANDMIHAENMR.L
UFUMH_MOUSE97.8%352%507543719.0(P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3)
*	TK050203_NMyc_cyto1_step11.1020.1020.1	1.4905	0.2981	1286.42	1	5000.0%	2	K.KPVHPNDHVNK.S
USBP2_MOUSE97.8%242.3%472526286.2(Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56)
	TK050203_NMyc_cyto1_step02.2340.2340.1	2.1024	0.062	1304.77	1	5450.0%	2	K.EPLGPALAHELR.Y
UPSA4_MOUSE97.8%338%261294717.7(Q9R1P0) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome component C9) (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome subunit L)
	TK050203_NMyc_cyto1_step01.3440.3440.2	2.8885	0.4065	2698.45	1	3330.0%	1	R.YLLQYQEPIPCEQLVTALCDIK.Q
UQ9EQR097.7%22463.1%25042724266.6(Q9EQR0) Fatty acid synthase
*	TK050203_NMyc_cyto1_step07.3507.3507.2	2.4034	0.3402	2779.98	1	3260.0%	1	R.AIPQEKPIFLSVEDTSFQWVDSLK.S
*	TK050203_NMyc_cyto1_step06.2030.2030.1	1.9535	0.1609	852.66	2	6430.0%	4	K.ALHLVGLK.R
*	TK050203_NMyc_cyto1_step03.1892.1892.1	1.5918	0.1033	1468.6	1	5000.0%	1	R.RQQEQLVPTLEK.F
*	TK050203_NMyc_cyto1_step03.1935.1935.2	2.4769	0.4073	1782.47	1	4380.0%	1	R.RVYATILNAGTNTDGSK.E
*	TK050203_NMyc_cyto1_step01.3118.3118.1	2.3565	0.3039	1412.78	1	5910.0%	1	K.DNLEFFLTNLGK.V
*	TK050203_NMyc_cyto1_step06.1549.1549.1	2.0642	0.2328	1271.53	1	7220.0%	4	R.HFQLEQDKPK.E
UCIW2_MOUSE97.7%358.5%411452987.8(P97438) Potassium channel subfamily K member 2 (Outward rectifying potassium channel protein TREK-1) (Two-pore potassium channel TPKC1) (TREK-1 K+ channel subunit)
	TK050203_NMyc_cyto1_step06.3539.3539.3	3.1484	0.3313	3798.84	1	1930.0%	2	R.TEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGK.G
UQ9JJ2897.6%331.9%12711448036.1(Q9JJ28) Fliih protein
*	TK050203_NMyc_cyto1_step12.2303.2303.2	2.7395	0.4292	2778.45	1	2710.0%	1	K.LEHLSVSHNHLTTLHGELSSLPSLR.A
UQ6116797.6%114%225256785.7(Q61167) APC-binding protein EB2 (Fragment)
	TK050203_NMyc_cyto1_step05.1837.1837.1	2.3457	0.302	1329.55	1	6670.0%	1	K.LEHEYIHNFK.V
UDPY3_MOUSE97.4%573.2%570619366.5(Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein)
	TK050203_NMyc_cyto1_step02.2162.2162.2	2.8043	0.4053	2032.35	1	4720.0%	1	R.NLHQSGFSLSGTQVDEGVR.S
UEHD1_MOUSE97.4%223.7%534606036.8(Q9WVK4) EH-domain containing protein 1 (mPAST1)
*	TK050203_NMyc_cyto1_step12.2094.2094.2	2.8026	0.4011	2288.5	1	3750.0%	1	K.VKLEGHELPADLPPHLIPPSK.R
URB35_HUMAN97.2%115%201230258.3(Q15286) Ras-related protein Rab-35 (RAB-1C) (GTP-binding protein RAY)
*	TK050203_NMyc_cyto1_step01.2046.2046.1	1.6525	0.3107	1071.79	1	6000.0%	1	K.LLIIGDSGVGK.S
URB1A_HUMAN97.2%224.9%205226786.2(P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein)
	TK050203_NMyc_cyto1_step01.2046.2046.1	1.6525	0.3107	1071.79	1	6000.0%	1	K.LLLIGDSGVGK.S
UQ9EQJ597.2%880.3%32623542878.3(Q9EQJ5) Striated muscle-specific serine/threonine protein kinase
*	TK050203_NMyc_cyto1_step06.1307.1307.1	1.8699	0.3086	1305.6	2	5000.0%	1	R.RVLQEYEVLR.T
UPRS6_MOUSE97.2%577.2%418472815.3(P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21)
	TK050203_NMyc_cyto1_step11.1303.1303.1	1.9862	0.3159	1294.51	1	5000.0%	2	K.AVAHHTTAAFIR.V
	TK050203_NMyc_cyto1_step02.2961.2961.2	2.2383	0.2792	2538.84	2	3420.0%	1	K.LQQELEFLEVQEEYIKDEQK.N
USTN1_MOUSE97.2%447.4%148171436.0(P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein)
*	TK050203_NMyc_cyto1_step01.1875.1875.1	2.0867	0.3139	1314.68	1	5450.0%	1	K.ESVPDFPLSPPK.K
ULAS1_MOUSE97.2%226.5%263299947.0(Q61792) LIM and SH3 domain protein 1 (LASP-1) (MLN 50)
	TK050203_NMyc_cyto1_step05.1414.1414.1	2.0798	0.201	1204.56	2	6670.0%	1	K.QQSELQSQVR.Y
	TK050203_NMyc_cyto1_step02.1301.1301.1	1.6807	0.313	1212.48	2	5620.0%	1	K.ACFHCETCK.M
UQ9D8S997.2%1115.3%137143798.8(Q9D8S9) 1810037G04Rik protein
*	TK050203_NMyc_cyto1_step07.2832.2832.2	2.1292	0.551	2300.34	1	3100.0%	1	R.LVHEALSEELAGPVHALAIQAK.T
UPFD1_MOUSE97.2%1118.9%122142558.3(Q9CWM4) Prefoldin subunit 1
	TK050203_NMyc_cyto1_step06.2917.2917.2	2.9253	0.3694	2735.23	1	2830.0%	1	K.HAHLTDTEIMTLVDETNMYEGVGR.M
UCDK4_MOUSE97.1%223.6%303337516.6(P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3)
	TK050203_NMyc_cyto1_step08.2020.2020.1	2.3229	0.2652	1467.87	1	5910.0%	1	R.RLEAFEHPNVVR.L
UQ8TDG497.1%8161.9%11011241756.5(Q8TDG4) DNA helicase HEL308
*	TK050203_NMyc_cyto1_step05.2709.2709.2	2.7655	0.4014	2404.98	2	2620.0%	2	K.SLYIATIEKGHSLVNSLIETGR.I
UNAL2_HUMAN97.0%332.4%10621205156.1(Q9NX02) NACHT-, LRR- and PYD-containing protein 2 (Nucleotide-binding site protein 1)
*	TK050203_NMyc_cyto1_step11.2660.2660.2	2.1846	0.4577	2678.54	2	2200.0%	1	R.VLPGPFSYTVVLYGPAGLGKTTLAQK.L
UQ96L7197.0%551.3%12101362636.3(Q96L71) ARAP1
*	TK050203_NMyc_cyto1_step10.2623.2623.2	3.0367	0.2897	1937.43	1	5000.0%	1	K.HYSVVLPTVSHSGFLYK.T
UATOX_MOUSE96.9%1117.6%6873386.5(O08997) Copper transport protein ATOX1 (Metal transport protein ATX1)
*	TK050203_NMyc_cyto1_step01.2291.2291.1	2.3674	0.2555	1416.84	4	4580.0%	1	K.LGGVEFNIDLPNK.K
UQ91VJ396.9%462.8%361401496.2(Q91VJ3) Similar to Adenosin kinase
*	TK050203_NMyc_cyto1_step02.2241.2241.1	2.4387	0.2478	1350.61	1	6500.0%	2	K.VAQWLIQEPHK.A
UQ9CZ4496.8%558.6%370407105.1(Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence
	TK050203_NMyc_cyto1_step05.1629.1629.2	1.7569	0.3862	1691.42	1	4640.0%	1	R.LAHGGQVNLDMEDHR.D
*	TK050203_NMyc_cyto1_step06.1526.1526.1	1.4259	0.1721	1218.53	1	5500.0%	1	R.HSGQDVHVVLK.L
	TK050203_NMyc_cyto1_step02.1582.1582.1	1.4974	0.3787	1027.63	2	5620.0%	1	R.RGEVPAELR.R
UUBPE_MOUSE96.8%242.2%492558715.2(Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15) (Ubiquitin thiolesterase 14) (Ubiquitin-specific processing protease 14) (Deubiquitinating enzyme 14)
*	TK050203_NMyc_cyto1_step03.1943.1943.1	1.9131	0.3061	1351.42	1	5000.0%	2	R.SSSSGHYVSWVR.R
UUBCG_HUMAN96.8%223.5%170195095.3(Q99462) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19) (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) (Q99462) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19) (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7)
	TK050203_NMyc_cyto1_step05.1718.1718.1	1.7574	0.3064	814.26	2	7500.0%	1	K.AHLTFPK.D
UQ99K5196.8%551.7%630707425.6(Q99K51) Hypothetical 70.7 kDa protein
	TK050203_NMyc_cyto1_step05.2693.2693.1	2.1376	0.2979	1415.68	2	5450.0%	1	K.AYFHLLNQIAPK.G
UGTM2_MOUSE96.8%465.1%217255857.4(P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5)
*	TK050203_NMyc_cyto1_step06.1846.1846.1	2.4153	0.2446	1432.69	1	5450.0%	2	K.KKPEYLEGLPEK.M
UGMDS_HUMAN96.4%335.1%372419507.3(O60547) GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) (GMD)
*	TK050203_NMyc_cyto1_step05.2382.2382.2	2.7816	0.3707	2253.47	1	3950.0%	1	K.IINEVKPTEIYNLGAQSHVK.I
UQ96A9096.4%3911.5%217235738.5(Q96A90) G6b-C protein precursor
*	TK050203_NMyc_cyto1_step10.3260.3260.3	3.2909	0.1202	3008.32	2	2300.0%	3	R.FDHSLDLLCPPHIAPLVKTEPQRPVK.E
UGYG2_HUMAN96.3%241.8%501552125.1(O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2)
*	TK050203_NMyc_cyto1_step06.1953.1953.1	2.1431	0.2857	1129.81	2	6670.0%	2	K.RPELGLTLTK.L
UQ9R1D296.3%223.4%326370286.6(Q9R1D2) Cyclin-dependent kinase 6
	TK050203_NMyc_cyto1_step06.1866.1866.1	1.7998	0.2976	1477.6	1	4550.0%	1	R.HLETFEHPNVVR.L
UGLYG_MOUSE96.3%592.7%332372715.3(Q9R062) Glycogenin-1 (EC 2.4.1.186)
*	TK050203_NMyc_cyto1_step06.1953.1953.1	2.1431	0.2857	1129.81	2	6670.0%	2	K.RPELGITLTK.L
UQ9NR9996.3%13250.4%28283122938.3(Q9NR99) Adlican
*	TK050203_NMyc_cyto1_step08.1540.1540.1	1.5922	0.2451	1445.54	1	5000.0%	4	R.RVWQTVSPVESR.I
UQ9D15796.3%332.5%366410007.8(Q9D157) 0610025K21Rik protein
	TK050203_NMyc_cyto1_step07.1176.1176.1	1.7741	0.2995	1207.52	1	5560.0%	1	R.ACHQLHQEGK.F
UA2M1_HUMAN96.3%224.4%435496559.5(P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain) (P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain)
	TK050203_NMyc_cyto1_step11.3133.3133.2	2.695	0.3762	2244.13	1	3420.0%	1	K.WARPPISMNFEVPFAPSGLK.V
UQ9CVL396.3%223.8%263282868.2(Q9CVL3) 1810024J13Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step08.2100.2100.1	2.4552	0.1553	1316.82	1	7000.0%	1	K.KPIPEEHLILK.T
UQ96QA196.3%226%463516265.7(Q96QA1) FKSG16
*	TK050203_NMyc_cyto1_step11.3276.3276.3	3.2562	0.1518	3319.43	5	1960.0%	1	K.ILFVEPAIFLSAFAMTLTGPLTTQYVYRR.I
UHBB_HUMAN96.2%357.5%146158677.3(P02023) Hemoglobin beta chain
	TK050203_NMyc_cyto1_step01.2831.2831.1	2.3917	0.2203	1151.86	2	5450.0%	2	K.VVAGVANALAHK.Y
UCERU_MOUSE96.1%111.8%10621211625.8(Q61147) Ceruloplasmin precursor (EC 1.16.3.1) (Ferroxidase)
*	TK050203_NMyc_cyto1_step06.3243.3243.2	2.3126	0.4294	2316.85	1	4470.0%	1	K.HYFIGITEAVWDYASGTEEK.K
UCIA1_HUMAN96.1%121225.9%339378405.0(O76071) WD-repeat containing protein Ciao 1
*	TK050203_NMyc_cyto1_step06.2977.2977.2	2.7144	0.1904	2412.63	1	3750.0%	11	R.CWFLAWNPAGTLLASCGGDRR.I
UP2CG_MOUSE96.1%226.8%542587284.4(Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13)
*	TK050203_NMyc_cyto1_step02.1560.1560.3	2.8893	0.3857	3692.84	1	1890.0%	1	K.GHTGFSSNSEHGTEAGQISEPGTATGEAGPSCSSASDK.L
UQ9HCI596.1%333.1%9911068345.4(Q9HCI5) Hypothetical protein KIAA1587 (Fragment)
*	TK050203_NMyc_cyto1_step11.2596.2596.3	2.8882	0.379	4095.51	1	1850.0%	1	R.LLSVEFVWQRYLDYRPVTDCKPVEYEFFWGPR.S
UQ91YD696.0%221.9%859965096.3(Q91YD6) Villin-like protein (Fragment)
	TK050203_NMyc_cyto1_step07.1827.1827.2	2.9162	0.289	1829.29	1	5310.0%	1	R.AQIAVVDAENEATNLLR.I
UQ9DBF196.0%224.7%510555146.4(Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1)
*	TK050203_NMyc_cyto1_step05.2333.2333.2	2.9631	0.0807	1708.01	1	6540.0%	1	R.LFLHESIHNEVVDR.L
*	TK050203_NMyc_cyto1_step01.2942.2942.1	1.4384	0.2147	1382.32	1	5450.0%	1	K.AWNIWADIPAPK.R
UQ8TDG396.0%465.2%523573537.2(Q8TDG3) Zinc transporter ZTL1
	TK050203_NMyc_cyto1_step05.3634.3634.3	3.2133	0.1441	3163.39	5	1850.0%	2	K.RLQALSHLVSVLLLCPWVIVLSVTTESK.V
UPA1G_MOUSE95.9%229.5%232258536.9(Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit)
*	TK050203_NMyc_cyto1_step10.2494.2494.2	2.5235	0.4045	2447.48	1	3410.0%	1	K.IVVVWVGTNNHSHTAEQVTGGIK.A
UPSA7_MOUSE95.9%228.5%248278558.5(Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1)
	TK050203_NMyc_cyto1_step02.2990.2990.2	2.5376	0.4032	2451.43	1	3330.0%	1	R.AITVFSPDGHLFQVEYAQEAVK.K
UQ9BVR595.8%113.3%601688105.2(Q9BVR5) Hypothetical protein (Fragment)
*	TK050203_NMyc_cyto1_step05.3049.3049.2	2.3649	0.4125	2332.05	1	3750.0%	1	K.TTHVVNLGSNQYLFSVIVDPK.E
UGSH1_MOUSE95.8%443.3%636725985.8(P97494) Glutamate--cysteine ligase catalytic subunit (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS heavy chain)
	TK050203_NMyc_cyto1_step08.2062.2062.2	2.3413	0.4115	2351.75	1	4290.0%	1	R.LGCPGFTLPEHRPNPEEGGASK.S
UDSC2_MOUSE95.8%331.1%902999615.0(P55292) Desmocollin 2A/2B precursor (Epithelial type 2 desmocollin)
*	TK050203_NMyc_cyto1_step02.1640.1640.1	2.3871	0.1566	1375.65	2	6000.0%	1	R.ELIDKYQLLIK.V
UAPA2_MOUSE95.7%248.8%102113197.2(P09813) Apolipoprotein A-II precursor (Apo-AII)
*	TK050203_NMyc_cyto1_step02.1841.1841.1	1.8407	0.2901	1196.51	1	6670.0%	2	K.THEQLTPLVR.S
UQ8WZ7395.7%247.2%363405145.5(Q8WZ73) Fring
*	TK050203_NMyc_cyto1_step06.3262.3262.2	2.1189	0.4349	2781.5	1	2500.0%	2	K.GLQHLVSGAEDQNGGAVPSGLEENLCK.I
USNXC_MOUSE95.6%226.1%165191167.3(O70493) Sorting nexin 12 (SDP8 protein)
	TK050203_NMyc_cyto1_step05.1290.1290.1	2.0968	0.2632	1206.54	1	6500.0%	1	K.IAGHPLAQNER.C
UO1458495.6%551.3%843979657.5(O14584) WUGSC:H_GS034D21.1 protein (Fragment)
*	TK050203_NMyc_cyto1_step01.1952.1952.1	2.0388	0.2722	1235.78	1	5450.0%	1	R.ESGVSLIATVTR.L
UQ91YS895.6%112.7%374416245.4(Q91YS8) Similar to calcium/calmodulin-dependent protein kinase I
	TK050203_NMyc_cyto1_step02.1509.1509.1	2.0643	0.2786	1282.6	1	6500.0%	1	K.NIHQSVSEQIK.K
UDLK_MOUSE95.6%112.9%385413205.9(Q09163) Delta-like protein precursor (DLK) (Preadipocyte factor 1) (Pref-1) (Adipocyte differentiation inhibitor protein) [Contains: Fetal antigen 1 (FA1)]
*	TK050203_NMyc_cyto1_step02.2149.2149.1	2.0648	0.2696	1457.57	1	5450.0%	1	R.CHVGWEGPLCDK.C
USH3L_MOUSE95.6%1110.5%114128114.9(Q9JJU8) SH3 domain-binding glutamic acid-rich-like protein
*	TK050203_NMyc_cyto1_step02.2684.2684.1	2.282	0.241	1593.69	1	4580.0%	1	K.KQQDVLCFLEANK.I
UQ9JM1495.6%116%200230765.5(Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C)
	TK050203_NMyc_cyto1_step07.2107.2107.2	2.7715	0.3551	1634.54	1	6250.0%	1	R.RFPEEPHVPLEQR.R
URECK_HUMAN95.5%4103.3%9711064576.7(O95980) Reversion-inducing cysteine-rich protein with Kazal motifs precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15)
*	TK050203_NMyc_cyto1_step10.3386.3386.3	3.1578	0.2442	3120.17	1	2340.0%	1	R.GALLLLLAVAGVAEVAGGLAPGSAGALCCNHSK.D
ULDHB_MOUSE95.5%352.4%333364416.1(P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H)
	TK050203_NMyc_cyto1_step05.1599.1599.1	1.5071	0.3469	1013.57	1	6250.0%	2	R.IHPVSTMVK.G
UQ8QZU695.4%5254.9%264291856.7(Q8QZU6) Similar to unknown (Protein for IMAGE:3534875) (Fragment)
*	TK050203_NMyc_cyto1_step01.4614.4614.1	1.7228	0.035	1588.7	5	3460.0%	5	R.VVAPHQLHSEANER.L
UQ8R2Q795.3%332.1%869990467.5(Q8R2Q7) Similar to hypothetical protein FLJ20318
*	TK050203_NMyc_cyto1_step12.2178.2178.2	2.6701	0.3638	2241.68	1	3610.0%	1	K.DHLIAPNDNDFGKYSFLFK.D
UQ9CQM995.0%242.4%337377785.6(Q9CQM9) Thioredoxin-like 2
*	TK050203_NMyc_cyto1_step08.1750.1750.1	1.9534	0.2784	1081.71	1	6250.0%	2	K.EHPHVSFVK.L
UO5486595.0%221.6%620705985.3(O54865) Soluble guanylate cyclase beta-1 subunit
	TK050203_NMyc_cyto1_step10.2116.2116.1	1.8946	0.2711	1421.76	5	4000.0%	1	K.EPMQVWFLSRK.N
UQ91V4194.9%114.2%215238976.2(Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512)
	TK050203_NMyc_cyto1_step02.2170.2170.1	1.8638	0.2673	1263.56	2	5560.0%	1	K.SCLLHQFTEK.K
ULDHA_MOUSE94.9%101813%331363677.7(P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M)
*	TK050203_NMyc_cyto1_step07.2727.2727.2	2.3978	0.3231	1848.73	1	5670.0%	1	K.LKGEMMDLQHGSLFLK.T
*	TK050203_NMyc_cyto1_step05.1878.1878.1	1.6406	0.2626	1027.49	1	5620.0%	3	R.VHPISTMIK.G
*	TK050203_NMyc_cyto1_step01.1012.1012.1	1.8336	0.2618	1259.58	2	5000.0%	1	K.SLNPELGTDADK.E
	TK050203_NMyc_cyto1_step01.1647.1647.1	1.8429	0.2845	1121.11	1	5560.0%	1	K.SADTLWGIQK.E
UIKKB_MOUSE94.9%111.6%757866906.4(O88351) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1.-) (I-kappa-B-kinase beta) (IkBKB) (IKK-beta) (IKK-B) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB)
	TK050203_NMyc_cyto1_step12.2290.2290.1	1.7944	0.2833	1373.73	1	5420.0%	1	K.ERLGTGGFGNVIR.W
UK1CS_MOUSE94.9%442.2%403445425.4(P19001) Keratin, type I cytoskeletal 19 (Cytokeratin 19) (K19) (CK 19)
*	TK050203_NMyc_cyto1_step06.1493.1493.1	1.6988	0.2693	1231.7	1	5000.0%	1	R.TKFETEHALR.L
UGELS_MOUSE94.9%665.8%730807465.8(P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin)
	TK050203_NMyc_cyto1_step03.1592.1592.1	1.8417	0.2846	1275.67	1	6000.0%	1	K.HVVPNEVVVQR.L
*	TK050203_NMyc_cyto1_step05.2667.2667.2	1.9843	0.3168	2799.09	1	2710.0%	1	K.NWRDPDQTDGPGLGYLSSHIANVER.V
	TK050203_NMyc_cyto1_step05.1385.1385.1	1.4766	0.2202	850.4	1	6880.0%	1	K.KGGVASGFK.H
UQ9CQF394.9%114.8%227262408.8(Q9CQF3) 3110048P04Rik protein (RIKEN cDNA 3110048P04 gene)
	TK050203_NMyc_cyto1_step06.1934.1934.1	1.735	0.2887	1388.69	2	4090.0%	1	R.TVEGVLIVHEHR.L
UHP28_HUMAN94.9%115.5%181206308.9(Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1)
*	TK050203_NMyc_cyto1_step02.1712.1712.1	1.7689	0.2788	1214.02	1	6000.0%	1	K.KVTQLDLDGPK.E
UO7515294.9%461.2%810891318.4(O75152) Hypothetical protein KIAA0663
*	TK050203_NMyc_cyto1_step08.1572.1572.1	1.7192	0.2674	1134.52	3	5000.0%	2	R.GQSEEPAGKTK.S
UQ9DBC794.9%246%381431855.3(Q9DBC7) 1300018C22Rik protein (Protein kinase, cAMP dependent regulatory, type 1, alpha) (RIKEN cDNA 1300018C22 gene)
*	TK050203_NMyc_cyto1_step05.4020.4020.2	2.3955	0.3028	2605.58	1	3260.0%	2	K.IVVQGEPGDEFFIILEGTAAVLQR.R
UP2CB_MOUSE94.8%224.9%390427955.2(P36993) Protein phosphatase 2C beta isoform (EC 3.1.3.16) (PP2C-beta) (IA) (Protein phosphatase 1B)
	TK050203_NMyc_cyto1_step05.2522.2522.2	2.4071	0.3948	2420.43	1	3950.0%	1	R.VANYCSTHLLEHITTNEDFR.A
UPLSI_HUMAN94.7%8642.1%629703535.5(Q14651) I-plastin (Intestine-specific plastin)
*	TK050203_NMyc_cyto1_step01.3427.3427.1	2.0674	0.2431	1546.82	5	3850.0%	8	R.EIVEKILSVADSNK.D
UQ96P8894.7%119.5%379418579.5(Q96P88) Type II gonadotropin-releasing hormone receptor (Fragment)
*	TK050203_NMyc_cyto1_step02.3096.3096.3	2.7498	0.4442	4196.27	1	1530.0%	1	R.LFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACR.T
UQ9JII694.6%4612.3%324364567.4(Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase)
	TK050203_NMyc_cyto1_step01.2099.2099.1	1.8149	0.1145	1506.96	2	4170.0%	1	R.DAGHPLYPFNDPY.-
*	TK050203_NMyc_cyto1_step02.3350.3350.2	2.8145	0.2921	2100.16	1	4440.0%	1	R.HPDEPVLLEEPVVLALAEK.H
	TK050203_NMyc_cyto1_step05.1485.1485.1	2.0853	0.233	1300.6	1	6500.0%	2	K.HHPEDVEPALR.K
UQ924V894.6%552.1%565618106.8(Q924V8) Carboxylesterase MH1 (EC 3.1.1.1)
	TK050203_NMyc_cyto1_step02.2412.2412.1	2.0357	0.2555	1436.62	1	5000.0%	1	R.GNWGHLDQVAALR.W
UQ8WUC794.6%73714.4%1041054011.6(Q8WUC7) Hypothetical protein (Fragment)
*	TK050203_NMyc_cyto1_step01.3111.3111.1	1.7635	0.1915	1599.37	6	3000.0%	6	R.RPGGAAMLAESPSVPR.L
UQ9DBD094.6%6101.7%700767667.2(Q9DBD0) 1300017J02Rik protein
*	TK050203_NMyc_cyto1_step08.1330.1330.1	2.0294	0.2572	1496.76	1	5000.0%	1	R.KPVTEAQSCHLAR.V
UQ9P0H794.6%111.9%12301363615.8(Q9P0H7) TIP120 protein
	TK050203_NMyc_cyto1_step11.3679.3679.2	2.3809	0.4025	2663.23	1	2170.0%	1	R.QGGLLVNFHPSILTCLLPQLTSPR.L
UQ9ULK894.5%11834.4%547606729.3(Q9ULK8) Hypothetical protein KIAA1212 (Fragment)
	TK050203_NMyc_cyto1_step12.2785.2785.2	2.3695	0.3987	2611.69	1	2080.0%	9	R.KELGAMAFSTTAINFSTVNSSAGFR.S
UQ9D63394.5%394.3%559633115.5(Q9D633) 4833403I15Rik protein
*	TK050203_NMyc_cyto1_step07.0214.0214.3	2.9327	0.1604	2879.4	2	2290.0%	3	R.ALVATQMEPTFARHVFPCFDEPALK.A
UZF95_MOUSE94.4%441.1%819937857.6(Q9Z1D8) Zinc finger protein 95 (Zfp-95)
*	TK050203_NMyc_cyto1_step07.1338.1338.1	1.6165	0.2728	1092.41	1	6110.0%	1	K.ETLGQSSSKR.T
UHMG4_MOUSE94.3%114%199228798.4(O54879) High mobility group protein 4 (HMG-4) (High mobility group protein 2a) (HMG-2a)
	TK050203_NMyc_cyto1_step01.2627.2627.1	1.9219	0.2623	1132.88	1	6880.0%	1	K.YEKDVADYK.S
UQ9H85794.3%111.9%520607196.8(Q9H857) Hypothetical protein FLJ13933
*	TK050203_NMyc_cyto1_step07.1230.1230.1	1.6852	0.2647	1249.65	3	5500.0%	1	-.MRVESGSAQER.G
UO1546994.3%332.7%439474628.1(O15469) Monocyte inhibitory receptor precursor
	TK050203_NMyc_cyto1_step08.1545.1545.1	1.7836	0.2637	1373.64	1	5420.0%	1	R.AIFSVGPVSPSRR.W
UPSPB_MOUSE94.3%392.7%377417286.2(P50405) Pulmonary surfactant-associated protein B precursor (SP-B) (Pulmonary surfactant-associated proteolipid SPL(Phe))
*	TK050203_NMyc_cyto1_step06.1535.1535.1	1.7715	0.2664	1298.6	1	5500.0%	3	K.AICNHVGLCPR.G
UQ8VFK894.1%229.8%317353138.2(Q8VFK8) Olfactory receptor MOR201-1
	TK050203_NMyc_cyto1_step07.2450.2450.3	2.8025	0.3887	3738.39	1	1940.0%	1	K.SISFNGCATQFFFFGSFLGTECFLLAMMAYDR.Y
UM3K3_MOUSE94.0%332.9%626707768.9(Q61084) Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.1.-) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3)
	TK050203_NMyc_cyto1_step10.1640.1640.2	2.7075	0.3275	2084.2	1	4170.0%	1	K.IATQPTNPQLPSHISEHGR.D
UFSC1_HUMAN93.9%221.8%492543997.2(Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55)
