WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'E04F12_F12_12.ab1' (602 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 3 Sequences : less than 3 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 915 168 |======================================================== 6310 747 170 |======================================================== 3980 577 140 |============================================== 2510 437 149 |================================================= 1580 288 101 |================================= 1000 187 72 |======================== 631 115 43 |============== 398 72 16 |===== 251 56 18 |====== 158 38 8 |== 100 30 9 |=== 63.1 21 3 |= 39.8 18 2 |: 25.1 16 3 |= 15.8 13 1 |: >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 12 <<<<<<<<<<<<<<<<< 10.0 12 1 |: 6.31 11 0 | 3.98 11 0 | 2.51 11 0 | 1.58 11 0 | 1.00 11 0 | 0.63 11 0 | 0.40 11 0 | 0.25 11 0 | 0.16 11 0 | 0.10 11 0 | 0.063 11 0 | 0.040 11 0 | 0.025 11 0 | 0.016 11 0 | 0.010 11 0 | 0.0063 11 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|12407755|gb|AAG53638.1|AF291714_1(AF291714) initia... +1 305 3.6e-26 1 gi|6685535|sp|P56820|IF37_ARATHPUTATIVE EUKARYOTIC TR... +1 305 1.9e-25 1 gi|10176887|dbj|BAB10117.1|(AB011475) eukaryotic tran... +1 302 4.0e-25 1 gi|4503523ref|NP_003744.1| eukaryotic translation ini... +1 138 2.1e-06 1 gi|9055214ref|NP_061219.1| eIF3 p66 [Mus musculus] >g... +1 134 8.8e-06 1 gi|7299570|gb|AAF54756.1|(AE003694) CG4810 gene produ... +1 126 0.00011 1 gi|7141239|gb|AAF37264.1|AF220363_1(AF220363) eukaryo... +1 126 0.00011 1 gi|7301022|gb|AAF56158.1|(AE003744) eIF-3p66 gene pro... +1 126 0.00011 1 gi|7492557|pir||T38999probable elongation initation f... +1 122 0.00035 1 gi|6685653|sp|O94236|MOE1_SCHPOMICROTUBULE DESTABILIZ... +1 122 0.00035 1 gi|267549|sp|P30642|IF37_CAEELPUTATIVE EUKARYOTIC TRA... +1 112 0.0060 1 gi|8843986|gb|AAF80206.1|AF282853_5(AF282853) CagP [H... +3 71 0.9999 1
Use the
and
icons to retrieve links to Entrez:
>gi|12407755|gb|AAG53638.1|AF291714_1 (AF291714) initiation factor 3d [Arabidopsis thaliana] Length = 418 Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 418 0 150 300 Plus Strand HSPs: Score = 305 (107.4 bits), Expect = 3.6e-26, P = 3.6e-26 Identities = 59/76 (77%), Positives = 64/76 (84%), Frame = +1 Query: 28 SIVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPEDEQVQPPSEGAEGG 207 SIVDLCMKL+EGKYVLVKDPSKPQVRIYEVP DAFENDYVEEPLPEDEQVQP E EG Sbjct: 339 SIVDLCMKLSEGKYVLVKDPSKPQVRIYEVPPDAFENDYVEEPLPEDEQVQPTEENTEGA 398 Query: 208 EATTT-TNDVEDKQID 252 EA+ T + E+K+ D Sbjct: 399 EASVAATKETEEKKAD 414
>gi|6685535|sp|P56820|IF37_ARATH PUTATIVE EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 7 (EIF-3 ZETA) >gi|7486971|pir||T10640 hypothetical protein T13K14.140 - Arabidopsis thaliana >gi|5262788|emb|CAB45893.1| (AL080282) translation initiation factor eIF3-like protein [Arabidopsis thaliana] >gi|7268895|emb|CAB79098.1| (AL161554) translation initiation factor eIF3-like protein [Arabidopsis thaliana] Length = 591 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 591 0 150 300 450 Plus Strand HSPs: Score = 305 (107.4 bits), Expect = 1.9e-25, P = 1.9e-25 Identities = 59/76 (77%), Positives = 64/76 (84%), Frame = +1 Query: 28 SIVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPEDEQVQPPSEGAEGG 207 SIVDLCMKL+EGKYVLVKDPSKPQVRIYEVP DAFENDYVEEPLPEDEQVQP E EG Sbjct: 512 SIVDLCMKLSEGKYVLVKDPSKPQVRIYEVPPDAFENDYVEEPLPEDEQVQPTEENTEGA 571 Query: 208 EATTT-TNDVEDKQID 252 EA+ T + E+K+ D Sbjct: 572 EASVAATKETEEKKAD 587
>gi|10176887|dbj|BAB10117.1| (AB011475) eukaryotic translation initiation factor 3 subunit 7 [Arabidopsis thaliana] Length = 588 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 588 0 150 300 450 Plus Strand HSPs: Score = 302 (106.3 bits), Expect = 4.0e-25, P = 4.0e-25 Identities = 61/82 (74%), Positives = 69/82 (84%), Frame = +1 Query: 28 SIVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPEDEQVQPPSEGAEGG 207 SIVDLCMKL+EGKYVLVKDPSKPQVRIYEVPADAF+NDYVEEPLPEDEQVQPP E + G Sbjct: 507 SIVDLCMKLSEGKYVLVKDPSKPQVRIYEVPADAFDNDYVEEPLPEDEQVQPPEENTDAG 566 Query: 208 EAT---TTTN-DVEDKQIDGQA 261 T ++TN VEDK+ + +A Sbjct: 567 AETNGVSSTNVAVEDKKSEVEA 588
