Q99KT4 - (Q99KT4) Hypothetical 28.4 kDa protein (Fragment) || Number of peptides = 5 || unambiguous || 99.6% Confident
A2M1_HUMAN - (P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain) (P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9D0G0 - (Q9D0G0) 2610020A16Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
D3D2_MOUSE - (P42125) 3,2-trans-enoyl-CoA isomerase, mitochondrial precursor (EC 5.3.3.8) (Dodecenoyl-CoA delta-isomerase) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q91YP2 - (Q91YP2) Hypothetical 80.4 kDa protein || Number of peptides = 3 || unambiguous || 99.6% Confident
G6PI_MOUSE - (P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) || Number of peptides = 3 || unambiguous || 99.6% Confident
RT06_MOUSE - (P58064) Mitochondrial 28S ribosomal protein S6 (MRP-S6) || Number of peptides = 1 || unambiguous || 99.6% Confident
MPRI_MOUSE - (Q07113) Cation-independent mannose-6-phosphate receptor precursor (CI Man-6-P receptor) (CI-MPR) (Insulin-like growth factor II receptor) (300 kDa mannose 6-phosphate receptor) (MPR 300) (MPR300) || Number of peptides = 25 || unambiguous || 99.6% Confident
Q9CY30 - (Q9CY30) 2510015F01Rik protein || Number of peptides = 11 || ambiguous || 99.6% Confident
RM03_MOUSE - (Q99N95) Mitochondrial 60S ribosomal protein L3 (L3mt) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q96FL3 - (Q96FL3) Similar to hypothetical protein FLJ20647 (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
LMG1_MOUSE - (P02468) Laminin gamma-1 chain precursor (Laminin B2 chain) || Number of peptides = 6 || unambiguous || 99.6% Confident
DGK_MOUSE - (Q9QX60) Deoxyguanosine kinase, mitochondrial precursor (EC 2.7.1.113) (dGK) || Number of peptides = 8 || unambiguous || 99.6% Confident
RS3_MOUSE - (P17073) 40S ribosomal protein S3 || Number of peptides = 14 || ambiguous || 99.6% Confident
VIME_MOUSE - (P20152) Vimentin || Number of peptides = 72 || unambiguous || 99.6% Confident
Q9R0E2 - (Q9R0E2) Lysyl hydroxylase 1 (Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1) || Number of peptides = 5 || unambiguous || 99.6% Confident
P70663 - (P70663) SPARC-like protein 1 precursor (Matrix glycoprotein Sc1) (Extracellular matrix protein 2) (Extracellular matrix-associated protein) || Number of peptides = 6 || unambiguous || 99.6% Confident
CBR2_MOUSE - (P08074) Lung carbonyl reductase [NADPH] (EC 1.1.1.184) (NADPH-dependent carbonyl reductase) (LCR) (Adipocyte P27 protein) (AP27) || Number of peptides = 71 || unambiguous || 99.6% Confident
O35371 - (O35371) Peripherial benzodiazepine receptor associated protein || Number of peptides = 3 || unambiguous || 99.6% Confident
SAP_MOUSE - (Q61207) Sulfated glycoprotein 1 precursor (SGP-1) (Prosaposin) || Number of peptides = 19 || unambiguous || 99.6% Confident
UCR2_MOUSE - (Q9DB77) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial precursor (EC 1.10.2.2) (Complex III subunit II) || Number of peptides = 12 || unambiguous || 99.6% Confident
P137_MOUSE - (Q60865) GPI-anchored protein p137 (p137GPI) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CQF9 - (Q9CQF9) 1200015P13Rik protein (RIKEN cDNA 1200015P13 gene) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q99LB7 - (Q99LB7) Similar to CG6385 gene product || Number of peptides = 14 || unambiguous || 99.6% Confident
Q99NB1 - (Q99NB1) Acetyl-CoA synthetase 2 || Number of peptides = 11 || unambiguous || 99.6% Confident
ITH2_MOUSE - (Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) || Number of peptides = 6 || unambiguous || 99.6% Confident
O88325 - (O88325) Alpha-N-acetylglucosaminidase || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9D0F3 - (Q9D0F3) 2610020P13Rik protein || Number of peptides = 9 || unambiguous || 99.6% Confident
ADT1_MOUSE - (P48962) ADP,ATP carrier protein, heart/skeletal muscle isoform T1 (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) (mANC1) || Number of peptides = 30 || unambiguous || 99.6% Confident
O70341 - (O70341) Taipoxin-associated calcium binding protein 49 || Number of peptides = 4 || unambiguous || 99.6% Confident
FKB3_MOUSE - (Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) || Number of peptides = 3 || unambiguous || 99.6% Confident
SPCO_MOUSE - (Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) || Number of peptides = 27 || unambiguous || 99.6% Confident
TPP1_MOUSE - (O89023) Tripeptidyl-peptidase I precursor (EC 3.4.14.9) (TPP-I) (Tripeptidyl aminopeptidase) (Lysosomal pepstatin insensitive protease) (LPIC) || Number of peptides = 16 || unambiguous || 99.6% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 25 || unambiguous || 99.6% Confident
Q8R086 - (Q8R086) Similar to sulfite oxidase || Number of peptides = 5 || unambiguous || 99.6% Confident
HO2_MOUSE - (O70252) Heme oxygenase 2 (EC 1.14.99.3) (HO-2) || Number of peptides = 9 || unambiguous || 99.6% Confident
PDK2_MOUSE - (Q9JK42) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial precursor (EC 2.7.1.99) (Pyruvate dehydrogenase kinase isoform 2) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9DCH4 - (Q9DCH4) 0610037M02Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
O35114 - (O35114) CD36 antigen (Collagen type I receptor, thrombospondin receptor)-like 2 (MLGP85/LIMP II) || Number of peptides = 11 || unambiguous || 99.6% Confident
CYPC_MOUSE - (P30412) Peptidyl-prolyl cis-trans isomerase C (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin C) || Number of peptides = 8 || unambiguous || 99.6% Confident
NCB2_MOUSE - (P81117) Nucleobindin 2 precursor (DNA-binding protein NEFA) || Number of peptides = 4 || unambiguous || 99.6% Confident
TTHY_MOUSE - (P07309) Transthyretin precursor (Prealbumin) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 20 || ambiguous || 99.6% Confident
FKBX_MOUSE - (Q61576) 65 kDa FK506-binding protein precursor (EC 5.2.1.8) (FKBP65) (FKBPRP) (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (Immunophilin FKBP65) || Number of peptides = 7 || unambiguous || 99.6% Confident
HEM6_MOUSE - (P36552) Coproporphyrinogen III oxidase, mitochondrial precursor (EC 1.3.3.3) (Coproporphyrinogenase) (Coprogen oxidase) (COX) || Number of peptides = 2 || unambiguous || 99.6% Confident
IDHP_MOUSE - (P54071) Isocitrate dehydrogenase [NADP], mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) (ICD-M) || Number of peptides = 30 || unambiguous || 99.6% Confident
CA16_MOUSE - (Q04857) Collagen alpha 1(VI) chain precursor || Number of peptides = 14 || unambiguous || 99.6% Confident
DYJ2_HUMAN - (O43237) Dynein light intermediate chain 2, cytosolic (LIC53/55) (LIC-2) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9D846 - (Q9D846) 2010300P09Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
ETFA_MOUSE - (Q99LC5) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor (Alpha-ETF) || Number of peptides = 15 || unambiguous || 99.6% Confident
NLTP_MOUSE - (P32020) Nonspecific lipid-transfer protein, mitochondrial precursor (NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol carrier protein X) (SCP-X) (SCPX) || Number of peptides = 7 || ambiguous || 99.6% Confident
CALU_MOUSE - (O35887) Calumenin precursor || Number of peptides = 31 || unambiguous || 99.6% Confident
NPS1_MOUSE - (O55125) NipSnap1 protein || Number of peptides = 19 || unambiguous || 99.6% Confident
O88312 - (O88312) GOB-4 protein (Anterior GRADIENT 2) (XENEPUS LAEVIS) (XENOPUS LAEVIS) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9D7G7 - (Q9D7G7) 0710008K08Rik protein || Number of peptides = 16 || ambiguous || 99.6% Confident
T9S2_MOUSE - (P58021) Transmembrane 9 superfamily protein member 2 precursor || Number of peptides = 11 || unambiguous || 99.6% Confident
CATD_MOUSE - (P18242) Cathepsin D precursor (EC 3.4.23.5) || Number of peptides = 23 || unambiguous || 99.6% Confident
Q922L0 - (Q922L0) Yolk sac gene 2 || Number of peptides = 2 || unambiguous || 99.6% Confident
MTE1_MOUSE - (Q9QYR9) Acyl coenzyme A thioester hydrolase, mitochondrial precursor (EC 3.1.2.2) (Very-long-chain acyl-CoA thioesterase) (MTE-I) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q9CWK5 - (Q9CWK5) 2410024C15Rik protein || Number of peptides = 11 || ambiguous || 99.6% Confident
RL7_MOUSE - (P14148) 60S ribosomal protein L7 || Number of peptides = 3 || ambiguous || 99.6% Confident
GLSK_HUMAN - (O94925) Glutaminase, kidney isoform, mitochondrial precursor (EC 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase) || Number of peptides = 8 || unambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 17 || ambiguous || 99.6% Confident
MYHA_HUMAN - (P35580) Myosin heavy chain, nonmuscle type B (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q8VDJ3 - (Q8VDJ3) Similar to lipoprotein-binding protein (Expressed sequence AA960365) || Number of peptides = 22 || unambiguous || 99.6% Confident
Q922Q1 - (Q922Q1) Unknown (Protein for MGC:6272) || Number of peptides = 4 || unambiguous || 99.6% Confident
O54774 - (O54774) MBLVR || Number of peptides = 6 || unambiguous || 99.6% Confident
SELB_MOUSE - (Q9JHW4) Selenocysteine-specific elongation factor (Elongation factor sec) (mSelB) || Number of peptides = 7 || unambiguous || 99.6% Confident
CA26_MOUSE - (Q02788) Collagen alpha 2(VI) chain precursor || Number of peptides = 22 || unambiguous || 99.6% Confident
Q91VA7 - (Q91VA7) Tumor-related protein (Unknown) (Protein for MGC:6572) || Number of peptides = 25 || unambiguous || 99.6% Confident
Q9D5G9 - (Q9D5G9) 4930442D21Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9EQ20 - (Q9EQ20) Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27) || Number of peptides = 20 || unambiguous || 99.6% Confident
Q8TB53 - (Q8TB53) Similar to KIAA1007 protein (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
AMPL_MOUSE - (Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) || Number of peptides = 4 || ambiguous || 99.6% Confident
ILK_MOUSE - (O55222) Integrin-linked protein kinase (EC 2.7.1.-) || Number of peptides = 6 || ambiguous || 99.6% Confident
ITB1_MOUSE - (P09055) Integrin beta-1 precursor (Fibronectin receptor beta subunit) (CD29 antigen) (Integrin VLA-4 beta subunit) || Number of peptides = 3 || unambiguous || 99.6% Confident
CPSM_HUMAN - (P31327) Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSASE I) || Number of peptides = 19 || unambiguous || 99.6% Confident
Q9D7V4 - (Q9D7V4) 2210401K11Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
O88306 - (O88306) DJ-1 || Number of peptides = 5 || ambiguous || 99.6% Confident
G25B_HUMAN - (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q9D2F6 - (Q9D2F6) 4930552N12Rik protein || Number of peptides = 5 || unambiguous || 99.6% Confident
Q07646 - (Q07646) PEG1/MEST protein (Mesoderm specific transcript) || Number of peptides = 6 || ambiguous || 99.6% Confident
O88299 - (O88299) 50 kDa glycoprotein (RH50) (Erythrocyte membrane protein RH50) || Number of peptides = 4 || ambiguous || 99.6% Confident
RL9_MOUSE - (P51410) 60S ribosomal protein L9 || Number of peptides = 12 || ambiguous || 99.6% Confident
Q9CY59 - (Q9CY59) 2500002N19Rik protein || Number of peptides = 5 || ambiguous || 99.6% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 1 || unambiguous || 99.6% Confident