	TK050203_NMyc_cyto1_step11.2277.2277.2	2.3749	0.3885	1241.16	1	7220.0%	1	K.LINRPIIVFR.G
UENOG_MOUSE93.8%6266.7%433471655.1(P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2)
	TK050203_NMyc_cyto1_step06.3041.3041.2	2.0445	0.2952	3027.97	4	1720.0%	5	R.HIAQLAGNSDLILPVPAFNVINGGSHAGNK.L
UQ922D893.8%445.7%9351012567.1(Q922D8) Similar to C1-tetrahydrofolate synthase
	TK050203_NMyc_cyto1_step08.1513.1513.1	2.2525	0.2142	1390.53	1	5450.0%	1	K.THLSLSHNPEQK.G
	TK050203_NMyc_cyto1_step10.4111.4111.3	2.8771	0.1563	4680.64	8	1130.0%	1	R.ASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF.-
UQ8R0B193.5%1110.4%386418355.6(Q8R0B1) Similar to gephyrin
	TK050203_NMyc_cyto1_step02.4021.4021.3	2.8626	0.3618	4407.94	1	1500.0%	1	R.DSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISR.A
UQ99K3093.4%113.2%729822297.2(Q99K30) Similar to hypothetical protein FLJ21935
*	TK050203_NMyc_cyto1_step06.1474.1474.2	2.2587	0.3924	2472.16	1	2830.0%	1	K.HSLSSESQAPEDIAPPGSSPHANR.G
UKINH_MOUSE93.4%221.2%9631095496.3(Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC)
	TK050203_NMyc_cyto1_step07.1364.1364.1	1.8743	0.256	1482.63	1	3750.0%	1	R.HVAVTNMNEHSSR.S
U2ABA_HUMAN93.3%241.8%447516926.2(Q00007) Serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alpha isoform (PP2A, subunit B, B-alpha isoform) (PP2A, subunit B, B55-alpha isoform) (PP2A, subunit B, PR55-alpha isoform) (PP2A, subunit B, R2-alpha isoform)
*	TK050203_NMyc_cyto1_step11.1451.1451.1	2.084	0.2381	1104.53	1	6880.0%	2	K.ILHTAWHPK.E
UQ921J093.2%222%564643865.9(Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417)
	TK050203_NMyc_cyto1_step02.1985.1985.1	2.2517	0.2014	1341.67	1	6360.0%	1	K.SAFPHLQDAQVK.L
UMTAP_MOUSE93.2%355.7%283310627.1(Q9CQ65) 5'-methylthioadenosine phosphorylase (EC 2.4.2.28) (MTA phosphorylase) (MTAPase)
*	TK050203_NMyc_cyto1_step07.1803.1803.2	2.6741	0.2818	1984.08	2	4060.0%	2	R.TSLRPQTFYDGSHCSAR.G
UCOQ6_HUMAN93.1%484.3%468508597.1(Q9Y2Z9) Putative ubiquinone biosynthesis monooxgenase COQ6 (EC 1.14.13.-) (CGI-10)
	TK050203_NMyc_cyto1_step08.1689.1689.2	2.5601	0.3654	2410.59	1	3250.0%	2	K.DNLDDMGYIVENDVIMHALTK.Q
USERC_MOUSE93.0%332.7%370404738.0(Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP)
	TK050203_NMyc_cyto1_step07.2410.2410.1	2.2591	0.1315	1277.04	1	7000.0%	1	K.LPHSVLLEIQK.Q
UQ9DBT293.0%333.3%675757035.1(Q9DBT2) 1200014H24Rik protein
	TK050203_NMyc_cyto1_step05.2473.2473.2	2.0704	0.4208	2378.34	1	3410.0%	1	K.ASKPLPPAPAPDEYLVSPITGEK.I
UO3572793.0%222.8%597656386.9(O35727) Factor XII
*	TK050203_NMyc_cyto1_step07.2756.2756.2	2.0609	0.4173	2103.2	1	4410.0%	1	R.LHEGFSSITYQHDLALLR.L
UQ9HD4492.7%112%510589025.9(Q9HD44) Arsenite related gene 1
	TK050203_NMyc_cyto1_step03.1888.1888.1	1.5815	0.2615	1185.73	3	5000.0%	1	R.EVLPVDITTAK.D
UQ9JIX492.6%221.6%743831078.7(Q9JIX4) DNA binding protein DESRT
*	TK050203_NMyc_cyto1_step05.2107.2107.1	1.7509	0.255	1390.82	2	4170.0%	1	K.QPLASPSTQMDSK.Q
UQ9EQ0092.6%247.4%230259425.1(Q9EQ00) cAMP-dependent protein kinase regulatory subunit
*	TK050203_NMyc_cyto1_step06.2611.2611.2	2.7334	0.2264	1942.52	1	4120.0%	2	K.FLALGCSSLGRTLNTAMK.N
UQ9D1G192.6%2410%201221875.7(Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene)
	TK050203_NMyc_cyto1_step06.2395.2395.2	2.7365	0.2313	2278.18	1	3750.0%	2	R.GAHGIIVVYDVTDQESYANVK.Q
UQ9CXN192.6%118.9%259287306.0(Q9CXN1) 3110052N05Rik protein
	TK050203_NMyc_cyto1_step11.3671.3671.2	2.6679	0.3024	2813.66	1	3260.0%	1	K.INPPPYLTCESFPHAVDHILQHLL.-
UCSE1_MOUSE92.5%7110.8%9711104555.8(Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein)
	TK050203_NMyc_cyto1_step11.1291.1291.1	2.0352	0.2319	1048.41	1	6880.0%	2	K.IHLAQSLHK.L
UQ9EP9492.5%1111.6%164190549.0(Q9EP94) Natural killer cell receptor Ly-49P3 (Natural killer cell receptor Ly49P3 isoform)
	TK050203_NMyc_cyto1_step02.3181.3181.2	2.743	0.0495	2282.45	1	4740.0%	1	K.QTCQSSGLSLLKIDDEDELK.F
UQ99P3192.4%224.2%357391675.4(Q99P31) Hsp70 binding protein (RIKEN cDNA 1500019G21 gene)
	TK050203_NMyc_cyto1_step10.3102.3102.2	2.3808	0.3765	1805.64	1	5330.0%	1	K.SAFLLQNLLVGHPEHK.G
UQ9QZM192.4%113.4%582621225.0(Q9QZM1) PLIC-1
	TK050203_NMyc_cyto1_step07.2532.2532.2	2.3814	0.3791	2326.76	1	3750.0%	1	K.DQDTLSQHGIHDGLTVHLVIK.T
UO8820792.3%660.7%18381836925.0(O88207) Collagen a1(V)
*	TK050203_NMyc_cyto1_step11.1063.1063.1	1.6853	0.2588	1392.51	2	4580.0%	1	K.EPAPTQKPVEAAR.E
UKNG_MOUSE92.3%221.5%661731026.5(O08677) Kininogen precursor [Contains: Bradykinin]
	TK050203_NMyc_cyto1_step02.1232.1232.1	1.6816	0.2505	1090.47	1	5500.0%	1	K.KATSQVVAGTK.Y
UM1A2_HUMAN92.2%242.2%641730047.6(O60476) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2)
	TK050203_NMyc_cyto1_step06.3033.3033.2	2.5988	0.317	1822.71	1	4640.0%	2	K.MDRPNGLYPNYLNPR.T
UQ9HCE992.2%4101.5%9291031225.7(Q9HCE9) Hypothetical protein KIAA1623 (Fragment)
*	TK050203_NMyc_cyto1_step12.0049.0049.1	1.6591	0.2582	1315.5	1	3930.0%	3	R.AGEGGEEGDGPPGGK.E
UO8844392.1%223.4%585689966.0(O88443) SWAP-70
*	TK050203_NMyc_cyto1_step06.2875.2875.2	2.5121	0.3619	2396.69	1	4000.0%	1	K.NPHLITNWGPAAFTQAELEER.E
UQ96JH292.1%442%12701373115.6(Q96JH2) Hypothetical protein KIAA1855 (Fragment)
*	TK050203_NMyc_cyto1_step05.3019.3019.2	2.666	0.2677	2678.79	1	3000.0%	1	R.ASMADGDLEPEEGSKTLVLVSPGDMK.K
UFACC_MOUSE91.8%226.4%591670066.1(P50652) Fanconi anemia group C protein homolog (FACC protein)
*	TK050203_NMyc_cyto1_step05.4132.4132.3	2.9609	0.3338	4488.04	2	1250.0%	1	R.LLLSLLLWTPEGHAIVWEAVTHGPTFEITGPGCCPRIWR.S
URPA5_MOUSE91.8%113.8%346390765.4(P52432) DNA-directed RNA polymerase I 40 kDa polypeptide (EC 2.7.7.6) (RPA40)
	TK050203_NMyc_cyto1_step08.2002.2002.2	2.136	0.3893	1551.2	1	5000.0%	1	K.DHAKFSPVATASYR.L
UPNPH_MOUSE91.5%118%289322776.2(P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP)
	TK050203_NMyc_cyto1_step05.2945.2945.2	2.6408	0.1745	2668.1	5	2390.0%	1	K.LQEGTYVMLAGPNFETVAESRLLK.M
UQ9BYW291.4%552.1%20612311735.7(Q9BYW2) Huntingtin interacting protein 1
	TK050203_NMyc_cyto1_step01.3600.3600.3	2.6928	0.4108	4774.87	1	1310.0%	1	K.FACEEYKQSIGSTSSASVNHFDDLYQPIGSSGIASSLQSLPPGIK.V
UQ9DBV391.4%441.7%11451286257.9(Q9DBV3) 1200013B07Rik protein
	TK050203_NMyc_cyto1_step12.3178.3178.2	2.2883	0.379	2254.52	2	2500.0%	1	R.ILQTLKEHQVVVVAGDTGCGK.S
UQ969J291.1%222.4%545615797.6(Q969J2) P373c6.1 (Novel C2H2 type zinc finger protein) (Similar to hypothetical protein P1 p373c6)
*	TK050203_NMyc_cyto1_step01.3627.3627.1	1.7663	0.2474	1517.69	4	3460.0%	1	R.VLQVPGLAQGGCCR.E
UO8865391.1%1121.8%124135537.3(O88653) MEK binding partner 1 (Mitogen-activated protein kinase kinase 1 interacting protein 1)
*	TK050203_NMyc_cyto1_step06.2878.2878.2	2.0227	0.4243	2903.35	1	2410.0%	1	K.VANDSAPEHALRPGFLSTFALATDQGSK.L
UPSB2_MOUSE91.1%116%201229067.0(Q9R1P3) Proteasome subunit beta type 2 (EC 3.4.25.1) (Proteasome component C7-I) (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I)
*	TK050203_NMyc_cyto1_step01.2278.2278.1	2.1298	0.1629	1467.6	4	4580.0%	1	K.DGIHNLENIAFPK.R
UKAPA_MOUSE91.1%112.3%350404398.8(P05132) cAMP-dependent protein kinase, alpha-catalytic subunit (EC 2.7.1.37) (PKA C-alpha)
	TK050203_NMyc_cyto1_step01.1962.1962.1	2.1214	0.1564	1045.16	1	7500.0%	1	R.NLLQVDLTK.R
UQ8R1Q891.0%335.5%523566146.4(Q8R1Q8) Hypothetical 56.6 kDa protein
*	TK050203_NMyc_cyto1_step11.1101.1101.2	1.9994	0.4591	2463.77	1	2590.0%	1	K.KTGSPGGPGVGGSPGGGAAGASPSLPPSAK.K
UPFD6_MOUSE90.9%114.7%127144558.9(Q03958) Prefoldin subunit 6 (Protein Ke2)
	TK050203_NMyc_cyto1_step03.1379.1379.1	1.4964	0.3179	951.47	1	8330.0%	1	K.RYESQLR.D
UQ9CZT390.9%356.6%335379709.8(Q9CZT3) 2610529C04Rik protein
*	TK050203_NMyc_cyto1_step02.3560.3560.2	2.6096	0.027	2749.27	3	2500.0%	2	R.RMMCIAGNGLVVLFFSWMLSIFR.S
UPPCE_MOUSE90.8%221.7%710807525.7(Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE)
	TK050203_NMyc_cyto1_step01.0310.0310.1	1.7031	0.2476	1417.49	4	3750.0%	1	K.SDGTETSTNLHQK.L
UFK79_HUMAN90.8%9393.3%333385038.4(Q9BXC1) Putative P2Y purinoceptor FKSG79
*	TK050203_NMyc_cyto1_step05.2369.2369.1	1.8725	0.1721	1410.56	2	5450.0%	6	K.YPMAQDLGEKQK.A
UQ9DAH090.6%112.5%279319247.6(Q9DAH0) Four and a half LIM domains 4
	TK050203_NMyc_cyto1_step01.1363.1363.1	1.5191	0.3024	833.69	1	6430.0%	1	K.NPITGFGK.G
UO5518990.4%243.7%407436646.5(O55189) Ameloblastin
*	TK050203_NMyc_cyto1_step01.4360.4360.1	1.9644	0.223	1569.82	3	3670.0%	2	K.GEGPEGSPLQEANPGK.R
UY711_HUMAN90.2%243.9%623657206.1(O94819) Hypothetical protein KIAA0711
*	TK050203_NMyc_cyto1_step06.1733.1733.3	3.0946	0.15	2659.3	1	2920.0%	2	R.VVERQWEAGSAGAASPEELASPEER.A
URADI_MOUSE90.2%449.3%583684526.1(P26043) Radixin
	TK050203_NMyc_cyto1_step07.3466.3466.2	2.2358	0.0932	2879.75	1	2400.0%	1	K.EAILNDEIYCPPETAVLLASYAVQAK.Y
	TK050203_NMyc_cyto1_step06.3187.3187.2	2.1354	0.2854	2488.47	1	3100.0%	1	K.KGTELWLGVDALGLNIYEHDDK.L
	TK050203_NMyc_cyto1_step06.1313.1313.1	1.7339	0.236	1248.6	4	5000.0%	1	R.IQNWHEEHR.G
UO7057690.0%571.9%12401411536.3(O70576) Stag3 protein
*	TK050203_NMyc_cyto1_step06.3250.3250.2	2.5973	0.1834	2908.86	1	2710.0%	1	K.QLYTELIQEQGPQGLTELPAFIEMR.D
UQ9CRD890.0%2211.4%176202918.1(Q9CRD8) C330008K14Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step05.2679.2679.2	2.1834	0.3754	2453.35	1	3000.0%	1	K.VSILKVPDIQLEEESWLSLQK.R
UNAL1_HUMAN90.0%6261.3%14731658656.8(Q9C000) NACHT-, LRR- and PYD-containing protein 2 (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) (Caspase recruitment domain protein 7)
*	TK050203_NMyc_cyto1_step11.2832.2832.2	2.5977	0.116	2283.39	1	4210.0%	5	R.IAVPSPLDAPQLLHFVDQYR.E
UQ8TEP489.8%441.8%792883026.8(Q8TEP4) FLJ00149 protein (Fragment)
	TK050203_NMyc_cyto1_step11.1732.1732.1	1.848	0.2228	1533.81	2	3570.0%	1	K.GGAQHGVSSCEGTQR.T
UQ8VCD789.8%684.3%10541199667.0(Q8VCD7) Similar to gene amplified in squamous cell carcinoma 1
	TK050203_NMyc_cyto1_step01.1463.1463.1	1.7195	0.0772	996.61	3	6110.0%	1	R.AGLAKVIPPK.E
*	TK050203_NMyc_cyto1_step06.3155.3155.3	2.9095	0.3269	4002.11	2	1530.0%	2	K.VLTEGEENDEEGHGSNLEPGEIPEALSEERNGLNIPK.I
UKPCG_MOUSE89.7%113.9%697783587.5(P05697) Protein kinase C, gamma type (EC 2.7.1.-) (PKC-gamma)
	TK050203_NMyc_cyto1_step06.2179.2179.3	2.7358	0.3586	3240.19	1	1850.0%	1	K.FKEPHAAFYAAEIAIGLFFLHNQGIIYR.D
UBRF3_HUMAN89.6%8101.9%12141365996.7(Q9ULD4) Bromodomain and PHD finger-containing protein 3 (Fragment)
	TK050203_NMyc_cyto1_step12.1837.1837.3	2.8668	0.3293	2561.41	3	2280.0%	1	R.EGLLHNGVPIPVPPLDVLKLGEQK.Q
UQ6162789.6%792.2%10091122446.7(Q61627) Glutamate receptor delta-1 subunit precursor
*	TK050203_NMyc_cyto1_step05.3029.3029.2	2.5817	0.2721	2624.49	1	3410.0%	2	K.DDRVFQLAVSDLSLNDDILQSEK.I
UADK_MOUSE89.5%223.6%279311037.4(P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment)
	TK050203_NMyc_cyto1_step05.1877.1877.1	1.6462	0.2339	1157.53	1	6000.0%	1	R.AGHYAASVIIR.R
UQ8QZT189.3%334.5%424448168.5(Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial
*	TK050203_NMyc_cyto1_step11.1851.1851.2	2.0154	0.3962	1933.88	3	3420.0%	1	K.VNIHGGAVSLGHPIGMSGAR.I
UKEMK_MOUSE89.3%461.7%774858749.7(Q05512) Putative serine/threonine-protein kinase EMK (EC 2.7.1.-)
*	TK050203_NMyc_cyto1_step10.2367.2367.1	2.008	0.1715	1574.81	1	4230.0%	2	-.MSSARTPLPTLNER.D
UQ9HCE389.2%331.5%13291449028.7(Q9HCE3) Hypothetical protein KIAA1629 (Zinc finger protein) (Fragment)
	TK050203_NMyc_cyto1_step07.3380.3380.2	2.5715	0.2435	2408.83	1	3250.0%	1	K.TFETEAALNTHMRTHGMAFIK.S
UQ9D13589.1%114%150163624.9(Q9D135) 2300003P22Rik protein
*	TK050203_NMyc_cyto1_step07.1266.1266.1	1.5259	0.279	763.58	1	5830.0%	1	K.VGHVPVR.F
UPCNA_MOUSE89.1%225.4%261287854.8(P17918) Proliferating cell nuclear antigen (PCNA) (Cyclin)
	TK050203_NMyc_cyto1_step01.1896.1896.1	1.6986	0.2323	1583.88	1	4290.0%	1	R.DLSHIGDAVVISCAK.N
UQ9JIX789.1%9234.6%582637768.1(Q9JIX7) Putative GTP-binding protein
	TK050203_NMyc_cyto1_step02.4230.4230.2	2.0705	0.2376	2993.78	2	2410.0%	4	R.GEAVYQIGVEDNGLLVGLAEEEMRASLK.T
UQ99LS388.7%335.8%225250966.1(Q99LS3) Similar to phosphoserine phosphatase
*	TK050203_NMyc_cyto1_step12.1666.1666.2	1.9744	0.4692	1554.08	1	5770.0%	1	R.LLAEHPPHLTPGIR.E
UQ99LN288.5%118.1%346393066.3(Q99LN2) Hypothetical 39.3 kDa protein (Fragment)
*	TK050203_NMyc_cyto1_step12.3210.3210.2	2.2529	0.3684	3080.05	1	2320.0%	1	R.FPLLQPGIPPQRGIPPPSVLDAALHPPPR.G
UKF4A_HUMAN88.5%330.7%12321399096.3(O95239) Chromosome-associated kinesin KIF4A (Chromokinesin)
*	TK050203_NMyc_cyto1_step01.2232.2232.1	1.6389	0.2227	1110.67	2	5560.0%	1	K.YLIGELVSSK.I
UQ1542488.5%221.2%9151026405.5(Q15424) HSP27 ERE-TATA-binding protein (HET) (Scaffold attachment factor B)
*	TK050203_NMyc_cyto1_step01.2383.2383.1	1.6647	0.2261	1372.84	2	4550.0%	1	K.TELHGKMISVEK.A
UQ91WA388.4%224.6%347391577.1(Q91WA3) Similar to hypothetical protein FLJ22237
*	TK050203_NMyc_cyto1_step07.2108.2108.2	2.4113	0.3356	1886.2	4	3440.0%	1	R.AHDIPILMVTSGGYQKR.T
UQ9QZY288.2%331.5%827847528.4(Q9QZY2) GRIN1
*	TK050203_NMyc_cyto1_step05.3254.3254.1	1.6853	0.221	1349.65	1	4580.0%	1	R.VSLVKTETLSSGK.E
UCYPB_MOUSE88.2%226.3%208227139.5(P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1)
	TK050203_NMyc_cyto1_step06.1977.1977.1	2.0614	0.1958	1475.57	1	5000.0%	1	K.HYGPGWVSMANAGK.D
UQ9D3K688.1%552.3%569609414.6(Q9D3K6) 9130005N14Rik protein
	TK050203_NMyc_cyto1_step12.1019.1019.1	1.4539	0.3614	1299.32	1	3850.0%	1	R.GPHTPPPPGAAGSR.G
UCAN2_MOUSE87.8%334.6%700798725.0(O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80)
*	TK050203_NMyc_cyto1_step10.3560.3560.2	2.1867	0.3658	2464.14	1	3330.0%	1	R.LFVQLAGEDAEISAFELQTILR.R
	TK050203_NMyc_cyto1_step01.2434.2434.1	1.5323	0.2087	1422.28	4	3640.0%	1	R.KPPPNLFKIIQK.A
UAAC2_MOUSE87.8%442%8941036535.5(Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein)
	TK050203_NMyc_cyto1_step07.1631.1631.1	1.7059	0.0995	1301.66	1	5560.0%	1	K.HTNYTMEHIR.V
	TK050203_NMyc_cyto1_step01.2356.2356.1	1.9771	0.2109	1199.84	1	7220.0%	1	R.DLLLDPAWEK.Q
UO8884087.7%220.5%38574183084.8(O88840) Mutant fibrillin-1
	TK050203_NMyc_cyto1_step05.3347.3347.2	2.5685	0.2554	2339.61	3	2890.0%	1	R.GFMTNGADIDECKVIHDVCR.N
UQ9UQM887.3%222.7%450499499.1(Q9UQM8) CGI-44 protein
	TK050203_NMyc_cyto1_step01.2858.2858.1	1.5401	0.2416	1512.62	1	4170.0%	1	K.AEPLETFPFDQSK.E
UO3519587.2%244.8%604691756.2(O35195) Putative pheromone receptor (Fragment)
*	TK050203_NMyc_cyto1_step07.2346.2346.3	2.7423	0.3422	3528.24	1	1810.0%	2	K.FWENMDDTNIIIIYGDIDSLEGPMRNIGQR.L
UDSC2_HUMAN87.2%334%901999625.3(Q02487) Desmocollin 2A/2B precursor (Desmosomal glycoprotein II and III) (Desmocollin-3)
*	TK050203_NMyc_cyto1_step12.2507.2507.3	2.7894	0.325	4033.2	3	1460.0%	1	K.YSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDK.Y
UQ9UPQ387.2%575%804890928.0(Q9UPQ3) Hypothetical protein KIAA1099 (Centaurin gamma2)
	TK050203_NMyc_cyto1_step12.2783.2783.3	2.795	0.3367	4680.06	1	1500.0%	1	R.GNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSR.V
UMETH_HUMAN87.1%461.7%12651405275.6(Q99707) 5-methyltetrahydrofolate--homocysteine methyltransferase (EC 2.1.1.13) (Methionine synthase, vitamin-B12 dependent) (MS)
*	TK050203_NMyc_cyto1_step11.1795.1795.2	2.292	0.3428	2274.58	2	2860.0%	2	R.LTESLAMAPASAVSGLYFSNLK.S
UCCAA_HUMAN87.1%220.5%25052823638.8(O00555) Voltage-dependent P/Q-type calcium channel alpha-1A subunit (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI)
	TK050203_NMyc_cyto1_step01.1851.1851.1	1.9368	0.2184	1486.76	2	4580.0%	1	R.QDPPLAEDIDNMK.N
USWS1_MOUSE87.0%334.2%240267915.1(Q9D8Y0) Swiprosin 1
	TK050203_NMyc_cyto1_step06.1738.1738.1	1.9212	0.2138	1136.57	1	5500.0%	1	K.LGAPQTHLGLK.S
UM3KC_MOUSE86.9%552.1%888960846.2(Q60700) Mitogen-activated protein kinase kinase kinase 12 (EC 2.7.1.37) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK)
	TK050203_NMyc_cyto1_step05.2993.2993.2	2.5205	0.1439	2088.51	2	3420.0%	1	R.TPSPSFGGFVSTLSEASMRK.L
UCC04_MOUSE86.8%3513.8%253285726.1(Q9CQX5) Protein C3orf4 homolog
	TK050203_NMyc_cyto1_step05.4016.4016.3	2.7641	0.3399	4198.95	1	1790.0%	2	-.MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYR.S
UQ9HCH086.6%221.2%10031047499.2(Q9HCH0) Hypothetical protein KIAA1602 (Fragment)
	TK050203_NMyc_cyto1_step07.1628.1628.1	2.0401	0.1805	1383.59	4	4580.0%	1	R.LQGQERAPGAEVK.H
UQ9R16686.5%221.7%644734569.2(Q9R166) Zinc finger protein ZFP109
*	TK050203_NMyc_cyto1_step01.1412.1412.1	2.0318	0.1505	1211.57	1	5910.0%	1	R.NLLAVGGQVPNK.M
UQ9CR1686.5%332.2%370407437.4(Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D)
	TK050203_NMyc_cyto1_step10.1764.1764.1	1.5406	0.2381	1028.59	2	5620.0%	1	K.HVVFGQVIK.G
UMTPN_MOUSE86.4%1117.1%117127305.5(P80144) Myotrophin (V-1 protein) (Granule cell differentiation protein)
	TK050203_NMyc_cyto1_step12.3447.3447.2	2.2085	0.3587	2473.12	1	3750.0%	1	R.KPLHYAADCGQLEILEFLLLK.G
UIC1_MOUSE86.1%113.2%504556386.4(P97290) Plasma protease C1 inhibitor precursor (C1 Inh) (C1Inh)
	TK050203_NMyc_cyto1_step02.2874.2874.2	2.3797	0.3213	1830.64	1	4690.0%	1	K.GVTSVSQIFHSPDLAIR.D
UQ9JLG786.0%680.4%19542169816.9(Q9JLG7) Kiaa0575
*	TK050203_NMyc_cyto1_step07.0212.0212.1	1.7694	0.2185	1111.24	3	5620.0%	2	K.QRAEQHVLK.L
UQ9Y37285.7%115.8%325350809.7(Q9Y372) CGI-62 protein
	TK050203_NMyc_cyto1_step12.1219.1219.2	2.18	0.3563	2171.93	1	3420.0%	1	R.AEGTDIPTVKPLKPRPEPPK.K
UAD20_HUMAN85.5%113%726817116.5(O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 20)
*	TK050203_NMyc_cyto1_step06.3170.3170.2	2.3058	0.3287	2757.37	1	2730.0%	1	R.CGLTEEKIAHQMELQLSYNFTLK.Q
UQ1314785.3%113.7%401444497.3(Q13147) Abl interactor 2
*	TK050203_NMyc_cyto1_step01.3315.3315.1	1.565	0.2197	1582.99	2	3330.0%	1	R.TYSSSGSSGPSHPSSR.S
UQ9EQ3085.2%112.2%11001237744.9(Q9EQ30) Ran binding protein 5 (Fragment)
	TK050203_NMyc_cyto1_step11.3684.3684.2	2.3166	0.3251	3089.15	1	3120.0%	1	K.FKPDCVNVEEVLPHWLSWLPLHEDK.E
UQ91X9485.2%243.1%257292839.3(Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD)
	TK050203_NMyc_cyto1_step10.1475.1475.1	1.9599	0.2004	1047.64	1	6880.0%	2	K.KYHNVGLSK.C
UGRA1_MOUSE85.1%464.6%457526578.9(Q64018) Glycine receptor alpha-1 chain precursor (Glycine receptor 48 kDa subunit) (Strychnine binding subunit)
*	TK050203_NMyc_cyto1_step05.2306.2306.2	2.1676	0.3436	2326.15	4	2860.0%	2	K.GANNNNTTNPPPAPSKSPEEMR.K
UQ8VDN384.7%481.5%10241052469.0(Q8VDN3) Hypothetical 105.2 kDa protein (Fragment)
*	TK050203_NMyc_cyto1_step08.2072.2072.1	1.7359	0.2131	1476.79	2	3330.0%	2	K.GSGLGLHGAVPDIGVK.G
UCTE1_MOUSE84.7%241.7%419461366.6(O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I)
	TK050203_NMyc_cyto1_step05.1863.1863.1	1.7373	0.2142	898.45	1	7140.0%	2	R.HFLAPGVR.R
UPCNT_MOUSE84.5%571.2%19202183364.9(P48725) Pericentrin
*	TK050203_NMyc_cyto1_step07.2891.2891.2	2.3192	0.3193	2774.61	2	2170.0%	2	R.EELNGSWDPVLAQASHLEELEHLR.S
UQ9H91784.5%115.2%674740058.0(Q9H917) Hypothetical protein FLJ13080
*	TK050203_NMyc_cyto1_step01.3396.3396.3	2.9853	0.2879	3862.17	1	1790.0%	1	K.FVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPVDER.L
UPRSX_HUMAN84.2%444.4%389441737.5(Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44)
	TK050203_NMyc_cyto1_step02.2064.2064.1	1.6475	0.1998	1305.55	1	5500.0%	1	K.IHIDLPNEQAR.L
	TK050203_NMyc_cyto1_step07.1352.1352.1	1.5198	0.2473	838.56	1	5710.0%	1	K.IHAGPITK.H
UQ6086484.1%223.7%543625826.8(Q60864) MSTI1
*	TK050203_NMyc_cyto1_step02.1526.1526.1	1.7646	0.1405	1066.83	1	6250.0%	1	K.HEANNLQLK.E