>gi|4503523 ref|NP_003744.1| eukaryotic translation initiation factor 3, subunit 7 (zeta, 66/67kD) [Homo sapiens] >gi|11418048 ref|XP_009954.1| eukaryotic translation initiation factor 3, subunit 7 (zeta, 66/67kD) [Homo sapiens] >gi|6685526|sp|O15371|IF37_HUMAN EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 7 (EIF-3 ZETA) (EIF3 P66) >gi|2351378|gb|AAD03466.1| (U54558) translation initiation factor eIF3 p66 subunit [Homo sapiens] >gi|4200328|emb|CAA18440.1| (AL022313) dJ1119A7.2 (eukaryotic translation initiation factor 3, subunit 7 (zeta, 66/67kD) (EIF3-P66)) [Homo sapiens] >gi|12653123|gb|AAH00328.1|AAH00328 (BC000328) eukaryotic translation initiation factor 3, subunit 7 (zeta, 66/67kD) [Homo sapiens] >gi|12653399|gb|AAH00469.1|AAH00469 (BC000469) eukaryotic translation initiation factor 3, subunit 7 (zeta, 66/67kD) [Homo sapiens] Length = 548 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 548 0 150 300 450 Plus Strand HSPs: Score = 138 (48.6 bits), Expect = 2.1e-06, P = 2.1e-06 Identities = 23/54 (42%), Positives = 37/54 (68%), Frame = +1 Query: 31 IVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPEDEQVQPPSE 192 ++D+CMKL EGKY+++KDP+K +R+Y +P F +D EE E+E+ + E Sbjct: 494 VIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEE 547
>gi|9055214 ref|NP_061219.1| eIF3 p66 [Mus musculus] >gi|6685529|sp|O70194|IF37_MOUSE EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 7 (EIF-3 ZETA) (EIF3 P66) >gi|2992164|dbj|BAA25327.1| (AB012580) eIF3 p66 [Mus musculus] Length = 547 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 547 0 150 300 450 Plus Strand HSPs: Score = 134 (47.2 bits), Expect = 8.8e-06, P = 8.8e-06 Identities = 22/54 (40%), Positives = 37/54 (68%), Frame = +1 Query: 31 IVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPEDEQVQPPSE 192 ++D+CMKL EGKY+++KDP+K +R+Y +P F ++ EE E+E+ + E Sbjct: 493 VIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSEEDEEDEEEEEEEEEEEE 546
>gi|7299570|gb|AAF54756.1| (AE003694) CG4810 gene product [Drosophila melanogaster] Length = 551 Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 551 0 150 300 450 Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 0.00011, P = 0.00011 Identities = 21/46 (45%), Positives = 35/46 (76%), Frame = +1 Query: 31 IVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPED 168 ++DL M+ +GKY+++KDP+KP +R+Y+VP +AF++D EE D Sbjct: 498 LIDLVMRQPDGKYLIMKDPNKPMIRLYDVPENAFDSDGDEEEESSD 543
>gi|7141239|gb|AAF37264.1|AF220363_1 (AF220363) eukaryotic translation initiation factor 3 p66 subunit [Drosophila melanogaster] Length = 560 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 560 0 150 300 450 Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 0.00011, P = 0.00011 Identities = 21/50 (42%), Positives = 37/50 (74%), Frame = +1 Query: 31 IVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPEDEQVQ 180 I+DL MK +GKY+++KDP+KP +R+Y++P + F++D ++ +DE Q Sbjct: 501 IIDLVMKQKDGKYLIMKDPNKPIIRLYDIPDNTFDSDDSDDGEGDDEGFQ 550
>gi|7301022|gb|AAF56158.1| (AE003744) eIF-3p66 gene product [Drosophila melanogaster] Length = 560 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 560 0 150 300 450 Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 0.00011, P = 0.00011 Identities = 21/50 (42%), Positives = 37/50 (74%), Frame = +1 Query: 31 IVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYVEEPLPEDEQVQ 180 I+DL MK +GKY+++KDP+KP +R+Y++P + F++D ++ +DE Q Sbjct: 501 IIDLVMKQKDGKYLIMKDPNKPIIRLYDIPDNTFDSDDSDDGEGDDEGFQ 550
