WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A01A22_CONSENSUS (597 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 4 Sequences : less than 4 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1090 205 |=================================================== 6310 885 161 |======================================== 3980 724 156 |======================================= 2510 568 152 |====================================== 1580 416 142 |=================================== 1000 274 80 |==================== 631 194 35 |======== 398 159 34 |======== 251 125 16 |==== 158 109 27 |====== 100 82 13 |=== 63.1 69 6 |= 39.8 63 6 |= 25.1 57 5 |= 15.8 52 4 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 48 <<<<<<<<<<<<<<<<< 10.0 48 2 |: 6.31 46 5 |= 3.98 41 1 |: 2.51 40 1 |: 1.58 39 3 |: 1.00 36 1 |: 0.63 35 1 |: 0.40 34 0 | 0.25 34 1 |: 0.16 33 0 | 0.10 33 1 |: 0.063 32 4 |= 0.040 28 0 | 0.025 28 3 |: 0.016 25 2 |: 0.010 23 0 | 0.0063 23 1 |: 0.0040 22 1 |: 0.0025 21 2 |: 0.0016 19 3 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|7435657|pir||T07171subtilisin-like proteinase (EC ... +3 313 1.3e-29 2 gi|3176874|gb|AAC18851.1|(AF065639) cucumisin-like se... +3 217 1.2e-19 2 gi|1076414|pir||S52770subtilisin-like proteinase (EC ... +3 215 1.9e-19 2 gi|9759234|dbj|BAB09758.1|(AB016890) serine protease-... +3 144 6.6e-08 1 gi|9759233|dbj|BAB09757.1|(AB016890) contains similar... +3 131 9.8e-08 1 gi|8570441|gb|AAF76468.1|AC020622_2(AC020622) Contain... +3 138 1.8e-06 1 gi|10177636|dbj|BAB10784.1|(AB024027) subtilisin-like... +3 135 6.4e-06 1 gi|6688548|emb|CAB65690.1|(AJ270956) subtilisin-like ... +3 108 3.8e-05 1 gi|9759235|dbj|BAB09759.1|(AB016890) serine protease-... +3 127 8.6e-05 1 gi|9759217|dbj|BAB09629.1|(AB016885) subtilisin-like ... +3 126 0.00012 1 gi|7488080|pir||H71413probable cucumisin - Arabidopsi... +3 122 0.00020 1 gi|4006827|gb|AAC95169.1|(AC005970) putative serine p... +3 114 0.00034 2 gi|5302780|emb|CAB46058.1|(Z97337) cucumisin [Arabido... +3 122 0.00039 1 gi|11994380|dbj|BAB02339.1|(AB019229) cucumisin-like ... +3 119 0.00049 2 gi|9759215|dbj|BAB09627.1|(AB016885) subtilisin-like ... +3 121 0.00050 1 gi|7435664|pir||T12963subtilisin homolog T6H20.120 - ... +3 121 0.00056 1 gi|9759214|dbj|BAB09626.1|(AB016885) subtilisin-like ... +3 118 0.0013 1 gi|3413481|emb|CAA07250.1|(AJ006786) serine protease ... +3 118 0.0014 1 gi|7435682|pir||T14845antifreeze-like protein (af70) ... +3 118 0.0015 1 gi|7435665|pir||T12964subtilisin homolog T6H20.130 - ... +3 117 0.0018 1 gi|7435662|pir||T07184subtilisin-like proteinase (EC ... +3 117 0.0018 1 gi|9759216|dbj|BAB09628.1|(AB016885) subtilisin-like ... +3 115 0.0031 1 gi|9759240|dbj|BAB09764.1|(AB016890) serine protease-... +3 114 0.0042 1 gi|1086249|pir||S52769subtilisin-like proteinase ag12... +3 104 0.011 2 gi|6723681|emb|CAB67119.1|(Y18931) subtilisin-like pr... +3 110 0.013 1 gi|7435661|pir||T06580subtilisin-like proteinase (EC ... +3 109 0.017 1 gi|4200340|emb|CAA76727.1|(Y17278) P69D protein [Lyco... +3 109 0.017 1 gi|3970731|emb|CAA07059.1|(AJ006480) SBT4B protein [L... +3 109 0.018 1 gi|9757901|dbj|BAB08348.1|(AB015475) serine protease-... +3 106 0.040 1 gi|7435656|pir||T07172subtilisin-like proteinase (EC ... +3 95 0.043 2 gi|3970733|emb|CAA07060.1|(AJ006481) SBT4C protein [L... +3 102 0.049 2 gi|7435655|pir||T07170subtilisin-like proteinase (EC ... +3 105 0.053 1 gi|7435654|pir||T07169subtilisin-like proteinase (EC ... +3 104 0.068 1 gi|7428210|pir||A55800cucumisin (EC 3.4.21.25) precur... +3 100 0.18 1 gi|3970757|emb|CAA07062.1|(AJ006483) SBT4E protein [L... +3 96 0.46 1 gi|7435672|pir||T06017subtilisin-like proteinase homo... +3 95 0.54 1 gi|4218991|gb|AAD12260.1|(AF098632) subtilisin-like p... +3 94 0.65 1 gi|10177874|dbj|BAB11244.1|(AB010074) serine protease... +3 93 0.71 2 gi|10177637|dbj|BAB10785.1|(AB024027) serine protease... +3 93 0.72 1 gi|9294050|dbj|BAB02007.1|(AB020746) protein kinase-l... -1 90 0.92 1 gi|106685|pir||S24710Ig alpha chain - human >gi|28568... -1 65 0.95 1 gi|7435675|pir||T01351subtilisin-like proteinase homo... +3 88 0.99 1 gi|6708179|gb|AAF25830.1|AF190794_1(AF190794) subtili... +3 88 0.993 1 gi|106688|pir||S24709Ig alpha chain - human >gi|28566... -1 63 0.994 1 gi|106687|pir||S24711Ig alpha chain - human >gi|28570... -1 63 0.994 1 gi|106367|pir||S08352Ig alpha chain precursor - human... -1 63 0.994 1 gi|1711284|dbj|BAA13994.1|(D89609) choriogenin H [Ory... -1 85 0.9997 1 gi|11265104|pir||T48553subtilisin-like proteinase hom... +3 86 0.9998 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|7435657 |___________________________ gi|3176874 |___________________________ gi|1076414 |___________________________ gi|9759234 | __________________________ gi|9759233 | __________________________ gi|8570441 | _________________________ gi|10177636 | __________________________ gi|6688548 | ____________________________ gi|9759235 | __________________________ gi|9759217 | __________________________ gi|7488080 | __________________________ gi|4006827 | _________________________ gi|5302780 | __________________________ gi|11994380 | __________________________ gi|9759215 | __________________________ gi|7435664 | __________________________ gi|9759214 | __________________________ gi|3413481 | _________________________ gi|7435682 | __________________________ gi|7435665 | __________________________ gi|7435662 | _________________________ gi|9759216 | __________________________ gi|9759240 | __________________________ gi|1086249 | __________________________ gi|6723681 | ________________________ gi|7435661 | _________________________ gi|4200340 | _________________________ gi|3970731 | __________________________ gi|9757901 | __________________________ gi|7435656 | __________________________ gi|3970733 | __________________________ gi|7435655 | __________________________ gi|7435654 | __________________________ gi|7428210 | __________________________ gi|3970757 | __________________________ gi|7435672 |___________________________ gi|4218991 | __________________________ gi|10177874 | ___________________ gi|10177637 | ___________________ gi|7435675 | _________________________ gi|6708179 | _________________________ gi|11265104 | ___________________ Prosite Hits: __ __________________________________________________ Query sequence: | | | | | 199 0 50 100 150 __________________ Prosite hits: TYR_PHOSPHO_SITE Tyrosine kinase phosphorylation site. 5..11 __________________ Locus_ID Frame 1 Hits gi|7435657 | ____ gi|3176874 | ____ gi|1076414 | ____ gi|4006827 | ____ gi|11994380 | ____ gi|1086249 | ______ gi|7435656 | ______ gi|3970733 | ________ gi|10177874 | ______ __________________________________________________ Query sequence: | | | | | 199 0 50 100 150 Locus_ID Frame -1 Hits gi|9294050 | gi|106685 | _____________ gi|106688 | ___________ gi|106687 | ________ gi|106367 | ________ gi|1711284 | __________________________________________________ Query sequence: | | | | | 199 0 50 100 150
Use the and icons to retrieve links to Entrez:
>gi|7435657|pir||T07171 subtilisin-like proteinase (EC 3.4.21.-) 1 - tomato >gi|1771160|emb|CAA67429.1| (X98929) SBT1 [Lycopersicon esculentum] >gi|3687305|emb|CAA06999.1| (AJ006378) subtilisin-like protease [Lycopersicon esculentum] Length = 766 Frame 3 hits (HSPs): ________ Frame 1 hits (HSPs): _ __________________________________________________ Database sequence: | | | | | | | 766 0 150 300 450 600 750 Plus Strand HSPs: Score = 313 (110.2 bits), Expect = 1.3e-29, Sum P(2) = 1.3e-29 Identities = 63/105 (60%), Positives = 76/105 (72%), Frame = +3 Query: 6 KDYRVEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKASVMSLGDSNV 185 K+YRV D NYPSF++PM+TA G S T +Y+R LTNVG P TYKASV S +V Sbjct: 651 KEYRVADLNYPSFSIPMETAWGEHADSSTPTVTRYTRTLTNVGNPATYKASVSS-ETQDV 709 Query: 186 KTVVEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDGK 320 K +VEP TL+F+ KK YTV+FT TS PSGTTSFARLEW+DG+ Sbjct: 710 KILVEPQTLTFSRKNEKKTYTVTFTATSKPSGTTSFARLEWSDGQ 754 Score = 59 (20.8 bits), Expect = 1.3e-29, Sum P(2) = 1.3e-29 Identities = 10/14 (71%), Positives = 12/14 (85%), Frame = +1 Query: 316 GKHKVGTPIAFSWT 357 G+H V +PIAFSWT Sbjct: 753 GQHVVASPIAFSWT 766 >gi|3176874|gb|AAC18851.1| (AF065639) cucumisin-like serine protease [Arabidopsis thaliana] >gi|9758435|dbj|BAB09021.1| (AB007645) cucumisin-like serine protease [Arabidopsis thaliana] Length = 757 Frame 3 hits (HSPs): ________ Frame 1 hits (HSPs): _ __________________________________________________ Database sequence: | | | | | || 757 0 150 300 450 600 750 Plus Strand HSPs: Score = 217 (76.4 bits), Expect = 1.2e-19, Sum P(2) = 1.2e-19 Identities = 51/105 (48%), Positives = 63/105 (60%), Frame = +3 Query: 6 KDYRVEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKASVMSLGDSNV 185 K Y V D NYPSFAV +D G+G KY+R +T+VG GTY V S + V Sbjct: 651 KSYSVADLNYPSFAVNVD---GVGA-------YKYTRTVTSVGGAGTYSVKVTS-ETTGV 699 Query: 186 KTVVEPNTLSFTELYXKKDYTVSFTY-TSMPSGTTSFARLEWTDGK 320 K VEP L+F E KK YTV+FT +S PSG+ SF +EW+DGK Sbjct: 700 KISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGK 745 Score = 62 (21.8 bits), Expect = 1.2e-19, Sum P(2) = 1.2e-19 Identities = 10/14 (71%), Positives = 12/14 (85%), Frame = +1 Query: 316 GKHKVGTPIAFSWT 357 GKH VG+P+A SWT Sbjct: 744 GKHVVGSPVAISWT 757 >gi|1076414|pir||S52770 subtilisin-like proteinase (EC 3.4.21.-), nodule-specific - Arabidopsis thaliana (fragment) >gi|757534|emb|CAA59963.1| (X85974) subtilisin-like protease [Arabidopsis thaliana] Length = 746 Frame 3 hits (HSPs): ________ Frame 1 hits (HSPs): _ Annotated Domains: __ __ __________________________________________________ Database sequence: | | | | | | 746 0 150 300 450 600 __________________ Annotated Domains: PROSITE AA_TRNA_LIGASE_II_1: Aminoacyl-transfer 92..108 PROSITE SUBTILASE_SER: Serine proteases, subtila 529..539 __________________ Plus Strand HSPs: Score = 215 (75.7 bits), Expect = 1.9e-19, Sum P(2) = 1.9e-19 Identities = 51/105 (48%), Positives = 63/105 (60%), Frame = +3 Query: 6 KDYRVEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKASVMSLGDSNV 185 K Y V D NYPSFAV +D G G+ KY+R +T+VG GTY V S + V Sbjct: 640 KSYSVADLNYPSFAVNVD-----GAGA-----YKYTRTVTSVGGAGTYSVKVTS-ETTGV 688 Query: 186 KTVVEPNTLSFTELYXKKDYTVSFTY-TSMPSGTTSFARLEWTDGK 320 K VEP L+F E KK YTV+FT +S PSG+ SF +EW+DGK Sbjct: 689 KISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGK 734 Score = 62 (21.8 bits), Expect = 1.9e-19, Sum P(2) = 1.9e-19 Identities = 10/14 (71%), Positives = 12/14 (85%), Frame = +1 Query: 316 GKHKVGTPIAFSWT 357 GKH VG+P+A SWT Sbjct: 733 GKHVVGSPVAISWT 746 >gi|9759234|dbj|BAB09758.1| (AB016890) serine protease-like protein [Arabidopsis thaliana] Length = 732 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 732 0 150 300 450 600 Plus Strand HSPs: Score = 144 (50.7 bits), Expect = 6.6e-08, P = 6.6e-08 Identities = 35/98 (35%), Positives = 54/98 (55%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + + GS T TV ++R LTNVG P TY + V++ S + + Sbjct: 626 NLNYPSMSAKLS-------GSGTTFTVTFNRTLTNVGTPNSTYTSKVVAGHGSKLDVKIT 678 