	TK050203_NMyc_cyto1_step01.2112.2112.1	1.8772	0.2028	1490.69	1	5000.0%	1	R.LAYINPDLALEEK.N
UTYB4_MOUSE84.0%41610%5056795.0(P20065) Thymosin beta-4 (T beta 4)
	TK050203_NMyc_cyto1_step01.0411.0411.1	1.7057	0.2114	657.34	2	7000.0%	4	K.NPLPSK.E
UQ9QXT083.9%5915.9%182207675.1(Q9QXT0) Putative secreted protein ZSIG9 (5330432A10RIK protein) (Transmembrane protein 4)
*	TK050203_NMyc_cyto1_step08.1466.1466.1	1.5779	0.2145	1393.66	2	4500.0%	2	K.RTDLCDHALHR.S
	TK050203_NMyc_cyto1_step07.3579.3579.2	1.9679	0.304	2515.33	2	2370.0%	2	K.FACESIVEEYEDELIEFFSR.E
UO9492783.9%111.9%641726388.9(O94927) Hypothetical protein KIAA0841 (Fragment)
*	TK050203_NMyc_cyto1_step02.2426.2426.1	1.8552	0.2014	1311.92	5	4580.0%	1	K.ASELLLPAAASLR.Q
UITAL_MOUSE83.8%121442.1%11631283446.1(P24063) Integrin alpha-L precursor (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (Leukocyte function associated molecule 1, alpha chain) (CD11a)
	TK050203_NMyc_cyto1_step05.3339.3339.2	1.7914	0.243	2926.57	1	2200.0%	12	K.EMLHVYVLSGIGGLVLLFLIFLALYK.V
UQ9ES6583.8%111.3%548617125.9(Q9ES65) Harmonin isoform a1
	TK050203_NMyc_cyto1_step01.2120.2120.1	1.6889	0.2105	1056.62	2	5710.0%	1	K.DYLYDVLR.M
UQ9DBH483.8%574.1%490548748.1(Q9DBH4) 1300010F03Rik protein
	TK050203_NMyc_cyto1_step06.2949.2949.2	2.4627	0.2823	2470.03	1	3000.0%	2	R.NVLPVLNNLLENREMQLEDGR.F
UO9513583.8%351.5%10511110488.8(O95135) Ataxin-2-like protein A2LP
	TK050203_NMyc_cyto1_step10.1247.1247.2	2.0905	0.3541	1718.47	1	5000.0%	2	R.GPHHLDNSSPGPGSEAR.G
UQ9CSN883.7%113.8%369422218.5(Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment)
	TK050203_NMyc_cyto1_step11.1487.1487.2	2.4655	0.2662	1793.46	1	5000.0%	1	K.LITQTFNHHNQLAQK.A
UQ8VHQ083.4%6182.6%385437876.4(Q8VHQ0) SPI3L2
*	TK050203_NMyc_cyto1_step12.2070.2070.2	2.2519	0.2996	1258.65	1	6000.0%	4	K.QGLFLSNVIHK.S
UO0030183.3%331.5%711731617.3(O00301) KSRP
*	TK050203_NMyc_cyto1_step02.2085.2085.1	1.6473	0.2071	1402.71	5	4550.0%	1	K.RQLEDGDQPESK.K
UPSB6_MOUSE83.3%224.6%238254255.1(Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y)
*	TK050203_NMyc_cyto1_step10.2187.2187.1	1.6565	0.2055	1568.56	1	5000.0%	1	K.LTPIHDHIFCCR.S
UQ9CYP982.9%118.5%117133965.6(Q9CYP9) 3930402F23Rik protein
*	TK050203_NMyc_cyto1_step02.1849.1849.1	1.94	0.1955	1140.52	1	6000.0%	1	R.GEPAEPSPEPK.E
UQ9H49182.8%394.7%170191899.3(Q9H491) BA346K17.1.2 (Novel protein similar to MAP1ALC3 (Micotubule-associated proteins 1A/1B light chain 3) from Rat, isoform 2) (Fragment)
*	TK050203_NMyc_cyto1_step01.1574.1574.1	2.0437	0.1175	1050.57	2	6250.0%	3	R.AMPSDRPFK.Q
UQ9BYZ482.8%7131.4%12521455737.8(Q9BYZ4) PRTD-NY2
*	TK050203_NMyc_cyto1_step01.3196.3196.1	1.6118	0.2109	1499.37	1	3750.0%	1	K.SPEVKTATQKPWK.R
*	TK050203_NMyc_cyto1_step03.1915.1915.1	1.6521	0.1047	839.58	4	6670.0%	3	R.KLQALHK.E
UQ9H5M382.7%461.4%715821876.6(Q9H5M3) Hypothetical protein FLJ23305
*	TK050203_NMyc_cyto1_step02.1710.1710.1	1.6018	0.211	1303.08	3	5000.0%	2	K.ESGFHQKALQR.A
UC2F2_MOUSE82.6%221.2%491559497.9(P33267) Cytochrome P450 2F2 (EC 1.14.14.-) (CYPIIF2) (Naphthalene dehydrogenase) (Naphthalene hydroxylase) (P450-NAH-2)
*	TK050203_NMyc_cyto1_step01.0207.0207.1	1.624	0.2057	863.48	1	7500.0%	1	R.FSVQILR.N
UPGCV_MOUSE82.5%790.7%33583669444.6(Q62059) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M)
*	TK050203_NMyc_cyto1_step05.3058.3058.2	2.3282	0.3097	2735.63	5	2170.0%	2	K.IFNMVTDLPQRDPTDTLSPLDMSK.I
UQ922K682.4%338%363406966.5(Q922K6) Unknown (Protein for MGC:7530)
*	TK050203_NMyc_cyto1_step05.3173.3173.2	1.966	0.3699	2966.17	2	1900.0%	1	R.SQSSDTEQPSPTSGGGKVAAVQPPEEGPSR.K
UQ9DB2182.4%358.5%318363629.1(Q9DB21) 1500031A17Rik protein
	TK050203_NMyc_cyto1_step06.3494.3494.2	2.4726	0.0523	3119.56	1	2040.0%	2	R.FNSEILCAALWGVNLLVGTENGLMLLDR.S
URGS3_HUMAN82.4%333.9%519566024.9(P49796) Regulator of G-protein signaling 3 (RGS3) (RGP3)
	TK050203_NMyc_cyto1_step06.3073.3073.2	2.4159	0.2691	2508.52	1	3500.0%	1	K.IFAEYIAIQACKEVNLDSYTR.E
UPSD3_MOUSE82.4%112.3%530606998.2(P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen)
*	TK050203_NMyc_cyto1_step05.1971.1971.1	2.0095	0.1555	1423.73	1	4580.0%	1	K.AVHGFFTSNNATR.D
UE2F5_HUMAN82.3%3511.8%346376105.1(Q15329) Transcription factor E2F5 (E2F-5)
*	TK050203_NMyc_cyto1_step11.3728.3728.3	2.9424	0.2892	4680.19	1	1340.0%	1	R.FSYVTHEDICNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQK.K
UQ9WVQ582.2%115.4%241269496.9(Q9WVQ5) MMRP19 (Monocyte macrophage 19)
*	TK050203_NMyc_cyto1_step02.1665.1665.1	1.8748	0.199	1513.18	1	4620.0%	1	K.HGNEIYIAPSGVQK.E
UQ9JHU982.0%334.3%557609326.4(Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1)
*	TK050203_NMyc_cyto1_step02.2742.2742.2	2.457	0.2288	2779.16	1	2920.0%	1	K.TMSIVSYNHLGNNDGQNLSAPLQFR.S
UNRTN_MOUSE82.0%118.7%1952221910.9(P97463) Neurturin precursor
*	TK050203_NMyc_cyto1_step08.1254.1254.2	2.0201	0.3482	1985.72	1	3820.0%	1	R.LAQYRALLQGAPDAVELR.E
UEF1D_MOUSE81.8%466.4%281312935.0(P57776) Elongation factor 1-delta (EF-1-delta)
*	TK050203_NMyc_cyto1_step05.1313.1313.1	1.705	0.2046	756.65	1	7500.0%	2	K.KPTLVAK.S
	TK050203_NMyc_cyto1_step03.1383.1383.1	1.829	0.0875	1423.59	1	5000.0%	1	R.ATAPQTQHVSPMR.Q
UMAP4_HUMAN81.7%572.4%11521210195.4(P27816) Microtubule-associated protein 4 (MAP 4)
*	TK050203_NMyc_cyto1_step06.1197.1197.1	1.8744	0.1898	1347.67	1	5830.0%	2	K.HVPGGGNVQIQNK.K
	TK050203_NMyc_cyto1_step02.1957.1957.1	1.9088	0.0037	1590.59	2	4060.0%	1	K.VGSLDNVGHLPAGGAVK.T
UQ9Z1K381.5%8161.3%20552189725.0(Q9Z1K3) Multiple PDZ domain protein
	TK050203_NMyc_cyto1_step10.3322.3322.2	2.4415	0.1891	3063.32	1	2590.0%	3	R.LKPGDHILAVDDEVVAGCPVEKFISLLK.T
UQ96DU781.4%350.9%683752075.1(Q96DU7) Inositol 1,4,5-trisphosphate 3-kinase C
*	TK050203_NMyc_cyto1_step01.4367.4367.1	1.6863	0.2	938.76	1	7500.0%	2	R.ERPRPRK.D
UQ9CPS781.2%116%248274549.8(Q9CPS7) 1810003N24Rik protein (Putative 25.7 kDa protein) (RIKEN cDNA 1810003N24 gene)
*	TK050203_NMyc_cyto1_step01.1048.1048.1	1.5822	0.2122	1565.49	2	4000.0%	1	R.QAEQSSAAGQDGEAGR.M
UQ9D90081.2%223.1%327373367.5(Q9D900) 1810014G04Rik protein
*	TK050203_NMyc_cyto1_step08.1808.1808.1	1.5666	0.2107	1378.71	2	5500.0%	1	R.FLSYVQAQHQR.R
UO3592581.1%12684.1%537580818.3(O35925) Beta1-syntrophin
*	TK050203_NMyc_cyto1_step11.3725.3725.2	1.6884	0.2774	2586.34	3	2500.0%	8	R.SIVQGCHNSAELTAEITTACTYR.N
UCRP1_MOUSE81.1%469.2%7684198.6(P04006) Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
	TK050203_NMyc_cyto1_step08.1618.1618.1	1.8222	0.1898	1113.65	2	6430.0%	2	K.DWHRPCLK.C
UQ96NA881.1%333.1%513558268.9(Q96NA8) Hypothetical protein FLJ31164
*	TK050203_NMyc_cyto1_step06.2418.2418.2	2.4608	0.1496	1918.52	6	3750.0%	1	K.HHQLLFGTGLLKAEPTR.R
UQ9NZC281.1%1118.7%230254476.3(Q9NZC2) Triggering receptor expressed on myeloid cells 2
*	TK050203_NMyc_cyto1_step01.3487.3487.3	2.6312	0.4314	4736.97	1	1160.0%	1	K.ILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT.-
UIMA5_HUMAN81.1%115%536602675.2(O15131) Importin alpha-6 subunit (Karyopherin alpha-5 subunit)
	TK050203_NMyc_cyto1_step12.3930.3930.3	3.0238	0.1663	3109.57	6	1850.0%	1	R.LGEQESKQNGIGINPYCALIEEAYGLDK.I
UQ8VDY281.1%3516.8%185208138.0(Q8VDY2) Hypothetical 20.8 kDa protein
*	TK050203_NMyc_cyto1_step10.3134.3134.3	2.5993	0.4305	3605.85	1	1850.0%	2	R.DEGEWRLAVCFLAASSVLLAGGLSLFLFFVWK.W
UCA21_MOUSE81.1%793.2%13721295579.2(Q01149) Collagen alpha 2(I) chain precursor
*	TK050203_NMyc_cyto1_step10.3263.3263.3	2.6123	0.515	3928.06	1	1480.0%	1	R.GEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPR.G
UDDX9_MOUSE81.0%331.3%13801495826.9(O70133) ATP-dependent RNA helicase A (Nuclear DNA helicase II) (NDH II) (DEAD-box protein 9) (mHEL-5)
	TK050203_NMyc_cyto1_step07.1660.1660.2	2.4168	0.2418	2146.0	1	4170.0%	1	K.LEAGIRGISHVIVDEIHER.D
UQ91VN181.0%226.5%368419196.0(Q91VN1) Zinc finger protein ZF-12
*	TK050203_NMyc_cyto1_step12.3037.3037.2	2.0066	0.3572	2855.12	1	2080.0%	1	K.LEEDPDGEEGSSISWNHLPDPEVFR.Q
UQ9UK2381.0%352.9%515561536.7(Q9UK23) N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (EC 3.1.4.45)
*	TK050203_NMyc_cyto1_step07.2242.2242.1	1.7834	0.1991	1573.98	1	4330.0%	2	R.TFSVLEPGGPGGCAAR.R
UQ9WV3981.0%352%11401268815.3(Q9WV39) Damage-specific DNA binding protein 1
	TK050203_NMyc_cyto1_step05.3629.3629.2	2.3068	0.3098	2652.09	2	2830.0%	2	R.KTEPATGFIDGDLIESFLDISRPK.M
UQ1418580.7%440.5%18652153747.6(Q14185) DOCK180 protein
*	TK050203_NMyc_cyto1_step02.1997.1997.1	2.0604	0.0912	1110.54	1	6670.0%	1	K.VIAAKEVNHK.G
URT21_MOUSE80.3%119.2%871056110.3(P58059) Mitochondrial 28S ribosomal protein S21 (MRP-S21)
	TK050203_NMyc_cyto1_step01.1934.1934.1	2.057	0.0614	1158.61	3	6880.0%	1	R.IYNMEMARK.I
UQ8R3U280.2%8389.9%324371208.7(Q8R3U2) Similar to hypothetical protein FLJ22693 (Fragment)
*	TK050203_NMyc_cyto1_step12.2829.2829.3	2.5129	0.3202	3895.83	1	1720.0%	6	-.IWYWMDEFGSWQEYGRQGSGHPVTTISSSDVER.A
UO9562580.2%221.5%10531193838.7(O95625) Zinc finger protein
*	TK050203_NMyc_cyto1_step03.1458.1458.2	2.41	0.1939	1763.96	3	4060.0%	1	K.GAVSSHEAVVDLSGFCK.A
UO7504279.8%770.6%18822101785.5(O75042) Hypothetical protein KIAA0454 (Fragment)
*	TK050203_NMyc_cyto1_step01.3778.3778.1	2.0223	0.1255	1394.66	1	5450.0%	1	K.LKNAHNIINLLK.E
UQ9QZ1379.8%222.4%502579805.1(Q9QZ13) Fatso protein
*	TK050203_NMyc_cyto1_step05.2874.2874.1	1.9053	0.175	1509.61	1	5420.0%	1	K.MESMTNAVLREVK.R
UQ1478979.7%10120.4%32593760785.0(Q14789) GIANTIN (GCP372) (MACROGOLGIN) (Golgi autoantigen, golgin subfamily B, 1)
*	TK050203_NMyc_cyto1_step01.3643.3643.1	1.932	0.1668	1507.78	2	4170.0%	1	K.ELSMVTELRAQVK.Q
UQ9HBF979.7%352.4%714814978.8(Q9HBF9) Gag-pro-pol protein (Fragment)
*	TK050203_NMyc_cyto1_step08.2050.2050.2	1.8823	0.2604	2118.81	2	2940.0%	2	K.YVHVTVDTYSHFTFATAR.T
UHGFA_MOUSE79.6%113.7%653705687.0(Q9R098) Hepatocyte growth factor activator precursor (EC 3.4.21.-) (HGF activator) (HGFA)
*	TK050203_NMyc_cyto1_step10.2506.2506.2	1.9581	0.3461	2630.57	3	2500.0%	1	R.VHSQTPEILAALPESAPAVRPTCGK.R
UINA7_HUMAN79.5%2144119%189221076.9(P01567) Interferon alpha-7 precursor (Interferon alpha-J1) (IFN-alpha-J1) (Interferon alpha-J) (LeIF J)
*	TK050203_NMyc_cyto1_step05.0002.0002.3	2.5088	0.3722	4317.32	1	1320.0%	21	K.FSTELYQQLNDLEACVIQEVGVEETPLMNEDFILAVR.K
UQ91Y1679.5%4104.4%9421022485.1(Q91Y16) Protocadherin alpha 3
*	TK050203_NMyc_cyto1_step10.3800.3800.3	2.6124	0.4084	4502.24	1	1400.0%	3	R.EDIPEHNLLITAVDGGKPELTGTTQVKITVLDVNDNAPAFEK.T
UQ9H7U379.4%222.8%387426506.4(Q9H7U3) Hypothetical protein FLJ14257
	TK050203_NMyc_cyto1_step08.1645.1645.1	1.8887	0.183	1305.65	1	5910.0%	1	R.HHGQEGSILVTK.V
UQ96DQ179.4%118.9%302332837.7(Q96DQ1) Hypothetical protein FLJ30646
*	TK050203_NMyc_cyto1_step05.3451.3451.2	2.0894	0.3327	3180.29	1	2410.0%	1	K.WITYVGLGISIGSLILCLIIEALFWKQA.-
UQ9EQ1879.2%442.1%389432565.4(Q9EQ18) SIR2L2
*	TK050203_NMyc_cyto1_step05.1502.1502.1	1.909	0.1494	1175.41	1	6880.0%	1	R.KEYTMGWMK.E
UQ9JJQ079.2%5112.2%542631349.2(Q9JJQ0) Pig-b
*	TK050203_NMyc_cyto1_step06.3289.3289.1	1.5965	0.1977	1545.85	3	4580.0%	3	K.EINTFLTSGNYER.A
UQ91VR879.2%1114.7%7587615.5(Q91VR8) Unknown (Protein for MGC:6981)
	TK050203_NMyc_cyto1_step03.1603.1603.1	1.9106	0.1526	1425.58	1	4550.0%	1	R.EYIEIITSSIKK.I
UCIN6_HUMAN79.2%330.7%16821934728.0(Q01118) Sodium channel protein, cardiac and skeletal muscle alpha-subunit
*	TK050203_NMyc_cyto1_step10.2050.2050.1	1.5937	0.2018	1352.56	2	4550.0%	1	R.ILKIIPLNQGLK.S
UQ9HCL979.2%224%670771005.5(Q9HCL9) Hypothetical protein KIAA1553 (Fragment)
*	TK050203_NMyc_cyto1_step12.2149.2149.3	2.9159	0.2928	3186.69	1	2220.0%	1	K.DFCKIPLDELVVPSPDFPVPSPYLLSDK.E
UCDC2_MOUSE79.1%113.4%297341078.4(P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1)
	TK050203_NMyc_cyto1_step11.1439.1439.1	1.462	0.2565	1209.66	1	5500.0%	1	K.WKPGSLASHVK.N
URS16_MOUSE78.8%117.6%1441622510.2(P14131) 40S ribosomal protein S16
	TK050203_NMyc_cyto1_step02.2110.2110.1	1.7681	0.1856	1381.69	1	5910.0%	1	K.LLEPVLLLGKER.F
UO9507278.8%221.5%547626145.0(O95072) Recombination and sister chromatid cohesion protein homolog (Similar to Rec8p, a meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family) (Fragment)
	TK050203_NMyc_cyto1_step02.1878.1878.1	1.4121	0.3334	1013.57	1	6250.0%	1	R.RPPVPPPPR.R
UUBF1_MOUSE78.8%5171.4%765895095.8(P25976) Nucleolar transcription factor 1 (Upstream binding factor 1) (UBF-1)
	TK050203_NMyc_cyto1_step07.2316.2316.1	1.6278	0.1961	1410.6	1	5000.0%	4	R.EDHPDLIQNAKK.S
UQ9NRT978.7%11672.5%9471044065.0(Q9NRT9) Protocadherin 13 (Fragment)
*	TK050203_NMyc_cyto1_step11.2395.2395.2	1.8647	0.3683	2746.21	1	2080.0%	8	R.GLSGQYVTLDNRSGELHTSAQEIDR.E
UPSDD_MOUSE78.6%482.9%376428095.7(Q9WVJ2) 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5)
	TK050203_NMyc_cyto1_step10.1675.1675.1	1.9839	0.1329	1366.63	2	4550.0%	2	R.QLTFEEIAKSAK.I
UQ9D1M278.5%337.7%143161995.3(Q9D1M2) 1110003E08Rik protein
	TK050203_NMyc_cyto1_step02.1556.1556.1	1.8464	0.1847	1225.59	1	5450.0%	1	K.HAEATLGSGNLR.M
USCP1_MOUSE78.4%5110.8%9931159625.8(Q62209) Synaptonemal complex protein 1 (SCP-1 protein)
*	TK050203_NMyc_cyto1_step11.1475.1475.1	1.6183	0.1965	937.67	1	6880.0%	3	K.YIPTGGSNK.K
UNPHN_MOUSE78.3%350.7%12421348905.6(Q9QZS7) Nephrin precursor (Renal glomerulus-specific cell adhesion receptor)
*	TK050203_NMyc_cyto1_step02.1968.1968.1	1.8525	0.1782	1064.83	4	5000.0%	2	R.VILSVLVPPK.V
UQ9CXF978.3%334.4%616673339.0(Q9CXF9) 4121402D02Rik protein
*	TK050203_NMyc_cyto1_step02.4322.4322.2	1.8073	0.4309	3082.49	1	2410.0%	1	R.CLMPSSVAGETSVLAVPSWRDHSVEPLR.D
UPMS2_MOUSE78.3%572.4%859952257.4(P54279) PMS1 protein homolog 2 (DNA mismatch repair protein PMS2)
*	TK050203_NMyc_cyto1_step11.4055.4055.2	1.8055	0.4472	2516.41	1	2380.0%	1	K.SMFAEMEILGQFNLGFIVTKLK.E
UAGM1_MOUSE78.2%462%542594536.2(Q9CYR6) Phosphoacetylglucosamine mutase (EC 5.4.2.3) (PAGM) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase)
*	TK050203_NMyc_cyto1_step08.2166.2166.1	1.8608	0.1719	1482.79	2	3640.0%	2	R.TNAQHLDHIMFR.M
UROA2_MOUSE78.2%353.5%341359938.6(O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1)
	TK050203_NMyc_cyto1_step03.1368.1368.1	1.8404	0.181	1340.66	1	5420.0%	2	R.EESGKPGAHVTVK.K
UFIBG_HUMAN78.2%551.5%453515125.6(P02679) Fibrinogen gamma chain precursor (PRO2061)
*	TK050203_NMyc_cyto1_step02.1544.1544.1	1.8269	0.1736	1023.54	2	6430.0%	1	R.KMLEEIMK.Y
UPMG2_MOUSE78.2%113.2%252286968.5(O70250) Phosphoglycerate mutase 2 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme M) (PGAM-M) (BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase)
*	TK050203_NMyc_cyto1_step03.1506.1506.1	1.5014	0.2259	1112.45	1	6250.0%	1	K.HNYYTSISK.D
UGRG_MOUSE78.1%225.6%197220006.4(Q06195) GRG protein (ESP1 protein) (Amino enhancer of split) (AES-1/AES-2)
	TK050203_NMyc_cyto1_step10.1536.1536.1	1.5801	0.2006	1318.58	1	5450.0%	1	R.HSGSSHLPQQLK.F
UQ8VEK778.1%10522.5%2372729410.3(Q8VEK7) Hypothetical 27.3 kDa protein
	TK050203_NMyc_cyto1_step03.1970.1970.1	1.5429	0.129	910.53	3	7500.0%	7	R.QHMKVHK.E
UQ99K4878.0%114.7%473545418.9(Q99K48) Non-POU-domain-containing, octamer-binding protein
	TK050203_NMyc_cyto1_step05.3669.3669.2	2.0327	0.3287	2671.11	1	2950.0%	1	R.NLPQYVSNELLEEAFSVFGQVER.A
UQ9ER6577.7%682.6%9661078685.7(Q9ER65) Calsyntenin-2
	TK050203_NMyc_cyto1_step06.3275.3275.2	1.9725	0.3368	2961.81	1	2200.0%	2	K.YHFNPSQSILVMEGDDIGNINRALQK.V
UQ96RU177.4%221.6%685766806.5(Q96RU1) Rhophilin-like protein
*	TK050203_NMyc_cyto1_step01.3239.3239.1	1.6962	0.1905	1367.33	1	5000.0%	1	K.ETKDVDFAVVLK.D
UMIF_MOUSE77.4%245.3%114123737.3(P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor)
*	TK050203_NMyc_cyto1_step05.1391.1391.1	1.4561	0.2334	837.46	3	6670.0%	2	R.LHISPDR.V
UROK_MOUSE77.4%352.4%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein)
	TK050203_NMyc_cyto1_step01.2983.2983.1	1.5945	0.1959	1342.83	1	5450.0%	2	K.IILDLISESPIK.G
UQ9CSF277.3%6368.2%159182849.2(Q9CSF2) 2810405K07Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step01.4382.4382.1	2.0021	0.1212	1590.76	1	4620.0%	6	R.DCGKAFYGVTSLNR.H
UQ8R34977.2%221.5%620714605.8(Q8R349) Similar to CDC16 cell division cycle 16 homolog (S. cerevisiae)
*	TK050203_NMyc_cyto1_step03.1766.1766.1	1.9016	0.1398	1143.44	1	7780.0%	1	K.ELLDSLPLNK.L
UQ9BYT977.2%221.6%9811146558.6(Q9BYT9) Hypothetical protein
*	TK050203_NMyc_cyto1_step11.1752.1752.2	1.8214	0.3643	1855.54	2	3120.0%	1	K.NDMNYIASSGPLFKDGK.R
UPTPZ_HUMAN77.2%660.8%23142545284.9(P23471) Protein-tyrosine phosphatase zeta precursor (EC 3.1.3.48) (R-PTP-zeta)
*	TK050203_NMyc_cyto1_step03.1452.1452.2	2.1081	0.3194	2121.78	1	3420.0%	1	K.TVLPAVPSDPILVETPKVDK.I
UQ9CVA377.1%226.8%161183749.1(Q9CVA3) 2210415M20Rik protein (Fragment)
	TK050203_NMyc_cyto1_step11.1329.1329.1	1.8176	0.1687	1311.51	1	5000.0%	1	K.IVVHLHPAPSNK.E
UAP19_MOUSE77.1%246.3%111121629.1(P56212) cAMP-regulated phosphoprotein 19 (ARPP-19)
	TK050203_NMyc_cyto1_step05.1303.1303.1	1.8161	0.162	831.56	1	6430.0%	2	R.KPSLVASK.L
UGHR_MOUSE77.0%225.7%650727834.9(P16882) Growth hormone receptor precursor (GH receptor) (GH binding protein) (GHBP) (Serum binding protein)
*	TK050203_NMyc_cyto1_step11.2020.2020.3	2.6544	0.3317	3968.96	2	1420.0%	1	-.MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQR.I
UQ924K176.9%247.3%328383035.9(Q924K1) Aryl-hydrocarbon interacting protein-like 1
	TK050203_NMyc_cyto1_step01.3199.3199.2	2.1009	0.3153	2937.01	5	2290.0%	2	R.LGEVAEFWCDTIHTGVYPMLSRSLR.Q
UMY1C_MOUSE76.8%110.9%10281181569.4(Q9WTI7) Myosin Ic (Myosin I beta) (MMIb)
	TK050203_NMyc_cyto1_step06.1511.1511.1	1.5155	0.2214	1263.63	2	5560.0%	1	R.HLGYKPEEYK.M
UFCEB_HUMAN76.7%2216.4%244265345.1(Q01362) High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-chain)
*	TK050203_NMyc_cyto1_step01.3979.3979.3	2.6204	0.3494	4666.32	4	1060.0%	1	K.EQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFK.A
UQ8R5L076.5%245.8%155175529.5(Q8R5L0) Age-related protein
*	TK050203_NMyc_cyto1_step01.2692.2692.1	1.6609	0.1881	1112.65	2	5000.0%	2	K.GINKIVQVLK.V
UQ9NVV776.4%224.9%406445968.7(Q9NVV7) Hypothetical protein FLJ10482
*	TK050203_NMyc_cyto1_step11.3669.3669.2	1.8939	0.3461	2283.81	1	3000.0%	1	R.SPPLTTGEPVDNLSPEERDAR.T
UCAG2_MOUSE76.4%6363.4%533592128.6(Q09200) Beta-1,4 N-acetylgalactosaminyltransferase (EC 2.4.1.92) ((N-acetylneuraminyl)-galactosylglucosylceramide) (GM2/GD2 synthase) (GalNAc-T)
*	TK050203_NMyc_cyto1_step07.4117.4117.2	2.3689	0.142	2224.0	4	3610.0%	6	R.RFYPTVTIVIADDSDKPER.I
UQ8TB8076.4%339.3%248273107.2(Q8TB80) Hypothetical protein
*	TK050203_NMyc_cyto1_step10.2251.2251.2	2.3647	0.2561	2437.07	1	2610.0%	1	R.SSLAALDNHGGDPLGSRASSTTYR.N
UMK06_MOUSE76.3%461.3%720821895.2(Q61532) Mitogen-activated protein kinase 6 (EC 2.7.1.-) (Extracellular signal-regulated kinase 3) (ERK-3)
	TK050203_NMyc_cyto1_step03.1947.1947.1	1.9375	0.1353	1165.58	2	6110.0%	2	R.LLLSPNNYTK.A
USYG_MOUSE76.3%463.2%729818786.7(Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS)
	TK050203_NMyc_cyto1_step06.3086.3086.2	1.9372	0.3399	2915.35	1	2830.0%	2	R.QHFIQEEQILEIDCTMLTPEPVLK.T
UQ9H1Y176.1%243%877983306.1(Q9H1Y1) BA446H13.1.1 (Novel protein similar to KIAA1059 (Ortholog of mouse VPS10 domain receptor protein SORCS) (Isoform 1)) (Fragment)
*	TK050203_NMyc_cyto1_step10.2511.2511.3	2.6028	0.3552	2917.68	2	2120.0%	2	K.VESQLIGSISIVAENQSTKEIPTYVNV.-
ULY9_HUMAN76.1%225.8%655721075.5(Q9HBG7) T-lymphocyte surface antigen Ly-9 precursor (Lymphocyte antigen 9) (Cell-surface molecule Ly-9) (CD229 antigen)