PLMN_MOUSE - (P20918) Plasminogen precursor (EC 3.4.21.7) [Contains: Angiostatin] || Number of peptides = 9 || unambiguous || 99.6% Confident
Q9CZB7 - (Q9CZB7) Protein kinase, interferon inducible double stranded RNA dependent activator || Number of peptides = 3 || ambiguous || 99.6% Confident
PLSL_MOUSE - (Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q8QZT1 - (Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial || Number of peptides = 21 || unambiguous || 99.6% Confident
T9S3_MOUSE - (Q9ET30) Transmembrane 9 superfamily protein member 3 precursor || Number of peptides = 11 || ambiguous || 99.6% Confident
A4_MOUSE - (P12023) Alzheimer's disease amyloid A4 protein homolog precursor (Amyloidogenic glycoprotein) (AG) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q99MI1 - (Q99MI1) Rab6-interacting protein 2 isoform B || Number of peptides = 1 || unambiguous || 99.6% Confident
IF32_MOUSE - (Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9JJB2 - (Q9JJB2) Brain cDNA, clone MNCb-4134 || Number of peptides = 5 || unambiguous || 99.6% Confident
EFTS_MOUSE - (Q9CZR8) Elongation factor Ts, mitochondrial precursor (EF-Ts) (EF-TsMt) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q91YM4 - (Q91YM4) Hypothetical 71.5 kDa protein || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9D910 - (Q9D910) 1810013B01Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9DCT9 - (Q9DCT9) 0610010I20Rik protein || Number of peptides = 8 || ambiguous || 99.6% Confident
Q91W90 - (Q91W90) Similar to hypothetical protein MGC3178 || Number of peptides = 11 || ambiguous || 99.6% Confident
Q9CTF9 - (Q9CTF9) 1300003F06Rik protein (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q922L5 - (Q922L5) Unknown (Protein for MGC:5677) || Number of peptides = 20 || unambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 39 || unambiguous || 99.6% Confident
Q9D5Y7 - (Q9D5Y7) 4921504I16Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
HBAZ_MOUSE - (P06467) Hemoglobin zeta chain || Number of peptides = 1 || unambiguous || 99.6% Confident
ADDA_MOUSE - (Q9QYC0) Alpha adducin (Erythrocyte adducin alpha subunit) || Number of peptides = 2 || unambiguous || 99.6% Confident
M2A1_MOUSE - (P27046) Alpha-mannosidase II (EC 3.2.1.114) (Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (MAN II) (Golgi alpha-mannosidase II) (Mannosidase alpha class 2A member 1) (AMAN II) || Number of peptides = 7 || unambiguous || 99.6% Confident
DCOL_MOUSE - (Q9CZL5) DcoH-like protein 2700061N24Rik || Number of peptides = 3 || ambiguous || 99.6% Confident
OPA1_MOUSE - (P58281) Dynamin-like 120 kDa protein, mitochondrial precursor (Large GTP binding protein) (LargeG) || Number of peptides = 3 || ambiguous || 99.6% Confident
RM27_MOUSE - (Q99N92) Mitochondrial 60S ribosomal protein L27 (L27mt) || Number of peptides = 7 || unambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 22 || unambiguous || 99.6% Confident
COPB_MOUSE - (Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP) || Number of peptides = 15 || unambiguous || 99.6% Confident
PGK1_HUMAN - (P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) || Number of peptides = 1 || unambiguous || 99.6% Confident
TRFE_MOUSE - (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) || Number of peptides = 18 || unambiguous || 99.6% Confident
O70304 - (O70304) Integrin alpha8 (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
MDHM_MOUSE - (P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37) || Number of peptides = 29 || unambiguous || 99.6% Confident
Q9D197 - (Q9D197) 5730591C18Rik protein || Number of peptides = 9 || ambiguous || 99.6% Confident
CCHL_MOUSE - (P53702) Cytochrome c-type heme lyase (EC 4.4.1.17) (CCHL) (Holocytochrome c-type synthase) || Number of peptides = 2 || unambiguous || 99.6% Confident
O35129 - (O35129) BAP || Number of peptides = 4 || ambiguous || 99.6% Confident
KPY2_MOUSE - (P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) || Number of peptides = 7 || unambiguous || 99.6% Confident
ETFA_HUMAN - (P13804) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor (Alpha-ETF) || Number of peptides = 14 || unambiguous || 99.6% Confident
RM49_MOUSE - (Q9CQ40) Mitochondrial 60s ribosomal protein L49 (L49mt) (MRP-L49) || Number of peptides = 1 || unambiguous || 99.6% Confident
GRN_MOUSE - (P28798) Granulins precursor (Acrogranin) [Contains: Granulin 1; Granulin 2; Granulin 3; Granulin 4; Granulin 5; Granulin 6; Granulin 7] || Number of peptides = 1 || unambiguous || 99.6% Confident
Q8QZU3 - (Q8QZU3) Similar to hexose-6-phosphate dehydrogenase (Glucose 1-dehydrogenase) (Fragment) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q8QZU4 - (Q8QZU4) Similar to hydroxyacyl-coenzyme A dehydrogenase/3-ketoacyl-coenzyme A thiolase/enoyl-coenzyme A hydratase (Trifunctional protein), alpha subunit (Fragment) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9QYB1 - (Q9QYB1) Intracellular chloride channel protein || Number of peptides = 2 || ambiguous || 99.6% Confident
Q8VCW8 - (Q8VCW8) Similar to hypothetical protein FLJ20920 || Number of peptides = 16 || unambiguous || 99.6% Confident
KBL_MOUSE - (O88986) 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursor (EC 2.3.1.29) (AKB ligase) (Glycine acetyltransferase) || Number of peptides = 8 || unambiguous || 99.6% Confident
CA24_MOUSE - (P08122) Collagen alpha 2(IV) chain precursor || Number of peptides = 10 || unambiguous || 99.6% Confident
RM12_MOUSE - (Q9DB15) 60S ribosomal protein L12, mitochondrial precursor (L12mt) || Number of peptides = 18 || ambiguous || 99.6% Confident
ANPC_MOUSE - (P70180) Atrial natriuretic peptide clearance receptor precursor (ANP-C) (ANPRC) (NPR-C) (Atrial natriuretic peptide C-type receptor) (EF-2) || Number of peptides = 2 || unambiguous || 99.6% Confident
ATA2_MOUSE - (O55143) Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (EC 3.6.3.8) (Calcium pump 2) (SERCA2) (SR Ca(2+)-ATPase 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) || Number of peptides = 8 || ambiguous || 99.6% Confident
HCDH_MOUSE - (Q61425) Short chain 3-hydroxyacyl-CoA dehydrogenase, mitochondrial precursor (EC 1.1.1.35) (HCDH) (Medium and short chain L-3-hydroxyacyl-coenzyme A dehydrogenase) || Number of peptides = 39 || unambiguous || 99.6% Confident
Q9UFU8 - (Q9UFU8) Hypothetical protein (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q921P5 - (Q921P5) Unknown (Protein for IMAGE:3981915) (Fragment) || Number of peptides = 26 || unambiguous || 99.6% Confident
PDX5_MOUSE - (P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) || Number of peptides = 10 || ambiguous || 99.6% Confident
SUCA_MOUSE - (Q9WUM5) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, alpha chain) (SCS-alpha) || Number of peptides = 13 || unambiguous || 99.6% Confident
PDA4_MOUSE - (P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) || Number of peptides = 28 || unambiguous || 99.6% Confident
POR2_MOUSE - (Q60930) Voltage-dependent anion-selective channel protein 2 (VDAC-2) (mVDAC2) (mVDAC6) (Outer mitochondrial membrane protein porin 2) || Number of peptides = 6 || unambiguous || 99.6% Confident
MCCA_MOUSE - (Q99MR8) Methylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursor (EC 6.4.1.4) (3-Methylcrotonyl-CoA carboxylase 1) (MCCase alpha subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase alpha subunit) || Number of peptides = 7 || unambiguous || 99.6% Confident
POR1_MOUSE - (Q60932) Voltage-dependent anion-selective channel protein 1 (VDAC-1) (mVDAC1) (mVDAC5) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) || Number of peptides = 26 || unambiguous || 99.6% Confident
Q9EP56 - (Q9EP56) Lysosomal thiol reductase precursor || Number of peptides = 7 || ambiguous || 99.6% Confident
MY1C_MOUSE - (Q9WTI7) Myosin Ic (Myosin I beta) (MMIb) || Number of peptides = 10 || unambiguous || 99.6% Confident
TRAL_MOUSE - (Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9CR88 - (Q9CR88) 1810032L21Rik protein || Number of peptides = 9 || unambiguous || 99.6% Confident
Q99LE6 - (Q99LE6) Similar to ATP-binding cassette, sub-family F (GCN20), member 2 || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9QXG5 - (Q9QXG5) Lysophosphatidic acid phosphatase || Number of peptides = 5 || unambiguous || 99.6% Confident
GBLP_HUMAN - (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) || Number of peptides = 20 || ambiguous || 99.6% Confident
OAT_MOUSE - (P29758) Ornithine aminotransferase, mitochondrial precursor (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) || Number of peptides = 62 || unambiguous || 99.6% Confident
Q9D2L8 - (Q9D2L8) 2310016C19Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
Q91YX4 - (Q91YX4) Similar to thioredoxin reductase 2 || Number of peptides = 3 || ambiguous || 99.6% Confident
SZ15_MOUSE - (Q9WVL7) Small inducible cytokine B15 precursor (CXCL15) (Lungkine) || Number of peptides = 2 || unambiguous || 99.6% Confident
RS20_HUMAN - (P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 || Number of peptides = 8 || ambiguous || 99.6% Confident
HMGL_MOUSE - (P38060) Hydroxymethylglutaryl-CoA lyase, mitochondrial precursor (EC 4.1.3.4) (HMG-CoA lyase) (HL) (3-hydroxy-3-methylglutarate-CoA lyase) || Number of peptides = 4 || unambiguous || 99.6% Confident
CY1_MOUSE - (Q9D0M3) Cytochrome c1, heme protein, mitochondrial precursor (Cytochrome c-1) || Number of peptides = 2 || ambiguous || 99.6% Confident
CYTB_MOUSE - (Q62426) Cystatin B (Stefin B) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q99LF0 - (Q99LF0) Similar to plexin B1 (Unknown) (Protein for MGC:7576) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q8VC75 - (Q8VC75) Hypothetical 24.4 kDa protein || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9JIG7 - (Q9JIG7) DXImx40e protein (DNA segment, Chr X, Immunex 40, expressed) (Similar to JM1 protein) || Number of peptides = 6 || unambiguous || 99.6% Confident
P4H2_MOUSE - (Q60716) Prolyl 4-hydroxylase alpha-2 subunit precursor (EC 1.14.11.2) (4-PH alpha-2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase alpha-2 subunit) || Number of peptides = 5 || unambiguous || 99.6% Confident
VP36_MOUSE - (Q9DBH5) Vesicular integral-membrane protein VIP36 precursor || Number of peptides = 5 || unambiguous || 99.6% Confident
ACDL_MOUSE - (P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9CZE2 - (Q9CZE2) 2810011D23Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
O88812 - (O88812) Mac25 || Number of peptides = 1 || ambiguous || 99.6% Confident
ENOA_MOUSE - (P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 12 || ambiguous || 99.6% Confident
Q9CQX8 - (Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q8VDC0 - (Q8VDC0) Leucyl-tRNA synthetase || Number of peptides = 5 || unambiguous || 99.6% Confident
RHOG_HUMAN - (P35238) Rho-related GTP-binding protein RhoG (Sid10750) (P35238) Rho-related GTP-binding protein RhoG (Sid10750) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9DBL1 - (Q9DBL1) 1300003O09Rik protein || Number of peptides = 9 || unambiguous || 99.6% Confident
PSPB_MOUSE - (P50405) Pulmonary surfactant-associated protein B precursor (SP-B) (Pulmonary surfactant-associated proteolipid SPL(Phe)) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q922W5 - (Q922W5) Similar to pyrroline-5-carboxylate reductase 1 || Number of peptides = 1 || unambiguous || 99.6% Confident