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ LSF + K+ +TV+ T +++ S S A L W+DG Sbjct: 679 PSVLSFKTVNEKQSFTVTVTGSNLDSEVPSSANLIWSDG 717 >gi|9759233|dbj|BAB09757.1| (AB016890) contains similarity to serine protease~gene_id:MNC17.2 [Arabidopsis thaliana] Length = 172 Frame 3 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 Plus Strand HSPs: Score = 131 (46.1 bits), Expect = 9.8e-08, P = 9.8e-08 Identities = 34/98 (34%), Positives = 51/98 (52%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + + S++ TV ++R +TNVG P TYK+ V+ S + V Sbjct: 65 NLNYPSMSAQLRR-------SESSLTVTFNRTVTNVGTPNSTYKSKVVLNQGSKLNVKVT 117 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ LSF + KK +TV+ T + S A L W+DG Sbjct: 118 PSVLSFKTVSEKKSFTVTVTGSDSDPKLPSSANLIWSDG 156 >gi|8570441|gb|AAF76468.1|AC020622_2 (AC020622) Contains similarity to p69d gene from Lycopersicon esculentum gb|Y17278 and contains a Peptidase S8 PF|00082 domain. [Arabidopsis thaliana] Length = 756 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | || 756 0 150 300 450 600 750 Plus Strand HSPs: Score = 138 (48.6 bits), Expect = 1.8e-06, P = 1.8e-06 Identities = 38/95 (40%), Positives = 51/95 (53%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKASVMSLGDSNVKTVVEP 203 D NYPSFAV + + G + LKTV+Y R +TNVG+P T + V VK VEP Sbjct: 653 DLNYPSFAVNL-----VNGAN--LKTVRYKRTVTNVGSP-TCEYMVHVEEPKGVKVRVEP 704 Query: 204 NTLSFTELYXKKDYTVSF-TYTSMPSGTTSFARLEW 308 L F + + YTV++ S S ++SF L W Sbjct: 705 KVLKFQKARERLSYTVTYDAEASRNSSSSSFGVLVW 740 >gi|10177636|dbj|BAB10784.1| (AB024027) subtilisin-like protease [Arabidopsis thaliana] Length = 707 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 707 0 150 300 450 600 Plus Strand HSPs: Score = 135 (47.5 bits), Expect = 6.4e-06, P = 6.4e-06 Identities = 33/98 (33%), Positives = 54/98 (55%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + + G+D+ +V ++R LTNVG P TYK+ V++ S + V Sbjct: 598 NLNYPSMSAKLS-------GTDSTFSVTFNRTLTNVGTPNSTYKSKVVAGHGSKLSIKVT 650 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ L F + K+ ++V+ T + + S S A L W+DG Sbjct: 651 PSVLYFKTVNEKQSFSVTVTGSDVDSEVPSSANLIWSDG 689 >gi|6688548|emb|CAB65690.1| (AJ270956) subtilisin-like protein [Lycopersicon esculentum] Length = 113 Frame 3 hits (HSPs): _________________________________________ __________________________________________________ Database sequence: | | | | 113 0 50 100 Plus Strand HSPs: Score = 108 (38.0 bits), Expect = 3.8e-05, P = 3.8e-05 Identities = 35/106 (33%), Positives = 50/106 (47%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVE 200 + NYPS VP + SR +TNVG + TYKA + + NV TVV Sbjct: 9 ELNYPSITVP-----------NLRNNYSVSRTVTNVGKSRSTYKAVIFAPKGINV-TVV- 55 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDGKA*GWYSN 341 P L+FT Y K ++TV+F + G F L W + + W ++ Sbjct: 56 PRRLAFTRYYQKMNFTVTFKVAAPTQGYV-FGSLSWRNKRT--WVTS 99 >gi|9759235|dbj|BAB09759.1| (AB016890) serine protease-like protein [Arabidopsis thaliana] Length = 697 Frame 3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 697 0 150 300 450 600 Plus Strand HSPs: Score = 127 (44.7 bits), Expect = 8.6e-05, P = 8.6e-05 Identities = 32/98 (32%), Positives = 51/98 (52%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + + GS+ V ++R +TNVG P TYK+ V+ S + V Sbjct: 585 NLNYPSMSAKLS-------GSNISFIVTFNRTVTNVGTPNSTYKSKVVLNHGSKLNVKVS 637 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ LS + K+ +TV+ + + + S S A L W+DG Sbjct: 638 PSVLSMKSMNEKQSFTVTVSASELHSELPSSANLIWSDG 676 >gi|9759217|dbj|BAB09629.1| (AB016885) subtilisin-like serine protease [Arabidopsis thaliana] Length = 713 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 713 0 150 300 450 600 Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 0.00012, P = 0.00012 Identities = 31/98 (31%), Positives = 53/98 (54%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + + S++ V ++R +TNVG P TYK+ ++ SN+K V Sbjct: 605 NLNYPSMSAKLPK-------SESSFIVTFNRTVTNVGTPNSTYKSKIVLNHGSNLKVEVS 657 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ LS + K+ +TV+ + +++ S A L W+DG Sbjct: 658 PSVLSMKSVKEKQSFTVTVSGSNIDPKLPSSANLIWSDG 696 >gi|7488080|pir||H71413 probable cucumisin - Arabidopsis thaliana Length = 439 Frame 3 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 439 0 150 300 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 0.00020, P = 0.00020 Identities = 37/100 (37%), Positives = 56/100 (56%), Frame = +3 Query: 18 VEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTV 194 + + NYPS + + +S SD + +SR +TNVG G TYKA + G+ + Sbjct: 336 MRNLNYPSMSAKVSASSS----SD----ITFSRTVTNVGEKGSTYKAKLS--GNPKLSIK 385 Query: 195 VEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSF--ARLEWTDG 317 VEP TLSF KK +TV+ + S+ +G ++ A L W+DG Sbjct: 386 VEPATLSFKAPGEKKSFTVTVSGKSL-AGISNIVSASLIWSDG 427 >gi|4006827|gb|AAC95169.1| (AC005970) putative serine protease [Arabidopsis thaliana] Length = 754 Frame 3 hits (HSPs): ______ Frame 1 hits (HSPs): _ __________________________________________________ Database sequence: | | | | | || 754 0 150 300 450 600 750 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 0.00034, Sum P(2) = 0.00034 Identities = 36/95 (37%), Positives = 52/95 (54%), Frame = +3 Query: 30 NYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGT-YKASVMSLGDSNVKTVVEPN 206 NYPSF+V + GG + V+Y+R +TNVGA + YK +V G +V V+P+ Sbjct: 653 NYPSFSV-------LFGGK---RVVRYTREVTNVGAASSVYKVTVN--GAPSVGISVKPS 700 Query: 207 TLSFTELYXKKDYTVSFTYTSMPSGTTS--FARLEWTD 314 LSF + KK YTV+F S T F + W++ Sbjct: 701 KLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSN 738 Score = 48 (16.9 bits), Expect = 0.00034, Sum