*	TK050203_NMyc_cyto1_step12.2338.2338.3	2.6079	0.3486	4383.64	4	1320.0%	1	R.ISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWR.S
UCH60_MOUSE76.0%441.9%573609566.2(P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65)
	TK050203_NMyc_cyto1_step02.2414.2414.1	1.7502	0.1843	1216.58	5	5000.0%	1	K.NAGVEGSLIVEK.I
UPLO2_HUMAN76.0%391.8%737846646.6(O00469) Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursor (EC 1.14.11.4) (Lysyl hydroxylase 2) (LH2)
*	TK050203_NMyc_cyto1_step01.4410.4410.1	1.7637	0.1772	1588.78	4	3460.0%	3	K.VVFAADGILWPDKR.L
UZF64_HUMAN76.0%224.1%510579338.3(P15622) Zinc finger protein clone 647
*	TK050203_NMyc_cyto1_step06.2921.2921.2	1.8785	0.3402	2654.95	4	2140.0%	1	R.SLIQHERIHTGEKPFQCTECGK.A
UO0031975.9%110.9%672744855.1(O00319) WUGSC:H_DJ525N14.1 protein
*	TK050203_NMyc_cyto1_step05.1602.1602.1	1.4864	0.2328	842.41	2	7500.0%	1	K.HLMEGQK.I
UPSD7_MOUSE75.7%6617.4%321365406.8(P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein)
	TK050203_NMyc_cyto1_step03.1435.1435.1	1.6133	0.1573	1009.48	1	5620.0%	1	R.ITNQVHGLK.G
	TK050203_NMyc_cyto1_step06.1887.1887.1	1.8279	0.1564	1158.69	1	5560.0%	1	R.IVGWYHTGPK.L
	TK050203_NMyc_cyto1_step11.3401.3401.2	1.7775	0.4334	1943.92	1	4690.0%	1	K.VVVHPLVLLSVVDHFNR.I
	TK050203_NMyc_cyto1_step02.3005.3005.2	1.5756	0.3244	2682.43	1	3260.0%	1	K.TFEHVTSEIGAEEAEEVGVEHLLR.D
UQ99KJ975.4%353.4%638732165.6(Q99KJ9) Hypothetical 73.2 kDa protein
*	TK050203_NMyc_cyto1_step05.3278.3278.2	2.2406	0.2717	2708.25	1	2950.0%	2	R.KPLLVHVYGAYGMDLKMNFRPEK.R
UWDR8_MOUSE75.2%338.4%462520277.2(Q9JM98) WD-repeat protein 8
*	TK050203_NMyc_cyto1_step12.3492.3492.2	1.9716	0.3318	3181.85	1	1670.0%	1	R.AMAGALSTSESKYEIASGPVSLQTLKPVADR.A
*	TK050203_NMyc_cyto1_step10.1803.1803.1	1.6118	0.0909	1208.59	4	5000.0%	1	K.ERVGTAYEQR.D
UQ9DAJ675.2%574.6%152171826.0(Q9DAJ6) 1500026J17Rik protein
	TK050203_NMyc_cyto1_step03.1395.1395.1	1.7937	0.1593	987.52	1	6430.0%	2	K.IYHPNVDK.L
UCHM1_HUMAN75.2%112.4%334371027.6(O75829) Chondromodulin-I precursor (ChM-I) [Contains: Chondrosurfactant protein (CH-SP)]
*	TK050203_NMyc_cyto1_step01.1300.1300.1	1.4784	0.2247	913.53	1	5620.0%	1	R.IPEVGAVTK.Q
UQ8TCZ975.0%15230.7%40744467046.6(Q8TCZ9) Polycystic kidney and hepatic disease 1
*	TK050203_NMyc_cyto1_step01.3899.3899.2	2.1832	0.2931	3141.91	1	2320.0%	1	R.ALGLPPPVSVFPKTEAEWTASFFNAGTFR.E
UQ9UI0174.8%331.2%742873265.3(Q9UI01) Hypothetical protein
*	TK050203_NMyc_cyto1_step01.1444.1444.1	1.5871	0.1901	1177.55	2	5560.0%	1	R.LQKTLENSNK.K
UUBIQ_HUMAN74.7%4417.1%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin
	TK050203_NMyc_cyto1_step01.0135.0135.1	1.79	0.1683	1083.46	2	5620.0%	1	R.TLSDYNIQK.E
	TK050203_NMyc_cyto1_step01.1498.1498.1	1.6635	0.1654	648.48	1	8000.0%	1	R.LIFAGK.Q
UAKT2_MOUSE74.7%222.3%481557426.4(Q60823) RAC-beta serine/threonine protein kinase (EC 2.7.1.-) (RAC-PK-beta) (Protein kinase Akt-2) (Protein kinase B, beta) (PKB beta)
	TK050203_NMyc_cyto1_step05.2190.2190.1	1.5447	0.1961	1446.6	2	4090.0%	1	R.AKVTMNDFDYLK.L
UCPN2_MOUSE74.6%222.2%500573159.9(P15539) Cytochrome P450 11B2, mitochondrial precursor (EC 1.14.15.4) (CYPXIB2) (P450C11) (Steroid 11-beta-hydroxylase) (Aldosterone synthase)
*	TK050203_NMyc_cyto1_step08.1546.1546.2	2.1507	0.3031	1444.49	1	5000.0%	1	R.RGVFLLNGPEWR.L
UQ9BXT574.6%14260.4%27893153626.2(Q9BXT5) TEX15
*	TK050203_NMyc_cyto1_step05.1819.1819.1	1.6814	0.1853	1425.62	1	5450.0%	1	K.KDCAAFAICDQK.S
UQ1517074.3%5176.4%1571830711.2(Q15170) Transcription factor S-II-related protein (PP21)
*	TK050203_NMyc_cyto1_step01.2894.2894.1	1.6983	0.1712	1254.89	1	5500.0%	4	R.WSTLPKSSPPR.S
UPA2A_HUMAN74.1%116.3%144160839.2(P14555) Phospholipase A2, membrane associated precursor (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase) (Group IIA phospholipase A2) (GIIC sPLA2) (Non-pancreatic secretory phospholipase A2) (NPS-PLA2)
*	TK050203_NMyc_cyto1_step05.1607.1607.1	1.8406	0.1407	1419.64	1	5000.0%	1	K.YQYYSNKHCR.G
UTBL3_HUMAN74.0%335.2%519560478.1(Q12788) WD-repeat protein SAZD (Transducin beta-like 3 protein)
*	TK050203_NMyc_cyto1_step01.2928.2928.1	1.5415	0.1344	1321.79	1	5000.0%	1	R.VASGASSSLPWTR.C
	TK050203_NMyc_cyto1_step05.2917.2917.2	2.3167	0.1739	1800.09	3	4330.0%	1	R.CHDKDINSVAIAPNDK.L
UQ8TDH173.9%221.1%9911099415.6(Q8TDH1) CLL-associated antigen KW-13 (Fragment)
*	TK050203_NMyc_cyto1_step01.2804.2804.1	1.6447	0.1852	1289.88	1	4550.0%	1	R.DGAIEDIITVIK.T
UQ9Z2V773.9%331%10641192135.7(Q9Z2V7) Lymphocyte specific formin related protein
*	TK050203_NMyc_cyto1_step01.2804.2804.1	1.6447	0.1852	1289.88	1	4550.0%	1	R.DGAIEDIITVLK.T
UQ9CQH273.8%41612.1%1071220711.4(Q9CQH2) 1810008A14Rik protein
*	TK050203_NMyc_cyto1_step05.4067.4067.1	1.6287	0.1839	1545.36	5	4620.0%	4	R.QQPVLLQLALAGHR.A
UQ9D0I873.7%223.8%239275468.5(Q9D0I8) 2610012O22Rik protein
	TK050203_NMyc_cyto1_step02.2533.2533.1	1.6452	0.1751	1235.44	3	5000.0%	1	K.LFGYEMAEFK.V
UQ9CR2573.7%592.9%489523655.5(Q9CR25) 9130020C19Rik protein
*	TK050203_NMyc_cyto1_step11.2309.2309.2	2.1567	0.0848	1522.05	3	4290.0%	2	R.VVGLLAGTLGVARHR.E
UQ91WD873.7%241.5%11301246674.7(Q91WD8) Similar to sodium/calcium/potassium exchanger
	TK050203_NMyc_cyto1_step06.3181.3181.2	2.364	0.105	2088.69	2	4120.0%	2	R.LLFLLGMLIIGSTYQHLR.R
UQ8VIG873.7%2225.5%5563675.2(Q8VIG8) Hypothetical 6.4 kDa protein
*	TK050203_NMyc_cyto1_step10.2655.2655.2	2.3414	0.1323	1698.77	3	4290.0%	1	R.LMNEVTVPGRTHLTK.W
UQ91WS773.7%6204.9%511584797.6(Q91WS7) Hypothetical 58.5 kDa protein
*	TK050203_NMyc_cyto1_step05.3514.3514.3	2.8072	0.1105	2937.22	1	2100.0%	2	K.SDSLEDLWENLSLKPASSPHIHISTR.L
UQ8R2D973.7%248.3%302352739.4(Q8R2D9) Vomeronasal receptor V1RC15
*	TK050203_NMyc_cyto1_step10.3502.3502.2	2.3672	0.0109	3006.56	1	2600.0%	2	K.FVMNAYPTITPLIQIISDNRMIITLK.N
UQ96SC373.7%990.9%26732910216.6(Q96SC3) Fibulin-6 (Fragment)
	TK050203_NMyc_cyto1_step05.3427.3427.2	2.342	0.3638	2915.21	6	2000.0%	1	K.MTWMKDGRPLPQTDQVQTLGGGEVLR.I
UEF1B_MOUSE73.5%114.9%224245774.6(O70251) Elongation factor 1-beta (EF-1-beta)
	TK050203_NMyc_cyto1_step02.2042.2042.1	1.9572	0.1174	1474.54	1	5000.0%	1	K.KLQIQCVVEDDK.V
UY136_HUMAN73.5%110.9%9501083025.7(Q14149) Hypothetical protein KIAA0136 (Fragment)
*	TK050203_NMyc_cyto1_step01.2610.2610.1	1.6691	0.1709	1309.69	2	5560.0%	1	R.QCHMFTDQIK.V
UQ9CVM473.4%116.7%194216234.3(Q9CVM4) 1810012H02Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step01.0735.0735.1	1.6116	0.1824	1392.21	1	4620.0%	1	K.LSEASGGLAENGER.S
UQ9WUC273.4%441%11301271997.7(Q9WUC2) SH2-containing inositol phosphatase
	TK050203_NMyc_cyto1_step01.1930.1930.1	1.8498	0.1336	1540.66	2	5000.0%	1	K.REGFCQLLQQMK.N
UQ96T6873.4%441.5%719818547.6(Q96T68) CLLL8 protein
*	TK050203_NMyc_cyto1_step01.0499.0499.1	1.5037	0.2185	1341.9	2	5000.0%	1	K.NTSSDSLTKFNK.G
UTDT_MOUSE73.3%661.9%530603317.9(P09838) DNA nucleotidylexotransferase (EC 2.7.7.31) (Terminal addition enzyme) (Terminal deoxynucleotidyltransferase) (TDT) (Terminal transferase)
*	TK050203_NMyc_cyto1_step02.2041.2041.1	2.0052	0.0933	1392.86	2	5500.0%	1	R.FRDLVLFILEK.K
UQ9HC7373.2%392.7%371420135.2(Q9HC73) Cytokine receptor CRL2 PRECUSOR (IL-XR) (Thymic stromal LYMPHOPOIETIN protein receptor TSLPR)
	TK050203_NMyc_cyto1_step06.2095.2095.1	1.7559	0.1633	1188.67	2	5500.0%	3	R.NGTHPVFTASR.W
UQ91W5073.1%334.1%798887916.4(Q91W50) Hypothetical 88.8 kDa protein
	TK050203_NMyc_cyto1_step10.1476.1476.2	1.8931	0.2626	1367.39	1	5910.0%	1	K.GTVSFHSHSDHR.F
	TK050203_NMyc_cyto1_step07.3287.3287.2	1.8051	0.3458	2577.5	1	3180.0%	1	R.LLPQGTVIFEDISIEHFEGTVTK.V
UVAB1_HUMAN72.9%112.9%513569805.8(P15313) Vacuolar ATP synthase subunit B, kidney isoform (EC 3.6.3.14) (V-ATPase B1 subunit) (Vacuolar proton pump B isoform 1) (Endomembrane proton pump 58 kDa subunit)
*	TK050203_NMyc_cyto1_step12.1873.1873.2	1.8391	0.3371	1690.16	1	5330.0%	1	K.AIVQVFEGTSGIDARK.T
UDAG1_MOUSE72.9%571.6%893969058.4(Q62165) Dystroglycan precursor (Dystrophin-associated glycoprotein 1) [Contains: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)]
*	TK050203_NMyc_cyto1_step10.3403.3403.1	1.7219	0.1646	1575.65	1	4640.0%	2	R.LAGDPAPVVNDIHKK.I
UQ9BRG072.8%352.4%542580585.8(Q9BRG0) Hypothetical protein (Fragment)
*	TK050203_NMyc_cyto1_step01.4618.4618.1	1.8986	0.127	1586.57	2	3850.0%	2	R.LDSGDLLQQAQEIR.K
UQ91ZJ572.7%462.6%508569797.6(Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2
*	TK050203_NMyc_cyto1_step05.1823.1823.1	1.8943	0.1198	1584.45	1	4620.0%	1	K.ILTTAASHEFEHTK.K
UDNPE_MOUSE72.7%331.9%473521677.1(Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21)
	TK050203_NMyc_cyto1_step12.1890.1890.2	2.0847	0.3128	1198.84	1	8330.0%	1	R.IPHLAIHLQR.N
UPODX_HUMAN72.7%222.3%528555965.6(O00592) Podocalyxin-like protein 1 precursor
*	TK050203_NMyc_cyto1_step05.2062.2062.1	1.5063	0.2066	1364.63	3	4580.0%	1	K.SSHSVTTDLTSTK.A
UCA64_HUMAN72.6%461.8%16781624619.2(Q14031) Collagen alpha 6(IV) chain precursor
	TK050203_NMyc_cyto1_step06.3237.3237.2	2.2628	0.2608	2957.96	5	1770.0%	2	R.GVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEK.G
UARD1_HUMAN72.5%220.9%574640676.4(P36406) GTP-binding protein ARD-1 (Tripartite motif protein 23)
*	TK050203_NMyc_cyto1_step07.1340.1340.1	1.4065	0.3263	650.32	1	7000.0%	1	R.VHIGPK.M
UARI1_HUMAN72.5%397.4%557641185.1(Q9Y4X5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein) (HHARI) (H7-AP2) (HUSSY-27) (MOP-6)
*	TK050203_NMyc_cyto1_step06.2977.2977.3	2.96	0.2368	3618.44	2	1590.0%	3	R.DGLLCGETGGGGGSALGPGGGGGGGGGGGGGGPGHEQEEDYR.Y
U143T_MOUSE72.3%337.3%245277784.8(P35216) 14-3-3 protein tau (14-3-3 protein theta)
	TK050203_NMyc_cyto1_step02.3221.3221.2	2.2984	0.2462	2146.06	1	3890.0%	1	K.TAFDEAIAELDTLNEDSYK.D
UAPXL_HUMAN72.2%661.2%16161764097.1(Q13796) Apical-like protein (APXL protein)
*	TK050203_NMyc_cyto1_step12.1583.1583.2	2.1452	0.2994	2160.3	1	3160.0%	1	R.TLDHFSSLGSVDSLDHPSSR.L
UHBE_HUMAN72.1%61422.6%146160728.6(P02100) Hemoglobin epsilon chain
*	TK050203_NMyc_cyto1_step05.4144.4144.2	1.8763	0.3264	2591.33	1	2500.0%	2	K.MNVEEAGGEALGRLLVVYPWTQR.F
*	TK050203_NMyc_cyto1_step01.4346.4346.1	1.8814	0.1092	1195.75	4	5450.0%	3	K.LVSAVAIALAHK.Y
UQ9R0S472.0%9151.3%14551636746.5(Q9R0S4) NIK-related kinase
*	TK050203_NMyc_cyto1_step02.4292.4292.2	2.1109	0.2984	2272.31	1	2890.0%	3	K.EPEVVQVHAQVLLPLLSQNR.H
UPGK2_MOUSE71.9%331.2%416447807.1(P09041) Phosphoglycerate kinase, testis specific (EC 2.7.2.3)
	TK050203_NMyc_cyto1_step01.1947.1947.1	1.808	0.1361	734.5	1	8000.0%	1	K.DVIFLK.D
UO8907671.7%2416.8%137151855.4(O89076) Ring canal protein (Fragment)
*	TK050203_NMyc_cyto1_step11.3256.3256.2	2.088	0.3073	2602.82	1	2390.0%	2	K.YEDIPAAQLMAHKVVLASSSPVFK.A
U3BP1_HUMAN71.5%4102.1%622667655.9(Q9Y3L3) SH3-domain binding protein 1 (3BP-1)
*	TK050203_NMyc_cyto1_step11.1805.1805.1	1.9546	0.105	1533.67	2	3850.0%	3	R.RSLSSLDTALAELR.E
UDD24_HUMAN71.1%9652.8%859963329.1(Q9GZR7) ATP-dependent RNA helicase DDX24 (DEAD-box protein 24)
*	TK050203_NMyc_cyto1_step06.3310.3310.2	2.3045	0.1709	2523.85	4	2500.0%	8	R.NAAPPPSNTEAPPGETRTEAGAETR.S
UQ9Z2L771.1%115.4%442495595.0(Q9Z2L7) Cytokine receptor related protein 4
	TK050203_NMyc_cyto1_step12.2547.2547.2	2.3046	0.1612	2696.48	1	2710.0%	1	K.HGTVASRPPVQIEELIEKPGGIIVR.W
UQ9D2N770.9%441.3%765872216.0(Q9D2N7) 4631422O05Rik protein
	TK050203_NMyc_cyto1_step01.2944.2944.1	1.6825	0.1619	1303.75	4	4000.0%	1	K.NRLQSLEAIEK.D
UQ9287870.9%222.1%13121538926.9(Q92878) RAD50
	TK050203_NMyc_cyto1_step07.3496.3496.2	2.2623	0.2504	3034.74	5	2410.0%	1	K.QIITFFSPLTILVGPNGAGKTTIIECLK.Y
UO7014070.8%338.9%247283187.8(O70140) Calcyclin binding protein (Fragment)
	TK050203_NMyc_cyto1_step07.2735.2735.2	2.2169	0.2609	2682.32	1	2950.0%	1	K.IYITLTGVHQVPTENVQVHFTER.S
UQ9CW6470.7%663.9%748810075.6(Q9CW64) 1200003G01Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step06.1295.1295.1	1.5142	0.197	1104.74	1	6670.0%	1	R.LVVADTGHHR.I
*	TK050203_NMyc_cyto1_step12.2197.2197.2	1.7761	0.3575	2164.37	1	2750.0%	1	K.SAAHIGLPPVTVHPGQALQLR.L
URYR1_HUMAN70.7%10120.2%50385651845.3(P21817) Ryanodine receptor 1 (Skeletal muscle-type ryanodine receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel)
*	TK050203_NMyc_cyto1_step01.4462.4462.1	1.9328	0.1009	1586.76	2	4170.0%	2	K.VMADDEFTQDLFR.F
UQ99L2870.4%5257.4%1631961110.0(Q99L28) Similar to 60S ribosomal protein L30 isolog
	TK050203_NMyc_cyto1_step05.3262.3262.1	1.6286	0.141	1432.78	2	4580.0%	5	K.QNIHLIRAPLAGK.G
UADRO_MOUSE70.3%112.4%494542028.7(Q61578) NADPH:adrenodoxin oxidoreductase, mitochondrial precursor (EC 1.18.1.2) (Adrenodoxin reductase) (AR) (Ferredoxin-NADP(+) reductase)
*	TK050203_NMyc_cyto1_step01.2287.2287.1	1.9204	0.1161	1456.7	2	4580.0%	1	K.SRPIDPSVPFDPK.L
USBP1_MOUSE70.3%444%472523526.4(P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56)
	TK050203_NMyc_cyto1_step01.1515.1515.1	1.7685	0.1521	1234.54	2	6500.0%	1	R.IYVVDVGSEPR.A
	TK050203_NMyc_cyto1_step03.1482.1482.1	1.6224	0.1107	1214.46	1	5560.0%	1	K.SPQYSQVIHR.L
UO4379270.1%110.7%14411567566.2(O43792) Steroid receptor coactivator
	TK050203_NMyc_cyto1_step01.1583.1583.1	1.4796	0.2099	1200.57	1	6500.0%	1	R.LNIQPAKAESK.D
UQ9D4M770.0%112.8%887999198.1(Q9D4M7) 4931400A14Rik protein
*	TK050203_NMyc_cyto1_step07.3170.3170.2	1.9023	0.3231	3068.74	1	2200.0%	1	R.TALYRLSSVNEDLDNQLQYLHTPDMK.K
UQ9H0E370.0%222.1%10481103249.8(Q9H0E3) Hypothetical protein
	TK050203_NMyc_cyto1_step05.3638.3638.2	2.2986	0.2014	2655.43	3	2270.0%	1	R.KQQHVISTEEGDMMETNSTDDEK.S
UQ9R0R570.0%9294.3%10341159368.2(Q9R0R5) Transcription factor CA150b
	TK050203_NMyc_cyto1_step08.2322.2322.2	2.0227	0.2581	2276.32	1	3330.0%	5	K.IKSDFFELLSNHHLDSQSR.W
*	TK050203_NMyc_cyto1_step07.3438.3438.2	2.1999	0.0855	2941.17	9	1920.0%	1	K.AAQKAKPVATTPIPGTPWCVVWTGDER.V
UQ9CVB669.8%117.1%170199138.4(Q9CVB6) 2210023N03Rik protein (Fragment)
	TK050203_NMyc_cyto1_step11.1584.1584.1	1.7452	0.1504	1451.73	1	4170.0%	1	R.ASHTAPQVLFSHR.E
URGSE_MOUSE69.8%221.8%547598347.4(P97492) Regulator of G-protein signaling 14 (RGS14) (RAP1/RAP2 interacting protein)
*	TK050203_NMyc_cyto1_step01.0115.0115.1	1.6382	0.1637	1278.56	1	5500.0%	1	R.SQGCLPRTQTK.D
UQ9CRA969.8%114%253293745.8(Q9CRA9) 1500031J01Rik protein
	TK050203_NMyc_cyto1_step03.1630.1630.1	1.6599	0.1694	1380.6	1	5500.0%	1	K.EQHSKIDMVHR.N
UDPP6_HUMAN69.8%111.3%865975886.3(P42658) Dipeptidyl peptidase IV like protein (Dipeptidyl aminopeptidase-related protein) (Dipeptidylpeptidase VI) (DPPX)
*	TK050203_NMyc_cyto1_step11.1075.1075.1	1.5501	0.1796	958.59	2	5000.0%	1	R.GGGGGGAGGRPR.F
UQ9DA3769.8%115.6%478547138.4(Q9DA37) 1700010P07Rik protein
*	TK050203_NMyc_cyto1_step10.2983.2983.2	1.7575	0.3755	2772.45	1	2780.0%	1	R.TPDSNGDLDTGSELGPGSPAPTAEEVEK.E
UFINC_MOUSE69.7%680.5%24772732155.3(P11276) Fibronectin precursor (FN) (Fragments)
	TK050203_NMyc_cyto1_step05.1318.1318.1	1.5092	0.1948	1323.69	2	5000.0%	1	K.LGVRPSQGGEAPR.E
UORP5_HUMAN69.7%222%879986177.5(Q9H0X9) Oxysterol binding protein-related protein 5 (OSBP-related protein 5) (ORP-5)
*	TK050203_NMyc_cyto1_step08.1845.1845.2	1.8719	0.3258	2163.95	3	2780.0%	1	R.EAQQELHRHLSAMLSSTAR.A
UPGTB_MOUSE69.4%396.2%339377065.1(P53612) Geranylgeranyl transferase type II beta subunit (EC 2.5.1.-) (RAB geranylgeranyltransferase beta subunit) (RAB geranyl-geranyltransferase beta subunit) (RAB GG transferase beta) (RAB GGTase beta)
	TK050203_NMyc_cyto1_step12.3081.3081.2	2.019	0.3066	2597.76	4	2620.0%	3	R.MSGVYWGLTVMDLMGQLHRMNR.E
UQ8TAD869.4%113.5%3964577810.0(Q8TAD8) Smad nuclear interacting protein (Smad nuclear-interacting protein 1)
*	TK050203_NMyc_cyto1_step02.1734.1734.1	1.9968	0.0976	1587.65	10	3210.0%	1	R.RTSNERPGSGQGQGR.D
UQ99JG569.4%242.4%509595728.4(Q99JG5) Nuclear export factor-a isoform 2 (Fragment)
*	TK050203_NMyc_cyto1_step01.3831.3831.1	1.9998	0.066	1520.7	8	4580.0%	2	K.LFQLDSLIDVVKK.A
UQ9DA3069.3%2432.4%108119906.6(Q9DA30) 1700021P04Rik protein
*	TK050203_NMyc_cyto1_step06.3485.3485.3	2.9874	0.1584	3921.32	3	1860.0%	2	K.MDLLQPAPGSYKDTFGENSFIEPDPLPPITGVADER.D
UFOH1_HUMAN69.2%241.3%750843317.0(Q04609) Glutamate carboxypeptidase II (EC 3.4.17.21) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Pteroylpoly-gamma-glutamate carboxypeptidase) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Folate hydrolase 1) (Prostate-specific membrane antigen) (PSMA) (PSM)
	TK050203_NMyc_cyto1_step01.3070.3070.1	1.4564	0.2204	1252.82	1	5000.0%	2	R.HVIYAPSSHNK.Y
UQ8R50969.2%241.3%528567549.2(Q8R509) Polypirimidine tract binding protein
	TK050203_NMyc_cyto1_step05.1445.1445.1	1.6152	0.1597	964.5	1	7140.0%	2	K.HQSVQLPR.E
UQ1515469.2%330.6%20242287055.1(Q15154) Pericentriol material 1
*	TK050203_NMyc_cyto1_step07.2284.2284.1	1.5333	0.1837	1406.63	3	4580.0%	1	R.KIEATGVIQSCAK.E
UAOC3_HUMAN69.1%443%763846226.5(Q16853) Membrane copper amine oxidase (EC 1.4.3.6) (Vascular adhesion protein-1) (VAP-1) (HPAO)
*	TK050203_NMyc_cyto1_step12.2371.2371.2	2.2922	0.1386	2627.19	1	2610.0%	1	K.TILVLLILAVITIFALVCVLLVGR.G
UO1501369.1%352%11211250567.2(O15013) Hypothetical protein KIAA0294
	TK050203_NMyc_cyto1_step06.2887.2887.2	2.1201	0.2696	2774.71	1	2500.0%	2	K.LALEEENHMGWFCVEDDGNHIKK.E
UZP3_MOUSE69.0%119.4%424463046.6(P10761) Zona pellucida sperm-binding protein 3 precursor (Zona pellucida glycoprotein ZP3) (Sperm receptor) (Zona pellucida protein C)
*	TK050203_NMyc_cyto1_step02.3206.3206.3	2.6341	0.3198	4128.51	1	1380.0%	1	K.ANDQTVEGWTASAQTSVALGLGLATVAFLTLAAIVLAVTRK.C
USM3C_HUMAN68.9%5176.9%751852078.7(Q99985) Semaphorin 3C precursor (Semaphorin E) (Sema E)
*	TK050203_NMyc_cyto1_step12.1821.1821.3	2.6284	0.2448	3555.82	4	1500.0%	1	K.DHILSLNINNISQEALSVFWPASTIKVEECK.M
*	TK050203_NMyc_cyto1_step07.3512.3512.2	2.2036	0.2509	2529.98	1	3180.0%	4	K.VVVLPTNNSVSGELILEELEVFK.N
UQ9CWK168.8%118.9%259294445.7(Q9CWK1) 2410026J11Rik protein
	TK050203_NMyc_cyto1_step05.3113.3113.2	1.8759	0.316	2440.2	2	2830.0%	1	K.FGAILAQGILDAGGHNVTISLQSR.T
UQ96L5068.8%228.2%414467819.1(Q96L50) 4-1BB-mediated signaling molecule
*	TK050203_NMyc_cyto1_step05.3519.3519.3	2.5713	0.3749	3940.84	1	1690.0%	1	K.LPATIGDLIHLQELNLNDNHLESFSVALCHSTLQK.S
UNOA1_HUMAN68.8%113.9%510520568.9(P51513) Onconeural ventral antigen-1 (NOVA-1) (Paraneoplastic Ri antigen) (Ventral neuron-specific protein 1)
*	TK050203_NMyc_cyto1_step10.2182.2182.2	1.9404	0.3083	2271.79	2	3000.0%	1	R.VCLIQGTVEALNAVHGFIAEK.I
UQ9EPK668.8%353%465524035.2(Q9EPK6) Sil1 protein precursor
*	TK050203_NMyc_cyto1_step06.2650.2650.2	2.2852	0.0905	1618.92	1	5710.0%	2	K.LLVILATNQPLPAKK.K
UQ924S668.8%223.7%726778579.2(Q924S6) Zinc finger protein 219
*	TK050203_NMyc_cyto1_step01.3982.3982.2	2.2874	0.1026	2792.97	1	2410.0%	1	R.ARSSGGMQSSPAAEGLARPQVPSSSAFR.C
UST31_HUMAN68.8%241.5%10191157305.2(Q9BXU1) Serine/threonine protein kinase 31 (EC 2.7.1.37) (Serine/threonine-protein kinase NYD-SPK)
*	TK050203_NMyc_cyto1_step07.2484.2484.2	2.2852	0.109	1834.17	1	4670.0%	2	K.RPLVRSEVNGQIILLK.G
UO4343268.6%221.9%15851766515.4(O43432) EIF4GII
*	TK050203_NMyc_cyto1_step07.3464.3464.2	2.2427	0.2382	3181.49	1	2500.0%	1	R.SSASSLNRFSALQPPAPSGSTPSTPVEFDSR.R
UQ9ULH068.5%570.6%17771972106.7(Q9ULH0) Hypothetical protein KIAA1250 (Fragment)
*	TK050203_NMyc_cyto1_step01.3910.3910.1	1.5027	0.1958	1368.19	1	4090.0%	2	K.AKEYLSDALLDK.K