ETFB_MOUSE - (Q9DCW4) Electron transfer flavoprotein beta-subunit (Beta-ETF) || Number of peptides = 11 || unambiguous || 99.6% Confident
AF32_HUMAN - (Q9Y4W6) AFG3-like protein 2 (EC 3.4.24.-) (Paraplegin-like protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
MYO6_MOUSE - (Q64331) Myosin VI || Number of peptides = 9 || unambiguous || 99.6% Confident
ODBA_MOUSE - (P50136) 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component alpha chain (E1)) (BCKDH E1-alpha) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q8R0T8 - (Q8R0T8) Hypothetical 50.9 kDa protein (Fragment) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9D172 - (Q9D172) DNA segment, Chr 10, Johns Hopkins University 81 expressed (Hypothetical 28.1 kDa protein) || Number of peptides = 19 || unambiguous || 99.6% Confident
Q9CT05 - (Q9CT05) 2610027H02Rik protein (Fragment) || Number of peptides = 14 || ambiguous || 99.6% Confident
Q9Z126 - (Q9Z126) Platelet factor 4 || Number of peptides = 2 || unambiguous || 99.6% Confident
CATC_MOUSE - (P97821) Dipeptidyl-peptidase I precursor (EC 3.4.14.1) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) || Number of peptides = 8 || unambiguous || 99.6% Confident
DEST_MOUSE - (Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9ERI6 - (Q9ERI6) Alcohol dehydrogenase PAN2 (RIKEN cDNA 3110030G19 gene) || Number of peptides = 1 || ambiguous || 99.6% Confident
LMB1_MOUSE - (P02469) Laminin beta-1 chain precursor (Laminin B1 chain) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q99K23 - (Q99K23) Similar to hypothetical protein FLJ11200 || Number of peptides = 3 || unambiguous || 99.6% Confident
SYR_MOUSE - (Q9D0I9) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA ligase) (ArgRS) || Number of peptides = 2 || unambiguous || 99.6% Confident
ATPB_MOUSE - (P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 179 || ambiguous || 99.6% Confident
Q9D7N6 - (Q9D7N6) 2310001L22Rik protein || Number of peptides = 3 || unambiguous || 99.6% Confident
CU80_MOUSE - (Q8VHI3) Protein C21orf80 homolog || Number of peptides = 3 || unambiguous || 99.6% Confident
RALA_MOUSE - (P05810) Ras-related protein RAL-A || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9CZN7 - (Q9CZN7) Serine hydroxymethyltransferase (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) || Number of peptides = 18 || unambiguous || 99.6% Confident
HYES_MOUSE - (P34914) Soluble epoxide hydrolase (SEH) (EC 3.3.2.3) (Epoxide hydratase) (Cytosolic epoxide hydrolase) (CEH) || Number of peptides = 4 || unambiguous || 99.6% Confident
NCB1_MOUSE - (Q02819) Nucleobindin 1 precursor (CALNUC) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q9UG16 - (Q9UG16) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 20 || unambiguous || 99.6% Confident
ILK1_HUMAN - (Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9EPZ2 - (Q9EPZ2) ELAC2 || Number of peptides = 5 || unambiguous || 99.6% Confident
PYC_MOUSE - (Q05920) Pyruvate carboxylase, mitochondrial precursor (EC 6.4.1.1) (Pyruvic carboxylase) (PCB) || Number of peptides = 40 || unambiguous || 99.6% Confident
CTE1_MOUSE - (O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) || Number of peptides = 5 || ambiguous || 99.6% Confident
B3AT_MOUSE - (P04919) Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (MEB3) || Number of peptides = 15 || unambiguous || 99.6% Confident
Q99L23 - (Q99L23) Similar to NADH dehydrogenase (Ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Q reductase) (Fragment) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q922K2 - (Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment) || Number of peptides = 6 || unambiguous || 99.6% Confident
LMB2_MOUSE - (Q61292) Laminin beta-2 chain precursor (S-laminin) (S-LAM) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q99K35 - (Q99K35) Similar to hypothetical protein LOC57333 (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9Z247 - (Q9Z247) FK506 binding protein 9 precursor (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS) || Number of peptides = 25 || unambiguous || 99.6% Confident
FINC_MOUSE - (P11276) Fibronectin precursor (FN) (Fragments) || Number of peptides = 28 || unambiguous || 99.6% Confident
ACDV_MOUSE - (P50544) Acyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor (EC 1.3.99.-) (VLCAD) (MVLCAD) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CR68 - (Q9CR68) 4430402G14Rik protein (RIKEN cDNA 4430402G14 gene) || Number of peptides = 11 || unambiguous || 99.6% Confident
COPE_MOUSE - (O89079) Coatomer epsilon subunit (Epsilon-coat protein) (Epsilon-COP) (Fragment) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q91YT0 - (Q91YT0) Similar to NADH dehydrogenase (Ubiquinone) flavoprotein 1 (51kD) || Number of peptides = 17 || unambiguous || 99.6% Confident
LCFB_MOUSE - (P41216) Long-chain-fatty-acid--CoA ligase 2 (EC 6.2.1.3) (Long-chain acyl-CoA synthetase 2) (LACS 2) || Number of peptides = 3 || unambiguous || 99.6% Confident
GL6S_HUMAN - (P15586) N-acetylglucosamine-6-sulfatase precursor (EC 3.1.6.14) (G6S) (Glucosamine-6-sulfatase) || Number of peptides = 3 || unambiguous || 99.6% Confident
MDHC_MOUSE - (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) || Number of peptides = 2 || unambiguous || 99.6% Confident
TCPD_MOUSE - (P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) || Number of peptides = 5 || unambiguous || 99.6% Confident
PDP1_HUMAN - (Q9P0J1) [Pyruvate dehydrogenase [Lipoamide]]-phosphatase 1, mitochondrial precursor (EC 3.1.3.43) (PDP 1) (Pyruvate dehydrogenase phosphatase, catalytic subunit 1) (PDPC 1) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9QXT0 - (Q9QXT0) Putative secreted protein ZSIG9 (5330432A10RIK protein) (Transmembrane protein 4) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9D2Y1 - (Q9D2Y1) 9130022B02Rik protein || Number of peptides = 18 || ambiguous || 99.6% Confident
Q91Z10 - (Q91Z10) Similar to phosphoenolpyruvate carboxykinase 2 (Mitochondrial) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q8VDG8 - (Q8VDG8) Similar to paraoxonase 2 || Number of peptides = 1 || ambiguous || 99.6% Confident
MAAI_MOUSE - (Q9WVL0) Maleylacetoacetate isomerase (EC 5.2.1.2) (MAAI) (Glutathione S-transferase zeta 1) (EC 2.5.1.18) (GSTZ1-1) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q925I1 - (Q925I1) TOB3 || Number of peptides = 3 || unambiguous || 99.6% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 4 || ambiguous || 99.6% Confident
PRTP_MOUSE - (P16675) Lysosomal protective protein precursor (EC 3.4.16.5) (Cathepsin A) (Carboxypeptidase C) (MO54) || Number of peptides = 7 || unambiguous || 99.6% Confident
EFTU_HUMAN - (P49411) Elongation factor Tu, mitochondrial precursor (P43) || Number of peptides = 7 || unambiguous || 99.6% Confident
CD36_MOUSE - (Q08857) Platelet glycoprotein IV (GPIV) (GPIIIB) (CD36 antigen) (PAS IV) (PAS-4 protein) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CXR8 - (Q9CXR8) 3110021P21Rik protein || Number of peptides = 7 || unambiguous || 99.6% Confident
ADHA_MOUSE - (P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q9JJE7 - (Q9JJE7) Brain cDNA, clone MNCb-0629, similar to Homo sapiens delta-6 fatty acid desaturase (CYB5RP) mRNA || Number of peptides = 3 || unambiguous || 99.6% Confident
Q99K48 - (Q99K48) Non-POU-domain-containing, octamer-binding protein || Number of peptides = 6 || ambiguous || 99.6% Confident
ACDS_MOUSE - (Q07417) Acyl-CoA dehydrogenase, short-chain specific, mitochondrial precursor (EC 1.3.99.2) (SCAD) (Butyryl-CoA dehydrogenase) || Number of peptides = 9 || unambiguous || 99.6% Confident
NPS2_MOUSE - (O55126) NipSnap2 protein (Glioblastoma amplified sequence) || Number of peptides = 8 || unambiguous || 99.6% Confident
SDFL_MOUSE - (Q9ESP1) Stromal cell-derived factor 2-like protein 1 precursor (SDF2 like protein 1) || Number of peptides = 13 || unambiguous || 99.6% Confident
GBAS_MOUSE - (P04894) Guanine nucleotide-binding protein G(S), alpha subunit (Adenylate cyclase-stimulating G alpha protein) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9NRP2 - (Q9NRP2) DC13 || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CZU6 - (Q9CZU6) 2610511A05Rik protein (Citrate synthase) || Number of peptides = 18 || unambiguous || 99.6% Confident
Q9CQV5 - (Q9CQV5) 3110030K20Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
AGT2_HUMAN - (Q9BYV1) Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) (Beta-ALAAT II) || Number of peptides = 3 || unambiguous || 99.6% Confident
SDF2_MOUSE - (Q9DCT5) Stromal cell-derived factor 2 precursor (SDF-2) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q99LX7 - (Q99LX7) Hypothetical 31.3 kDa protein (Fragment) || Number of peptides = 19 || unambiguous || 99.6% Confident
Q99KS1 - (Q99KS1) Hypothetical 16.5 kDa protein (Fragment) || Number of peptides = 12 || ambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 64 || ambiguous || 99.6% Confident
PDX3_MOUSE - (P20108) Thioredoxin-dependent peroxide reductase, mitochondrial precursor (EC 1.11.1.-) (Perioredoxin 3) (Antioxidant protein 1) (AOP-1) (MER5 protein) (PRX III) || Number of peptides = 22 || unambiguous || 99.6% Confident
Q9JJL8 - (Q9JJL8) Seryl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.11) || Number of peptides = 5 || unambiguous || 99.6% Confident
CH60_MOUSE - (P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65) || Number of peptides = 340 || unambiguous || 99.6% Confident
Q8VDM6 - (Q8VDM6) Similar to E1B-55 kDa-associated protein 5 || Number of peptides = 5 || unambiguous || 99.6% Confident
IMB1_MOUSE - (P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CWJ1 - (Q9CWJ1) 2410043M02Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
UCR1_MOUSE - (Q9CZ13) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor (EC 1.10.2.2) || Number of peptides = 9 || unambiguous || 99.6% Confident
ECHB_HUMAN - (P55084) Trifunctional enzyme beta subunit, mitochondrial precursor (TP-beta) [Includes: 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase)] || Number of peptides = 1 || ambiguous || 99.6% Confident
G3BP_MOUSE - (P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q91YQ5 - (Q91YQ5) Similar to ribophorin I || Number of peptides = 14 || unambiguous || 99.6% Confident
Q96T12 - (Q96T12) Hypothetical protein FLJ14515 || Number of peptides = 3 || unambiguous || 99.6% Confident
CTN2_MOUSE - (Q61301) Alpha-2 catenin (Alpha-catenin related protein) (Alpha N-catenin) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D9S0 - (Q9D9S0) 1700030F05Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9DAB4 - (Q9DAB4) 1700015E05Rik protein || Number of peptides = 62 || ambiguous || 99.6% Confident
CRTC_MOUSE - (P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) || Number of peptides = 109 || unambiguous || 99.6% Confident
OM70_MOUSE - (Q9CZW5) Mitochondrial precursor proteins import receptor (Translocase of outer membrane TOM70) || Number of peptides = 5 || unambiguous || 99.6% Confident
MDHM_HUMAN - (P40926) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37) || Number of peptides = 9 || unambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 305 || ambiguous || 99.6% Confident
Q61595 - (Q61595) Kinectin || Number of peptides = 19 || unambiguous || 99.6% Confident