P(2) = 0.00034 Identities = 7/12 (58%), Positives = 11/12 (91%), Frame = +1 Query: 319 KHKVGTPIAFSW 354 +H+V +P+AFSW Sbjct: 740 QHEVRSPVAFSW 751 >gi|5302780|emb|CAB46058.1| (Z97337) cucumisin [Arabidopsis thaliana] >gi|7268250|emb|CAB78546.1| (AL161540) cucumisin [Arabidopsis thaliana] Length = 687 Frame 3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 687 0 150 300 450 600 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 0.00039, P = 0.00039 Identities = 37/100 (37%), Positives = 56/100 (56%), Frame = +3 Query: 18 VEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTV 194 + + NYPS + + +S SD + +SR +TNVG G TYKA + G+ + Sbjct: 584 MRNLNYPSMSAKVSASSS----SD----ITFSRTVTNVGEKGSTYKAKLS--GNPKLSIK 633 Query: 195 VEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSF--ARLEWTDG 317 VEP TLSF KK +TV+ + S+ +G ++ A L W+DG Sbjct: 634 VEPATLSFKAPGEKKSFTVTVSGKSL-AGISNIVSASLIWSDG 675 >gi|11994380|dbj|BAB02339.1| (AB019229) cucumisin-like serine protease; subtilisin-like protease [Arabidopsis thaliana] Length = 777 Frame 3 hits (HSPs): _______ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | | 777 0 150 300 450 600 750 Plus Strand HSPs: Score = 119 (41.9 bits), Expect = 0.00049, Sum P(2) = 0.00049 Identities = 36/99 (36%), Positives = 53/99 (53%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGA--PGTYKASVMSLGDSNVKTVV 197 D NYPSF+V + T + VKY RV+ NVG+ Y+ V S +NV+ V Sbjct: 664 DLNYPSFSVVF---------ASTGEVVKYKRVVKNVGSNVDAVYEVGVKS--PANVEIDV 712 Query: 198 EPNTLSFTELYXKKDYTVSFTYTSMPSGTTS-----FARLEWTDGK 320 P+ L+F++ +Y V+F + G S F +EWTDG+ Sbjct: 713 SPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGE 758 Score = 40 (14.1 bits), Expect = 0.00049, Sum P(2) = 0.00049 Identities = 6/13 (46%), Positives = 9/13 (69%), Frame = +1 Query: 316 GKHKVGTPIAFSW 354 G+H V +P+A W Sbjct: 757 GEHVVKSPVAVQW 769 >gi|9759215|dbj|BAB09627.1| (AB016885) subtilisin-like serine protease [Arabidopsis thaliana] Length = 677 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 677 0 150 300 450 600 Plus Strand HSPs: Score = 121 (42.6 bits), Expect = 0.00050, P = 0.00050 Identities = 36/98 (36%), Positives = 55/98 (56%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKAS-VMSLGDSNVKTVV 197 + NYPS + +D G ++ TV + R +TN+G P TYK+ V++ G VK V Sbjct: 575 NLNYPSMSAKID-------GYNSSFTVTFKRTVTNLGTPNSTYKSKIVLNHGAKLVK--V 625 Query: 198 EPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ LSF + K+ +TV+F+ + TS A L W+DG Sbjct: 626 SPSVLSFKRVNEKQSFTVTFSGNLNLNLPTS-ANLIWSDG 664 >gi|7435664|pir||T12963 subtilisin homolog T6H20.120 - Arabidopsis thaliana >gi|5541674|emb|CAB51180.1| (AL096859) subtilisin-like proteinase homolog [Arabidopsis thaliana] Length = 736 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 736 0 150 300 450 600 Plus Strand HSPs: Score = 121 (42.6 bits), Expect = 0.00056, P = 0.00056 Identities = 35/98 (35%), Positives = 49/98 (50%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + + G+ K V + R +TNVG P TYKA V+ S +K V Sbjct: 637 NLNYPSMSAQVS-------GTKPFK-VTFRRTVTNVGRPNATYKAKVVG---SKLKVKVV 685 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P LS LY KK +TV+ + + A+L W+DG Sbjct: 686 PAVLSLKSLYEKKSFTVTVSGAGPKAENLVSAQLIWSDG 724 >gi|9759214|dbj|BAB09626.1| (AB016885) subtilisin-like serine protease [Arabidopsis thaliana] Length = 693 Frame 3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 693 0 150 300 450 600 Plus Strand HSPs: Score = 118 (41.5 bits), Expect = 0.0013, P = 0.0013 Identities = 32/98 (32%), Positives = 49/98 (50%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + + S + TV ++R +TNVG TYK+ V+ S +K V Sbjct: 581 NLNYPSMSAKLSK-------SKSSFTVTFNRTVTNVGTSNSTYKSKVVINHGSKLKVKVS 633 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ LS + K+ +TVS + + S A L W+DG Sbjct: 634 PSVLSMKSVNEKQSFTVSVSGNDLNPKLPSSANLIWSDG 672 >gi|3413481|emb|CAA07250.1| (AJ006786) serine protease [Lycopersicon esculentum] Length = 747 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 747 0 150 300 450 600 Plus Strand HSPs: Score = 118 (41.5 bits), Expect = 0.0014, P = 0.0014 Identities = 38/97 (39%), Positives = 52/97 (53%), Frame = +3 Query: 30 NYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVEPN 206 NYPSF++ D S T +T Y+R +TNVG A +YK V S V VEP+ Sbjct: 648 NYPSFSI-YDLGS-------TPQT--YTRTVTNVGDAKSSYKVEVAS--PEGVAIEVEPS 695 Query: 207 TLSFTELYXKKDYTVSFTYTSMPSGTTSFAR-LEWTDGK 320 L+F+EL K Y V+F+ T+ S T L+WT + Sbjct: 696 ELNFSELNQKLTYQVTFSKTANSSNTEVIEGFLKWTSNR 734 >gi|7435682|pir||T14845 antifreeze-like protein (af70) - Norway spruce >gi|1483177|dbj|BAA13135.1| (D86598) antifreeze-like protein (af70) [Picea abies] Length = 779 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 779 0 150 300 450 600 750 Plus Strand HSPs: Score = 118 (41.5 bits), Expect = 0.0015, P = 0.0015 Identities = 37/101 (36%), Positives = 54/101 (53%), Frame = +3 Query: 18 VEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNV---GAPGTYKASVMSLGDSNVK 188 + + NYPS A+ + GI GS T+ SR +TN AP TYK ++ + NVK Sbjct: 675 ISNMNYPSIAI---SKLGIKNGSTTI-----SRSVTNFVPEQAP-TYKVTIDAPPGLNVK 725 Query: 189 TVVEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDGK 320 V P L F++ K + V FT T++ + +F L W+DGK Sbjct: 726 --VSPEILHFSKTSKKLSFNVVFTPTNVATKGYAFGTLVWSDGK 767 >gi|7435665|pir||T12964 subtilisin homolog T6H20.130 - Arabidopsis thaliana >gi|5541675|emb|CAB51181.1| (AL096859) subtilisin-like proteinase homolog [Arabidopsis thaliana] Length = 739 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 739 0 150 300 450 600 Plus Strand HSPs: Score = 117 (41.2 bits), Expect = 0.0018, P = 0.0018 Identities = 34/98 (34%), Positives = 47/98 (47%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 + NYPS + A K + + R +TNVG P TYKA V+ S +K V Sbjct: 638 NLNYPSMTAQVSAAK-------PFKVI-FRRTVTNVGRPNATYKAKVVG---SKLKVKVV 686 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P LS LY KK +TV+ + + A+L W+DG Sbjct: 687 PAVLSLKSLYEKKSFTVTASGAGPKAENLVSAQLIWSDG 725 >gi|7435662|pir||T07184 subtilisin-like proteinase (EC 3.4.21.