UQ96RY668.4%119.6%2923118411.8(Q96RY6) Hypothetical protein
*	TK050203_NMyc_cyto1_step10.2910.2910.2	1.8233	0.326	3102.54	4	1790.0%	1	-.MGTQKPPRPEASCGCTGRCGSDAPPALSR.A
UCOXZ_HUMAN68.3%3512%276314589.1(Q9Y6N1) Cytochrome c oxidase assembly protein COX11, mitochondrial precursor
*	TK050203_NMyc_cyto1_step06.3214.3214.3	2.635	0.3175	4297.43	1	1670.0%	2	K.IQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPR.M
UCU18_MOUSE68.2%333%439498379.2(P58467) Protein C21orf18 homolog
	TK050203_NMyc_cyto1_step05.4139.4139.1	1.7774	0.1329	1545.67	2	4620.0%	1	K.KVLLGEVISDTNEK.T
UQ9D7A068.0%332.7%446484925.4(Q9D7A0) Adult male tongue cDNA, RIKEN full-length enriched library, clone:2310020N01, full insert sequence
	TK050203_NMyc_cyto1_step01.1794.1794.1	1.5914	0.1689	1323.62	1	5420.0%	1	R.STSFGVPNANSIK.Q
UO0026168.0%441.6%755786365.8(O00261) Collagen type XIV (Fragment)
	TK050203_NMyc_cyto1_step01.3383.3383.1	1.5873	0.1626	1534.64	5	4170.0%	1	K.ETLLDAIKHISYK.G
UQ9UI4568.0%790.4%20392294797.0(Q9UI45) PHD finger protein 3
*	TK050203_NMyc_cyto1_step01.1563.1563.1	1.7393	0.1462	995.51	4	5620.0%	1	K.IQSCNSGVK.S
UREST_HUMAN67.9%110.6%14271609895.4(P30622) Restin (Cytoplasmic linker protein-170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament associated protein)
*	TK050203_NMyc_cyto1_step01.2770.2770.1	1.9509	0.0201	1260.84	1	6670.0%	1	K.ERDVEELQLK.L
UQ9ERS967.8%223.3%580646166.5(Q9ERS9) (N6-adenosine) (Unknown) (Protein for MGC:18732)
*	TK050203_NMyc_cyto1_step11.3005.3005.2	1.8342	0.3153	2184.13	1	3160.0%	1	K.LLHHLSDLALTLPTDAVSIR.L
UQ9CT6867.7%1110.6%302337468.3(Q9CT68) 1190005F20Rik protein (Fragment)
	TK050203_NMyc_cyto1_step12.2426.2426.3	2.9704	0.1193	3768.76	9	1480.0%	1	K.TLIFESECTPQSQCSTHAPSNTNKQEENGVFVK.T
UQ9DA1867.7%2216.1%149172739.2(Q9DA18) 1700023B23Rik protein
*	TK050203_NMyc_cyto1_step10.2792.2792.2	1.7884	0.3278	2659.82	5	1880.0%	1	K.EAMVADLDAGPGMLEPCVLPSAKER.S
UCLAT_HUMAN67.6%221.6%748825688.6(P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase) (Choline acetylase) (ChAT)
*	TK050203_NMyc_cyto1_step01.2235.2235.1	1.741	0.1313	1356.11	2	4580.0%	1	K.AAVPASEKLLLLK.D
UO4330467.4%111.3%756853036.8(O43304) Hypothetical protein KIAA0420 (Fragment)
*	TK050203_NMyc_cyto1_step06.2531.2531.2	2.2802	0.0034	1399.31	3	5500.0%	1	R.FLRAHDFHLDK.A
UQ99LN867.4%5177.8%335363016.2(Q99LN8) Similar to hypothetical protein FLJ20411
*	TK050203_NMyc_cyto1_step05.3501.3501.2	2.2749	0.0585	2878.7	10	1920.0%	4	R.LITGAVNPTVLYVSGGNTQVISYSEHR.Y
UDHAM_MOUSE67.4%224.2%519565387.6(P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2)
*	TK050203_NMyc_cyto1_step02.3116.3116.2	1.8983	0.3082	2288.35	1	2950.0%	1	K.VAFTGSTEVGHLIQVAAGSSNLK.R
UACDL_MOUSE67.4%222.3%430480828.2(P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD)
*	TK050203_NMyc_cyto1_step08.1344.1344.1	1.4157	0.2593	1261.67	1	6000.0%	1	K.TVAHIQTVQHK.L
UQ9H00967.4%116.5%215232234.7(Q9H009) Alpha-NAC protein
*	TK050203_NMyc_cyto1_step10.2363.2363.1	1.8625	0.1132	1572.73	5	3570.0%	1	K.AMSKLGLLQVTGVTR.V
UQ9DC4567.3%441.1%814935875.3(Q9DC45) 1200003J11Rik protein
	TK050203_NMyc_cyto1_step01.4563.4563.1	1.5847	0.1663	1159.47	1	5560.0%	1	K.EQVKIAENVK.L
UQ8TC2867.3%1112.5%192209725.6(Q8TC28) Similar to RIKEN cDNA 2010208K18 gene
*	TK050203_NMyc_cyto1_step11.4124.4124.2	1.8913	0.3132	2609.48	2	2290.0%	1	K.HKIPLDASVLDIGTGNGVFLVELAK.F
UQ9254967.1%330.9%12871436246.0(Q92549) Hypothetical protein KIAA0261 (Fragment)
*	TK050203_NMyc_cyto1_step11.1019.1019.2	1.6995	0.448	1439.51	1	5000.0%	1	R.IVEDDASISSCNK.L
UQ9BX6667.1%5171.8%12921424546.8(Q9BX66) Sorbin and SH3 domain containing 1
*	TK050203_NMyc_cyto1_step07.2607.2607.2	1.8755	0.3115	2597.85	3	2390.0%	4	R.ALSPEMHAVTSEWISLTVGVPGRR.S
UQ96P2667.1%223.4%610689348.9(Q96P26) Cytosolic nucleotidase Ib alpha
	TK050203_NMyc_cyto1_step12.2685.2685.2	2.245	0.2093	2549.04	1	3570.0%	1	R.GIYPASTQLDRNSLSEQQQQQR.E
UQ9DC1467.0%354.7%592648997.5(Q9DC14) 1200007H22Rik protein
	TK050203_NMyc_cyto1_step01.2931.2931.1	1.8293	0.1099	1505.76	1	4620.0%	1	K.LDLQKPSVPAIPPK.K
	TK050203_NMyc_cyto1_step11.3376.3376.1	1.8122	0.1838	1543.47	9	3670.0%	2	R.ETTGSESDGGDSSSTK.S
UQ9QYZ667.0%221.8%504567879.4(Q9QYZ6) Hypothetical 56.8 kDa protein (Fragment)
*	TK050203_NMyc_cyto1_step07.1478.1478.1	1.8372	0.1015	1210.6	1	5560.0%	1	K.YSVPCRLSVK.L
UTIAM_MOUSE66.9%660.6%15911775326.7(Q60610) T-lymphoma invasion and metastasis inducing protein 1 (TIAM1 protein)
	TK050203_NMyc_cyto1_step01.2856.2856.1	1.9331	0.016	1153.68	1	5560.0%	1	K.EPELAAFVFK.T
UQ99MP066.9%114.3%488525168.8(Q99MP0) T-box 1
*	TK050203_NMyc_cyto1_step06.2950.2950.2	2.2315	0.1948	1958.14	4	2860.0%	1	R.VLSPALPGPGGLVPLPGGSGGR.H
UCDC7_HUMAN66.9%221.2%574638888.7(O00311) Cell division cycle 7-related protein kinase (EC 2.7.1.-) (CDC7-related kinase) (HsCdc7) (huCdc7)
*	TK050203_NMyc_cyto1_step01.0523.0523.1	1.9354	0.014	1058.71	2	7140.0%	1	R.EYMLNLFK.A
UO8834966.8%6181.5%17131869076.1(O88349) Latent TGF beta binding protein
*	TK050203_NMyc_cyto1_step05.3473.3473.2	2.2598	0.1347	2934.86	3	2310.0%	4	R.LEPGQPQLSPGVSTIHLHPQFPVVVEK.T
USYS_MOUSE66.6%225.3%511582586.3(P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS)
*	TK050203_NMyc_cyto1_step01.3942.3942.2	2.2238	0.2231	2934.25	1	2220.0%	1	K.EAVGDDESVPENVLNFDDLTADALAALK.V
UO5480666.6%115.5%200224035.4(O54806) Huntingtin interacting protein-2
	TK050203_NMyc_cyto1_step02.2286.2286.1	1.8093	0.1075	1455.47	1	5450.0%	1	K.KIENLCAMGFDR.N
UUDB4_HUMAN66.6%397.4%528605138.5(P06133) UDP-glucuronosyltransferase 2B4 precursor, microsomal (EC 2.4.1.17) (UDPGT) (Hyodeoxycholic acid) (HLUG25) (UDPGTH-1)
*	TK050203_NMyc_cyto1_step12.3914.3914.3	2.8069	0.2439	4749.03	1	1600.0%	3	R.VAAHDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWK.F
UDRI1_MOUSE66.5%354.3%601641735.0(Q62431) Dead ringer like-1 protein (B-cell regulator of IgH transcription) (Bright)
*	TK050203_NMyc_cyto1_step07.3286.3286.2	2.1516	0.264	2992.9	1	2310.0%	2	R.AVQQSFLAMTAQLPMNIRINSQASESR.Q
UQ8TEV866.5%41025.7%1401528410.6(Q8TEV8) Smith-Magenis syndrome chromosome region candidate 5 protein
*	TK050203_NMyc_cyto1_step02.3694.3694.3	2.5554	0.3744	3825.56	1	1600.0%	3	R.VNRILSAVQNTLCTGPSSQAPPQPPQASPPAAADHSR.T
UQ9HBY166.4%113.2%730807278.7(Q9HBY1) Actin filament associated protein
*	TK050203_NMyc_cyto1_step12.2709.2709.2	2.2679	0.131	2494.19	3	2390.0%	1	K.LSSERPSSDGEGVVENGITTCNGK.E
UQ9JLH866.4%356.1%345392614.8(Q9JLH8) Tropomodulin 4
*	TK050203_NMyc_cyto1_step07.3108.3108.2	2.2629	0.126	2266.05	1	3810.0%	2	R.SFSLVATKSGDPIANAVADMLR.E
UQ9BYC766.4%115.6%197218819.5(Q9BYC7) Mitochondrial ribosomal protein bMRP36a
	TK050203_NMyc_cyto1_step05.2050.2050.1	1.9335	0.2295	1284.39	7	4090.0%	1	R.FLASVLHNGLGR.Y
UEZH2_MOUSE66.4%221.6%746853366.8(Q61188) Enhancer of zeste homolog 2 (ENX-1)
	TK050203_NMyc_cyto1_step05.2582.2582.2	2.2596	0.0097	1398.55	4	5420.0%	1	K.KDETSSSSEANSR.C
UQ9P2F666.2%220.9%11941330158.0(Q9P2F6) Hypothetical protein KIAA1391 (Fragment)
*	TK050203_NMyc_cyto1_step08.2285.2285.1	1.9209	0.0223	1520.75	5	4550.0%	1	R.RCSEPNIEDQNR.K
UQ9DAM266.2%247.4%216260678.8(Q9DAM2) 1700007I06Rik protein
	TK050203_NMyc_cyto1_step07.2992.2992.2	2.1452	0.2626	2082.8	1	3750.0%	2	R.DLFHDFDITGDRLLNYK.E
UQ9BTP466.1%2421.9%146163429.5(Q9BTP4) Hypothetical protein (Fragment)
*	TK050203_NMyc_cyto1_step07.1870.1870.3	2.774	0.2495	3762.98	3	1640.0%	2	K.NLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCK.A
URFX5_HUMAN66.1%8381.5%616653239.3(P48382) DNA-binding protein RFX5 (Regulatory factor X subunit 5)
*	TK050203_NMyc_cyto1_step01.4522.4522.1	1.875	0.098	1166.72	4	5560.0%	6	K.KPERLAQPPK.D
UP2YR_HUMAN66.0%117.8%373420729.4(P47900) P2Y purinoceptor 1 (ATP receptor) (P2Y1) (Purinergic receptor)
*	TK050203_NMyc_cyto1_step02.2374.2374.3	2.666	0.2971	3548.12	1	1810.0%	1	R.SYFIYSMCTTVAMFCVPLVLILGCYGLIVR.A
UPM5P_HUMAN66.0%221.9%12221342945.8(Q15155) Protein pM5 precursor
	TK050203_NMyc_cyto1_step01.0414.0414.2	1.7093	0.3808	2752.11	2	2170.0%	1	R.QINQFDLSGNVITSSEYLPTLWVK.L
UQ9CT5866.0%223.2%380444245.5(Q9CT58) 2600001J17Rik protein (Fragment)
	TK050203_NMyc_cyto1_step01.2791.2791.1	1.8728	0.0972	1522.65	1	5000.0%	1	R.LFAMIEQKNGEIK.H
UO9498665.9%440.7%13001500895.4(O94986) Hypothetical protein KIAA0912 (Fragment)
*	TK050203_NMyc_cyto1_step02.1552.1552.1	1.9183	0.0318	1241.54	2	6110.0%	1	R.YLNHQLVIIK.D
UQ1422165.9%330.8%14101624965.6(Q14221) Endosome-associated protein
	TK050203_NMyc_cyto1_step01.1922.1922.1	1.9007	0.0383	1469.62	2	4550.0%	1	K.HQLQVQMENTLK.E
UQ925M965.9%570.9%10511216478.1(Q925M9) DNA-dependent ATPase SNF2H
	TK050203_NMyc_cyto1_step02.2106.2106.1	1.9004	0.0324	1166.56	5	5560.0%	2	K.QNLLSVGDYR.H
UHRX_HUMAN65.9%6120.7%39694318969.1(Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein)
	TK050203_NMyc_cyto1_step06.3993.3993.2	2.1149	0.2631	2940.96	1	2590.0%	3	K.EKPPPVNKQENAGTLNILSTLSNGNSSK.Q
UEFTU_HUMAN65.9%115.8%452495427.6(P49411) Elongation factor Tu, mitochondrial precursor (P43)
*	TK050203_NMyc_cyto1_step02.4305.4305.2	2.0717	0.2864	2937.59	2	2310.0%	1	R.ELLTEFGYKGEETPVIVGSALCALEGR.D
USPB8_HUMAN65.8%224.8%374427865.6(P50452) Cytoplasmic antiproteinase 2 (CAP2) (CAP-2) (Protease inhibitor 8) (Serpin B8)
*	TK050203_NMyc_cyto1_step08.2046.2046.2	2.0092	0.2908	2183.99	3	2500.0%	1	R.GFQSLLSEVNRTGTQYLLR.T
UMLEN_MOUSE65.7%225.7%141157314.9(Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment)
	TK050203_NMyc_cyto1_step03.1900.1900.1	1.8718	0.0905	996.62	1	7500.0%	1	R.HVLVTLGEK.M
UQ9HAW165.6%112.1%13721546055.0(Q9HAW1) RNA polymerase III transcription initiation factor B'' short
	TK050203_NMyc_cyto1_step11.3052.3052.2	1.7333	0.3708	3138.31	5	1550.0%	1	K.SSVSVPSESHPLSTINQEAPQPTATSTKEK.Q
UQ8WWL265.6%7130.8%728809257.5(Q8WWL2) Spir-2 protein (Fragment)
*	TK050203_NMyc_cyto1_step06.1525.1525.1	1.491	0.1363	898.52	4	7500.0%	3	K.QRSLHEK.I
UQ9HCM265.6%111.9%593646636.9(Q9HCM2) Hypothetical protein KIAA1550 (Fragment)
*	TK050203_NMyc_cyto1_step02.2568.2568.1	1.8888	0.0751	1179.7	1	6820.0%	1	K.NLIPPVAGGNVK.L
USGCA_MOUSE65.5%355.4%387432876.5(P82350) Alpha-sarcoglycan precursor (Alpha-SG) (Adhalin) (50 kDa dystrophin-associated glycoprotein) (50DAG)
*	TK050203_NMyc_cyto1_step10.2715.2715.2	2.2477	0.1316	2284.66	1	3570.0%	2	-.MAAAVTWIPLLAGLLAGLRDTK.A
UQ96SY565.5%332.2%674753815.1(Q96SY5) Hypothetical protein FLJ14564 (Fragment)
	TK050203_NMyc_cyto1_step10.3168.3168.2	2.2343	0.1151	1842.35	2	4000.0%	1	K.FSEPNTYIDGLPSQDR.Q
UQ6395365.5%334.2%332374716.6(Q63953) Interferon gamma receptor 2 (Interferon gamma receptor beta subunit)
*	TK050203_NMyc_cyto1_step05.3093.3093.2	2.2478	0.0945	1822.6	2	4640.0%	1	R.VYCLQTEAQLILKNK.K
UO6037965.5%222.2%757855509.0(O60379) R29381_1 (Fragment)
	TK050203_NMyc_cyto1_step01.2146.2146.2	2.2408	0.1572	1986.39	6	3530.0%	1	R.NLSDIGTIMRVVELSPLK.G
UQ9CZ8565.5%1214422.8%114127155.0(Q9CZ85) 2810038F24Rik protein
*	TK050203_NMyc_cyto1_step11.4327.4327.2	2.2547	0.1837	3007.82	9	1730.0%	12	R.AQYTLMAQAVDRDTNKPLGPPSEFIDK.D
UQ9JIH865.5%5111.2%15431737578.6(Q9JIH8) Canalicular multispecific organic anion transporter cMOAT
*	TK050203_NMyc_cyto1_step05.1830.1830.2	2.2344	0.0883	2066.18	6	2780.0%	3	R.TTIIASVYKEALTLSNLAR.R
UQ8VCB365.5%112.6%704808856.9(Q8VCB3) Hypothetical 80.9 kDa protein
*	TK050203_NMyc_cyto1_step02.3378.3378.2	2.231	0.0784	2017.13	9	4170.0%	1	R.GRSLSVTSLGGLPVWEAER.L
UQ8R3K865.5%1117.3%162183177.5(Q8R3K8) Hypothetical 18.3 kDa protein (Fragment)
*	TK050203_NMyc_cyto1_step11.3317.3317.2	2.2358	0.3061	3147.28	8	1960.0%	1	R.ATGPHDTLGTPEFLSSSFPFSPVGNLCRR.S
UCADH_MOUSE65.5%221.3%827916454.9(Q9R100) Cadherin-17 precursor (Liver-intestine-cadherin) (LI-cadherin) (BILL-cadherin) (P130)
*	TK050203_NMyc_cyto1_step01.2248.2248.1	1.7087	0.1459	1309.63	1	5000.0%	1	R.DPEGLTVSYSLK.G
UQ9Y36465.5%245.9%438482507.4(Q9Y364) CGI-50 protein
	TK050203_NMyc_cyto1_step02.4020.4020.2	2.2303	0.0492	2992.45	4	1920.0%	2	R.LLVGAADGYLYMYNLDPQEGGECALMK.Q
UQ99LC365.4%4101.4%355406037.8(Q99LC3) RIKEN cDNA 2900053E13 gene
*	TK050203_NMyc_cyto1_step03.1171.1171.1	1.5226	0.1776	806.35	1	7000.0%	3	K.LHEYSR.V
UQ9Z0H465.3%114.9%508542718.8(Q9Z0H4) Apoptosis-related RNA binding protein (CUG triplet repeat,RNA binding protein 2)
	TK050203_NMyc_cyto1_step01.3096.3096.2	1.8125	0.3117	2820.93	5	2000.0%	1	R.AMAQNAIKAMHQSQTMEGCSSPIVVK.F
UQ91XU365.2%113.8%421473366.9(Q91XU3) Phosphatidyl inositol phosphate kinase type II gamma (Phosphatidylinositol-4-phosphate 5-kinase, type II, gamma)
	TK050203_NMyc_cyto1_step05.1591.1591.2	1.9867	0.2973	1795.74	1	5310.0%	1	K.HGAGAEISTVHPEQYAK.R
UQ9Y23865.2%441%17551957826.4(Q9Y238) Deleted in lung and ESOPHAGEAL cancer 1
	TK050203_NMyc_cyto1_step11.3196.3196.2	1.9827	0.2907	2161.26	1	3530.0%	1	K.EDRLVELLVFYGPPFPLR.D
UQ9EPS365.1%112.4%618700998.8(Q9EPS3) D-glucuronyl C5-epimerase (EC 5.1.3.-) (Heparin/heparan sulfate:glucuronic acid C5 epimerase)
*	TK050203_NMyc_cyto1_step05.3450.3450.2	1.8304	0.2998	1805.99	3	2670.0%	1	K.DYVFLSSALRATAPYK.F
UO9579065.1%441.8%13521525456.1(O95790) Neuroblastoma-amplified protein
	TK050203_NMyc_cyto1_step08.2362.2362.3	2.7458	0.246	2923.69	3	1900.0%	1	K.QMLPAEGVKELCLLLLNQSLLLPSLK.L
UQ91WJ965.0%111.9%537592468.4(Q91WJ9) Reduced in osteosclerosis transporter
	TK050203_NMyc_cyto1_step06.1390.1390.1	1.8774	0.0785	1267.6	5	5500.0%	1	K.FNLQKDITSAK.V
UQ91VX365.0%6121.8%12961436646.4(Q91VX3) Similar to topoisomerase (DNA) II binding protein (Fragment)
*	TK050203_NMyc_cyto1_step12.2741.2741.2	1.7932	0.3117	2537.9	2	2170.0%	3	K.LFKPSFDVTDALAALETPNAASQK.R
UO0884764.9%5251.5%19662167607.5(O08847) RNA polymerase II largest subunit
*	TK050203_NMyc_cyto1_step12.3604.3604.2	1.9491	0.2969	3097.65	1	2240.0%	5	K.GSTYSPTSPGYSPTSPTYSLTSPAISDEEN.-
UO7549964.8%335.1%433482297.6(O75499) B cell linker protein BLNK-S
	TK050203_NMyc_cyto1_step06.2599.2599.2	1.943	0.2995	2455.79	2	2500.0%	1	K.ARLTSTLPALTALQKPQVPPKPK.G
UQ9H3K064.7%1119%6376575.2(Q9H3K0) My023 protein
*	TK050203_NMyc_cyto1_step01.3554.3554.1	1.6444	0.1506	1518.78	1	5000.0%	1	R.NNLVPDVLEDLLY.-
UARP2_HUMAN64.7%221.5%394447616.7(O15142) Actin-like protein 2 (Actin-related protein 2)
*	TK050203_NMyc_cyto1_step03.1552.1552.1	1.6351	0.1493	801.6	4	6670.0%	1	R.RLDIAGR.D
UO7511664.7%330.6%13881609126.0(O75116) Hypothetical protein KIAA0619
*	TK050203_NMyc_cyto1_step02.2182.2182.1	1.8835	0.03	1234.3	4	5560.0%	1	R.KNEESQEIQK.K
UQ9Y2V164.6%221.8%448535834.9(Q9Y2V1) Hypothetical protein
	TK050203_NMyc_cyto1_step06.1411.1411.1	1.8439	0.0969	1015.56	1	6250.0%	1	R.EIDAALQKK.R
UP2G4_MOUSE64.3%332.5%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4)
	TK050203_NMyc_cyto1_step03.1702.1702.1	1.8608	0.0899	1182.64	1	5500.0%	1	K.AAHLCAEAALR.L
URASH_MOUSE64.1%116.3%189213485.3(Q61411) Transforming protein P21/H-RAS-1 (C-H-RAS)
	TK050203_NMyc_cyto1_step11.2311.2311.2	2.176	0.2313	1390.09	2	5420.0%	1	K.DSDDVPMVLVGNK.C
UQ9P28064.1%111.7%526602619.4(Q9P280) Hypothetical protein KIAA1448 (Fragment)
*	TK050203_NMyc_cyto1_step01.4359.4359.1	1.4951	0.1779	1254.72	1	5560.0%	1	R.FIPPENRKPR.F
UQ9NZB664.1%221%12261375525.4(Q9NZB6) Retinoblastoma-binding protein 1-like 1
	TK050203_NMyc_cyto1_step01.2815.2815.1	1.495	0.1746	1390.94	2	4170.0%	1	K.VHADLVISKPVSK.S
UPSE1_MOUSE64.1%339.6%249286736.0(P97371) Proteasome activator complex subunit 1 (Proteasome activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha)
*	TK050203_NMyc_cyto1_step02.4208.4208.2	1.7182	0.3503	2975.82	1	2290.0%	1	R.LKPEIKDVTEQLNLVTTWLQLQIPR.I
UQ9JJG564.0%113.2%309332824.6(Q9JJG5) Brain cDNA, clone MNCb-1504, similar to D50917 KIAA0127 protein (Homo sapiens)
	TK050203_NMyc_cyto1_step01.1419.1419.1	1.6149	0.1493	1275.46	4	5000.0%	1	K.FDEHEDGLEGK.I
UQ9ULQ264.0%242.2%12811482566.9(Q9ULQ2) Hypothetical protein KIAA1168 (Fragment)
*	TK050203_NMyc_cyto1_step02.2264.2264.3	2.654	0.278	3421.79	1	2320.0%	2	K.QLQVVPLFGDMQIELARYIETSAHYEENK.S
UQ8VIM664.0%221.4%18091964035.4(Q8VIM6) Stereocilin
*	TK050203_NMyc_cyto1_step01.3570.3570.2	2.2292	0.0010	2669.07	2	2600.0%	1	K.AALVAGIVHPAAEGLQEPVPNCADIR.G
UO7542764.0%5112.8%832896168.8(O75427) Leucin rich neuronal protein
*	TK050203_NMyc_cyto1_step02.3994.3994.2	2.2265	0.0595	2786.77	1	2830.0%	3	R.NQLSTLPEELGDLPLVRLDFSCNR.V
UQ1559863.9%9150.5%46505220757.9(Q15598) Titin (Fragment)
	TK050203_NMyc_cyto1_step10.3546.3546.2	2.2069	0.1498	2439.95	1	2860.0%	1	K.VRVIGSPNSPEGPLEYDDIQVR.S
UGR78_MOUSE63.9%442.1%655724225.2(P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP)
	TK050203_NMyc_cyto1_step02.2312.2312.1	1.7433	0.119	1588.66	1	4290.0%	1	K.KSDIDEIVLVGGSTR.I
UQ9D6M063.5%554.5%448487785.4(Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene)
*	TK050203_NMyc_cyto1_step01.1162.1162.1	1.781	0.1072	1298.68	5	4550.0%	1	R.SMSQAMDMVLGK.S
*	TK050203_NMyc_cyto1_step07.1334.1334.1	1.7697	0.0533	1155.47	2	5560.0%	1	R.HLAYEHSLGK.L
UQ9CWV163.4%333.1%489537166.8(Q9CWV1) 5730432L01Rik protein
*	TK050203_NMyc_cyto1_step11.4120.4120.2	2.2004	0.1971	1772.09	1	4670.0%	1	K.VAPGEQTDPIPHQLLR.K
UU183_MOUSE63.4%115.5%422474027.7(Q922R1) UPF0183 protein
*	TK050203_NMyc_cyto1_step05.2629.2629.2	2.2034	0.0155	2743.35	2	2830.0%	1	R.VFERAVYFGDSCQDVLSMLGSPHK.V
UQ9BXU663.4%551.6%9171057175.1(Q9BXU6) Testis protein TEX11
	TK050203_NMyc_cyto1_step07.2510.2510.2	2.2192	0.1019	1970.24	10	3330.0%	1	R.NMACCYLNLQQLDKAK.E
UQ91W7863.4%116.4%267302505.6(Q91W78) Similar to hypothetical protein FLJ13154
*	TK050203_NMyc_cyto1_step05.3197.3197.2	2.2033	0.1795	2088.43	9	3530.0%	1	R.LVLMEEFHVSLSQSVVLR.H
UNEC2_HUMAN63.4%222.4%638705656.5(P16519) Neuroendocrine convertase 2 precursor (EC 3.4.21.94) (NEC 2) (PC2) (Prohormone convertase 2) (Proprotein convertase 2) (KEX2-like endoprotease 2)
*	TK050203_NMyc_cyto1_step07.2483.2483.2	2.2191	0.0399	1918.66	1	4330.0%	1	K.EELEEELDEAVERSLK.S
UK052_HUMAN63.4%112.3%10461182566.6(P42285) Protein KIAA0052 (Fragment)
*	TK050203_NMyc_cyto1_step01.4471.4471.2	2.2088	0.0782	2752.18	5	2290.0%	1	K.GEMQVVPVLVHLLSAISSVRLYIPK.D
UADO_HUMAN63.3%110.7%13381479317.1(Q06278) Aldehyde oxidase (EC 1.2.3.1)
	TK050203_NMyc_cyto1_step05.2075.2075.1	1.6004	0.1496	1368.53	1	5000.0%	1	K.MDNAYKFPNLR.C
UQ1536163.3%573.2%8861012199.6(Q15361) Transcription factor
*	TK050203_NMyc_cyto1_step11.3432.3432.3	2.9196	0.1549	3125.46	1	2140.0%	1	R.EAGTDMQESQPTVGLDDETPQLLGPTHKK.K
UQ9NX0863.0%115.5%183210905.4(Q9NX08) Hypothetical protein FLJ20502
	TK050203_NMyc_cyto1_step02.2249.2249.1	1.4938	0.1731	1268.74	3	4000.0%	1	R.MPLLSLHLDVK.E
UQ96N5262.8%331.1%645739829.2(Q96N52) Hypothetical protein FLJ31400
*	TK050203_NMyc_cyto1_step01.3107.3107.1	1.3956	0.2632	920.24	1	5710.0%	1	K.RALQVAHK.A
UO8903262.7%330.8%11241241718.8(O89032) Fish protein
	TK050203_NMyc_cyto1_step02.2578.2578.1	1.6344	0.147	1169.74	1	5560.0%	1	K.QRIIPFLPGK.I
UQ96QA062.7%249.7%206231209.3(Q96QA0) FKSG24
	TK050203_NMyc_cyto1_step01.3730.3730.2	1.9762	0.287	2538.72	1	3500.0%	2	R.VTYINGLTLGWDTYLSYLKYR.S
UHV04_MOUSE62.5%1120.5%117127728.9(P01748) Ig heavy chain V region 23 precursor
*	TK050203_NMyc_cyto1_step10.2631.2631.3	2.9117	0.1692	2715.46	4	2190.0%	1	K.QRPGQGLEWIGNINPGNGGTNYNEK.F
UQ8VE3362.5%227.3%370423186.6(Q8VE33) Hypothetical 42.3 kDa protein
	TK050203_NMyc_cyto1_step06.3439.3439.2	1.9853	0.2843	3179.3	1	2040.0%	1	K.RKPPSFFGASFLMGSLGGMGYFAYWYLK.K