Q9CV71 - (Q9CV71) Ribosomal protein, mitochondrial, S7 (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9JM65 - (Q9JM65) Nonclathrin coat protein epsilon-COP (Coatomer protein complex, subunit epsilon) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q922D8 - (Q922D8) Similar to C1-tetrahydrofolate synthase || Number of peptides = 10 || unambiguous || 99.6% Confident
RNT1_MOUSE - (Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9CQU0 - (Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene) || Number of peptides = 16 || unambiguous || 99.6% Confident
ANK1_MOUSE - (Q02357) Ankyrin 1 (Erythrocyte ankyrin) || Number of peptides = 22 || ambiguous || 99.6% Confident
BCAM_MOUSE - (O35855) Branched-chain amino acid aminotransferase, mitochondrial precursor (EC 2.6.1.42) (BCAT(m)) (Fragment) || Number of peptides = 7 || ambiguous || 99.6% Confident
TCPY_MOUSE - (Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q99KI0 - (Q99KI0) Similar to mitochondrial aconitase (Nuclear aco2 gene) || Number of peptides = 67 || unambiguous || 99.6% Confident
Q99KP6 - (Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV) || Number of peptides = 5 || ambiguous || 99.6% Confident
TBA1_HUMAN - (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) || Number of peptides = 31 || ambiguous || 99.6% Confident
LMG2_MOUSE - (Q61092) Laminin gamma-2 chain precursor (Kalinin/nicein/epiligrin 100 kDa subunit) (Laminin B2t chain) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q91X76 - (Q91X76) Similar to hypothetical protein FLJ12442 || Number of peptides = 9 || unambiguous || 99.6% Confident
Q8VHY0 - (Q8VHY0) AN2/NG2 proteoglycan || Number of peptides = 14 || unambiguous || 99.6% Confident
Q8R065 - (Q8R065) Hypothetical 26.3 kDa protein || Number of peptides = 14 || unambiguous || 99.6% Confident
TPP2_MOUSE - (Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CZN1 - (Q9CZN1) 9430083G14Rik protein (RIKEN cDNA 9430083G14 gene) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9DCU6 - (Q9DCU6) 1110017G11Rik protein (Mitochondrial ribosomal protein L4) (L4mt) || Number of peptides = 4 || ambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9DCJ5 - (Q9DCJ5) 0610033L03Rik protein (RIKEN cDNA 0610033L03 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
SPRC_MOUSE - (P07214) SPARC precursor (Secreted protein acidic and rich in cysteine) (Osteonectin) (ON) (Basement membrane protein BM-40) || Number of peptides = 8 || ambiguous || 99.6% Confident
FRDA_MOUSE - (O35943) Frataxin, mitochondrial precursor (Fxn) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9DA61 - (Q9DA61) 2300004O14Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9D009 - (Q9D009) 2610209A20Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
HCD2_MOUSE - (O08756) 3-hydroxyacyl-CoA dehydrogenase type II (EC 1.1.1.35) (Type II HADH) (Endoplasmic reticulum-associated amyloid beta-peptide binding protein) || Number of peptides = 5 || unambiguous || 99.6% Confident
SODM_MOUSE - (P09671) Superoxide dismutase [Mn], mitochondrial precursor (EC 1.15.1.1) || Number of peptides = 5 || unambiguous || 99.6% Confident
DYSF_MOUSE - (Q9ESD7) Dysferlin (Dystrophy associated fer-1 like protein) (Fer-1 like protein 1) || Number of peptides = 6 || unambiguous || 99.6% Confident
PCD8_MOUSE - (Q9Z0X1) Programmed cell death protein 8, mitochondrial precursor (EC 1.-.-.-) (Apoptosis-inducing factor) || Number of peptides = 6 || unambiguous || 99.6% Confident
ATPA_MOUSE - (Q03265) ATP synthase alpha chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 74 || unambiguous || 99.6% Confident
IF2A_HUMAN - (P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q99JY0 - (Q99JY0) Similar to hydroxyacyl-coenzyme A dehydrogenase/3-ketoacyl-coenzyme A thiolase/enoyl-coenzyme A hydratase (Trifunctional protein), beta subunit || Number of peptides = 8 || unambiguous || 99.6% Confident
MUTA_MOUSE - (P16332) Methylmalonyl-CoA mutase, mitochondrial precursor (EC 5.4.99.2) (MCM) || Number of peptides = 9 || unambiguous || 99.6% Confident
CAO1_MOUSE - (Q9R0H0) Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (Palmitoyl-CoA oxidase) (AOX) || Number of peptides = 5 || unambiguous || 99.6% Confident
O88653 - (O88653) MEK binding partner 1 (Mitogen-activated protein kinase kinase 1 interacting protein 1) || Number of peptides = 8 || unambiguous || 99.6% Confident
FUMH_MOUSE - (P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) || Number of peptides = 38 || unambiguous || 99.6% Confident
TCPZ_MOUSE - (P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) || Number of peptides = 7 || unambiguous || 99.6% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 14 || ambiguous || 99.6% Confident
Q99K86 - (Q99K86) Lutheran blood group (Auberger b antigen included) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q91Y37 - (Q91Y37) Cytosolic aminopeptidase P || Number of peptides = 1 || ambiguous || 99.6% Confident
GTFI_MOUSE - (Q9ESZ8) General transcription factor II-I (GTFII-I) (TFII-I) (Bruton tyrosine kinase-associated protein-135) (BTK-associated protein-135) (BAP-135) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9JKR6 - (Q9JKR6) 170 kDa glucose regulated protein GRP170 precursor || Number of peptides = 56 || unambiguous || 99.6% Confident
RS23_HUMAN - (P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23 || Number of peptides = 10 || ambiguous || 99.6% Confident
CACP_MOUSE - (P47934) Carnitine O-acetyltransferase (EC 2.3.1.7) (Carnitine acetylase) (CAT) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q922R8 - (Q922R8) Similar to protein disulfide isomerase-related protein || Number of peptides = 4 || unambiguous || 99.6% Confident
ADRO_MOUSE - (Q61578) NADPH:adrenodoxin oxidoreductase, mitochondrial precursor (EC 1.18.1.2) (Adrenodoxin reductase) (AR) (Ferredoxin-NADP(+) reductase) || Number of peptides = 5 || unambiguous || 99.6% Confident
RL6_MOUSE - (P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) || Number of peptides = 6 || unambiguous || 99.6% Confident
AATM_MOUSE - (P05202) Aspartate aminotransferase, mitochondrial precursor (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-2) || Number of peptides = 40 || unambiguous || 99.6% Confident
ACDS_HUMAN - (P16219) Acyl-CoA dehydrogenase, short-chain specific, mitochondrial precursor (EC 1.3.99.2) (SCAD) (Butyryl-CoA dehydrogenase) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q14700 - (Q14700) Hypothetical protein KIAA0090 (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
2AAA_HUMAN - (P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9DC69 - (Q9DC69) 1010001N11Rik protein || Number of peptides = 12 || unambiguous || 99.6% Confident
Q91WK2 - (Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD) || Number of peptides = 6 || unambiguous || 99.6% Confident
ENPL_MOUSE - (P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) || Number of peptides = 136 || unambiguous || 99.6% Confident
CLP1_MOUSE - (Q08091) Calponin H1, smooth muscle (Basic calponin) (Calponin 1) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q8R1V4 - (Q8R1V4) Similar to RIKEN cDNA 2400003B06 gene || Number of peptides = 2 || unambiguous || 99.6% Confident
CAZ2_MOUSE - (P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) || Number of peptides = 3 || unambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 31 || unambiguous || 99.6% Confident
Q9DCS7 - (Q9DCS7) 0610011D08Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
FABE_MOUSE - (Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
EPPL_HUMAN - (P58107) Epiplakin (450 kDa epidermal antigen) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q8VCC9 - (Q8VCC9) Similar to spondin 1a || Number of peptides = 3 || ambiguous || 99.6% Confident
SPCB_MOUSE - (P15508) Spectrin beta chain, erythrocyte (Beta-I spectrin) || Number of peptides = 15 || unambiguous || 99.6% Confident
CLH1_HUMAN - (Q00610) Clathrin heavy chain 1 (CLH-17) || Number of peptides = 22 || unambiguous || 99.6% Confident
Q9Z2W5 - (Q9Z2W5) Glucosidase I || Number of peptides = 8 || unambiguous || 99.6% Confident
MVP_MOUSE - (Q9EQK5) Major vault protein (MVP) || Number of peptides = 2 || unambiguous || 99.6% Confident
CATZ_MOUSE - (Q9WUU7) Cathepsin Z precursor (EC 3.4.22.-) || Number of peptides = 15 || unambiguous || 99.6% Confident
ARSA_MOUSE - (P50428) Arylsulfatase A precursor (EC 3.1.6.8) (ASA) (Cerebroside-sulfatase) || Number of peptides = 5 || ambiguous || 99.6% Confident
MOES_MOUSE - (P26041) Moesin (Membrane-organizing extension spike protein) || Number of peptides = 3 || ambiguous || 99.6% Confident
COPP_MOUSE - (O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q9D8S9 - (Q9D8S9) 1810037G04Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
PDX1_MOUSE - (P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9D6R2 - (Q9D6R2) 1500012E04Rik protein || Number of peptides = 16 || ambiguous || 99.6% Confident
MPPB_MOUSE - (Q9CXT8) Mitochondrial processing peptidase beta subunit, mitochondrial precursor (EC 3.4.24.64) (Beta-MPP) (P-52) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9ERD3 - (Q9ERD3) Telokin || Number of peptides = 1 || unambiguous || 99.6% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9CYY9 - (Q9CYY9) Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 || Number of peptides = 15 || unambiguous || 99.6% Confident
Q9D051 - (Q9D051) 2610103L06Rik protein (Pyruvate dehydrogenase (Lipoamide) beta) || Number of peptides = 32 || unambiguous || 99.6% Confident
U2AF_MOUSE - (P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9UEV9 - (Q9UEV9) Actin-binding protein homolog ABP-278 || Number of peptides = 12 || unambiguous || 99.6% Confident
O08832 - (O08832) Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase) (UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase) (GalNAc-T4) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9D111 - (Q9D111) 3110050F08Rik protein || Number of peptides = 8 || ambiguous || 99.6% Confident
DHB4_MOUSE - (P51660) Estradiol 17 beta-dehydrogenase 4 (EC 1.1.1.62) (17-beta-HSD 4) (17-beta-hydroxysteroid dehydrogenase 4) || Number of peptides = 3 || unambiguous || 99.6% Confident
T9S1_MOUSE - (Q9DBU0) Transmembrane 9 superfamily protein member 1 precursor || Number of peptides = 4 || ambiguous || 99.6% Confident
RAGE_MOUSE - (Q62151) Advanced glycosylation end product-specific receptor precursor (Receptor for advanced glycosylation end products) || Number of peptides = 2 || unambiguous || 99.6% Confident
RL3_MOUSE - (P27659) 60S ribosomal protein L3 (J1 protein) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q8VDD5 - (Q8VDD5) Nonmuscle heavy chain myosin II-A || Number of peptides = 8 || unambiguous || 99.6% Confident
STRN_MOUSE - (O55106) Striatin || Number of peptides = 9 || unambiguous || 99.6% Confident
A2HS_MOUSE - (P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) || Number of peptides = 12 || unambiguous || 99.6% Confident
CYPB_MOUSE - (P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) || Number of peptides = 23 || unambiguous || 99.6% Confident
Q8R3F5 - (Q8R3F5) Hypothetical 24.9 kDa protein (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q922Q4 - (Q922Q4) Similar to pyrroline 5-carboxylate reductase isoform || Number of peptides = 5 || ambiguous || 99.6% Confident