-) precursor P69B, pathogenesis-related - tomato >gi|2230959|emb|CAA71234.1| (Y10149) subtilisin-like protease [Lycopersicon esculentum] >gi|4200336|emb|CAA76725.1| (Y17276) P69B protein [Lycopersicon esculentum] Length = 745 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 745 0 150 300 450 600 Plus Strand HSPs: Score = 117 (41.2 bits), Expect = 0.0018, P = 0.0018 Identities = 36/97 (37%), Positives = 50/97 (51%), Frame = +3 Query: 30 NYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVEPN 206 NYPSF++ G+G T Y+R +TNVG A +YK V S V VEP+ Sbjct: 647 NYPSFSI-----FGLGSTPQT-----YTRTVTNVGDATSSYKVEVAS--PEGVAIEVEPS 694 Query: 207 TLSFTELYXKKDYTVSFTYTSMPSGTTSFAR-LEWTDGK 320 L+F+EL K Y V+F+ T+ S L+WT + Sbjct: 695 ELNFSELNQKLTYQVTFSKTTNSSNPEVIEGFLKWTSNR 733 >gi|9759216|dbj|BAB09628.1| (AB016885) subtilisin-like serine protease [Arabidopsis thaliana] Length = 710 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 710 0 150 300 450 600 Plus Strand HSPs: Score = 115 (40.5 bits), Expect = 0.0031, P = 0.0031 Identities = 30/98 (30%), Positives = 51/98 (52%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVE 200 + NYPS + + S++ TV + R +TN+G A TYK+ ++ S + V Sbjct: 604 NLNYPSMSAKLSE-------SNSSFTVTFKRTVTNLGTANSTYKSKIVLNHGSKLNVKVS 656 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P+ LS L K+ +TV+ + +++ S A L W+DG Sbjct: 657 PSVLSMKSLKEKQSFTVTVSGSNIDPKLPSSANLIWSDG 695 >gi|9759240|dbj|BAB09764.1| (AB016890) serine protease-like protein [Arabidopsis thaliana] Length = 729 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 729 0 150 300 450 600 Plus Strand HSPs: Score = 114 (40.1 bits), Expect = 0.0042, P = 0.0042 Identities = 31/100 (31%), Positives = 49/100 (49%), Frame = +3 Query: 18 VEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTV 194 V+D NYP+ + + V + R +TNVG P TYKASV+ L ++ Sbjct: 623 VKDLNYPTMTTFVSSLDPFN--------VTFKRTVTNVGFPNSTYKASVVPL-QPELQIS 673 Query: 195 VEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 +EP L F L KK + V+ + + G+ + + W+DG Sbjct: 674 IEPEILRFGFLEEKKSFVVTISGKELKDGSFVSSSVVWSDG 714 >gi|1086249|pir||S52769 subtilisin-like proteinase ag12 (EC 3.4.21.-) - alder >gi|757522|emb|CAA59964.1| (X85975) subtilisin-like protease [Alnus glutinosa] Length = 761 Frame 3 hits (HSPs): _______ Frame 1 hits (HSPs): __ Annotated Domains: _ __________________________________________________ Database sequence: | | | | | || 761 0 150 300 450 600 750 __________________ Annotated Domains: PROSITE SUBTILASE_SER: Serine proteases, subtila 535..545 __________________ Plus Strand HSPs: Score = 104 (36.6 bits), Expect = 0.011, Sum P(2) = 0.011 Identities = 34/97 (35%), Positives = 49/97 (50%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVE 200 D NYPSF ++ ++ T + R +TNVG TYKA+V + DS V +V Sbjct: 651 DLNYPSFIAFHNSTC-----RRSVNT--FQRTVTNVGDGAATYKATVTAPKDSRV--IVS 701 Query: 201 PNTLSFTELYXKKDYT---VSFTYTSMPSGTTSFARLEWTD 314 P TL+F Y K+ Y ++FT + SF L W + Sbjct: 702 PQTLAFGSKYEKQSYNLTIINFTRDTKRKDI-SFGALVWAN 741 Score = 46 (16.2 bits), Expect = 0.011, Sum P(2) = 0.011 Identities = 9/18 (50%), Positives = 10/18 (55%), Frame = +1 Query: 298 VWNGRMGKHKVGTPIAFS 351 VW GKH V +PI S Sbjct: 738 VWANENGKHMVRSPIVVS 755 >gi|6723681|emb|CAB67119.1| (Y18931) subtilisin-like protease [Lycopersicon esculentum] Length = 743 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 743 0 150 300 450 600 Plus Strand HSPs: Score = 110 (38.7 bits), Expect = 0.013, P = 0.013 Identities = 35/94 (37%), Positives = 48/94 (51%), Frame = +3 Query: 30 NYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVEPN 206 NYPSF++ G+G T Y+R +TNVG A +YK + SL V V P Sbjct: 645 NYPSFSI-----YGLGSTPQT-----YTRTVTNVGDATSSYKVKIASL--IGVAVEVVPT 692 Query: 207 TLSFTELYXKKDYTVSFTYTSMPSGTTSFAR-LEWT 311 L+F+EL K Y V+F+ T+ S L+WT Sbjct: 693 ELNFSELNQKLTYQVTFSKTTSSSEVVVVEGFLKWT 728 >gi|7435661|pir||T06580 subtilisin-like proteinase (EC 3.4.21.-) p69f - tomato >gi|3183991|emb|CAA06414.1| (AJ005173) P69F protein [Lycopersicon esculentum] Length = 747 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 747 0 150 300 450 600 Plus Strand HSPs: Score = 109 (38.4 bits), Expect = 0.017, P = 0.017 Identities = 36/97 (37%), Positives = 52/97 (53%), Frame = +3 Query: 30 NYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVEPN 206 NYPSF++ + GS T +T Y+R +TNVG A +YK ++S V VEP+ Sbjct: 648 NYPSFSIRL--------GS-TPQT--YTRTVTNVGDAKSSYKVEIVS--PKGVVVKVEPS 694 Query: 207 TLSFTELYXKKDYTVSFTYTSMPSGTTSFAR-LEWTDGK 320 L+F+ L K Y V FT T+ S T+ L+W + Sbjct: 695 ALNFSTLNQKLTYQVIFTKTTNISTTSDVEGFLKWNSNR 733 >gi|4200340|emb|CAA76727.1| (Y17278) P69D protein [Lycopersicon esculentum] Length = 747 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | 747 0 150 300 450 600 Plus Strand HSPs: Score = 109 (38.4 bits), Expect = 0.017, P = 0.017 Identities = 36/97 (37%), Positives = 52/97 (53%), Frame = +3 Query: 30 NYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVEPN 206 NYPSF++ + GS T +T Y+R +TNVG A +YK ++S V VEP+ Sbjct: 648 NYPSFSIRL--------GS-TPQT--YTRTVTNVGDAKSSYKVEIVS--PKGVVVKVEPS 694 Query: 207 TLSFTELYXKKDYTVSFTYTSMPSGTTSFAR-LEWTDGK 320 L+F+ L K Y V FT T+ S T+ L+W + Sbjct: 