UKF5C_MOUSE62.4%462.7%9561092406.2(P28738) Kinesin heavy chain isoform 5C (Kinesin heavy chain neuron-specific 2)
*	TK050203_NMyc_cyto1_step05.4041.4041.2	2.1322	0.2412	2958.13	1	1920.0%	2	K.SLEPCDNTPIIDNITPVVDGISAEKEK.Y
UOXRP_HUMAN62.4%462.1%9991113355.2(Q9Y4L1) 150 kDa oxygen-regulated protein precursor (Orp150) (Hypoxia up-regulated 1)
*	TK050203_NMyc_cyto1_step02.3326.3326.2	1.9917	0.2767	2555.93	5	2380.0%	2	K.GARLIPEMDQIFTEVEMTTLEK.V
UQ9D2M662.2%113.8%652730086.2(Q9D2M6) 4632407K17Rik protein
	TK050203_NMyc_cyto1_step05.3719.3719.2	1.8165	0.2904	2624.03	5	2200.0%	1	R.TTSSADPTSPDLGPRGPELAGLQAER.D
UPUR8_MOUSE62.2%114.5%484548087.3(P54822) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylosuccinase) (ASL) (ASASE)
*	TK050203_NMyc_cyto1_step06.2769.2769.2	1.7969	0.2917	2515.32	1	3410.0%	1	K.DRADLPTLGFTHFQPAQLTTVGK.R
UO3560062.1%660.6%23102602076.2(O35600) ATP-binding cassette transporter
	TK050203_NMyc_cyto1_step01.2295.2295.1	1.8792	0.0024	1592.84	4	3850.0%	1	K.RNEEAQDLSGGMQR.K
UP9739062.1%5111.9%570650538.2(P97390) Vacuolar protein sorting homolog
	TK050203_NMyc_cyto1_step01.4390.4390.1	1.7323	0.1015	1252.8	2	5000.0%	3	R.KLVSAVVEYGGK.R
UQ99ML062.0%5112.7%440506326.5(Q99ML0) Blu protein
	TK050203_NMyc_cyto1_step11.1835.1835.2	1.9623	0.2857	1463.92	1	5830.0%	3	R.LDVLEAVAPERPR.C
UIRF1_HUMAN61.9%337.7%325365025.4(P10914) Interferon regulatory factor 1 (IRF-1)
*	TK050203_NMyc_cyto1_step01.3622.3622.2	1.9604	0.2802	2880.36	1	2200.0%	1	K.NMDATWLDSLLTPVRLPSIQAIPCAP.-
UQ9NXZ161.9%112.4%904991986.5(Q9NXZ1) Putative tumor antigen
*	TK050203_NMyc_cyto1_step10.2980.2980.2	1.9551	0.2828	2338.74	3	2730.0%	1	K.VLSTAPPQLVHMAAAGIPSMSTR.D
UQ9CXU361.9%2214.8%8190585.8(Q9CXU3) 3110003A17Rik protein
	TK050203_NMyc_cyto1_step01.3750.3750.1	1.8206	0.0728	1439.02	1	5420.0%	1	R.CANLFEALVGTLK.A
UP300_HUMAN61.9%551.4%24142641408.5(Q09472) E1A-associated protein p300
*	TK050203_NMyc_cyto1_step12.3696.3696.3	2.6373	0.2581	4003.44	2	1890.0%	1	K.ALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRR.V
UQ9R0B761.9%7494.1%294326988.9(Q9R0B7) Double-stranded RNA-binding zinc finger protein JAZ
*	TK050203_NMyc_cyto1_step01.3206.3206.1	1.4693	0.1785	1252.77	1	4580.0%	7	R.LADPAVSDLPAGK.G
UQ6202861.9%330.5%14871705126.6(Q62028) Phospholipase A2 receptor precursor
*	TK050203_NMyc_cyto1_step01.1502.1502.1	1.4688	0.1802	1002.51	4	5000.0%	1	K.TPVKIWEK.T
UDHAX_HUMAN61.6%225.9%511553666.9(P49419) Antiquitin (EC 1.2.1.-)
*	TK050203_NMyc_cyto1_step02.3004.3004.3	2.8586	0.2107	3439.9	1	1920.0%	1	R.EENEGVYNGSWGGRGEVITTYCPANNEPIAR.V
UO7025961.6%112.3%532583028.6(O70259) Voltage-gated potassium channel KV1.7
*	TK050203_NMyc_cyto1_step05.1093.1093.1	1.8492	0.0576	1281.57	1	5420.0%	1	R.LNGSSPMPGAPPR.Q
UTEA2_MOUSE61.5%242.5%445490416.4(P48301) Transcriptional enhancer factor TEF-4 (TEA domain family member 2) (TEAD-2) (Embryonic TEA domain-containing factor) (ETF) (ETEF-1)
	TK050203_NMyc_cyto1_step02.2194.2194.1	1.5636	0.1537	1405.69	3	4090.0%	2	K.VETERAQLEDGR.F
UQ9JLN561.5%350.8%592665568.7(Q9JLN5) Erythroid membrane-associated protein ERMAP
*	TK050203_NMyc_cyto1_step05.1249.1249.1	1.562	0.1477	711.49	2	7000.0%	2	R.LHKALK.K
UQ9UMC561.5%222.5%395453258.3(Q9UMC5) Zinc finger 2.2 (Fragment)
	TK050203_NMyc_cyto1_step01.2772.2772.1	1.6129	0.131	1407.54	1	5000.0%	1	K.ERHQECSDCGK.T
UANX3_MOUSE61.5%571.5%323363715.5(O35639) Annexin III (Lipocortin III) (Placental anticoagulant protein III) (PAP-III) (35-alpha calcimedin)
	TK050203_NMyc_cyto1_step05.1249.1249.1	1.562	0.1477	711.49	2	7000.0%	2	R.LHQALK.G
UQ9D5V561.5%571.3%780909747.8(Q9D5V5) 4921514I20Rik protein
	TK050203_NMyc_cyto1_step01.0924.0924.1	1.7583	0.0804	713.46	4	8000.0%	1	K.LELPLK.Q
	TK050203_NMyc_cyto1_step05.1249.1249.1	1.562	0.1477	711.49	2	7000.0%	2	K.IHQALK.E
UQ9CVI661.4%118.2%147170825.1(Q9CVI6) 1200015E15Rik protein (Fragment)
	TK050203_NMyc_cyto1_step07.2027.2027.1	1.6208	0.1388	1507.76	1	4170.0%	1	K.EELVAEQAIKHLK.Q
UQ9D0N461.4%682.9%419480646.9(Q9D0N4) 1110001I24Rik protein
	TK050203_NMyc_cyto1_step07.2027.2027.1	1.6208	0.1388	1507.76	1	4170.0%	1	K.EELVAEQALKHLK.Q
UQ9D9X561.4%6181.3%746825855.3(Q9D9X5) 1700026A16Rik protein
	TK050203_NMyc_cyto1_step01.3023.3023.1	1.361	0.3266	1311.89	1	5500.0%	4	K.YPEGNSSWQIK.E
UQ9D8P961.4%2414.5%117127605.5(Q9D8P9) 1810047K05Rik protein
	TK050203_NMyc_cyto1_step05.2639.2639.2	2.163	0.1819	1840.9	6	3530.0%	2	K.GFTTASSIANLKVSLLSK.E
UQ96CR161.4%7195%404455588.6(Q96CR1) Hypothetical protein
*	TK050203_NMyc_cyto1_step07.2954.2954.2	2.1919	0.1011	2283.64	4	2750.0%	4	R.ILRPQQGPGSSPDPSMWSELV.-
UPSDC_MOUSE61.4%114.8%456528777.1(Q9D8W5) 26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit p55)
	TK050203_NMyc_cyto1_step06.3543.3543.2	2.194	0.1028	2536.22	1	2950.0%	1	R.MAQLLDLSVDESEAFLSNLVVNK.T
UDHI1_HUMAN61.4%228.6%292324018.5(P28845) Corticosteroid 11-beta-dehydrogenase, isozyme 1 (EC 1.1.1.146) (11-DH) (11-beta-hydroxysteroid dehydrogenase 1) (11-beta-HSD1)
*	TK050203_NMyc_cyto1_step02.3316.3316.2	1.9256	0.2817	2901.39	1	2600.0%	1	K.EYSVSRVNVSITLCVLGLIDTETAMK.A
UPTPB_HUMAN61.4%331.1%19972242677.7(P23467) Protein-tyrosine phosphatase beta precursor (EC 3.1.3.48) (R-PTP-beta)
*	TK050203_NMyc_cyto1_step11.3804.3804.2	1.9184	0.2789	2579.33	3	2500.0%	1	R.YDILLLTENGILLRNTSEPATTK.Q
UCYC_HUMAN61.4%3911.5%104116189.6(P00001) Cytochrome c
*	TK050203_NMyc_cyto1_step10.2006.2006.1	1.6846	0.1234	1468.68	1	4580.0%	3	K.YIPGTKMIFVGIK.K
UQ9DAV861.3%227.1%240280838.4(Q9DAV8) 1600017L04Rik protein
	TK050203_NMyc_cyto1_step12.3201.3201.2	2.1904	0.0657	2084.42	1	3820.0%	1	R.TYCHSTITNPSNIGPEYK.N
UMEPA_MOUSE61.2%445.2%747841976.2(P28825) Meprin A alpha-subunit precursor (EC 3.4.24.18) (Endopeptidase-2) (MEP-1)
*	TK050203_NMyc_cyto1_step01.3719.3719.3	2.5277	0.3612	4430.28	2	1350.0%	1	-.MLWIQPACLLSLIFSAHIAAVSIKHLLNGSDHDTDVGEQK.D
UQ9NP7361.2%1113.9%165182256.5(Q9NP73) DJ298J18.2.1 (Novel protein similar to predicted yeast and plant proteins (Isoform 1)) (Uncharacterized hematopoietic stem/progenitor cells protein MDS031)
*	TK050203_NMyc_cyto1_step07.2474.2474.2	1.8917	0.2822	2587.35	1	2610.0%	1	K.EDIQKADLVISHAGAGSCLETLEK.G
UAD15_MOUSE61.1%332.1%815874256.2(O88839) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) (AD56)
	TK050203_NMyc_cyto1_step10.2495.2495.2	2.1389	0.2325	1972.3	4	3240.0%	1	R.GYTLELGPGDLQRPVISR.I
UQ6221961.1%224.3%444482287.2(Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5)
	TK050203_NMyc_cyto1_step05.2342.2342.2	1.8879	0.2833	2060.39	1	3420.0%	1	K.GLCGSCNKPIAGQVVTALGR.A
UMY5C_HUMAN61.1%440.3%17422027937.7(Q9NQX4) Myosin Vc (Myosin 5C)
*	TK050203_NMyc_cyto1_step02.1454.1454.1	1.8473	0.0229	758.59	1	8000.0%	1	K.EQIQLK.L
UQ922Y361.1%110.9%535605757.6(Q922Y3) Unknown (Protein for IMAGE:3498575) (Fragment)
	TK050203_NMyc_cyto1_step02.1454.1454.1	1.8473	0.0229	758.59	1	8000.0%	1	K.EQLQLK.I
UCHD1_HUMAN61.1%350.6%17091965177.2(O14646) Chromodomain-helicase-DNA-binding protein 1 (CHD-1)
*	TK050203_NMyc_cyto1_step02.1638.1638.1	1.854	0.0137	1433.01	1	5000.0%	2	K.NKEPGEIQYLIK.W
UQ9D5Y661.1%554.1%242295669.5(Q9D5Y6) 4921506D17Rik protein
	TK050203_NMyc_cyto1_step01.2136.2136.1	1.8441	0.0171	1374.74	1	5000.0%	1	R.IFREDYSITTK.G
UQ8WXA661.1%110.2%23162625165.4(Q8WXA6) AF15q14 isoform 2
*	TK050203_NMyc_cyto1_step02.1454.1454.1	1.8473	0.0229	758.59	1	8000.0%	1	R.EKLQIK.I
USHK1_HUMAN61.0%571.2%21612250198.1(Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1) (Somatostatin receptor interacting protein) (SSTR interacting protein) (SSTRIP)
*	TK050203_NMyc_cyto1_step12.3667.3667.2	2.1879	0.1284	2593.39	1	2410.0%	2	R.STLFLSTDAGDEDGGDGGLGTGAAPGPR.L
UQ9CZY660.9%467.1%310345776.5(Q9CZY6) 2610312C03Rik protein (26S proteasome-associated pad1 homolog)
	TK050203_NMyc_cyto1_step12.2426.2426.2	2.083	0.2644	2512.84	1	2270.0%	1	R.QTTSNLGHLNKPSIQALIHGLNR.H
UMGE1_HUMAN60.9%115.6%373411634.3(Q9UBF1) Melanoma-associated antigen E1 (MAGE-E1 antigen) (MAGE-C2 antigen) (Hepatocellular cancer antigen 587) (Cancer-testis antigen CT10)
*	TK050203_NMyc_cyto1_step06.2951.2951.2	2.1864	0.0754	2397.45	2	2860.0%	1	K.GNCASEEVIWEVLNAVGVYAGR.E
UQ8R3P660.8%331.7%515572375.2(Q8R3P6) Similar to hypothetical protein DKFZp564O1664
	TK050203_NMyc_cyto1_step02.1484.1484.1	1.483	0.1711	1176.41	2	5560.0%	1	R.FPLPFPFPSK.L
UQ9NYU160.7%460.6%15161747606.9(Q9NYU1) UDP-glucose:glycoprotein glucosyltransferase 2 precursor
*	TK050203_NMyc_cyto1_step12.3847.3847.1	1.866	0.0393	1072.98	2	5560.0%	2	K.MAQLLVVLGK.I
UFZD6_HUMAN60.5%113.4%706792748.0(O60353) Frizzled 6 precursor (Frizzled-6) (Fz-6) (hFz6)
	TK050203_NMyc_cyto1_step06.4112.4112.2	1.834	0.2763	2980.65	1	1880.0%	1	K.FLGIDQCAPPCPNMYFKSDELEFAK.S
UALFA_HUMAN60.4%353%363392898.1(P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1)
*	TK050203_NMyc_cyto1_step02.1661.1661.1	1.6022	0.1309	1436.51	2	5000.0%	2	-.PYQYPALTPEQK.K
UO1494060.3%112.9%385431129.3(O14940) Molybdenum cofactor biosynthesis protein A
	TK050203_NMyc_cyto1_step12.1022.1022.1	1.5275	0.1558	1366.92	1	5000.0%	1	R.QHAGMFSISQMK.N
UQ8WYP560.3%441.1%22662525566.6(Q8WYP5) Transcription factor ELYS
*	TK050203_NMyc_cyto1_step06.2466.2466.3	2.9034	0.0989	2958.65	2	2300.0%	1	R.YIQTMKPTVSSGNDVILHLTVLLFNR.C
UO9545860.2%350.6%12481386516.4(O95458) Beta-tubulin cofactor D
	TK050203_NMyc_cyto1_step08.1397.1397.1	1.4436	0.195	909.53	1	6430.0%	2	R.RGLLLPSR.L
UQ9QYK960.2%4162.6%343385196.5(Q9QYK9) MCAMK1-BETA2 protein (Pregnancy upregulated NONUBIQUITOUS CA2+/calmodulin-dependent kinase PNCK)
	TK050203_NMyc_cyto1_step01.4306.4306.1	1.8518	0.2689	1185.68	10	4440.0%	4	K.RAFNATSFLR.H
UZO1_MOUSE60.1%680.6%17451947106.7(P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1)
*	TK050203_NMyc_cyto1_step11.1157.1157.1	1.832	0.1394	1290.73	6	4550.0%	2	R.DGDIQEGDVVLK.I
UQ9NVM660.1%4103%304346878.5(Q9NVM6) Hypothetical protein FLJ10634
*	TK050203_NMyc_cyto1_step07.2551.2551.1	1.5374	0.1514	1109.85	5	5000.0%	3	K.GGYSKDVLLR.L
UQ8VCR260.1%223%304335189.0(Q8VCR2) Similar to hydroxysteroid 17-beta dehydrogenase 11
*	TK050203_NMyc_cyto1_step01.2443.2443.1	1.4268	0.2127	1246.79	1	5560.0%	1	K.SRLVLWDINK.R
UCALU_MOUSE60.1%392.9%315370644.7(O35887) Calumenin precursor
	TK050203_NMyc_cyto1_step07.1216.1216.1	1.43	0.2133	1189.43	1	5000.0%	3	R.VHHEPQLSDK.V
UQ9DBY860.0%221.3%855944766.4(Q9DBY8) 1200009I24Rik protein
*	TK050203_NMyc_cyto1_step02.2430.2430.1	1.8276	0.0333	1266.75	1	6360.0%	1	K.FEDVGGNDATLK.E
UQ8R0L660.0%224.4%206235215.7(Q8R0L6) Similar to coronin, actin binding protein, 2A (Fragment)
	TK050203_NMyc_cyto1_step01.2067.2067.1	1.8212	0.0382	1258.74	1	6110.0%	1	K.QLELEIKNLR.M
UQ8TCD560.0%116.5%201233996.6(Q8TCD5) 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C
	TK050203_NMyc_cyto1_step06.1451.1451.1	1.8242	0.0379	1545.6	3	4230.0%	1	R.DKTVVLGDLLIDDK.D
UQ9CQ2659.8%222.1%424485146.6(Q9CQ26) 5330424L14Rik protein (5730422L11Rik protein) (RIKEN cDNA 5730422L11 gene) (AMSH) (Associated molecule with the SH3 domain of STAM)
*	TK050203_NMyc_cyto1_step01.1976.1976.1	1.7007	0.1106	1165.55	2	6670.0%	1	R.DYKSAIIPEK.K
UO0042059.8%441.2%826908147.5(O00420) F19541_1 (Fragment)
	TK050203_NMyc_cyto1_step10.1756.1756.1	1.4125	0.2293	1299.56	4	4000.0%	1	R.VAQYARAQHVR.L
UCATC_MOUSE59.6%355.6%462523766.9(P97821) Dipeptidyl-peptidase I precursor (EC 3.4.14.1) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase)
*	TK050203_NMyc_cyto1_step11.3339.3339.3	2.8686	0.0494	3260.79	2	2310.0%	2	R.IPRPKPAPMTDEIQQQILNLPESWDWR.N
UQ9CQR159.6%333.9%564651468.9(Q9CQR1) DNA segment, Chr 6, Wayne state University 157, expressed
	TK050203_NMyc_cyto1_step11.2185.2185.3	2.8668	0.032	2626.49	1	2390.0%	1	K.EQLIIPQVPLFNILAKFNGITEK.E
UQ925I459.5%5110.7%843957367.4(Q925I4) Candidate taste receptor T1R2
*	TK050203_NMyc_cyto1_step07.1939.1939.1	1.823	0.1229	892.68	10	7500.0%	3	R.RFPAMLR.T
UQ9D3Z159.5%222.8%251279888.1(Q9D3Z1) 4933426K21Rik protein
	TK050203_NMyc_cyto1_step01.2190.2190.1	1.8168	0.0312	920.59	8	7140.0%	1	K.AVFLARDK.H
UQ8R5C859.5%111.4%562661518.2(Q8R5C8) Similar to adenovirus 5 E1A binding protein
	TK050203_NMyc_cyto1_step01.2031.2031.1	1.8285	4.0E-4	1177.72	2	6250.0%	1	K.YTKIFNDFK.D
UANPA_MOUSE59.5%350.8%10571191096.9(P18293) Atrial natriuretic peptide receptor A precursor (ANP-A) (ANPRA) (GC-A) (Guanylate cyclase) (EC 4.6.1.2) (NPR-A) (Atrial natriuretic peptide A-type receptor)
	TK050203_NMyc_cyto1_step01.2990.2990.1	1.8174	0.1373	1054.75	10	5620.0%	2	R.YSLTNDIVK.G
UKMLS_HUMAN59.4%220.9%19142107726.2(Q15746) Myosin light chain kinase, smooth muscle and non-muscle isozymes (EC 2.7.1.117) (MLCK) [Contains: Telokin (Kinase related protein) (KRP)]
	TK050203_NMyc_cyto1_step07.2631.2631.2	1.9292	0.2726	2110.48	1	4120.0%	1	K.QGIVHLDLKPENIMCVNK.T
UQ96EC359.4%116.5%413464277.2(Q96EC3) Similar to adrenergic, beta-2-, receptor, surface
*	TK050203_NMyc_cyto1_step01.4387.4387.2	1.761	0.2943	2902.28	1	2040.0%	1	-.MGQPGNGSAFLLAPNGSHAPDHDVTQQR.D
UQ920Z059.4%1110.1%308349528.4(Q920Z0) BM332P19.1 (Novel 7 transmembrane receptor (Rhodopsin family) (Olfactory receptor like) protein (Mm17M1-12)) (Olfactory receptor MOR250-2)
*	TK050203_NMyc_cyto1_step10.2135.2135.3	2.648	0.2502	3701.28	2	1530.0%	1	K.AISFLGCITQLHFFHFLGSTETMLLPVMAFDR.F
UEF2K_MOUSE59.3%111.4%724817395.4(O08796) Elongation factor 2 kinase (EC 2.7.1.-) (eEF-2 kinase) (eEF-2K) (Calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase)
	TK050203_NMyc_cyto1_step01.3403.3403.1	1.6942	0.1022	1373.3	2	5500.0%	1	K.LSNFLHAQQWK.G
UQ9NQZ759.2%334.5%604689607.6(Q9NQZ7) Lysosomal apyrase-like protein 1
*	TK050203_NMyc_cyto1_step05.2813.2813.2	1.9032	0.27	2821.63	1	2220.0%	1	R.TVGILDMGGASLQIAYEVPTSTSVLPAK.Q
UO5512959.0%440.9%906964649.5(O55129) Microtubule-associated protein (STOP protein)
*	TK050203_NMyc_cyto1_step02.1452.1452.1	1.53	0.1474	898.49	2	5620.0%	1	K.DSVPLAPAK.A
UQ9CS0559.0%331.6%514576384.4(Q9CS05) 2510002A14Rik protein (Fragment)
	TK050203_NMyc_cyto1_step01.1970.1970.1	1.6215	0.1242	1043.58	3	6250.0%	1	K.LINQVNTIK.N
UQ9QZJ459.0%4100.9%9011006775.7(Q9QZJ4) TPR-containing protein involved in spermatogenesis TPIS
*	TK050203_NMyc_cyto1_step01.2812.2812.1	1.6154	0.1276	1131.11	4	5620.0%	1	K.YIENCSDVK.H
UQ9H5F458.9%222.4%463534034.8(Q9H5F4) Hypothetical protein FLJ23495
	TK050203_NMyc_cyto1_step01.3624.3624.1	1.6821	0.101	1395.7	1	4550.0%	1	K.ELNAIMESMLNK.N
UQ9CVX358.9%223.5%342358178.5(Q9CVX3) 2410004D18Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step10.1759.1759.1	1.682	0.1118	1457.56	1	4580.0%	1	K.TPHCFLTGHGAEK.F
UQ9Y4D458.7%330.7%851947928.5(Q9Y4D4) Hypothetical protein KIAA0648 (Fragment)
*	TK050203_NMyc_cyto1_step02.1765.1765.1	1.6424	0.1169	869.6	1	6670.0%	1	R.ELLDLHK.Q
UQ9Z18958.7%117.5%334389488.4(Q9Z189) Macrophage actin-associated-tyrosine-phosphorylated protein
*	TK050203_NMyc_cyto1_step01.3074.3074.2	2.0524	0.2587	2835.37	2	2000.0%	1	K.TGQTPPAPIMYENFYSPQRNAAPPGK.T
UO9520658.5%682%10701130185.5(O95206) Protocadherin
	TK050203_NMyc_cyto1_step12.3097.3097.2	2.1564	0.2168	2138.38	1	3330.0%	1	R.AGGAVSTYVSVDPATGAIYALR.S
UKLKF_HUMAN58.4%1115.6%256280878.0(Q9H2R5) Kallikrein 15 precursor (EC 3.4.21.-) (ACO protease)
*	TK050203_NMyc_cyto1_step11.2879.2879.3	2.515	0.3435	4242.61	1	1560.0%	1	R.GAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTK.V
USHK2_HUMAN58.4%551%12531348005.6(Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)
*	TK050203_NMyc_cyto1_step01.3080.3080.1	1.3851	0.2838	1514.83	4	3460.0%	1	R.RAPSPVVSPTEMNK.E
UNCR1_MOUSE58.3%12200.6%24532706406.9(Q60974) Nuclear receptor co-repressor 1 (N-CoR1) (N-CoR) (Retinoid X receptor interacting protein 13) (RIP13)
*	TK050203_NMyc_cyto1_step11.2728.2728.2	2.0275	0.2676	1773.83	1	4000.0%	2	R.SYEAVEGSIKQGMSMR.E
UIRKA_MOUSE58.3%113.2%379424328.3(Q9JM63) ATP-sensitive inward rectifier potassium channel 10 (Potassium channel, inwardly rectifying, subfamily J, member 10) (Inward rectifier K+ channel Kir4.1)
	TK050203_NMyc_cyto1_step01.2420.2420.1	1.5732	0.1329	1546.73	1	4170.0%	1	K.YIADFSLFDQVVK.V
UQ96T0858.2%113.6%221240574.6(Q96T08) Hypothetical protein FLJ14526
*	TK050203_NMyc_cyto1_step01.2330.2330.1	1.6191	0.118	1112.71	4	6250.0%	1	-.MKSNLHPQR.C
UQ1505858.2%9291.8%16481864907.9(Q15058) Hypothetical protein KIAA0042
*	TK050203_NMyc_cyto1_step10.4148.4148.2	2.1751	0.0952	3062.08	4	2240.0%	5	K.ESLGGNSKTAMIATISPAASNIEETLSTLR.Y
UUBL1_MOUSE58.1%224%223248385.2(Q9R0P9) Ubiquitin carboxyl-terminal hydrolase isozyme L1 (EC 3.4.19.12) (UCH-L1) (Ubiquitin thiolesterase L1) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5)
*	TK050203_NMyc_cyto1_step05.2587.2587.1	1.4233	0.2139	1137.57	1	6110.0%	1	K.LEFEDGSVLK.Q
UQ8WXG958.0%9110.1%63076926864.6(Q8WXG9) Very large G protein-coupled receptor 1b
*	TK050203_NMyc_cyto1_step01.3190.3190.1	1.4696	0.1571	1262.82	4	5000.0%	1	R.RNDLIFPEQK.T
UHEPS_MOUSE58.0%111.4%416447397.4(O35453) Serine protease hepsin (EC 3.4.21.-)
	TK050203_NMyc_cyto1_step05.1138.1138.1	1.3931	0.2575	792.57	2	6670.0%	1	R.KPGVYTK.V
UPESC_MOUSE57.9%222.1%584677966.8(Q9EQ61) Pescadillo homolog 1
*	TK050203_NMyc_cyto1_step01.1663.1663.1	1.7906	0.0838	1566.43	2	4580.0%	1	K.DIKFLLHEPIVNK.F
UQ8R0Y357.9%221%696775666.4(Q8R0Y3) Similar to 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
*	TK050203_NMyc_cyto1_step06.1546.1546.1	1.7873	0.0833	1016.49	4	6430.0%	1	R.EVEELLQR.L
UQ9CRI057.9%118.6%139160025.7(Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment)
	TK050203_NMyc_cyto1_step03.1546.1546.1	1.6039	0.1232	1380.65	2	4580.0%	1	R.EDSVKPGAHLTVK.K
UPRSA_MOUSE57.9%332.5%442494935.2(O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1)
	TK050203_NMyc_cyto1_step02.2282.2282.1	1.761	0.0985	1460.67	1	5450.0%	1	R.KIEFPMPNEEAR.A
UQ9Y6X057.8%330.9%15421696329.8(Q9Y6X0) SET-binding protein (SEB) (Hypothetical protein KIAA0437)
*	TK050203_NMyc_cyto1_step01.1740.1740.1	1.7618	0.0914	1580.77	1	3570.0%	1	K.GSAGNTWSQLSNNNK.D
UQ9D5Z057.7%115.3%419470988.1(Q9D5Z0) 4921504E14Rik protein
*	TK050203_NMyc_cyto1_step02.2753.2753.2	1.805	0.2716	2554.53	1	2730.0%	1	K.VWIFLPQILFGILAILSGLLSLK.L
UOM40_MOUSE57.4%113.3%359380018.4(Q9QYA2) Probable mitochondrial import receptor subunit TOM40 homolog (Translocase of outer membrane 40 kDa subunit homolog)
	TK050203_NMyc_cyto1_step05.1157.1157.1	1.3385	0.3154	1566.28	2	3750.0%	1	K.CKELFPVQMEGVK.L
UQ9NRZ257.4%442%538598948.5(Q9NRZ2) Envelope protein
	TK050203_NMyc_cyto1_step01.1396.1396.1	1.4312	0.2035	1385.57	1	4550.0%	1	K.GLDLSKLHETLR.T
UTDR1_HUMAN57.3%351%777867635.2(Q9BXT4) Tudor domain containing protein 1
*	TK050203_NMyc_cyto1_step03.1895.1895.1	1.4996	0.1552	1007.62	1	6880.0%	2	K.EILPNGHVK.V
UVGR1_MOUSE57.3%550.6%13331498768.3(P35969) Vascular endothelial growth factor receptor 1 precursor (EC 2.7.1.112) (VEGFR-1) (Tyrosine-protein kinase receptor FLT) (FLT-1) (Embryonic receptor kinase 2)
	TK050203_NMyc_cyto1_step01.1391.1391.1	1.4518	0.1812	1072.57	1	6250.0%	1	K.YGNLSNYLK.S
UQ9UJR557.2%1185.7%3534926.6(Q9UJR5) LST-1/M protein
*	TK050203_NMyc_cyto1_step11.3332.3332.3	2.8496	0.0489	3063.43	7	1750.0%	1	R.NDAPSVLVPGPGLLRAGTPLCISAEAASAQQ.-
UMATK_MOUSE57.1%332.4%505560578.8(P41242) Megakaryocyte-associated tyrosine-protein kinase (EC 2.7.1.112) (Tyrosine-protein kinase CTK) (Protein kinase NTK)
*	TK050203_NMyc_cyto1_step01.2846.2846.1	1.3978	0.2333	1366.7	1	5000.0%	1	R.LFGAWHPAPAAAR.M