CPT2_MOUSE - (P52825) Carnitine O-palmitoyltransferase II, mitochondrial precursor (EC 2.3.1.21) (CPT II) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9D0Q7 - (Q9D0Q7) 2600005P05Rik protein || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9D8T7 - (Q9D8T7) 1810035L17Rik protein || Number of peptides = 8 || ambiguous || 99.6% Confident
Q8VCH0 - (Q8VCH0) Similar to acetyl-CoA acyltransferase, 3-oxo acyl-CoA thiolase A, peroxisomal || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9D739 - (Q9D739) 2900002J19Rik protein || Number of peptides = 7 || unambiguous || 99.6% Confident
SEP2_MOUSE - (P42208) Septin 2 (NEDD5 protein) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q91ZP1 - (Q91ZP1) Fibrinogen B-beta-chain (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 141 || ambiguous || 99.6% Confident
Q9P035 - (Q9P035) HSPC121 || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9Z0I9 - (Q9Z0I9) Collagen alpha3(VI) precursor (Fragment) || Number of peptides = 8 || unambiguous || 99.6% Confident
OST4_MOUSE - (O54734) Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit precursor (EC 2.4.1.119) (Oligosaccharyl transferase 48 kDa subunit) (DDOST 48 kDa subunit) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9CWU2 - (Q9CWU2) 2410004E01Rik protein || Number of peptides = 3 || unambiguous || 99.6% Confident
H2AG_HUMAN - (P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q91YE4 - (Q91YE4) 67 kDa polymerase-associated factor PAF67 || Number of peptides = 4 || ambiguous || 99.6% Confident
O35678 - (O35678) MONOGLYCERIDE lipase (EC 3.1.1.23) || Number of peptides = 3 || unambiguous || 99.6% Confident
ACF7_MOUSE - (Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) || Number of peptides = 20 || unambiguous || 99.6% Confident
Q922Q8 - (Q922Q8) Similar to hypothetical protein PRO1855 || Number of peptides = 4 || unambiguous || 99.6% Confident
SEP7_MOUSE - (O55131) Septin 7 (CDC10 protein homolog) || Number of peptides = 17 || ambiguous || 99.6% Confident
Q9D6U8 - (Q9D6U8) 2310056P07Rik protein (RIKEN cDNA 2310056P07 gene) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9DBF1 - (Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1) || Number of peptides = 10 || unambiguous || 99.6% Confident
O08794 - (O08794) Alpha glucosidase II, alpha subunit || Number of peptides = 63 || unambiguous || 99.6% Confident
O08795 - (O08795) Alpha glucosidase II, beta subunit || Number of peptides = 23 || ambiguous || 99.6% Confident
Q9D8V8 - (Q9D8V8) 1810029F08Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
GCDH_MOUSE - (Q60759) Glutaryl-CoA dehydrogenase, mitochondrial precursor (EC 1.3.99.7) (GCD) || Number of peptides = 9 || unambiguous || 99.6% Confident
FBN1_MOUSE - (Q61554) Fibrillin 1 precursor || Number of peptides = 8 || unambiguous || 99.6% Confident
GS28_MOUSE - (O88630) 28 kDa Golgi SNARE protein (Golgi SNAP receptor complex member 1) (28 kDa cis-Golgi SNARE p28) (GOS-28) || Number of peptides = 4 || unambiguous || 99.6% Confident
GR78_MOUSE - (P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) || Number of peptides = 237 || unambiguous || 99.6% Confident
NNTM_MOUSE - (Q61941) NAD(P) transhydrogenase, mitochondrial precursor (EC 1.6.1.2) (Pyridine nucleotide transhydrogenase) (Nicotinamide nucleotide transhydrogenase) || Number of peptides = 10 || unambiguous || 99.6% Confident
VDP_MOUSE - (Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment) || Number of peptides = 5 || ambiguous || 99.6% Confident
CATA_MOUSE - (P24270) Catalase (EC 1.11.1.6) || Number of peptides = 20 || unambiguous || 99.6% Confident
M1A2_MOUSE - (P39098) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2) || Number of peptides = 1 || ambiguous || 99.6% Confident
MYHB_MOUSE - (O08638) Myosin heavy chain, smooth muscle isoform (SMMHC) || Number of peptides = 11 || ambiguous || 99.6% Confident
Q9CPV3 - (Q9CPV3) 2900055D03Rik protein (RIKEN cDNA 2900055D03 gene) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q91VD9 - (Q91VD9) Hypothetical 79.7 kDa protein (Unknown) (Protein for MGC:7850) || Number of peptides = 9 || unambiguous || 99.6% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 29 || unambiguous || 99.6% Confident
KAD4_MOUSE - (Q9WUR9) Adenylate kinase isoenzyme 4, mitochondrial (EC 2.7.4.3) (ATP-AMP transphosphorylase) || Number of peptides = 3 || unambiguous || 99.6% Confident
GBG5_HUMAN - (P30670) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-5 subunit (P30670) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-5 subunit || Number of peptides = 8 || ambiguous || 99.6% Confident
Q8VC93 - (Q8VC93) Prion protein interacting protein || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CWW1 - (Q9CWW1) 2410003B16Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
GB11_MOUSE - (P21278) Guanine nucleotide-binding protein, alpha-11 subunit || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9ESW4 - (Q9ESW4) Putative lipid kinase (Similar to hypothetical protein FLJ10842) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9Z2L6 - (Q9Z2L6) Multiple inositol polyphosphate phosphatase || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9D1E3 - (Q9D1E3) 1110013G13Rik protein || Number of peptides = 5 || ambiguous || 99.6% Confident
UBC7_HUMAN - (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9D900 - (Q9D900) 1810014G04Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
Q91VM9 - (Q91VM9) Similar to pyrophosphatase (Inorganic) || Number of peptides = 1 || unambiguous || 99.6% Confident
HGD_MOUSE - (O09173) Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) || Number of peptides = 3 || unambiguous || 99.6% Confident
PAHX_MOUSE - (O35386) Phytanoyl-CoA dioxygenase, peroxisomal precursor (EC 1.14.11.18) (Phytanoyl-CoA alpha-hydroxylase) (PhyH) (Phytanic acid oxidase) (Lupus nephritis-associated peptide 1) || Number of peptides = 1 || unambiguous || 99.6% Confident
COF1_MOUSE - (P18760) Cofilin, non-muscle isoform || Number of peptides = 22 || unambiguous || 99.6% Confident
Q9CX81 - (Q9CX81) 3100002P13Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
AMAC_MOUSE - (O09174) Alpha-methylacyl-CoA racemase (EC 5.1.99.4) (2-methylacyl-CoA racemase) || Number of peptides = 4 || unambiguous || 99.6% Confident
MTX2_MOUSE - (O88441) Metaxin 2 || Number of peptides = 2 || ambiguous || 99.6% Confident
GSHR_MOUSE - (P47791) Glutathione reductase, mitochondrial precursor (EC 1.6.4.2) (GR) (GRase) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q61291 - (Q61291) AM2 receptor || Number of peptides = 33 || unambiguous || 99.6% Confident
Q924V8 - (Q924V8) Carboxylesterase MH1 (EC 3.1.1.1) || Number of peptides = 42 || ambiguous || 99.6% Confident
Q9DBG4 - (Q9DBG4) 1300012G16Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9D1G1 - (Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) || Number of peptides = 3 || unambiguous || 99.6% Confident
DYNA_MOUSE - (O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) || Number of peptides = 9 || unambiguous || 99.6% Confident
HS9B_MOUSE - (P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) || Number of peptides = 8 || ambiguous || 99.6% Confident
KAD2_MOUSE - (Q9WTP6) Adenylate kinase isoenzyme 2, mitochondrial (EC 2.7.4.3) (ATP-AMP transphosphorylase) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9Z2I0 - (Q9Z2I0) Leucine zipper-EF-hand containing transmembrane protein 1 || Number of peptides = 9 || unambiguous || 99.6% Confident
Q9UJR5 - (Q9UJR5) LST-1/M protein || Number of peptides = 1 || unambiguous || 99.6% Confident
DLDH_MOUSE - (O08749) Dihydrolipoamide dehydrogenase, mitochondrial precursor (EC 1.8.1.4) || Number of peptides = 69 || unambiguous || 99.6% Confident
Q9DBG6 - (Q9DBG6) 1300012C06Rik protein || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9D1H8 - (Q9D1H8) 1110007K17Rik protein (Mitochondrial ribosomal protein L53) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9D1I5 - (Q9D1I5) 1110007A04Rik protein || Number of peptides = 6 || unambiguous || 99.6% Confident
TFR1_MOUSE - (Q62351) Transferrin receptor protein 1 (TfR1) (TR) (TfR) (Trfr) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CRK7 - (Q9CRK7) 9430095H01Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9DAU1 - (Q9DAU1) 1600025D17Rik protein (Putative retinoic acid-regulated protein) (RIKEN cDNA 1600025D17 gene) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q99JA3 - (Q99JA3) Neuronal development-associated protein (Neuronal development-associated protein 7) || Number of peptides = 2 || unambiguous || 99.6% Confident
FLNA_HUMAN - (P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q61646 - (Q61646) Haptoglobin || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9D1L0 - (Q9D1L0) Ethanol induced 6 || Number of peptides = 1 || unambiguous || 99.6% Confident
POR3_MOUSE - (Q60931) Voltage-dependent anion-selective channel protein 3 (VDAC-3) (mVDAC3) (Outer mitochondrial membrane protein porin 3) || Number of peptides = 4 || ambiguous || 99.6% Confident
HS71_MOUSE - (P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) || Number of peptides = 7 || ambiguous || 99.6% Confident
K1CR_MOUSE - (P05784) Keratin, type I cytoskeletal 18 (Cytokeratin 18) (Cytokeratin endo B) (Keratin D) || Number of peptides = 3 || unambiguous || 99.6% Confident
HS47_HUMAN - (P29043) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Colligin 1) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9H724 - (Q9H724) Hypothetical protein FLJ21478 || Number of peptides = 2 || unambiguous || 99.6% Confident
DPP4_MOUSE - (P28843) Dipeptidyl peptidase IV (EC 3.4.14.5) (DPP IV) (T-cell activation antigen CD26) (Thymocyte-activating molecule) (THAM) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9CYA0 - (Q9CYA0) 5730592L21Rik protein || Number of peptides = 5 || unambiguous || 99.6% Confident
O88493 - (O88493) Type VI collagen alpha 3 subunit || Number of peptides = 14 || unambiguous || 99.6% Confident
Q920L1 - (Q920L1) Delta-5 desaturase || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D8A1 - (Q9D8A1) 5033417E09Rik protein || Number of peptides = 4 || ambiguous || 99.6% Confident
IDHG_MOUSE - (P70404) Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial precursor (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD+-specific ICDH) || Number of peptides = 5 || ambiguous || 99.6% Confident
P4H1_MOUSE - (Q60715) Prolyl 4-hydroxylase alpha-1 subunit precursor (EC 1.14.11.2) (4-PH alpha-1) (Procollagen-proline,2-oxoglutarate-4-dioxygenase alpha-1 subunit) || Number of peptides = 15 || unambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 10 || ambiguous || 99.6% Confident
Q9QWJ7 - (Q9QWJ7) Non-erythrocyte beta spectrin || Number of peptides = 6 || ambiguous || 99.6% Confident
RBB9_MOUSE - (O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q922B1 - (Q922B1) Similar to LRP16 protein || Number of peptides = 4 || unambiguous || 99.6% Confident
ACDM_MOUSE - (P45952) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor (EC 1.3.99.3) (MCAD) || Number of peptides = 7 || unambiguous || 99.6% Confident
PSPA_MOUSE - (P35242) Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP) || Number of peptides = 62 || unambiguous || 99.6% Confident