>gi|7492557|pir||T38999 probable elongation initation factor subunit - fission yeast (Schizosaccharomyces pombe) >gi|4056551|emb|CAA22586.1| (AL034583) elongation initation factor subunit; negative regulator moe1.; microtubule destabilising protein [Schizosaccharomyces pombe] Length = 567 Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 567 0 150 300 450 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 0.00035, P = 0.00035 Identities = 20/36 (55%), Positives = 30/36 (83%), Frame = +1 Query: 28 SIVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFE 135 +I D+C+K+ +GKYVLVKDP++P +R+Y VP + FE Sbjct: 519 TIADVCLKMPDGKYVLVKDPNRPILRLYSVPPNTFE 554
>gi|6685653|sp|O94236|MOE1_SCHPO MICROTUBULE DESTABILIZING PROTEIN MOE1 >gi|11281983|pir||T43555 Ras pathway interacting protein Moe1 - fission yeast (Schizosaccharomyces pombe) >gi|4176721|gb|AAD08893.1| (AF038568) negative regulator Moe1 [Schizosaccharomyces pombe] Length = 567 Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 567 0 150 300 450 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 0.00035, P = 0.00035 Identities = 20/36 (55%), Positives = 30/36 (83%), Frame = +1 Query: 28 SIVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFE 135 +I D+C+K+ +GKYVLVKDP++P +R+Y VP + FE Sbjct: 519 TIADVCLKMPDGKYVLVKDPNRPILRLYSVPPNTFE 554
>gi|267549|sp|P30642|IF37_CAEEL PUTATIVE EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 7 (EIF-3 ZETA) >gi|102510|pir||S24459 hypothetical protein R08D7.3 - Caenorhabditis elegans >gi|3878936|emb|CAA78049.1| (Z12017) predicted using Genefinder~cDNA EST yk105g8.3 comes from this gene~cDNA EST yk105g8.5 comes from this gene~cDNA EST yk152a2.3 comes from this gene~cDNA EST yk152a2.5 comes from this gene~cDNA EST yk490b3.3 comes from this gene~cDNA EST yk490b3> Length = 570 Frame 1 hits (HSPs): _____ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 570 0 150 300 450 __________________ Annotated Domains: PRODOM PD025385: O15371(1) O70194(1) YNE3(1) 3..555 __________________ Plus Strand HSPs: Score = 112 (39.4 bits), Expect = 0.0060, P = 0.0060 Identities = 20/50 (40%), Positives = 32/50 (64%), Frame = +1 Query: 31 IVDLCMKLNEGKYVLVKDPSKPQVRIYEVPADAFENDYV--EEPLPEDEQ 174 ++D CMK GKY+L+KDP P +R+Y +P FE++ +E +D+Q Sbjct: 521 VIDSCMKQKPGKYLLMKDPQSPVIRLYSLPEGTFESERESSDEENSDDDQ 570
>gi|8843986|gb|AAF80206.1|AF282853_5 (AF282853) CagP [Helicobacter pylori] Length = 110 Frame 3 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | | | 110 0 20 40 60 80 100 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 8.8, P = 1.0 Identities = 24/61 (39%), Positives = 32/61 (52%), Frame = +3 Query: 399 LKQNFLVFFFYATAVYDLQTLAY-LSGTTKAVISFKIVLRSFGLRVIIVVYKFPCLHRVI 575 LKQNFL F + D +L Y L + VI F I L S+G VI+V Y L +I Sbjct: 4 LKQNFLQFKYSFNKHLDKYSLYYRLFNISSIVIGFLIGLFSYGAGVILV-YPILFLFALI 62 Query: 576 LR 581 ++ Sbjct: 63 IK 64 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.98 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.359 0.162 0.621 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.355 0.156 0.536 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.344 0.156 0.525 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.355 0.156 0.576 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.348 0.154 0.519 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.355 0.156 0.560 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 200 198 10. 76 3 12 22 0.093 35 31 0.10 38 +2 0 200 199 10. 77 3 12 22 0.093 35 31 0.10 38 +1 0 200 199 10. 77 3 12 22 0.093 35 31 0.10 38 -1 0 200 198 10. 76 3 12 22 0.093 35 31 0.10 38 -2 0 200 198 10. 76 3 12 22 0.093 35 31 0.10 38 -3 0 200 199 10. 77 3 12 22 0.093 35 31 0.10 38 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 12 No. of states in DFA: 595 (59 KB) Total size of DFA: 223 KB (256 KB) Time to generate neighborhood: 0.02u 0.00s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 198.73u 1.22s 199.95t Elapsed: 00:00:34 Total cpu time: 198.76u 1.24s 200.00t Elapsed: 00:00:34 Start: Fri Jan 18 12:48:14 2002 End: Fri Jan 18 12:48:48 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000