695 ALNFSTLNQKLTYQVIFTKTTNISTTSDVEGFLKWNSNR 733 >gi|3970731|emb|CAA07059.1| (AJ006480) SBT4B protein [Lycopersicon esculentum] Length = 777 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 777 0 150 300 450 600 750 Plus Strand HSPs: Score = 109 (38.4 bits), Expect = 0.018, P = 0.018 Identities = 32/97 (32%), Positives = 47/97 (48%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 D NYPSF + + S + G L+ K+ R LTNVG G TYK + + +S V V Sbjct: 661 DLNYPSF-IALYPFS-LEGNFTWLEQ-KFRRTLTNVGKGGATYKVKIETPKNSTVS--VS 715 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTD 314 P TL F K+ Y ++ Y + +F + W + Sbjct: 716 PRTLVFKGKNDKQSYNLTIRYIGDSDQSKNFGSITWVE 753 >gi|9757901|dbj|BAB08348.1| (AB015475) serine protease-like protein [Arabidopsis thaliana] Length = 760 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | || 760 0 150 300 450 600 750 Plus Strand HSPs: Score = 106 (37.3 bits), Expect = 0.040, P = 0.040 Identities = 38/97 (39%), Positives = 47/97 (48%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKASVMS-LGDSNVKTVVE 200 DFNYPS VP T GS T+ +R L NVG P TY A LG V+ VE Sbjct: 662 DFNYPSITVPNLT------GSITV-----TRKLKNVGPPATYNARFREPLG---VRVSVE 707 Query: 201 PNTLSFTELYXKKDYTVSFTYTSM-PSGTTSFARLEWTD 314 P L+F + K + ++ + PSG F L WTD Sbjct: 708 PKQLTFNKTGEVKIFQMTLRPLPVTPSGYV-FGELTWTD 745 >gi|7435656|pir||T07172 subtilisin-like proteinase (EC 3.4.21.-) 2 - tomato >gi|1771162|emb|CAA67430.1| (X98930) SBT2 [Lycopersicon esculentum] >gi|3687307|emb|CAA07000.1| (AJ006379) subtilisin-like protease [Lycopersicon esculentum] Length = 775 Frame 3 hits (HSPs): ______ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | | 775 0 150 300 450 600 750 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.044, Sum P(2) = 0.043 Identities = 32/98 (32%), Positives = 41/98 (41%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAP-GTYKASVMSLGDSNVKTVVE 200 D NYP+ S + L + R +TNVG+P Y V + + VK VE Sbjct: 671 DLNYPAI-------SAVFPEKTKLSMLTLHRTVTNVGSPISNYHVVVSAFKGAVVK--VE 721 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 P L+FT K Y V+F S F L W DG Sbjct: 722 PERLNFTSKNQKLSYKVTFKTVSRQKAP-EFGSLIWKDG 759 Score = 51 (18.0 bits), Expect = 0.044, Sum P(2) = 0.043 Identities = 10/21 (47%), Positives = 13/21 (61%), Frame = +1 Query: 292 SHVWNGRMGKHKVGTPIAFSW 354 S +W G HKV +PIA +W Sbjct: 753 SLIWKD--GTHKVRSPIAITW 771 >gi|3970733|emb|CAA07060.1| (AJ006481) SBT4C protein [Lycopersicon esculentum] Length = 779 Frame 3 hits (HSPs): _______ Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | | 779 0 150 300 450 600 750 Plus Strand HSPs: Score = 102 (35.9 bits), Expect = 0.050, Sum P(2) = 0.049 Identities = 31/97 (31%), Positives = 43/97 (44%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 D NYPSF + G L+ K+ R LTNVG G TY+ + S +S + V Sbjct: 664 DLNYPSFIAFYSYSQA--GNYPWLEQ-KFRRTLTNVGKDGATYEVKIESPKNSTIS--VS 718 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTD 314 P TL F K+ YT++ Y G + W + Sbjct: 719 PQTLVFKNKNEKQSYTLTIRYRGDEKGGQD-GSITWVE 755 Score = 42 (14.8 bits), Expect = 0.050, Sum P(2) = 0.049 Identities = 11/33 (33%), Positives = 15/33 (45%), Frame = +1 Query: 280 GXPASHVWNGRMGKHKVGTPIAFSWT*--WAVE 372 G S W + G H V +P+ + T WA E Sbjct: 746 GQDGSITWVEKNGNHSVRSPMVITSTVDVWASE 778 >gi|7435655|pir||T07170 subtilisin-like proteinase (EC 3.4.21.-) 4 - tomato >gi|3687303|emb|CAA06998.1| (AJ006377) subtilisin-like protease [Lycopersicon esculentum] Length = 779 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 779 0 150 300 450 600 750 Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 0.054, P = 0.053 Identities = 34/97 (35%), Positives = 45/97 (46%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTVVE 200 D NYPSF + G L+ K+ R LTNVG G TYK + S +S + V Sbjct: 664 DLNYPSFIAFYSYSQE--GNYPWLEQ-KFRRTLTNVGKGGATYKVKIESPKNSTIS--VS 718 Query: 201 PNTLSFTELYXKKDYTVSFTYTS-MPSGTTSFARLEWTD 314 P TL F K+ YT++ Y SG T + W + Sbjct: 719 PQTLVFKNKNEKQSYTLTIRYRGDFNSGQTG--SITWVE 755 >gi|7435654|pir||T07169 subtilisin-like proteinase (EC 3.4.21.-) 3 - tomato >gi|3687301|emb|CAA06997.1| (AJ006376) subtilisin-like protease [Lycopersicon esculentum] >gi|3687309|emb|CAA07001.1| (AJ006380) subtilisin-like protease [Lycopersicon esculentum] Length = 761 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | || 761 0 150 300 450 600 750 Plus Strand HSPs: Score = 104 (36.6 bits), Expect = 0.070, P = 0.068 Identities = 29/97 (29%), Positives = 46/97 (47%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVG-APGTYKASVMSLGDSNVKTVVE 200 D NYPSF + + + G + TL K+ R +TNVG TYKA + + +S + V Sbjct: 651 DLNYPSF-IALYSIEG----NFTLLEQKFKRTVTNVGKGAATYKAKLKAPKNSTIS--VS 703 Query: 201 PNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTD 314 P L F K+ YT++ Y + + + W + Sbjct: 704 PQILVFKNKNEKQSYTLTIRYIGDEGQSRNVGSITWVE 741 >gi|7428210|pir||A55800 cucumisin (EC 3.4.21.25) precursor - muskmelon >gi|807698|dbj|BAA06905.1| (D32206) prepro-cucumisin [Cucumis melo] Length = 731 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 731 0 150 300 450 600 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.20, P = 0.18 Identities = 35/101 (34%), Positives = 48/101 (47%), Frame = +3 Query: 15 RVEDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAP--GTYKASVMSLGDSNVK 188 RV D NYPSF + + S T ++R LT+V AP TY+A + + + Sbjct: 628 RVWDLNYPSFGLSVSP-------SQTFNQY-FNRTLTSV-APQASTYRAMISA--PQGLT 676 Query: 189 TVVEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 V PN LSF L +K +T+ T G A L W+DG Sbjct: 677 ISVNPNVLSFNGLGDRKSFTL--TVRGSIKGFVVSASLVWSDG 717 >gi|3970757|emb|CAA07062.1| (AJ006483) SBT4E protein [Lycopersicon esculentum] Length = 777 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 777 0 150 300 450 600 750 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.61, P = 0.46 Identities = 32/97 (32%), Positives = 41/97 (42%), Frame = +3 Query: 24 DFNYPSFAV--PMDTASGIGGGSDTLKTVKYSRVLTNVGAPG-TYKASVMSLGDSNVKTV 194 D NYPSF P T K+ R LTNVG G TYK + +S V Sbjct: 661 DLNYPSFIALYPFSLEENF-----TWLEQKFRRTLTNVGKGGATYKVQTETPKNSIVS-- 713 Query: 195 VEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTD 314 V P TL F E K+ YT+S + + + W + Sbjct: 714 VSPRTLVFKEKNDKQSYTLSIRSIGDSDQSRNVGSITWVE 753 >gi|7435672|pir||T06017 subtilisin-like proteinase homolog T25K17.140 - Arabidopsis thaliana >gi|4539429|emb|CAB38962.1| (AL049171) subtilisin protease-like [Arabidopsis thaliana] >gi|7269485|emb|CAB79488.1| (AL161565) subtilisin protease-like [Arabidopsis thaliana] Length = 746 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 746 0 150 300 450 600 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.77, P = 0.54 Identities = 30/102 (29%), Positives = 47/102 (46%), Frame = +3 Query: 12 YRVE-DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKASVMSLGDSNVK 188 YR DFNYPS +P + +T+K R ++NVG V + V+ Sbjct: 634 YRTNADFNYPSITIPSLRLT---------RTIK--RTVSNVGPNKNTVYFVDIIRPVGVE 682 Query: 189 TVVEPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEWTDG 317 ++ P L F++ + Y V+F T + SG F + WT+G Sbjct: 683 VLIWPRILVFSKCQQEHSYYVTFKPTEIFSGRYVFGEIMWTNG 725 >gi|4218991|gb|AAD12260.1| (AF098632) subtilisin-like protease [Arabidopsis thaliana] Length = 772 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 772 0 150 300 450 600 750 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 1.0, P = 0.65 Identities = 32/99 (32%), Positives = 48/99 (48%), Frame = +3 Query: 24 DFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKASVMSLGDSNVKTVVEP 203 + NYPS VP T+S + TV SR + NVG P Y V + V V+P Sbjct: 674 NLNYPSITVPNLTSSKV--------TV--SRTVKNVGRPSMYTVKVNN--PQGVYVAVKP 721 Query: 204 NTLSFTELYXKKDYTVSFTYT--SMPSGTTSFARLEWTDGK 320 +L+FT++ +K + V + ++ G F L W+D K Sbjct: 722 TSLNFTKVGEQKTFKVILVKSKGNVAKGYV-FGELVWSDKK 761 >gi|10177874|dbj|BAB11244.1| (AB010074) serine protease-like protein [Arabidopsis thaliana] Length = 780 Frame 3 hits (HSPs): _____ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | | 780 0 150 300 450 600 750 Plus Strand HSPs: Score = 93 (32.7 bits), Expect = 1.2, Sum P(2) = 0.71 Identities = 26/72 (36%), Positives = 36/72 (50%), Frame = +3 Query: 93 LKTVKYSRVLTNVGAP-GTYKASVMSLGDSNVKTVVEPNTLSFTELYXKKDYTVSFTYTS 269 +K + R +TNVG +YK SV ++V V+P TL+FT + K YTV+F T Sbjct: 692 VKAMTLRRTVTNVGPHISSYKVSVSPFKGASV--TVQPKTLNFTSKHQKLSYTVTFR-TR 748 Query: 270 MPSGTTSFARLEW 308 F L W Sbjct: 749 FRMKRPEFGGLVW 761 Score = 39 (13.7 bits), Expect = 1.2, Sum P(2) = 0.71 Identities = 7/19 (36%), Positives = 10/19 (52%), Frame = +1 Query: 298 VWNGRMGKHKVGTPIAFSW 354 VW HKV +P+ +W Sbjct: 760 VWKSTT--HKVRSPVIITW 776 >gi|10177637|dbj|BAB10785.1| (AB024027) serine protease-like protein [Arabidopsis thaliana] Length = 741 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 741 0 150 300 450 600 Plus Strand HSPs: Score = 93 (32.7 bits), Expect = 1.3, P = 0.72 Identities = 22/73 (30%), Positives = 35/73 (47%), Frame = +3 Query: 102 VKYSRVLTNVGAP-GTYKASVMSLGDSNVKTVVEPNTLSFTELYXKKDYTVSFTYTSMPS 278 + + R +TNVG TY A V+ S + V P LS + K+ + V+ + S+ + Sbjct: 655 ITFQRTVTNVGMQKSTYNAKVVKFPGSKLSIKVSPRVLSMKSMNEKQSFMVTVSSDSIGT 714 Query: 279 GTTSFARLEWTDG 317 A L W+DG Sbjct: 715 KQPVSANLIWSDG 727 >gi|9294050|dbj|BAB02007.1| (AB020746) protein kinase-like protein [Arabidopsis thaliana] Length = 652 Frame -1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 652 0 150 300 450 600 Minus Strand HSPs: Score = 90 (31.7 bits), Expect = 2.5, P = 0.92 Identities = 30/83 (36%), Positives = 40/83 (48%), Frame = -1 Query: 252 TRYSPSXRTIP*NSXYSVPPQSSHSNPPTTSPKLCTFPELPR*SKP*STSRSSEYRNLPQ 73 T SPS + P NS + PP ++ S PPTT+P + P P ST+ +S + P Sbjct: 9 TTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPS--SPPPSP------STNSTSPPPSSPL 60 Query: 72 SPKLYP*EPQKKDN*NPPLCNPS 4 P L P P + PPL PS Sbjct: 61 PPSLPP--PSPPGSLTPPLPQPS 81 >gi|106685|pir||S24710 Ig alpha chain - human >gi|28568|emb|CAA78684.1| (Z14961) codes for truncated alpha Ig chain of patient BEN [Homo sapiens] Length = 78 Frame -1 hits (HSPs): _______________________________ Annotated Domains: ______________________ __________________________________________________ Database sequence: | | | | | 78 0 20 40 60 __________________ Annotated Domains: DOMO DM04904: 38..71 __________________ Minus Strand HSPs: Score = 65 (22.9 bits), Expect = 3.0, P = 0.95 Identities = 19/49 (38%), Positives = 24/49 (48%), Frame = -1 Query: 279 QTASKCM*TTRYSPSXRTIP*NSXY--SVPPQSSHSNPPTTSPKLCTFPEL 133 +TA++ T P T+P + S PP S S PPT SP C P L Sbjct: 24 RTATRTQRQTTSGPL--TVPARDNFVPSTPPTPSPSTPPTPSPSCC-HPRL 71 >gi|7435675|pir||T01351 subtilisin-like proteinase homolog F6N15.3 - Arabidopsis thaliana >gi|3193320|gb|AAC19302.1| (AF069299) contains similarity to the subtilase family of serine proteases (Pfam: subtilase.hmm, score: 47.57); strong similarity to Cucumis melo (muskmelon) cucumisin (GB:D32206) [Arabidopsis thaliana] >gi|7267110|emb|CAB80781.1| (AL161471) putative cucumisin protease [Arabidopsis thaliana] Length = 706 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 706 0 150 300 450 600 Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 4.6, P = 0.99 Identities = 28/96 (29%), Positives = 45/96 (46%), Frame = +3 Query: 21 EDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGT-YKASVMSLGDSNVKTVV 197 + NYP+ + + +A + TL + R +TNVG P + Y A+V + V+ V Sbjct: 600 DSLNYPTIQLTLRSAK-----TSTLAV--FRRRVTNVGPPSSVYTATVRA--PKGVEITV 650 Query: 198 EPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEW 308 EP +LSF++ K+ + V M G L W Sbjct: 651 EPQSLSFSKASQKRSFKVVVKAKQMTPGKIVSGLLVW 687 >gi|6708179|gb|AAF25830.1|AF190794_1 (AF190794) subtilisin-type serine endopeptidase XSP1 [Arabidopsis thaliana] Length = 749 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | 749 0 150 300 450 600 Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 4.9, P = 0.99 Identities = 28/96 (29%), Positives = 45/96 (46%), Frame = +3 Query: 21 EDFNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGT-YKASVMSLGDSNVKTVV 197 + NYP+ + + +A + TL + R +TNVG P + Y A+V + V+ V Sbjct: 643 DSLNYPTIQLTLRSAK-----TSTLAV--FRRRVTNVGPPSSVYTATVRA--PKGVEITV 693 Query: 198 EPNTLSFTELYXKKDYTVSFTYTSMPSGTTSFARLEW 308 EP +LSF++ K+ + V M G L W Sbjct: 694 EPQSLSFSKASQKRSFKVVVKAKQMTPGKIVSGLLVW 730 >gi|106688|pir||S24709 Ig alpha chain - human >gi|28566|emb|CAA78683.1| (Z14960) codes for truncated alpha heavy Ig mRNA of alpha heavy chain disease patient AYO [Homo sapiens] Length = 77 Frame -1 hits (HSPs): _________________________ Annotated Domains: ____________________ __________________________________________________ Database sequence: | | | | | 77 0 20 40 60 __________________ Annotated Domains: DOMO DM04904: 41..70 __________________ Minus Strand HSPs: Score = 63 (22.2 bits), Expect = 5.1, P = 0.99 Identities = 17/41 (41%), Positives = 21/41 (51%), Frame = -1 Query: 255 TTRYSPSXRTIP*NSXYSVPPQSSHSNPPTTSPKLCTFPEL 133 +TR + T+ +S S PP S S PPT SP C P L Sbjct: 33 STRGPETTGTV--SSVPSTPPTPSPSTPPTPSPSCC-HPRL 70 >gi|106687|pir||S24711 Ig alpha chain - human >gi|28570|emb|CAA78685.1| (Z14962) codes for truncated alpha Ig mRNA of alpha heavy chain disease patient HAR [Homo sapiens] Length = 68 Frame -1 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | 68 0 20 40 60 Minus Strand HSPs: Score = 63 (22.2 bits), Expect = 5.1, P = 0.99 Identities = 15/32 (46%), Positives = 17/32 (53%), Frame = -1 Query: 228 TIP*NSXYSVPPQSSHSNPPTTSPKLCTFPEL 133 T+ +S S PP S S PPT SP C P L Sbjct: 30 TVNASSVPSTPPTPSPSTPPTPSPSCC-HPRL 60 >gi|106367|pir||S08352 Ig alpha chain precursor - human >gi|34009|emb|CAA34977.1| (X17117) precursor polypeptide (AA -19 to 55) [Homo sapiens] >gi|4490539|emb|CAB38570.1| (X17116) alpha heavy chain [Homo sapiens] Length = 74 Frame -1 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | 74 0 20 40 60 Minus Strand HSPs: Score = 63 (22.2 bits), Expect = 5.1, P = 0.99 Identities = 15/32 (46%), Positives = 17/32 (53%), Frame = -1 Query: 228 TIP*NSXYSVPPQSSHSNPPTTSPKLCTFPEL 133 T+ +S S PP S S PPT SP C P L Sbjct: 37 TVRVSSVPSTPPTPSPSTPPTPSPSCC-HPRL 67 >gi|1711284|dbj|BAA13994.1| (D89609) choriogenin H [Oryzias latipes] Length = 591 Frame -1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | 591 0 150 300 450 Minus Strand HSPs: Score = 85 (29.9 bits), Expect = 8.2, P = 1.0 Identities = 46/149 (30%), Positives = 66/149 (44%), Frame = -1 Query: 453 PYRAGPKSKPRKSLQHLSGPFYLGHTFFHSPSCPAERNWSTNLMLSHPSIP-NVRSWXSQ 277 PY P+ KP+ QH+S P+Y G P P ++ S S+P P N + + Sbjct: 40 PYY--PQPKPQDP-QHVSPPYYPG-----KPQNPPQKP-SNPQYPSYPQTPQNPQVPQNP 90 Query: 276 TASKCM*TTRYSPSXRTIP*NSXYSVPPQSSHSNPPTT-SPKLCTFPELPR*SKP*STSR 100 + Y P + P N Y PQ SNPPT+ +P P+L + KP + + Sbjct: 91 QVPQNPQYPSY-PQNPSYPQNPSY---PQYP-SNPPTSQNPSYPQNPKLFQDGKPSNPQQ 145 Query: 99 SS--EYRNLPQSPKLYP*EPQKKDN*NPPLCNP 7 +Y + PQ P+ P PQ PP NP Sbjct: 146 PQVPQYPSKPQPPQ-NPQVPQYPSKPQPPQ-NP 176 >gi|11265104|pir||T48553 subtilisin-like proteinase homolog F14F18.110 [imported] - Arabidopsis thaliana >gi|7573361|emb|CAB87667.1| (AL163812) subtilisin-like protease-like protein [Arabidopsis thaliana] Length = 755 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | || 755 0 150 300 450 600 750 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 8.5, P = 1.0 Identities = 28/72 (38%), Positives = 33/72 (45%), Frame = +3 Query: 102 VKYSRVLTNVG-APGTYKASVMS-LGDSNVKTVVEPNTLSFTELYXKKDYTVSFTYTSMP 275 V +R +TNVG YK V LG VK V PNTL F Y V+ + T Sbjct: 665 VTLTRTVTNVGPVDSVYKLIVEPPLG---VKISVTPNTLLFNSNVKILSYKVTVSTTHKS 721 Query: 276 SGTTSFARLEWTDG 317 + F L WTDG Sbjct: 722 NSIYYFGSLTWTDG 735 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.97 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.323 0.137 0.434 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.347 0.162 0.586 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.356 0.160 0.641 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.340 0.146 0.511 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.337 0.148 0.494 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.345 0.152 0.483 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 198 194 10. 76 3 12 22 0.091 35 31 0.10 38 +2 0 198 192 10. 76 3 12 22 0.12 34 31 0.098 38 +1 0 199 194 10. 76 3 12 22 0.091 35 31 0.10 38 -1 0 199 194 10. 76 3 12 22 0.091 35 31 0.10 38 -2 0 198 192 10. 76 3 12 22 0.12 34 31 0.098 38 -3 0 198 193 10. 76 3 12 22 0.12 34 31 0.099 38 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 48 No. of states in DFA: 595 (59 KB) Total size of DFA: 234 KB (256 KB) Time to generate neighborhood: 0.02u 0.00s 0.02t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 215.04u 1.19s 216.23t Elapsed: 00:00:38 Total cpu time: 215.11u 1.22s 216.33t Elapsed: 00:00:38 Start: Mon Oct 1 16:16:13 2001 End: Mon Oct 1 16:16:51 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000