A2A2_MOUSE - (P17427) Adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) || Number of peptides = 5 || ambiguous || 99.6% Confident
IDHP_HUMAN - (P48735) Isocitrate dehydrogenase [NADP], mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) (ICD-M) || Number of peptides = 7 || unambiguous || 99.6% Confident
TCPH_MOUSE - (P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) || Number of peptides = 14 || ambiguous || 99.6% Confident
LICH_MOUSE - (Q9Z0M5) Lysosomal acid lipase/cholesteryl ester hydrolase precursor (EC 3.1.1.13) (LAL) (Acid cholesteryl ester hydrolase) (Sterol esterase) (Lipase A) (Cholesteryl esterase) || Number of peptides = 5 || unambiguous || 99.6% Confident
RB1A_HUMAN - (P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein) || Number of peptides = 9 || ambiguous || 99.6% Confident
PPOX_MOUSE - (P51175) Protoporphyrinogen oxidase (EC 1.3.3.4) (PPO) || Number of peptides = 4 || unambiguous || 99.6% Confident
LA_MOUSE - (P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) || Number of peptides = 2 || ambiguous || 99.6% Confident
RS1A_HUMAN - (P39027) 40S ribosomal protein S15a || Number of peptides = 12 || unambiguous || 99.6% Confident
DNPE_HUMAN - (Q9ULA0) Aspartyl aminopeptidase (EC 3.4.11.21) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9NSE4 - (Q9NSE4) Mitochondrial isoleucine tRNA synthetase (Fragment) || Number of peptides = 6 || unambiguous || 99.6% Confident
GLG1_MOUSE - (Q61543) Golgi apparatus protein 1 precursor (Golgi sialoglycoprotein MG-160) (E-selectin ligand 1) (ESL-1) (Selel) || Number of peptides = 7 || ambiguous || 99.6% Confident
SCB1_MOUSE - (Q9Z2I9) Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursor (EC 6.2.1.5) (Succinyl-CoA synthetase, betaA chain) (SCS-betaA) (ATP-specific succinyl-CoA synthetase beta subunit) (Fragment) || Number of peptides = 9 || unambiguous || 99.6% Confident
VTDB_MOUSE - (P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9DAS8 - (Q9DAS8) 1600029N02Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9DCC6 - (Q9DCC6) 2010012D11Rik protein || Number of peptides = 15 || ambiguous || 99.6% Confident
Q9DCC4 - (Q9DCC4) 1110058B13Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 4 || ambiguous || 99.6% Confident
PA1B_HUMAN - (Q29459) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9D0K2 - (Q9D0K2) 2610008O03Rik protein (RIKEN cDNA 2610008O03 gene) || Number of peptides = 99 || unambiguous || 99.6% Confident
NDR2_MOUSE - (Q9QYG0) NDRG2 protein (Ndr2 protein) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9D201 - (Q9D201) A930008K15Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D1Q6 - (Q9D1Q6) 1110001E24Rik protein (RIKEN cDNA 1110001E24 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
MY5C_HUMAN - (Q9NQX4) Myosin Vc (Myosin 5C) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q922N2 - (Q922N2) Unknown (Protein for MGC:11980) || Number of peptides = 8 || unambiguous || 99.6% Confident
IF3A_MOUSE - (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q9DB20 - (Q9DB20) DNA segment, Chr 12, Wayne state University 28, expressed (Unknown) (Protein for MGC:19017) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q91VT4 - (Q91VT4) Unknown (Protein for MGC:6971) || Number of peptides = 1 || unambiguous || 99.6% Confident
RS4_HUMAN - (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) || Number of peptides = 20 || ambiguous || 99.6% Confident
COX2_MOUSE - (P00405) Cytochrome c oxidase polypeptide II (EC 1.9.3.1) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q99J99 - (Q99J99) Similar to thiosulfate sulfurtransferase (Rhodanese) || Number of peptides = 5 || unambiguous || 99.6% Confident
ODB2_MOUSE - (P53395) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor (EC 2.3.1.-) (E2) (Dihydrolipoamide branched chain transacylase) (BCKAD E2 subunit) || Number of peptides = 18 || unambiguous || 99.6% Confident
IM8A_MOUSE - (Q9WVA2) Mitochondrial import inner membrane translocase subunit TIM8 A (Deafness dystonia protein 1 homolog) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q8VCM7 - (Q8VCM7) Similar to fibrinogen, gamma polypeptide || Number of peptides = 5 || ambiguous || 99.6% Confident
DHAM_MOUSE - (P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2) || Number of peptides = 80 || unambiguous || 99.6% Confident
Q921M4 - (Q921M4) Unknown (Protein for MGC:11816) || Number of peptides = 1 || ambiguous || 99.6% Confident
COPA_HUMAN - (P53621) Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) [Contains: Xenin (Xenopsin-related peptide); Proxenin] || Number of peptides = 9 || unambiguous || 99.6% Confident
RL15_MOUSE - (Q9CZM2) 60S ribosomal protein L15 || Number of peptides = 8 || ambiguous || 99.6% Confident
KC21_MOUSE - (Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37) || Number of peptides = 3 || ambiguous || 99.6% Confident
ADT2_MOUSE - (P51881) ADP,ATP carrier protein, fibroblast isoform (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) || Number of peptides = 21 || ambiguous || 99.6% Confident
Q921X9 - (Q921X9) Similar to for protein disulfide isomerase-related || Number of peptides = 4 || unambiguous || 99.6% Confident
SPCN_HUMAN - (Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) || Number of peptides = 19 || unambiguous || 99.6% Confident
MA32_MOUSE - (O35658) Complement component 1, Q subcomponent binding protein, mitochondrial precursor (Glycoprotein gC1qBP) (GC1q-R protein) || Number of peptides = 14 || ambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 1 || ambiguous || 99.6% Confident
GBR2_HUMAN - (O75899) Gamma-aminobutyric acid type B receptor, subunit 2 precursor (GABA-B receptor 2) (GABA-B-R2) (Gb2) (GABABR2) (G protein-coupled receptor 51) (GPR 51) (HG20) || Number of peptides = 5 || unambiguous || 99.6% Confident
FKB4_MOUSE - (P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) || Number of peptides = 2 || ambiguous || 99.6% Confident
RTN4_MOUSE - (Q99P72) Reticulon 4 (Neurite outgrowth inhibitor) (Nogo protein) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q91VU3 - (Q91VU3) SEC22, vesicle trafficking protein (S. cerevisiae)-like 1 || Number of peptides = 3 || ambiguous || 99.6% Confident
GR75_MOUSE - (P38647) Stress-70 protein, mitochondrial precursor (75 kDa glucose regulated protein) (GRP 75) (Peptide-binding protein 74) (PBP74) (P66 MOT) (Mortalin) || Number of peptides = 97 || unambiguous || 99.6% Confident
RHOA_MOUSE - (Q9QUI0) Transforming protein RhoA || Number of peptides = 9 || ambiguous || 99.6% Confident
TRBM_MOUSE - (P15306) Thrombomodulin precursor (Fetomodulin) (TM) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q91W48 - (Q91W48) Archain 1 || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9D5V9 - (Q9D5V9) 4921514D13Rik protein || Number of peptides = 5 || ambiguous || 99.6% Confident
Q91V41 - (Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q99PC3 - (Q99PC3) CGI-74-like SR-rich protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q91WP2 - (Q91WP2) Hypothetical 116.4 kDa protein || Number of peptides = 28 || unambiguous || 99.6% Confident
ODPA_MOUSE - (P35486) Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursor (EC 1.2.4.1) (PDHE1-A type I) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9D0H2 - (Q9D0H2) 2610017G09Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
RM13_MOUSE - (Q9D1P0) 60S ribosomal protein L13, mitochondrial (L13mt) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q91ZB1 - (Q91ZB1) Dihydrolipoamide S-acetyltransferase (Fragment) || Number of peptides = 18 || unambiguous || 99.6% Confident
P5CS_MOUSE - (Q9Z110) Delta 1-pyrroline-5-carboxylate synthetase (P5CS) [Includes: Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase) (GK); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)] || Number of peptides = 6 || unambiguous || 99.6% Confident
ZNT1_MOUSE - (Q60738) Zinc transporter 1 (ZnT-1) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q99PL5 - (Q99PL5) Ribosome binding protein 1 (Ribosome receptor protein) (RRp) (P180) || Number of peptides = 9 || unambiguous || 99.6% Confident
DYHC_MOUSE - (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) || Number of peptides = 15 || unambiguous || 99.6% Confident
NRP1_MOUSE - (P97333) Neuropilin-1 precursor (A5 protein) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q922H2 - (Q922H2) Similar to pyruvate dehydrogenase kinase, isoenzyme 3 || Number of peptides = 4 || unambiguous || 99.6% Confident
RT22_MOUSE - (Q9CXW2) Mitochondrial 28S ribosomal protein S22 (MRP-S22) || Number of peptides = 4 || unambiguous || 99.6% Confident
ODBA_HUMAN - (P12694) 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component alpha chain (E1)) (BCKDH E1-alpha) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9DBP9 - (Q9DBP9) 1200017E13Rik protein || Number of peptides = 18 || unambiguous || 99.6% Confident
RL7A_MOUSE - (P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) || Number of peptides = 16 || ambiguous || 99.6% Confident
RL22_MOUSE - (P41104) 60S ribosomal protein L22 (Heparin binding protein HBp15) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q91ZA3 - (Q91ZA3) Propionyl CoA-carboxylase alpha-subunit || Number of peptides = 8 || ambiguous || 99.6% Confident
SPCA_MOUSE - (P08032) Spectrin alpha chain, erythrocyte (Erythroid alpha-spectrin) || Number of peptides = 15 || unambiguous || 99.6% Confident
C560_MOUSE - (Q9CZB0) Succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursor (Integral membrane protein CII-3) (QPS1) (QPs-1) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q8R1S2 - (Q8R1S2) Similar to aldehyde dehydrogenase 4 family, member A1 (Fragment) || Number of peptides = 36 || unambiguous || 99.6% Confident
Q99L13 - (Q99L13) Similar to 3-hydroxyisobutyrate dehydrogenase || Number of peptides = 4 || unambiguous || 99.6% Confident
FETA_MOUSE - (P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) || Number of peptides = 35 || unambiguous || 99.6% Confident
AS3A_MOUSE - (P70158) Acid sphingomyelinase-like phosphodiesterase 3a precursor (EC 3.1.4.-) (ASM-like phosphodiesterase 3a) || Number of peptides = 3 || unambiguous || 99.6% Confident
DDX5_HUMAN - (P17844) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5) || Number of peptides = 1 || unambiguous || 99.6% Confident
FKB1_MOUSE - (P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) || Number of peptides = 2 || unambiguous || 99.6% Confident
MPPA_MOUSE - (Q9DC61) Mitochondrial processing peptidase alpha subunit, mitochondrial precursor (EC 3.4.24.64) (Alpha-MPP) (P-55) || Number of peptides = 17 || unambiguous || 99.6% Confident
SE1L_MOUSE - (Q9Z2G6) Sel-1 homolog precursor (Suppressor of lin-12-like protein) (Sel-1L) || Number of peptides = 5 || unambiguous || 99.6% Confident
K1CS_MOUSE - (P19001) Keratin, type I cytoskeletal 19 (Cytokeratin 19) (K19) (CK 19) || Number of peptides = 4 || unambiguous || 99.6% Confident
TRM3_MOUSE - (Q9R1R2) Tripartite motif protein 3 (RING finger protein 22) (RING finger protein HAC1) || Number of peptides = 1 || ambiguous || 99.6% Confident
RS7_HUMAN - (P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) || Number of peptides = 9 || ambiguous || 99.6% Confident