UGAA1_MOUSE57.1%222.2%455517549.3(P18504) Gamma-aminobutyric-acid receptor alpha-1 subunit precursor (GABA(A) receptor)
	TK050203_NMyc_cyto1_step01.1203.1203.1	1.3984	0.2221	1248.56	5	4500.0%	1	R.EPQLKAPTPHQ.-
UQ9CVT357.1%224%201223707.8(Q9CVT3) 1700037H04Rik protein (Fragment)
	TK050203_NMyc_cyto1_step03.1270.1270.1	1.7245	0.0891	1084.54	3	5620.0%	1	K.VGFLKILHR.Y
UBM8B_MOUSE57.0%222%399447527.6(P55105) Bone morphogenetic protein 8B precursor (BMP-8B)
*	TK050203_NMyc_cyto1_step10.2079.2079.1	1.5958	0.1207	1070.6	4	5000.0%	1	R.TGELYVSFR.D
UQ96M1257.0%1117.1%245274797.9(Q96M12) Hypothetical protein FLJ32908
*	TK050203_NMyc_cyto1_step01.3808.3808.3	2.7308	0.2107	4668.32	1	1250.0%	1	R.DHAIAAIVFSGIACVAYATEVTWTRARPGEITDYMASELGLLK.V
UQ96P6457.0%221.7%663730577.1(Q96P64) MRIP2
	TK050203_NMyc_cyto1_step01.1808.1808.1	1.6452	0.1138	1289.66	3	4550.0%	1	R.DAHGNTALTYAR.Q
UHXDD_HUMAN57.0%117.8%335352109.5(P35453) Homeobox protein Hox-D13 (Hox-4I)
*	TK050203_NMyc_cyto1_step02.2593.2593.3	2.7516	0.2118	3226.9	2	1920.0%	1	R.HEAYISMEGYQSWTLANGWNSQVYCTK.D
UQ8TAN856.9%117.6%460523417.3(Q8TAN8) Dynactin 4 (p62)
	TK050203_NMyc_cyto1_step06.2511.2511.3	2.7951	0.1986	4188.96	1	1640.0%	1	K.EIKIEPAQAVDEVEPLPEDYYTRPVNLTEVTTLQQR.L
UFOLC_MOUSE56.9%572.6%587649078.3(P48760) Folylpolyglutamate synthase, mitochondrial precursor (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (FPGS)
*	TK050203_NMyc_cyto1_step06.3039.3039.2	2.0006	0.2618	1826.01	2	4000.0%	2	R.TLNTLQTNASYLEQVK.R
UQ9WTR256.9%550.9%12891429627.1(Q9WTR2) Apoptosis signal-regulating kinase 2
*	TK050203_NMyc_cyto1_step01.1040.1040.1	1.4587	0.1626	1347.8	1	4580.0%	1	K.YAPASETPATLPK.D
UQ9273856.9%243.3%828941049.1(Q92738) Hypothetical protein KIAA0019
*	TK050203_NMyc_cyto1_step02.4157.4157.2	2.1251	0.1983	2936.77	1	2220.0%	2	K.RGSTASQYDNVPGPELDSGASVEEALER.A
UQ9UIF856.8%350.5%19722208646.3(Q9UIF8) Bromodomain adjacent to zinc finger domain 2B
	TK050203_NMyc_cyto1_step06.2047.2047.1	1.7567	0.0938	1157.33	1	6110.0%	1	K.NQPLDARVDK.I
UQ9UG9756.8%119.8%92104176.2(Q9UG97) Hypothetical protein (Fragment)
*	TK050203_NMyc_cyto1_step02.1620.1620.1	1.5502	0.1374	1040.58	1	6110.0%	1	-.YLSTPSSASK.A
UTEBP_MOUSE56.8%115.6%160187214.5(Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23)
	TK050203_NMyc_cyto1_step02.1530.1530.1	1.7216	0.0996	1131.66	1	6670.0%	1	R.KGESGQSWPR.L
UCGL_HUMAN56.7%112.7%405445346.7(P32929) Cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-cystathionase)
*	TK050203_NMyc_cyto1_step01.2350.2350.1	1.6269	0.1048	1445.93	1	5450.0%	1	R.YFRQVASEFGLK.I
UAPG1_MOUSE56.7%2210.6%113126657.9(Q62407) Aortic preferentially expressed protein 1 (APEG-1)
	TK050203_NMyc_cyto1_step03.1950.1950.1	1.6312	0.1042	1507.36	1	4580.0%	1	R.FAEEAEGGLCRLR.I
UQ9H2Y756.6%460.5%18832088817.2(Q9H2Y7) Zinc finger protein 106 (ZFP106)
*	TK050203_NMyc_cyto1_step06.1209.1209.1	1.6214	0.1029	1137.57	2	5560.0%	2	K.EIHTGSLNHK.A
UE4L2_MOUSE56.5%5250.7%9881098335.5(O70318) Band 4.1-like protein 2 (Generally expressed protein 4.1) (4.1G)
	TK050203_NMyc_cyto1_step03.1902.1902.1	1.6791	0.0988	910.5	1	7140.0%	5	R.KVEPVAHK.D
UQ9WU7856.4%110.9%869961516.7(Q9WU78) ALG-2 interacting protein AIP1
	TK050203_NMyc_cyto1_step03.1722.1722.1	1.8079	0.1728	1023.64	8	6250.0%	1	R.LQHAAELIK.N
UH2AW_HUMAN56.4%242.2%371399279.7(Q9P0M6) Core histone macro-H2A.2 (Histone macroH2A2) (mH2A2)
*	TK050203_NMyc_cyto1_step07.1100.1100.1	1.4425	0.1724	1003.41	3	5620.0%	2	K.EDIGKALEK.A
UGALT_HUMAN56.3%396.8%3683957310.2(O60755) Galanin receptor type 3 (GAL3-R) (GALR3)
*	TK050203_NMyc_cyto1_step11.3720.3720.2	2.134	0.1897	3006.48	1	2400.0%	3	R.LASHCLAYANSCLNPLVYALASRHFR.A
UTIAR_MOUSE56.3%466.1%392433898.0(P70318) Nucleolysin TIAR (TIA-1 related protein)
	TK050203_NMyc_cyto1_step06.2191.2191.2	1.6754	0.338	2590.17	1	3120.0%	1	R.FSTHESAAHAIVSVNGTTIEGHVVK.C
UIL6B_HUMAN56.3%221.7%9181035235.9(P40189) Interleukin-6 receptor beta chain precursor (IL-6R-beta) (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (GP130) (Oncostatin M receptor) (CDw130) (CD130 antigen)
*	TK050203_NMyc_cyto1_step12.3519.3519.2	1.6756	0.338	2064.65	4	3120.0%	1	R.SSFTVQDLKPFTEYVFR.I
UCLC6_MOUSE56.2%221.5%870969807.0(O35454) Chloride channel protein 6 (ClC-6)
	TK050203_NMyc_cyto1_step01.3634.3634.1	1.5905	0.1189	1597.65	4	3850.0%	1	K.FGVVQTSVEECSQK.G
UQ1682156.2%442%11221258375.0(Q16821) Type-1 protein phosphatase skeletal muscle glycogen targeting subunit (EC 3.1.3.16) (Serine /threonine specific protein phosphatase)
*	TK050203_NMyc_cyto1_step10.2876.2876.2	1.6653	0.5096	2906.29	1	1960.0%	1	R.NDDSHYTLCQRDTVGVIYDNDFEK.E
USYT1_MOUSE56.1%352.9%421474188.5(P46096) Synaptotagmin I (SytI) (p65)
	TK050203_NMyc_cyto1_step05.2087.2087.1	1.5308	0.1295	1410.9	2	4170.0%	2	K.KMDVGGLSDPYVK.I
UQ9Y4A456.1%352.6%381417875.8(Q9Y4A4) F22162_1 (Fragment)
*	TK050203_NMyc_cyto1_step07.1295.1295.1	1.4259	0.1922	1175.42	1	5500.0%	2	R.EAFLNGSDGHK.R
UMCT9_MOUSE56.0%243.7%246266529.7(O35164) Mast cell protease 9 precursor (EC 3.4.21.-) (MMCP-9)
	TK050203_NMyc_cyto1_step10.1910.1910.1	1.5623	0.1233	1145.16	2	6110.0%	2	R.EVELKIVGEK.A
UACH9_HUMAN55.9%111.7%479547806.5(Q9UGM1) Neuronal acetylcholine receptor protein, alpha-9 chain precursor
*	TK050203_NMyc_cyto1_step03.1875.1875.1	1.4955	0.1542	1109.54	3	5000.0%	1	R.VVILKYMSR.V
UQ9BVV255.8%467.5%318365268.6(Q9BVV2) Hypothetical protein
*	TK050203_NMyc_cyto1_step05.4127.4127.2	1.9376	0.2625	2903.43	1	2290.0%	2	K.LGNPQSFLDQEEADDQQLLEPEAWK.T
UQ9D4H755.8%221.5%753836566.4(Q9D4H7) 4932412G04Rik protein (BM145O4.1) (Novel protein)
	TK050203_NMyc_cyto1_step01.2030.2030.1	1.7875	0.067	1375.7	4	4550.0%	1	R.AQLPFLAMRSLK.D
UQ9QWY855.7%330.9%11471273957.6(Q9QWY8) ADP-ribosylation factor-directed GTPase activating protein isoform a
	TK050203_NMyc_cyto1_step10.1807.1807.1	1.7769	0.0778	1210.43	1	5500.0%	1	K.KRPPPPPPGHK.R
UQ9BZ7155.7%661%9741068097.1(Q9BZ71) NIR1
	TK050203_NMyc_cyto1_step01.2191.2191.1	1.6033	0.1083	1298.79	5	5000.0%	1	R.YESVNIKESAR.L
UQ9QZR955.6%551.7%16821640968.5(Q9QZR9) Alpha 4 collagen IV
*	TK050203_NMyc_cyto1_step12.2173.2173.3	2.8436	0.0832	3357.31	2	1900.0%	1	R.SYISRCAVCEAPAQAVAVHSQDQSIPPCPR.T
UMOT4_MOUSE55.6%396.2%470503737.9(P57787) Monocarboxylate transporter 4 (MCT 4)
*	TK050203_NMyc_cyto1_step12.3145.3145.3	2.8203	0.2099	3264.47	8	1720.0%	3	R.SIIQIYLTTGVITGLGLALNFQPSLIMLNR.Y
UMTTF_HUMAN55.6%113%399457789.4(Q99551) Transcription termination factor, mitochondrial precursor (mTERF)
*	TK050203_NMyc_cyto1_step11.1404.1404.1	1.7943	0.0399	1333.61	1	5000.0%	1	K.GASKEVIASIISR.Y
UO8862255.6%111.3%9681091696.8(O88622) Poly(ADP-ribose) glycohydrolase
*	TK050203_NMyc_cyto1_step01.2616.2616.1	1.4311	0.1893	1593.62	4	3460.0%	1	K.ESEPESPMDVDNSR.N
UQ9DBU555.6%333.4%667740919.4(Q9DBU5) 1200013I08Rik protein
*	TK050203_NMyc_cyto1_step06.2815.2815.2	1.8984	0.2641	2406.59	1	2830.0%	1	R.AKEQLASQPGSDSAASDGDSESLR.A
UQ1296555.5%222.2%11091270418.9(Q12965) Myosin-IC
*	TK050203_NMyc_cyto1_step11.2591.2591.2	1.6665	0.3621	2926.97	1	2500.0%	1	K.GVYQYHWQSHNVKHSGVDDMVLLSK.I
UAD07_MOUSE55.4%111.4%788890026.7(O35227) ADAM 7 precursor (A disintegrin and metalloproteinase domain 7)
*	TK050203_NMyc_cyto1_step01.0620.0620.1	1.4117	0.2132	1374.37	2	3640.0%	1	R.KDFDHVILLSGK.W
UQ91XL355.4%112.4%420475538.9(Q91XL3) UDP-glucuronic acid decarboxylase
*	TK050203_NMyc_cyto1_step01.2262.2262.1	1.7179	0.0993	1357.85	2	5500.0%	1	K.IEEIVEPLREK.I
UQ9D65455.3%112.1%559649897.8(Q9D654) 4633401C23Rik protein
*	TK050203_NMyc_cyto1_step05.2117.2117.1	1.5154	0.1423	1575.56	5	3750.0%	1	K.AFTNCSLLVQHQR.V
UOSTP_HUMAN55.2%115.7%314354234.6(P10451) Osteopontin precursor (Bone sialoprotein 1) (Urinary stone protein) (Secreted phosphoprotein 1) (SPP-1) (Nephropontin) (Uropontin)
*	TK050203_NMyc_cyto1_step11.2484.2484.2	1.76	0.2733	2103.31	3	3330.0%	1	K.QNLLAPQNAVSSEETNDFK.Q
UPIP3_HUMAN55.1%220.6%12341387995.9(Q01970) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 3 (EC 3.1.4.11) (PLC-beta-3) (Phospholipase C-beta-3)
*	TK050203_NMyc_cyto1_step01.1724.1724.1	1.5341	0.1352	956.68	5	6430.0%	1	K.FKSFEAAR.K
UCAH8_MOUSE55.1%116.2%290329784.8(P28651) Carbonic anhydrase-related protein (CARP) (CA-VIII)
	TK050203_NMyc_cyto1_step12.3067.3067.2	1.6896	0.3046	2200.53	1	3060.0%	1	K.SKTIPCFNPNTLLPDPLLR.D
UO7568555.0%335.9%441457617.4(O75685) GNAS1 protein (DJ806M20.3.2) (Fragment)
	TK050203_NMyc_cyto1_step02.4082.4082.3	2.505	0.328	3020.15	2	2120.0%	1	K.IHLRPPSPEIQAADPPTPRPTRASAWR.G
UQ99MS755.0%8201.8%17161848334.7(Q99MS7) Tangerin A
*	TK050203_NMyc_cyto1_step11.3236.3236.2	1.7534	0.2777	3087.72	2	1940.0%	1	R.AGPEQGSSARAASAGPQVSCVQTVPSDGQGVK.S
UZPR1_MOUSE54.9%332%459507154.8(Q62384) Zinc-finger protein ZPR1 (Zinc finger protein 259)
	TK050203_NMyc_cyto1_step06.1319.1319.1	1.7546	0.0841	1250.61	3	5560.0%	1	R.LLLTKIPFFR.E
UACPM_MOUSE54.9%3514.7%156173705.2(Q9CR21) Acyl carrier protein, mitochondrial precursor (ACP) (NADH-ubiquinone oxidoreductase 9.6 kDa subunit) (CI-SDAP)
*	TK050203_NMyc_cyto1_step06.2393.2393.2	1.8514	0.2624	2572.65	1	2610.0%	2	R.RRPGALQSALALAQVPGTVTHLCR.Q
UY212_HUMAN54.9%114.1%657737686.9(Q92611) Putative alpha-mannosidase KIAA0212 (EC 3.2.1.-)
*	TK050203_NMyc_cyto1_step07.3570.3570.2	1.8516	0.2583	2880.06	1	2220.0%	1	K.TGVPPDTNNETCTAGAGSLLVEFGILSR.L
UQ9QXL054.9%224.7%761887519.0(Q9QXL0) DBCCR1
*	TK050203_NMyc_cyto1_step06.2937.2937.3	2.7374	0.1857	4168.29	5	1320.0%	1	R.FNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLMLDIR.D
UQ8TBD954.9%441.2%10581182354.9(Q8TBD9) Similar to KIAA0800 gene product
	TK050203_NMyc_cyto1_step11.1819.1819.2	2.1212	0.1669	1537.84	2	4230.0%	1	K.EHGSGQDMVPILTR.M
UTNP3_MOUSE54.9%112.2%775875968.2(Q60769) Tumor necrosis factor, alpha-induced protein 3 (Putative DNA binding protein A20) (Zinc finger protein A20)
	TK050203_NMyc_cyto1_step02.2262.2262.2	2.1451	0.1692	2284.8	1	3530.0%	1	K.EINLVDDYFELVQHEYKK.W
UEGFR_HUMAN54.8%111.3%12101342776.7(P00533) Epidermal growth factor receptor precursor (EC 2.7.1.112) (Receptor protein-tyrosine kinase ErbB-1)
*	TK050203_NMyc_cyto1_step07.2250.2250.2	2.1579	0.1536	1899.62	3	3750.0%	1	K.NCTSISGDLHILPVAFR.G
UCPSA_HUMAN54.8%221.8%14421608226.4(Q10570) Cleavage and polyadenylation specificity factor, 160 kDa subunit (CPSF 160 kDa subunit)
	TK050203_NMyc_cyto1_step02.3654.3654.2	2.0613	0.2413	2993.09	1	1730.0%	1	R.GALRLHPMAIDGPVDSFAPFHNVNCPR.G
UDEST_MOUSE54.8%339.7%165185228.0(Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF)
*	TK050203_NMyc_cyto1_step07.3448.3448.2	1.6479	0.3439	2077.01	1	3750.0%	1	R.KEELMFFLWAPEQAPLK.S
UZN08_HUMAN54.8%222.9%543617737.8(P17098) Zinc finger protein 8 (Zinc finger protein HF.18) (Fragment)
*	TK050203_NMyc_cyto1_step05.2549.2549.2	2.1506	0.1367	1965.43	1	3750.0%	1	K.QLEFGLKEAPVQDQAYK.T
UO6062254.8%8183%9341009885.2(O60622) Protocadherin 43
	TK050203_NMyc_cyto1_step10.3468.3468.3	2.7852	0.1523	3029.07	1	2410.0%	3	R.EREPSLQLVLTALDGGTPALSASLPIHIK.V
USNC3_HUMAN54.8%112.7%411467535.3(Q92966) snRNA activating protein complex 50 kDa subunit (SNAPc 50 kDa subunit) (Proximal sequence element-binding transcription factor beta subunit) (PSE-binding factor beta subunit) (PTF beta subunit)
*	TK050203_NMyc_cyto1_step02.1914.1914.1	1.5921	0.1164	1391.88	2	4090.0%	1	R.AFHVGAFGELWR.G
UQ9D0S054.8%1120.2%188210498.7(Q9D0S0) 1190017B18Rik protein
	TK050203_NMyc_cyto1_step05.2906.2906.3	2.4725	0.3724	4497.92	1	1640.0%	1	K.QVDPQLGLQLASMLGCSFYEVSVSENYNDVYNAFHVLCK.E
UAMBP_MOUSE54.6%223.2%349390706.3(Q07456) AMBP protein precursor [Contains: Alpha-1-microglobulin; Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (HI-30)]
	TK050203_NMyc_cyto1_step11.1183.1183.1	1.5061	0.1436	1288.55	1	5450.0%	1	K.SSHHHGLTITAK.L
UQ96SN154.5%223.9%713791264.7(Q96SN1) Hypothetical protein FLJ14744
*	TK050203_NMyc_cyto1_step06.2019.2019.3	2.8254	0.1128	3419.54	3	1880.0%	1	K.LWNSFCNSDDPYNPLNFKAPFQTSGENEK.G
UESTN_MOUSE54.5%244.7%554611415.1(P23953) Liver carboxylesterase precursor (EC 3.1.1.1) (PES-N)
*	TK050203_NMyc_cyto1_step10.3318.3318.3	2.8266	0.0258	3120.47	4	2020.0%	2	K.AEEVAFWTELLAKNPPETDPTEHTEHK.-
UQ96PZ054.5%441.9%645732556.8(Q96PZ0) Hypothetical protein KIAA1897 (Fragment)
*	TK050203_NMyc_cyto1_step08.2137.2137.1	1.7837	0.0372	1432.7	4	4580.0%	1	K.ETSVAIEVIEDTK.E
UQ8TDQ654.4%119.4%265307628.5(Q8TDQ6) C-type lectin protein CLL-1
*	TK050203_NMyc_cyto1_step11.3585.3585.2	1.805	0.2576	3003.36	1	2000.0%	1	-.MSEEVTYADLQFQNSSEMEKIPEIGK.F
UQ9BQW954.2%116.5%246280427.8(Q9BQW9) DJ782G3.1 (LISCH7 (Liver-specific BHLH-ZIP transcription factor)) (Fragment)
*	TK050203_NMyc_cyto1_step12.1467.1467.2	1.7899	0.2634	1831.51	4	3440.0%	1	R.VVASKQGSTVTLGDFYR.G
UQ8VDF554.1%8642.2%314366029.0(Q8VDF5) Hypothetical 36.6 kDa protein (Fragment)
*	TK050203_NMyc_cyto1_step05.1529.1529.1	1.4652	0.1568	809.38	2	5710.0%	8	R.KGAVPAHK.A
USYN2_HUMAN54.0%333.4%582629688.4(Q92777) Synapsin II
*	TK050203_NMyc_cyto1_step06.2018.2018.2	2.16	0.1034	1934.6	2	4000.0%	1	K.QTAASAGLVDAPAPAPAAARK.A
UQ8TC8154.0%359.4%171199178.7(Q8TC81) Hypothetical protein
*	TK050203_NMyc_cyto1_step11.2935.2935.2	2.1616	0.1065	2031.66	1	3750.0%	1	K.LLSHGTNIEECSKCLLR.N
UPHS1_MOUSE54.0%460.7%850974317.1(Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1)
	TK050203_NMyc_cyto1_step02.1458.1458.1	1.5712	0.1121	811.35	1	8330.0%	1	K.IHSDIVK.T
UQ99LJ353.9%112.5%400459185.0(Q99LJ3) Hypothetical 45.9 kDa protein (Fragment)
	TK050203_NMyc_cyto1_step03.1356.1356.1	1.5133	0.1305	1325.58	1	5500.0%	1	R.RDQALTEEHAR.Q
UQ9D0R953.9%223.6%386424705.7(Q9D0R9) 2600001A11Rik protein
*	TK050203_NMyc_cyto1_step08.1589.1589.2	2.1602	0.0375	1781.43	4	4290.0%	1	K.GYPSCSFISFDVNCK.D
UQ96BW553.9%116%349390186.5(Q96BW5) Phosphotriesterase related
*	TK050203_NMyc_cyto1_step11.2003.2003.2	2.1515	0.1355	2339.66	10	2380.0%	1	K.VLQATAHAQAQLGCPVIIHPGR.S
UQ9CZ0153.9%111.1%637749699.4(Q9CZ01) 2810426N06Rik protein
*	TK050203_NMyc_cyto1_step05.1593.1593.1	1.3949	0.2196	1011.42	1	6430.0%	1	R.YSSFQNHK.Q
UML1A_HUMAN53.8%2410%350393759.5(P48039) Melatonin receptor type 1A (Mel-1A-R)
*	TK050203_NMyc_cyto1_step05.2945.2945.3	2.7814	0.0459	4001.64	4	1570.0%	2	R.NFVTMFVVFVLFAICWAPLNFIGLAVASDPASMVPR.I
UO6028453.8%332.7%10471151556.1(O60284) Hypothetical protein KIAA0535
*	TK050203_NMyc_cyto1_step10.3352.3352.3	2.7866	0.0661	3177.15	2	2050.0%	1	R.ASSYSYGQCSEDTHIAAAAAILNLSTRCR.E
UQ96DQ853.8%1118.5%146163005.3(Q96DQ8) Hypothetical protein FLJ30619
*	TK050203_NMyc_cyto1_step11.3297.3297.3	2.7805	0.0517	3265.83	3	1940.0%	1	R.GMEILGNLCKAEDNGVLICEYVDQDSYR.E
UUTRO_HUMAN53.7%8100.3%34333944955.3(P46939) Utrophin (Dystrophin-related protein 1) (DRP1) (DRP)
*	TK050203_NMyc_cyto1_step08.1669.1669.1	1.7829	0.0058	1132.74	7	6110.0%	1	K.LAEETKALEK.N
UQ1308853.7%241%11541269255.0(Q13088) ZEB (Fragment)
*	TK050203_NMyc_cyto1_step01.4478.4478.1	1.7863	0.0040	1588.78	1	5000.0%	2	R.IPLPEQCLFCPGR.T
UQ9UFA453.6%441.6%791856336.1(Q9UFA4) Hypothetical protein (Fragment)
*	TK050203_NMyc_cyto1_step08.1909.1909.1	1.4918	0.1455	1508.74	2	4230.0%	1	K.DGKSPLHMTAVHGR.F
UZ298_HUMAN53.5%7271.2%9511065178.5(P57071) Zinc finger protein 298 (PR-domain zinc finger protein 15) (Fragment)
*	TK050203_NMyc_cyto1_step05.2230.2230.1	1.556	0.106	1410.65	2	5000.0%	5	R.FFSTNSNLSKHK.K
UQ6162553.5%111.9%10071130826.1(Q61625) Glutamate receptor delta-2 subunit precursor
*	TK050203_NMyc_cyto1_step07.2887.2887.2	2.1321	0.0978	2339.3	1	3680.0%	1	R.DVFSQRILELQQSGDMDILK.H
UCA1A_MOUSE53.4%224.1%680667769.8(Q05306) Collagen alpha 1(X) chain precursor
*	TK050203_NMyc_cyto1_step12.2025.2025.3	2.7453	0.1492	2748.45	4	1960.0%	1	R.GHSGEPGLPGPPGPPGPPGQAVMPDGFIK.A
UARSF_HUMAN53.4%224.6%591660047.3(P54793) Arylsulfatase F precursor (EC 3.1.6.-) (ASF)
	TK050203_NMyc_cyto1_step10.3271.3271.3	2.7238	0.1807	3181.05	3	1850.0%	1	R.NTELAFESQLWLCVQLVAIAILTLTFGK.L
UTCO1_HUMAN53.3%111.8%433481955.0(P20061) Transcobalamin I precursor (TCI) (TC I)
*	TK050203_NMyc_cyto1_step01.1696.1696.1	1.7714	0.0652	1004.04	2	5620.0%	1	K.KSLINGQIK.A
UQ9H9L653.3%118.5%293320546.9(Q9H9L6) Hypothetical protein FLJ12668
*	TK050203_NMyc_cyto1_step11.3807.3807.3	2.7732	0.0036	3005.51	1	2500.0%	1	K.ALPLPMACTLSQFLASNRYYFTVQSK.D
UHO2_MOUSE53.3%445.7%315357395.9(O70252) Heme oxygenase 2 (EC 1.14.99.3) (HO-2)
*	TK050203_NMyc_cyto1_step12.2637.2637.2	2.1375	0.0197	2227.71	3	3060.0%	1	K.LATTALYFTYSALEEEMDR.N
UQ9C0B653.2%222.3%791898888.0(Q9C0B6) Hypothetical protein KIAA1747 (Fragment)
*	TK050203_NMyc_cyto1_step11.2313.2313.2	1.6253	0.3413	2133.78	3	3060.0%	1	R.TNVDAAAQCQNWTITLGNR.W
UE2K3_MOUSE53.2%551.2%11141246825.3(Q9Z2B5) Eukaryotic translation initiation factor 2-alpha kinase 3 precursor (EC 2.7.1.-) (PRKR-like endoplasmic reticulum kinase) (Pancreatic eIF2-alpha kinase)
*	TK050203_NMyc_cyto1_step01.2972.2972.1	1.5039	0.1288	1455.82	4	3850.0%	1	R.AGFIESTFKPGGNK.E
UATX7_HUMAN53.2%331.2%892954519.9(O15265) Ataxin-7 (Spinocerebellar ataxia type 7 protein)
*	TK050203_NMyc_cyto1_step01.0899.0899.1	1.4982	0.1293	1143.5	1	5000.0%	1	R.GPPTGSPAESIK.R
UQ8VCJ553.1%354.9%551615497.7(Q8VCJ5) Hypothetical 61.5 kDa protein (Fragment)
	TK050203_NMyc_cyto1_step11.2817.2817.2	1.7237	0.2707	2944.98	3	1850.0%	1	R.NLTVLTPEGEAGLSWPVGLPAPFTPHSR.F
UQ9CWM753.1%222.4%412474359.5(Q9CWM7) 2410017I18Rik protein
*	TK050203_NMyc_cyto1_step01.2004.2004.1	1.5449	0.1077	1386.61	1	5500.0%	1	K.FVSFPDKIFCK.E
UCDB5_HUMAN53.0%112.4%795864235.0(Q9Y5E4) Protocadherin beta 5 precursor (PCDH-beta5)
*	TK050203_NMyc_cyto1_step05.2789.2789.2	1.9756	0.2544	2134.84	4	2630.0%	1	K.FLKPIIPNLLPQGAGEEIGK.T
URGSI_HUMAN53.0%114.7%235275827.9(Q9NS28) Regulator of G-protein signaling 18 (RGS18)
*	TK050203_NMyc_cyto1_step01.2426.2426.1	1.5409	0.103	1286.81	4	4550.0%	1	K.LIHGSGKEETSK.E
UQ6470653.0%6181.2%20192218264.9(Q64706) Tenascin C precursor
*	TK050203_NMyc_cyto1_step06.3153.3153.2	2.0475	0.2405	2753.58	1	2500.0%	4	K.HFVVQVQEANNVEAAQNLTVPSSLR.A
UQ9NXX853.0%243.4%701780095.3(Q9NXX8) FLJ00007 protein (Fragment)
*	TK050203_NMyc_cyto1_step07.3482.3482.2	2.0543	0.2369	2935.94	1	2710.0%	2	R.EDELTITEGEWLEVIEEGDADEWVK.A
UQ96JB153.0%11170.4%44905148186.3(Q96JB1) Axonemal dynein heavy chain 8
*	TK050203_NMyc_cyto1_step06.2355.2355.2	2.0621	0.2177	2227.34	1	3330.0%	3	K.LTQVIENWTNQNLSFAAFK.G
UQ9D9R152.9%6264.5%440495666.6(Q9D9R1) Adult male testis cDNA, RIKEN full-length enriched library, clone:1700030N20, full insert sequence
	TK050203_NMyc_cyto1_step05.3211.3211.2	1.6423	0.3347	2383.66	1	2500.0%	5	K.VVGHRGSVDHENWVSSYNALR.A
UO0018852.9%220.9%10321120877.3(O00188) LLGL protein
	TK050203_NMyc_cyto1_step11.1544.1544.1	1.458	0.1528	1241.32	4	5560.0%	1	K.LKQELFAFNK.T
UQ6148052.9%392%558641547.6(Q61480) TRAF5
	TK050203_NMyc_cyto1_step12.2222.2222.2	2.1185	0.1261	1375.3	1	6360.0%	3	K.ESKIQQLAETVK.K
UQ9CSW152.8%113.4%266290489.4(Q9CSW1) 2610111I01Rik protein (Fragment)
	TK050203_NMyc_cyto1_step07.1579.1579.1	1.7507	0.0645	1314.51	2	5000.0%	1	K.TWTELLKHMR.E
UMAP2_HUMAN52.8%220.3%18271996104.9(P11137) Microtubule-associated protein 2 (MAP 2) (MAP2B) [Contains: MAP2C]
*	TK050203_NMyc_cyto1_step03.1219.1219.1	1.5343	0.1062	709.37	5	7000.0%	1	K.EFQTGK.E
UMTN4_MOUSE52.8%221.9%624689185.8(O89029) Matrilin-4 precursor (MAT-4)
	TK050203_NMyc_cyto1_step01.2076.2076.1	1.5315	0.1042	1355.42	3	4580.0%	1	K.EEGIVMYAVGVGK.A