PAGT_MOUSE - (O08912) Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase) (UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase) (GalNAc-T1) (ppGaNTase-T1) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q96HR0 - (Q96HR0) Similar to RIKEN cDNA 0610025L15 gene || Number of peptides = 4 || ambiguous || 99.6% Confident
NIDO_MOUSE - (P10493) Nidogen precursor (Entactin) || Number of peptides = 4 || unambiguous || 99.6% Confident
TCPE_MOUSE - (P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) || Number of peptides = 9 || unambiguous || 99.6% Confident
RNP6_MOUSE - (Q9CQ01) Ribonuclease 6 precursor (EC 3.1.27.-) || Number of peptides = 4 || unambiguous || 99.6% Confident
ABD3_MOUSE - (P55096) ATP-binding cassette, sub-family D, member 3 (70 kDa peroxisomal membrane protein) (PMP70) (PMP68) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q91V31 - (Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence) || Number of peptides = 5 || ambiguous || 99.6% Confident
ANX2_MOUSE - (P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV) || Number of peptides = 3 || unambiguous || 99.6% Confident
ARF1_HUMAN - (P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 || Number of peptides = 9 || ambiguous || 99.6% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 10 || ambiguous || 99.6% Confident
Q64449 - (Q64449) Lectin lambda || Number of peptides = 9 || unambiguous || 99.6% Confident
Q99LG0 - (Q99LG0) Similar to ubiquitin specific protease 16 || Number of peptides = 4 || unambiguous || 99.6% Confident
Q8R0B2 - (Q8R0B2) Hypothetical 26.4 kDa protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CZ47 - (Q9CZ47) 2610040F05Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
H11_MOUSE - (P43275) Histone H1.1 (H1 VAR.3) (H1A) || Number of peptides = 2 || unambiguous || 99.6% Confident
IDE_HUMAN - (P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9JHJ3 - (Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) || Number of peptides = 13 || unambiguous || 99.6% Confident
RL4_MOUSE - (Q9D8E6) 60S ribosomal protein L4 (L1) || Number of peptides = 3 || ambiguous || 99.6% Confident
PYRG_MOUSE - (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) || Number of peptides = 2 || unambiguous || 99.6% Confident
DHBK_MOUSE - (O70503) Putative steroid dehydrogenase KIK-I (EC 1.1.1.-) || Number of peptides = 3 || unambiguous || 99.5% Confident
GDIC_MOUSE - (Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) || Number of peptides = 2 || ambiguous || 99.5% Confident
Q9D7R6 - (Q9D7R6) 2010005E08Rik protein || Number of peptides = 3 || ambiguous || 99.5% Confident
GLYM_HUMAN - (P34897) Serine hydroxymethyltransferase, mitochondrial precursor (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) || Number of peptides = 5 || unambiguous || 99.5% Confident
PGBM_MOUSE - (Q05793) Basement membrane-specific heparan sulfate proteoglycan core protein precursor (HSPG) (Perlecan) (PLC) || Number of peptides = 14 || unambiguous || 99.5% Confident
Q8R0W0 - (Q8R0W0) Hypothetical 25.2 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 99.5% Confident
O88526 - (O88526) Nitrilase homolog 1 || Number of peptides = 1 || ambiguous || 99.5% Confident
Q9CZ56 - (Q9CZ56) 2810405J23Rik protein || Number of peptides = 2 || ambiguous || 99.5% Confident
IF5_HUMAN - (P55010) Eukaryotic translation initiation factor 5 (eIF-5) || Number of peptides = 2 || unambiguous || 99.5% Confident
ECH1_MOUSE - (O35459) Delta3,5-delta2,4-dienoyl-CoA isomerase, mitochondrial precursor (EC 5.3.3.-) || Number of peptides = 5 || unambiguous || 99.5% Confident
GCST_HUMAN - (P48728) Aminomethyltransferase, mitochondrial precursor (EC 2.1.2.10) (Glycine cleavage system T protein) (GCVT) || Number of peptides = 5 || unambiguous || 99.5% Confident
GBB2_HUMAN - (P11016) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) (P11016) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) || Number of peptides = 4 || ambiguous || 99.5% Confident
Q9D285 - (Q9D285) Adult male colon cDNA, RIKEN full-length enriched library, clone:9030215D04, full insert sequence || Number of peptides = 1 || ambiguous || 99.5% Confident
DHE3_MOUSE - (P26443) Glutamate dehydrogenase, mitochondrial precursor (EC 1.4.1.3) (GDH) || Number of peptides = 24 || ambiguous || 99.5% Confident
Q9D8P4 - (Q9D8P4) Ribosomal protein, mitochondrial, L26 || Number of peptides = 2 || unambiguous || 99.5% Confident
CHD1_MOUSE - (P40201) Chromodomain-helicase-DNA-binding protein 1 (CHD-1) || Number of peptides = 4 || unambiguous || 99.5% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 3 || unambiguous || 99.4% Confident
Q91YJ2 - (Q91YJ2) Similar to sorting nexin 4 || Number of peptides = 1 || unambiguous || 99.4% Confident
LMA5_MOUSE - (Q61001) Laminin alpha-5 chain precursor || Number of peptides = 16 || unambiguous || 99.4% Confident
BUB3_MOUSE - (Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5) || Number of peptides = 3 || ambiguous || 99.4% Confident
PL10_MOUSE - (P16381) Putative ATP-dependent RNA helicase PL10 || Number of peptides = 5 || unambiguous || 99.4% Confident
RL30_HUMAN - (P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 || Number of peptides = 3 || ambiguous || 99.4% Confident
AMPE_MOUSE - (P16406) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopeptidase A) (APA) (BP-1/6C3 antigen) || Number of peptides = 7 || unambiguous || 99.4% Confident
Q9CYW4 - (Q9CYW4) 2810435D12Rik protein (RIKEN cDNA 2810435D12 gene) || Number of peptides = 6 || unambiguous || 99.4% Confident
CYC_MOUSE - (P00009) Cytochrome c, somatic || Number of peptides = 12 || ambiguous || 99.4% Confident
Q9H8Y7 - (Q9H8Y7) Hypothetical protein FLJ13140 || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9Z1X5 - (Q9Z1X5) GLUT4 vesicle protein (Fragment) || Number of peptides = 5 || ambiguous || 99.4% Confident
Q9D7N9 - (Q9D7N9) 2310001A20Rik protein (Integral plasma membrane protein) || Number of peptides = 2 || unambiguous || 99.4% Confident
O54893 - (O54893) Putative membrane-associated guanylate kinase 1 || Number of peptides = 6 || unambiguous || 99.4% Confident
Q9ER58 - (Q9ER58) Testican-2 protein precursor || Number of peptides = 1 || unambiguous || 99.4% Confident
Q9CYN6 - (Q9CYN6) 5730405E07Rik protein || Number of peptides = 4 || unambiguous || 99.4% Confident
Q8R1S0 - (Q8R1S0) Similar to CGI-10 protein (Fragment) || Number of peptides = 4 || unambiguous || 99.4% Confident
ATY2_MOUSE - (Q9EPE9) Probable cation-transporting ATPase 2 (EC 3.6.3.-) (CATP) || Number of peptides = 5 || unambiguous || 99.4% Confident
Q8R2K3 - (Q8R2K3) Similar to single-stranded DNA binding protein || Number of peptides = 2 || ambiguous || 99.4% Confident
Q9QZE5 - (Q9QZE5) Coat protein gamma-cop (Coatomer protein complex, subunit gamma 1) || Number of peptides = 9 || unambiguous || 99.4% Confident
GNT1_MOUSE - (P27808) Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC 2.4.1.101) (N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I) (GNT-I) (GlcNAc-T I) || Number of peptides = 1 || ambiguous || 99.4% Confident
Q9D050 - (Q9D050) 2310034D24Rik protein || Number of peptides = 2 || ambiguous || 99.4% Confident
Q9D6E6 - (Q9D6E6) 2900073G15Rik protein || Number of peptides = 4 || unambiguous || 99.4% Confident
Q8R2M5 - (Q8R2M5) Hypothetical 60.1 kDa protein (Fragment) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9DCN3 - (Q9DCN3) 0610016I07Rik protein || Number of peptides = 5 || ambiguous || 99.4% Confident
PIMT_MOUSE - (P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) || Number of peptides = 3 || unambiguous || 99.3% Confident
ITA2_MOUSE - (Q62469) Integrin alpha-2 precursor (Platelet membrane glycoprotein Ia) (GPIa) (Collagen receptor) (VLA-2 alpha chain) (CD49b) || Number of peptides = 3 || unambiguous || 99.3% Confident
MPCP_MOUSE - (Q8VEM8) Phosphate carrier protein, mitochondrial precursor (PTP) || Number of peptides = 5 || unambiguous || 99.3% Confident
Q8VDP1 - (Q8VDP1) Similar to hypothetical protein FLJ10276 (Fragment) || Number of peptides = 1 || ambiguous || 99.3% Confident
FKB2_MOUSE - (P45878) FK506-binding protein precursor (FKBP-13) (Peptidyl-prolyl cis-trans isomerase) (PPiase) (EC 5.2.1.8) || Number of peptides = 5 || unambiguous || 99.3% Confident
SSDH_HUMAN - (P51649) Succinate semialdehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.24) (NAD(+)-dependent succinic semialdehyde dehydrogenase) || Number of peptides = 6 || unambiguous || 99.3% Confident
CTNB_MOUSE - (Q02248) Beta-catenin || Number of peptides = 4 || ambiguous || 99.3% Confident
RCN1_MOUSE - (Q05186) Reticulocalbin 1 precursor || Number of peptides = 5 || ambiguous || 99.3% Confident
FMO5_MOUSE - (P97872) Dimethylaniline monooxygenase [N-oxide forming] 5 (EC 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) || Number of peptides = 2 || ambiguous || 99.3% Confident
Q9R0B9 - (Q9R0B9) Lysyl hydroxylase isoform 2 || Number of peptides = 7 || ambiguous || 99.3% Confident
NPC2_MOUSE - (Q9Z0J0) Epididymal secretory protein E1 precursor || Number of peptides = 2 || unambiguous || 99.3% Confident
Q8VCM4 - (Q8VCM4) Similar to lipoyltransferase || Number of peptides = 1 || unambiguous || 99.3% Confident
PHB_MOUSE - (P24142) Prohibitin (B-cell receptor associated protein 32) (BAP 32) || Number of peptides = 8 || ambiguous || 99.3% Confident
Q9CRD7 - (Q9CRD7) 1700021I09Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 99.3% Confident
Q99LP6 - (Q99LP6) Putative grpE protein homolog || Number of peptides = 6 || ambiguous || 99.3% Confident
CAH2_MOUSE - (P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) || Number of peptides = 5 || ambiguous || 99.3% Confident
RL29_MOUSE - (P47915) 60S ribosomal protein L29 || Number of peptides = 1 || unambiguous || 99.3% Confident
Q99KR3 - (Q99KR3) Hypothetical 32.8 kDa protein || Number of peptides = 1 || unambiguous || 99.3% Confident
THI2_MOUSE - (P97493) Thioredoxin, mitochondrial precursor (Mt-TRX) (Thioredoxin 2) || Number of peptides = 3 || unambiguous || 99.2% Confident
Q923C1 - (Q923C1) Similar to alpha 1,2-mannosidase (Fragment) || Number of peptides = 4 || unambiguous || 99.2% Confident
TPP2_HUMAN - (P29144) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) || Number of peptides = 3 || unambiguous || 99.2% Confident
EZRI_MOUSE - (P26040) Ezrin (p81) (Cytovillin) (Villin 2) || Number of peptides = 6 || ambiguous || 99.2% Confident
Q91YK9 - (Q91YK9) RIKEN cDNA 0610009D10 gene || Number of peptides = 2 || ambiguous || 99.2% Confident
Q8R0M4 - (Q8R0M4) Hypothetical 67.1 kDa protein (Fragment) || Number of peptides = 8 || unambiguous || 99.2% Confident
NOC4_MOUSE - (O70378) Neighbor of COX4 || Number of peptides = 4 || unambiguous || 99.2% Confident
HG2A_MOUSE - (P04441) H-2 class II histocompatibility antigen, gamma chain (MHC class II associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD74 antigen) || Number of peptides = 3 || unambiguous || 99.2% Confident
TO1B_MOUSE - (Q9ER41) Torsin B precursor || Number of peptides = 3 || ambiguous || 99.2% Confident
SORL_MOUSE - (O88307) Sortilin-related receptor precursor (Sorting protein-related receptor containing LDLR class A repeats) (mSorLA) (SorLA-1) (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding repeats) (LR11) (Gp250) || Number of peptides = 12 || unambiguous || 99.1% Confident