UC1QA_HUMAN52.8%224.9%245260179.1(P02745) Complement C1q subcomponent, A chain precursor
*	TK050203_NMyc_cyto1_step01.4424.4424.1	1.5304	0.1058	1230.39	1	5000.0%	1	K.VGYPGPSGPLGAR.G
UQ96M0452.8%221.7%519603519.3(Q96M04) Hypothetical protein FLJ32933
*	TK050203_NMyc_cyto1_step05.1919.1919.1	1.5295	0.1086	1255.63	4	5560.0%	1	K.KPYGSQECRK.A
UPSD4_MOUSE52.8%221.6%376407044.8(O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein)
	TK050203_NMyc_cyto1_step05.1215.1215.1	1.5333	0.102	822.46	1	8330.0%	1	K.LHTVQPK.G
UQ9H7C452.8%116.6%151177265.0(Q9H7C4) Hypothetical protein FLJ21054
*	TK050203_NMyc_cyto1_step02.1446.1446.1	1.4662	0.1458	1255.58	2	5000.0%	1	R.LSLAEELSTYK.A
UGIT1_HUMAN52.7%441.7%761843316.8(Q9Y2X7) ARF GTPase-activating protein GIT1 (G protein-coupled receptor kinase-interactor 1)
*	TK050203_NMyc_cyto1_step10.1682.1682.1	1.7796	0.0294	1563.63	7	3460.0%	1	R.EFATLIIDILSEAK.R
UO1463752.7%460.5%14861624966.6(O14637) Laminin alpha 3b chain (Fragment)
*	TK050203_NMyc_cyto1_step06.1725.1725.1	1.7792	0.0202	967.88	7	5000.0%	2	R.SLVAFYHK.G
UQ96L9152.7%570.5%31243401469.2(Q96L91) P400 SWI2/SNF2-related protein
*	TK050203_NMyc_cyto1_step11.1579.1579.2	1.974	0.2499	2014.17	1	3440.0%	2	R.EHAAPYFQQLRQTTAPR.L
UPTND_HUMAN52.6%460.2%24852769036.4(Q12923) Protein tyrosine phosphatase, non-receptor type 13 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (PTP-BAS) (Protein-tyrosine phosphatase PTPL1) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1)
*	TK050203_NMyc_cyto1_step02.1148.1148.1	1.5175	0.127	705.48	1	8000.0%	2	K.KTTQVK.D
UCA44_HUMAN52.6%990.7%16901640958.6(P53420) Collagen alpha 4(IV) chain precursor
*	TK050203_NMyc_cyto1_step01.0712.0712.1	1.5074	0.124	1438.5	1	5000.0%	1	K.GDTISCNVTYPGR.H
UFMN1_MOUSE52.6%5110.6%14681638098.6(Q05860) Formin 1 isoforms I/II/III (Limb deformity protein)
	TK050203_NMyc_cyto1_step01.4466.4466.1	1.5139	0.1199	1193.9	2	6670.0%	3	K.KKPLSEAYEK.K
UQ8TED952.5%111%792885466.9(Q8TED9) FLJ00258 protein (Fragment)
*	TK050203_NMyc_cyto1_step03.1596.1596.1	1.3891	0.2203	1033.51	3	5000.0%	1	R.ETCDHGKGK.K
USOX1_HUMAN52.5%118.8%387388569.8(O00570) SOX-1 protein
*	TK050203_NMyc_cyto1_step05.2853.2853.2	1.694	0.2867	2938.63	1	1910.0%	1	K.YSLAGGLLAAGAGGGGAAVAMGVGVGVGAAPVGQR.L
UQ8TBM952.5%220.9%9371024428.6(Q8TBM9) Hypothetical protein
*	TK050203_NMyc_cyto1_step01.2196.2196.1	1.7135	0.0801	1057.64	1	6880.0%	1	R.LPEPAKSCR.Q
UCADD_MOUSE52.5%6262.2%714782865.1(Q9WTR5) Cadherin-13 precursor (Truncated-cadherin) (T-cadherin) (T-cad) (Heart-cadherin) (H-cadherin)
*	TK050203_NMyc_cyto1_step12.3970.3970.2	2.1026	0.1941	1772.06	1	3750.0%	5	R.VEEGAVGVIVNLTVEDK.D
UQ8TAP652.5%11733.6%659744146.8(Q8TAP6) Hypothetical protein
*	TK050203_NMyc_cyto1_step06.3398.3398.3	2.7335	0.0832	2938.12	3	2290.0%	3	K.ELNFVTDSVEQELPSSPKQPICFDR.Q
UCALG_MOUSE52.5%115.9%611694034.7(P52194) Calmegin precursor (MEG 1 antigen) (Calnexin-T) (A2/6)
*	TK050203_NMyc_cyto1_step06.3170.3170.3	2.7419	0.1572	4135.55	7	1320.0%	1	K.IPDPTAVKPEDWDENEPAQIEDSSAVKPDGWLDDEPK.F
UQ9D0L452.5%554.8%525597368.0(Q9D0L4) 2610005A10Rik protein (RIKEN cDNA 2610005A10 gene)
*	TK050203_NMyc_cyto1_step07.3471.3471.3	2.7436	0.0933	3050.01	3	2200.0%	1	R.NNAACYLPEISQLLNHVPRQMLLILK.T
UO1471252.4%222.1%375443209.4(O14712) Cell cycle progression restoration 8 protein
	TK050203_NMyc_cyto1_step01.4395.4395.1	1.7549	0.0559	1193.76	3	5620.0%	1	R.QIIQRYMLK.E
UFA5_HUMAN52.4%351%22242516996.0(P12259) Coagulation factor V precursor (Activated protein C cofactor)
	TK050203_NMyc_cyto1_step05.3579.3579.2	2.114	0.1557	2532.77	7	2170.0%	2	K.EKPQSTISGLLGPTLYAEVGDIIK.V
UCAP2_HUMAN52.4%112.3%477528246.4(P40123) Adenylyl cyclase-associated protein 2 (CAP 2)
*	TK050203_NMyc_cyto1_step01.3231.3231.1	1.7331	0.0489	1359.76	1	4550.0%	1	K.GKVNSIIIDNCK.K
US11Y_HUMAN52.4%119.6%104115098.6(Q9UDP3) Putative S100 calcium-binding protein H_NH0456N16.1
*	TK050203_NMyc_cyto1_step01.2964.2964.1	1.7522	0.0544	1307.67	2	5000.0%	1	R.CIQSLIAVFQK.Y
UIF41_HUMAN52.4%223%406461545.5(P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I)
	TK050203_NMyc_cyto1_step01.3004.3004.1	1.4965	0.1357	1556.79	1	4580.0%	1	K.MFVLDEADEMLSR.G
UQ96QH252.3%662.8%718792179.6(Q96QH2) Adaptor molecule-1
*	TK050203_NMyc_cyto1_step05.3143.3143.2	1.9183	0.2525	2509.42	3	2500.0%	1	R.GEILEVIEFTSNEEMLCRDPK.G
USPCA_HUMAN52.3%220.9%24182799155.0(P02549) Spectrin alpha chain, erythrocyte (Erythroid alpha-spectrin)
*	TK050203_NMyc_cyto1_step05.2670.2670.2	1.9172	0.251	2391.93	1	3330.0%	1	K.DLNTLAEDLLSSGTFNVDQIVK.K
UO9538152.2%4162.9%713787675.4(O95381) Connector enhancer of KSR-like protein CNK1
*	TK050203_NMyc_cyto1_step01.3834.3834.2	2.0816	0.2238	2504.32	1	2860.0%	4	R.LQIQPGDEVVQINEQVVVGWPR.K
UNCR2_HUMAN52.2%330.4%25172740328.1(Q9Y618) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC) (CTG26)
*	TK050203_NMyc_cyto1_step02.1314.1314.1	1.7665	0.0217	1217.42	2	5000.0%	1	K.YDTGASTTGSKK.H
UQ9NV1452.2%115.7%299343305.0(Q9NV14) Hypothetical protein FLJ10997
*	TK050203_NMyc_cyto1_step06.2663.2663.2	2.0734	0.227	2370.53	1	3530.0%	1	K.FCQRQFEDSQHFIDQLNR.H
UTRFE_HUMAN52.2%353.2%698770507.1(P02787) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) (PRO1400)
*	TK050203_NMyc_cyto1_step12.3407.3407.2	1.574	0.3909	2440.35	1	2950.0%	2	-.MRLAVGALLVCAVLGLCLAVPDK.T
UDVL2_MOUSE52.2%221.8%736788036.0(Q60838) Segment polarity protein dishevelled homolog DVL-2 (Dishevelled-2) (DSH homolog 2)
	TK050203_NMyc_cyto1_step10.1723.1723.1	1.4928	0.1322	1501.56	3	4230.0%	1	K.AMAAPESGLEVRDR.M
UQ9QWR852.1%359.4%415471226.3(Q9QWR8) Alpha-N-acetylgalactosaminidase (EC 3.2.1.49)
	TK050203_NMyc_cyto1_step07.4134.4134.3	2.4914	0.3228	4542.45	1	1410.0%	2	R.VYEGQNVFTGDIFSGLQTEVNFTVIINPSGVVMWYLYPIK.D
UPSB4_MOUSE52.0%118.7%264291165.7(P99026) Proteasome subunit beta type 4 precursor (EC 3.4.25.1) (Proteasome beta chain) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome chain 3)
*	TK050203_NMyc_cyto1_step01.3788.3788.2	1.7639	0.2609	2602.61	1	2390.0%	1	K.GVEIEGPLSAQTNWDIAHMISGFE.-
UQ9CXG852.0%223.2%816892376.9(Q9CXG8) 3322402E17Rik protein
*	TK050203_NMyc_cyto1_step01.3327.3327.2	1.6562	0.3044	3131.93	1	2120.0%	1	R.YQFSRPGPESVPLQMSAHWQCGPTLTR.V
UQ9281551.9%552.4%655753545.8(Q92815) Cytoplasmic dynein 2 heavy chain (Fragment)
*	TK050203_NMyc_cyto1_step11.3439.3439.2	1.604	0.3425	2096.28	1	3120.0%	1	R.KLAELDEYLQNLNHIQR.K
UFZD3_MOUSE51.9%111.7%666762087.6(Q61086) Frizzled 3 precursor (Frizzled-3) (Fz-3) (mFz3)
	TK050203_NMyc_cyto1_step01.2022.2022.1	1.5037	0.1228	1458.71	1	4090.0%	1	R.IEIPLEKENQDK.L
UDEK_HUMAN51.9%113.5%375426748.6(P35659) DEK protein
*	TK050203_NMyc_cyto1_step06.1450.1450.1	1.7771	0.0385	1548.27	1	4620.0%	1	K.KLLASANLEEVTMK.Q
UQ9H6L051.9%225.5%541595616.7(Q9H6L0) Hypothetical protein FLJ22170
*	TK050203_NMyc_cyto1_step12.2185.2185.3	2.4835	0.3579	3334.06	2	1750.0%	1	R.NFCVPPGASPEVPKPALSFYVLGSWLGGTQR.K
UARRS_HUMAN51.9%225.7%405450926.6(P10523) S-arrestin (Retinal S-antigen) (48 kDa protein) (S-AG) (Rod photoreceptor arrestin)
*	TK050203_NMyc_cyto1_step12.2562.2562.2	1.6051	0.3368	2648.12	2	2390.0%	1	R.DYIDHVSQVQPVDGVVLVDPDLVK.G
UNAC1_MOUSE51.9%332.3%9701080355.0(P70414) Sodium/calcium exchanger 1 precursor (Na(+)/Ca(2+)-exchange protein 1)
*	TK050203_NMyc_cyto1_step12.2405.2405.2	1.8694	0.2476	2765.53	1	2730.0%	1	K.HPEKEIEQLIELANYQVLSQQQK.S
UQ9D69351.9%111.8%551626855.7(Q9D693) 4631423C22Rik protein
	TK050203_NMyc_cyto1_step08.1340.1340.1	1.4855	0.136	1293.63	2	5000.0%	1	R.MASPWEESSNR.Q
UO2H2_HUMAN51.7%1112.8%312347978.2(O95918) Olfactory receptor 2H2 (Hs6M1-12)
	TK050203_NMyc_cyto1_step05.2961.2961.3	2.6982	0.1882	4513.74	1	1620.0%	1	R.LSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWAVLR.I
UQ9H2T851.7%331.6%9851062088.0(Q9H2T8) Ribeye
*	TK050203_NMyc_cyto1_step10.2020.2020.2	1.8453	0.2443	1879.32	1	3440.0%	1	R.SPLLPREYYSDPSGAAR.V
UPGCV_HUMAN51.6%11230.9%33963728214.5(P13611) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP)
*	TK050203_NMyc_cyto1_step12.3638.3638.3	2.6839	0.1893	3810.97	2	1610.0%	4	R.TYGFRSPQETYDVYCYVDHLDGDVFHLTVPSK.F
UK6B2_HUMAN51.6%115.2%482534837.3(Q9UBS0) Ribosomal protein S6 kinase beta 2 (EC 2.7.1.-) (S6K-beta 2) (70 kDa ribosomal protein S6 kinase 2) (p70-S6KB) (p70 ribosomal S6 kinase beta) (p70 S6Kbeta) (S6K2) (S6 kinase-related kinase) (SRK) (Serine/threonine-protein kinase 14 beta)
*	TK050203_NMyc_cyto1_step10.3327.3327.2	1.6193	0.309	2963.6	2	2000.0%	1	K.ESIHEGAVTHTFCGTIEYMAPEILVR.S
UTRFL_MOUSE51.6%461%707778668.6(P08071) Lactotransferrin precursor (Lactoferrin)
*	TK050203_NMyc_cyto1_step05.1137.1137.1	1.4337	0.1586	889.35	1	6430.0%	2	R.SCHTGIGR.S
UGFAP_MOUSE51.5%331.6%430499175.5(P03995) Glial fibrillary acidic protein, astrocyte (GFAP)
	TK050203_NMyc_cyto1_step11.1312.1312.1	1.6512	0.0987	1105.54	3	6430.0%	1	R.QMREQEER.H
UQ9P0T351.5%116.8%147162179.3(Q9P0T3) HSPC190
*	TK050203_NMyc_cyto1_step01.1322.1322.1	1.6654	0.0984	1146.59	1	6000.0%	1	K.SSSPGLYPPLK.E
UQ9CVT451.5%335.6%2142351611.5(Q9CVT4) 1700037B06Rik protein (Fragment)
*	TK050203_NMyc_cyto1_step01.1108.1108.1	1.6516	0.0982	1509.61	1	5000.0%	1	R.FLVLAFPVGCRAR.R
UZ268_HUMAN51.4%110.8%9471083748.9(Q14587) Zinc finger protein 268 (Zinc finger protein HZF3)
*	TK050203_NMyc_cyto1_step03.1668.1668.1	1.5196	0.1101	1127.48	3	5620.0%	1	R.KDQLISHQR.T
UPUR6_MOUSE51.4%332.1%425470707.2(Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)]
*	TK050203_NMyc_cyto1_step03.1300.1300.1	1.5225	0.1066	1147.5	1	6110.0%	1	K.RNPGVQEGYK.F
UHME2_MOUSE51.4%114%324338179.4(P09066) Homeobox protein engrailed-2 (Mo-En-2)
*	TK050203_NMyc_cyto1_step11.1032.1032.1	1.5084	0.1028	1341.36	2	4230.0%	1	K.KPGDPGGSLDGVLK.A
UQ9D3C551.4%117.4%1361374911.6(Q9D3C5) 5830493J20Rik protein
*	TK050203_NMyc_cyto1_step02.1357.1357.1	1.5131	0.1078	1180.92	1	5500.0%	1	R.SAFVVGLGCDR.R
UWDRB_HUMAN51.4%220.6%12241366856.9(Q9BZH6) WD-repeat protein 11
*	TK050203_NMyc_cyto1_step01.0279.0279.1	1.4559	0.1442	732.33	3	5710.0%	1	K.LATATGAK.K
UQ9DBK751.4%331.3%9771086796.0(Q9DBK7) 1300004C08Rik protein
*	TK050203_NMyc_cyto1_step07.3395.3395.1	1.625	0.0922	1447.56	3	4230.0%	1	R.VNGVVAALDSFQAR.H
UQ9H76051.3%2218%200217398.8(Q9H760) Hypothetical protein FLJ21277
*	TK050203_NMyc_cyto1_step02.3662.3662.3	2.6238	0.2369	4232.88	5	1250.0%	1	R.GLNGSSELMWLASPERIPAVYQAWGHSDDQDRPCPHR.H
UQ6202951.3%222.4%628690618.8(Q62029) POLY A binding protein 2 (POLYA binding protein, testis-enriched isoform)
*	TK050203_NMyc_cyto1_step11.3957.3957.2	1.5968	0.3272	1707.96	1	3330.0%	1	R.FGQILSVKVMTDEGGK.S
UAS15_HUMAN51.3%111.8%434483486.4(Q8WXK1) Ankyrin repeat and SOCS box containing protein 15 (ASB-15) (Fragment)
*	TK050203_NMyc_cyto1_step01.2003.2003.1	1.455	0.1466	1015.62	1	6880.0%	1	R.KDIVALLLK.H
UQ9D3F651.3%2215.9%226239856.5(Q9D3F6) 5830413L19Rik protein (MS4A4C protein)
*	TK050203_NMyc_cyto1_step10.2676.2676.3	2.5005	0.3208	3755.14	1	1530.0%	1	K.SLIISSLTLNTITSVLAATASIMGVVSVAVGSQFPFR.Y
USH31_MOUSE51.1%221.6%368415185.7(Q62419) SH3-containing GRB2-like protein 1 (SH3 domain protein 2B) (SH3p8)
	TK050203_NMyc_cyto1_step07.1291.1291.1	1.7782	0.0228	904.5	9	7500.0%	1	K.EIQHHLK.K
UQ9BZF951.1%110.6%14161625797.3(Q9BZF9) Uveal autoantigen
*	TK050203_NMyc_cyto1_step01.4494.4494.1	1.7759	0.0292	1195.87	8	4440.0%	1	R.LKLQNELAHK.V
UQ99J6251.1%113%364398676.7(Q99J62) Similar to replication factor C (Activator 1) 4 (37kD)
*	TK050203_NMyc_cyto1_step06.1837.1837.1	1.7718	0.0065	1487.82	3	5000.0%	1	R.FKPLSDKIQQER.L
USN1L_MOUSE51.1%460.8%779850286.9(Q60670) Probable serine/threonine protein kinase SNF1LK (EC 2.7.1.-) (HRT-20) (Myocardial SNF1-like kinase)
	TK050203_NMyc_cyto1_step01.0138.0138.1	1.7741	0.094	737.41	10	6670.0%	2	K.GNFAVVK.L
UQ8VDQ151.1%119.1%351380545.5(Q8VDQ1) Similar to RIKEN cDNA B830026H24 gene
*	TK050203_NMyc_cyto1_step11.2772.2772.3	2.5566	0.2753	3557.79	1	1560.0%	1	R.CKMNEDTGTDYLAPWQLAQVADGGGIGIVEESK.H
URAG2_MOUSE51.1%114.4%527590745.7(P21784) V(D)J recombination activating protein 2 (RAG-2)
*	TK050203_NMyc_cyto1_step07.2352.2352.2	1.6399	0.2908	2591.13	2	2390.0%	1	K.HSKIWFGSNMGNGTIFLGIPGDNK.Q
UQ9NSJ351.0%550.4%22702563776.0(Q9NSJ3) Hypothetical protein (Fragment)
*	TK050203_NMyc_cyto1_step10.1424.1424.1	1.3963	0.1998	1180.51	2	5620.0%	1	R.ELVHDRFHK.Q
UNETR_MOUSE51.0%353.8%761841188.3(O08762) Neurotrypsin precursor (EC 3.4.21.-) (Motopsin) (Brain-specific serine protease 3) (BSSP-3)
*	TK050203_NMyc_cyto1_step07.2954.2954.3	2.7058	0.125	3424.95	6	1720.0%	2	R.RCGAGESWGNATNLGVPCLHWDEVPPFLER.S
URBL2_HUMAN51.0%572.2%11391283577.4(Q08999) Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (PRB2) (P130) (RBR-2)
*	TK050203_NMyc_cyto1_step11.4275.4275.3	2.7197	0.0723	3065.0	3	2100.0%	1	R.LTGANSDMEEEERGDLIQFYNNIYIK.Q
UQ9GZQ351.0%1117.4%224246707.0(Q9GZQ3) Hypothetical protein FLJ13008 (HT002 protein, hypertension-related calcium-regulated gene)
*	TK050203_NMyc_cyto1_step06.2465.2465.3	2.7036	0.1914	4299.51	7	1220.0%	1	R.LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFR.D
USHH_HUMAN51.0%338.2%462496078.0(Q15465) Sonic hedgehog protein precursor (SHH) (HHG-1)
*	TK050203_NMyc_cyto1_step01.3902.3902.3	2.7164	0.2496	3756.24	10	1380.0%	1	R.LLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALGPR.A
UQ8TAC151.0%2222.9%157177626.8(Q8TAC1) Hypothetical gene supported by XM_059671
*	TK050203_NMyc_cyto1_step06.3586.3586.3	2.7051	0.3212	4395.67	8	1320.0%	1	K.GEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK.Y
UGLP1_HUMAN51.0%4106%463530608.1(P43220) Glucagon-like peptide 1 receptor precursor (GLP-1 receptor) (GLP-1-R) (GLP-1R)
*	TK050203_NMyc_cyto1_step12.3225.3225.3	2.7111	0.0193	3064.07	8	1960.0%	3	R.LALLLLGMVGRAGPRPQGATVSLWETVQK.W
UMLEV_HUMAN50.9%1111.3%194218015.1(P08590) Myosin light chain 1, slow-twitch muscle B/ventricular isoform (MLC1SB) (Alkali)
*	TK050203_NMyc_cyto1_step01.0148.0148.2	1.6741	0.2752	2429.88	4	2500.0%	1	K.AAPAPAPPPEPERPKEVEFDASK.I
UQ96NJ650.9%333.4%502576627.3(Q96NJ6) Hypothetical protein FLJ30726
*	TK050203_NMyc_cyto1_step05.2721.2721.2	1.6779	0.2806	2122.67	2	2650.0%	1	R.HLRIHAGEKPFACNECGK.A
UAAC4_MOUSE50.9%681.2%9121049775.4(P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein)
	TK050203_NMyc_cyto1_step03.1656.1656.1	1.4527	0.1507	1395.73	1	4550.0%	1	K.EAQRIAESNHIK.L
UQ9GZW250.8%2223.8%130136827.0(Q9GZW2) Hypothetical protein FLJ23544
*	TK050203_NMyc_cyto1_step11.2928.2928.2	1.5702	0.334	3153.41	1	1770.0%	1	K.GSPGKTGAAASCVLQGAPDAFPLGLEVDLVPR.A
UPRDG_HUMAN50.7%661.3%12761403736.2(Q9HAZ2) PR-domain zinc finger protein 16
	TK050203_NMyc_cyto1_step05.2794.2794.2	1.5926	0.3175	2244.1	1	2940.0%	1	R.FECENCVKVFTDPSNLQR.H
UQ9QUS350.7%5170.5%12171415557.2(Q9QUS3) BAMACAN
	TK050203_NMyc_cyto1_step02.1996.1996.1	1.5	0.1137	780.81	3	6670.0%	4	R.QIAAIHK.D
UKIT_HUMAN50.7%663.8%9761098647.0(P10721) Mast/stem cell growth factor receptor precursor (EC 2.7.1.112) (SCFR) (Proto-oncogene tyrosine-protein kinase Kit) (c-kit) (CD117 antigen)
*	TK050203_NMyc_cyto1_step07.3564.3564.3	2.6419	0.2312	4030.32	1	1490.0%	1	R.GAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGK.S
UBMP5_MOUSE50.7%226.9%452515128.9(P49003) Bone morphogenetic protein 5 precursor (BMP-5)
*	TK050203_NMyc_cyto1_step05.2791.2791.3	2.6281	0.2352	3508.45	4	1610.0%	1	R.GIVGFLWSGWVQVGYAKGGLGDNHVHSSFIYR.R
UQ9D2E050.7%111.5%660742399.5(Q9D2E0) 2310005B10Rik protein
*	TK050203_NMyc_cyto1_step01.1666.1666.1	1.7213	0.0283	1150.65	4	5500.0%	1	R.KMANDAGPDTK.K
UQ9R00450.7%551.4%657730228.5(Q9R004) Breast cancer resistance protein 1
*	TK050203_NMyc_cyto1_step03.1854.1854.1	1.4953	0.1081	1200.52	3	6110.0%	1	R.LPTTMKNHEK.N
UDDB2_HUMAN50.7%332.3%427478649.5(Q92466) DNA damage binding protein 2 (Damage-specific DNA binding protein 2) (DDB p48 subunit) (DDBb) (UV-damaged DNA-binding protein 2) (UV-DDB 2)
*	TK050203_NMyc_cyto1_step01.2494.2494.1	1.4961	0.1086	1314.07	3	4500.0%	1	K.TSEIVLRPRNK.R
UQ1566250.7%226.8%368420299.1(Q15662) Transformation-related protein (Fragment)
*	TK050203_NMyc_cyto1_step07.3159.3159.2	1.5968	0.3135	3108.31	1	2400.0%	1	R.GVIVDNFLLHPDGRFTWTIFFLSWVK.Q
UQ8VDC150.6%330.6%14371623365.0(Q8VDC1) FYVE and coiled-coil domain containing 1
*	TK050203_NMyc_cyto1_step08.1284.1284.1	1.4796	0.1209	1187.58	3	5000.0%	1	K.TANEECGHLR.A
UQ99N5450.6%111.6%607685689.4(Q99N54) Synaptotagmin-like protein 3-a
*	TK050203_NMyc_cyto1_step05.2298.2298.1	1.4756	0.1213	1430.09	2	5000.0%	1	K.CTVCFEDRNVK.I
UM3K2_HUMAN50.6%243.1%618695388.3(Q9Y2U5) Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.1.-) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2)
*	TK050203_NMyc_cyto1_step06.2617.2617.2	1.7834	0.2525	2481.95	3	2890.0%	2	K.YTRQILEGVHYLHSNMILHR.D
UEAR2_HUMAN50.5%119.2%403429007.8(P10588) Orphan nuclear receptor EAR-2 (V-erbA related protein EAR-2)
*	TK050203_NMyc_cyto1_step02.3417.3417.3	2.43	0.3657	3912.49	1	1760.0%	1	R.MSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAER.A
UCYH1_MOUSE50.5%241.5%398462885.6(Q9QX11) Cytohesin 1 (CLM1)
	TK050203_NMyc_cyto1_step06.2010.2010.1	1.7275	0.0396	985.59	1	6670.0%	2	R.QFLWSFR.L
UQ9BTR050.4%2419.4%3639117.3(Q9BTR0) Hypothetical protein
*	TK050203_NMyc_cyto1_step02.2529.2529.1	1.3585	0.2244	883.49	1	6430.0%	2	R.RGILPGLR.-
UBMP4_MOUSE50.4%463.9%408464978.2(P21275) Bone morphogenetic protein 4 precursor (BMP-4) (BMP-2B)
	TK050203_NMyc_cyto1_step11.3181.3181.2	1.7053	0.2583	2044.81	1	3750.0%	2	K.VVLKNYQEMVVEGCGCR.-
UGNL1_MOUSE50.4%334.7%430475414.9(P36916) Guanine nucleotide-binding protein-like 1 (GTP-binding protein MMR1)
	TK050203_NMyc_cyto1_step02.2804.2804.2	1.6996	0.264	2301.36	1	2750.0%	1	-.MEAAVAVLEMSDIVLLITDIR.H
UQ8VGQ450.4%117.4%309356008.3(Q8VGQ4) Olfactory receptor MOR184-7
*	TK050203_NMyc_cyto1_step06.2781.2781.2	1.7027	0.2659	2755.59	3	1960.0%	1	-.MTEDNYSLATEFILIGFSDHPDLK.T
UQ9R1J150.3%441.1%792890947.4(Q9R1J1) Serine/threonine-protein kinase NEK4
	TK050203_NMyc_cyto1_step01.1347.1347.1	1.3688	0.2083	1160.58	1	5560.0%	1	R.EGKSHTNEMK.D
UCGD3_MOUSE50.2%5252.7%292324116.5(P30282) G1/S-specific cyclin D3
*	TK050203_NMyc_cyto1_step11.2327.2327.1	1.72	0.0648	1074.56	1	5620.0%	5	R.EWEVLVLGK.L
UQ99LJ750.2%110.7%551601645.5(Q99LJ7) Similar to chromosome condensation 1-like
	TK050203_NMyc_cyto1_step01.0775.0775.1	1.3936	0.1834	521.33	1	8750.0%	1	R.VGAFK.N
URN14_HUMAN50.1%226.1%474538374.8(Q9UBS8) RING finger protein 14 (Androgen receptor-associated protein 54) (Triad2 protein) (HFB30)
*	TK050203_NMyc_cyto1_step06.2814.2814.3	2.547	0.2732	3615.31	2	1640.0%	1	K.HFNDPGSPCFNRLFYAVDVDDDIWEDEVED.-
UHB2D_MOUSE50.1%114.5%265299547.8(P01921) H-2 class II histocompatibility antigen, A-D beta chain precursor
*	TK050203_NMyc_cyto1_step07.2032.2032.1	1.7442	0.1008	1489.56	6	3750.0%	1	R.HNYEGPETSTSLR.R
UQ9BZ6650.1%6262.2%504558178.6(Q9BZ66) Cytochrome P450 2S1
	TK050203_NMyc_cyto1_step11.4216.4216.1	1.7342	0.2989	1375.66	8	3640.0%	5	R.KHEAFLPFSLGK.R
UQ8VHE650.1%10100.1%46215275086.1(Q8VHE6) Axonemal dynein heavy chain 5
	TK050203_NMyc_cyto1_step01.1979.1979.1	1.7406	0.2038	808.56	7	6670.0%	1	K.ITSLFVK.V
UQ9H0P050.1%332.7%336379487.1(Q9H0P0) Hypothetical protein
*	TK050203_NMyc_cyto1_step01.1598.1598.1	1.7303	0.0468	1267.45	9	6110.0%	1	K.IIEMMPEFQK.S
ProteinsPeptide IDsCopies
Unfiltered178243356133924
Filtered1153272028865