RL13_MOUSE - (P47963) 60S ribosomal protein L13 (A52) || Number of peptides = 3 || unambiguous || 99.1% Confident
RT16_MOUSE - (Q9CPX7) 28S ribosomal protein S16, mitochondrial precursor (MRP-S16) || Number of peptides = 1 || ambiguous || 99.1% Confident
Q9EPF1 - (Q9EPF1) L-gicerin/MUC18 || Number of peptides = 3 || unambiguous || 99.1% Confident
Q96L19 - (Q96L19) Similar to lactate dehydrogenase 1, A chain || Number of peptides = 2 || unambiguous || 99.1% Confident
Q9BY44 - (Q9BY44) CDA02 || Number of peptides = 4 || unambiguous || 99.1% Confident
Q9CPW2 - (Q9CPW2) B230118G17Rik protein || Number of peptides = 4 || unambiguous || 99.1% Confident
Q91V12 - (Q91V12) Acyl-CoA hydrolase (Hypothetical 37.6 kDa protein) || Number of peptides = 2 || ambiguous || 99.1% Confident
HBD_HUMAN - (P02042) Hemoglobin delta chain || Number of peptides = 1 || unambiguous || 99.1% Confident
Q9EQR0 - (Q9EQR0) Fatty acid synthase || Number of peptides = 12 || unambiguous || 99.1% Confident
Q9DBD3 - (Q9DBD3) 1300017C12Rik protein || Number of peptides = 1 || ambiguous || 99.1% Confident
Q9DC20 - (Q9DC20) 1200006O19Rik protein || Number of peptides = 1 || unambiguous || 99.1% Confident
Q9D023 - (Q9D023) 2610205H19Rik protein (RIKEN cDNA 2610205H19 gene) || Number of peptides = 2 || ambiguous || 99.1% Confident
SCB2_MOUSE - (Q9Z2I8) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, betaG chain) (SCS-betaG) (GTP-specific succinyl-CoA synthetase beta subunit) (Fragment) || Number of peptides = 5 || unambiguous || 99.1% Confident
RL11_MOUSE - (Q9CXW4) 60S ribosomal protein L11 || Number of peptides = 8 || ambiguous || 99.1% Confident
Q63918 - (Q63918) Serum deprivation response (Sdpr protein) || Number of peptides = 5 || unambiguous || 99.1% Confident
Q9CVB6 - (Q9CVB6) 2210023N03Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 99.1% Confident
Q8R016 - (Q8R016) Similar to bleomycin hydrolase || Number of peptides = 3 || unambiguous || 99.1% Confident
CYPM_MOUSE - (Q99KR7) Peptidyl-prolyl cis-trans isomerase, mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin F) || Number of peptides = 6 || unambiguous || 99.1% Confident
HS9A_MOUSE - (P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) || Number of peptides = 8 || unambiguous || 99.1% Confident
Q9UFH2 - (Q9UFH2) Hypothetical protein || Number of peptides = 5 || unambiguous || 99.1% Confident
Q91VH9 - (Q91VH9) Eukaryotic translation termination factor 1 || Number of peptides = 2 || ambiguous || 99.1% Confident
ST13_MOUSE - (Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) || Number of peptides = 1 || ambiguous || 99.1% Confident
NSF_MOUSE - (P46460) Vesicular-fusion protein NSF (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) (SKD2 protein) || Number of peptides = 1 || ambiguous || 99.1% Confident
TCPQ_MOUSE - (P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta) || Number of peptides = 3 || unambiguous || 99.0% Confident
R10A_MOUSE - (P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) || Number of peptides = 4 || unambiguous || 99.0% Confident
Q9D665 - (Q9D665) 4632417N05Rik protein || Number of peptides = 4 || ambiguous || 99.0% Confident
CATH_MOUSE - (P49935) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3) (Cathepsin BA) || Number of peptides = 6 || unambiguous || 99.0% Confident
SG2N_MOUSE - (Q9ERG2) Cell-cycle autoantigen SG2NA (S/G2 antigen) || Number of peptides = 4 || unambiguous || 98.9% Confident
Q9D157 - (Q9D157) 0610025K21Rik protein || Number of peptides = 4 || unambiguous || 98.9% Confident
PTB_MOUSE - (P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) || Number of peptides = 6 || ambiguous || 98.9% Confident
Q62219 - (Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5) || Number of peptides = 3 || unambiguous || 98.8% Confident
Q96MT3 - (Q96MT3) Hypothetical protein FLJ31937 || Number of peptides = 3 || unambiguous || 98.8% Confident
Q9GZV2 - (Q9GZV2) PGE1 transporter (Organic anion transporter polypeptide-related protein 3) || Number of peptides = 3 || ambiguous || 98.8% Confident
RAB2_MOUSE - (P53994) Ras-related protein Rab-2 || Number of peptides = 2 || ambiguous || 98.8% Confident
Q62009 - (Q62009) Osteoblast specific factor 2 precursor (OSF-2) || Number of peptides = 4 || unambiguous || 98.8% Confident
Q9DC44 - (Q9DC44) 1200003J13Rik protein || Number of peptides = 5 || ambiguous || 98.8% Confident
DLK_MOUSE - (Q09163) Delta-like protein precursor (DLK) (Preadipocyte factor 1) (Pref-1) (Adipocyte differentiation inhibitor protein) [Contains: Fetal antigen 1 (FA1)] || Number of peptides = 7 || unambiguous || 98.7% Confident
Q9DAE4 - (Q9DAE4) 1700012F10Rik protein || Number of peptides = 1 || ambiguous || 98.6% Confident
Q9CT45 - (Q9CT45) 2600014C01Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 98.6% Confident
BRF3_HUMAN - (Q9ULD4) Bromodomain and PHD finger-containing protein 3 (Fragment) || Number of peptides = 2 || ambiguous || 98.6% Confident
RS26_HUMAN - (P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26 || Number of peptides = 1 || ambiguous || 98.6% Confident
CALX_MOUSE - (P35564) Calnexin precursor || Number of peptides = 6 || unambiguous || 98.6% Confident
IMD2_MOUSE - (P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) || Number of peptides = 3 || ambiguous || 98.6% Confident
41_MOUSE - (P48193) Protein 4.1 (Band 4.1) (P4.1) (4.1R) || Number of peptides = 3 || unambiguous || 98.6% Confident
A1M2_HUMAN - (Q9Y6Q5) Adaptor-related protein complex 1, mu 2 subunit (Mu-adaptin 2) (Adaptor protein complex AP-1 mu-2 subunit) (Golgi adaptor HA1/AP1 adaptin mu-2 subunit) (Clathrin assembly protein assembly protein complex 1 medium chain 2) (AP-mu chain family member mu1B) || Number of peptides = 2 || unambiguous || 98.6% Confident
RL12_MOUSE - (P35979) 60S ribosomal protein L12 || Number of peptides = 3 || unambiguous || 98.6% Confident
CD38_MOUSE - (P56528) ADP-ribosyl cyclase 1 (EC 3.2.2.5) (Cyclic ADP-ribose hydrolase 1) (cADPr hydrolase 1) (NIM-R5 antigen) (I-19) || Number of peptides = 4 || unambiguous || 98.6% Confident
Q924D0 - (Q924D0) NOGO-interacting mitochondrial protein || Number of peptides = 3 || unambiguous || 98.6% Confident
AMRP_MOUSE - (P55302) Alpha-2-macroglobulin receptor-associated protein precursor (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) (Heparin binding protein-44) (HBP-44) || Number of peptides = 7 || unambiguous || 98.6% Confident
O15045 - (O15045) Hypothetical protein KIAA0336 || Number of peptides = 4 || unambiguous || 98.6% Confident
Q9CQ99 - (Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) || Number of peptides = 4 || unambiguous || 98.6% Confident
APP2_MOUSE - (Q06335) Amyloid-like protein 2 precursor (CDEI-box binding protein) (CDEBP) || Number of peptides = 3 || ambiguous || 98.6% Confident
Q9DC16 - (Q9DC16) 1200007D18Rik protein (RIKEN cDNA 1200007D18 gene) || Number of peptides = 1 || unambiguous || 98.6% Confident
THIM_HUMAN - (P42765) 3-ketoacyl-CoA thiolase, mitochondrial (EC 2.3.1.16) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (Mitochondrial 3-oxoacyl-CoA thiolase) (T1) || Number of peptides = 23 || unambiguous || 98.6% Confident
P70388 - (P70388) RAD50 || Number of peptides = 4 || unambiguous || 98.5% Confident
Q9QY03 - (Q9QY03) ERO1L || Number of peptides = 2 || unambiguous || 98.4% Confident
Q9WVJ3 - (Q9WVJ3) Aminopeptidase || Number of peptides = 5 || unambiguous || 98.4% Confident
MTP_MOUSE - (O08601) Microsomal triglyceride transfer protein, large subunit precursor || Number of peptides = 6 || unambiguous || 98.3% Confident
Q9D5X8 - (Q9D5X8) 4921508E09Rik protein || Number of peptides = 7 || unambiguous || 98.3% Confident
CO3_MOUSE - (P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] || Number of peptides = 13 || unambiguous || 98.3% Confident
TALI_MOUSE - (P26039) Talin || Number of peptides = 10 || unambiguous || 98.3% Confident
Q8TD57 - (Q8TD57) Axonemal heavy chain dynein type 3 || Number of peptides = 11 || unambiguous || 98.2% Confident
Q8VF90 - (Q8VF90) Olfactory receptor MOR235-2 || Number of peptides = 1 || unambiguous || 98.2% Confident
Q9JLN5 - (Q9JLN5) Erythroid membrane-associated protein ERMAP || Number of peptides = 2 || unambiguous || 98.2% Confident
RS12_MOUSE - (P09388) 40S ribosomal protein S12 || Number of peptides = 1 || ambiguous || 98.2% Confident
Q9HCJ0 - (Q9HCJ0) Hypothetical protein KIAA1582 (Fragment) || Number of peptides = 9 || unambiguous || 98.2% Confident
TERA_MOUSE - (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] || Number of peptides = 12 || ambiguous || 98.2% Confident
TBL2_MOUSE - (Q9R099) Transducin beta-like 2 protein || Number of peptides = 3 || unambiguous || 98.1% Confident
ANX6_MOUSE - (P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II) || Number of peptides = 2 || unambiguous || 98.1% Confident
TCP1_MOUSE - (P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) || Number of peptides = 4 || ambiguous || 98.1% Confident
Q9CXI5 - (Q9CXI5) 3230402M22Rik protein || Number of peptides = 3 || ambiguous || 98.1% Confident
R22A_MOUSE - (P35285) Ras-related protein Rab-22A (RAB-14) (Fragment) || Number of peptides = 6 || ambiguous || 98.0% Confident
Q9D2V2 - (Q9D2V2) 1300006C19Rik protein || Number of peptides = 1 || ambiguous || 98.0% Confident
Q8R4I1 - (Q8R4I1) Ataxin-7 || Number of peptides = 6 || unambiguous || 98.0% Confident
Q99KW2 - (Q99KW2) Similar to myosin 5C || Number of peptides = 3 || unambiguous || 98.0% Confident
DPP3_MOUSE - (Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) || Number of peptides = 5 || unambiguous || 98.0% Confident
Q9DCY2 - (Q9DCY2) 2310045J23Rik protein || Number of peptides = 2 || ambiguous || 97.9% Confident
THI2_HUMAN - (Q99757) Thioredoxin, mitochondrial precursor (Mt-TRX) (Thioredoxin 2) || Number of peptides = 2 || unambiguous || 97.9% Confident
Q9DD10 - (Q9DD10) B430104H02Rik protein || Number of peptides = 2 || ambiguous || 97.9% Confident
Q8R117 - (Q8R117) Hypothetical 37.8 kDa protein (Fragment) || Number of peptides = 4 || unambiguous || 97.8% Confident
Q9DCI7 - (Q9DCI7) 1200012F07Rik protein || Number of peptides = 4 || unambiguous || 97.8% Confident
HNT1_MOUSE - (P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) || Number of peptides = 5 || unambiguous || 97.7% Confident
PMG1_MOUSE - (Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) || Number of peptides = 2 || ambiguous || 97.6% Confident
Q9D9F6 - (Q9D9F6) 1700082C19Rik protein || Number of peptides = 1 || ambiguous || 97.6% Confident
PSPC_MOUSE - (P21841) Pulmonary surfactant-associated protein C precursor (SP-C) (SP5) (Pulmonary surfactant-associated proteolipid SPL(Val)) || Number of peptides = 6 || unambiguous || 97.6% Confident
Q921V5 - (Q921V5) Similar to mannosyl (Alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (Hypothetical 51.0 kDa protein) || Number of peptides = 1 || ambiguous || 97.6% Confident
RAPB_HUMAN - (P09526) Ras-related protein RAP-1b (GTP-binding protein smg p21B) || Number of peptides = 1 || ambiguous || 97.6% Confident
PODX_MOUSE - (Q9R0M4) Podocalyxin-like protein 1 precursor || Number of peptides = 2 || unambiguous || 97.6% Confident
Q96M77 - (Q96M77) Hypothetical protein FLJ32771 || Number of peptides = 5 || unambiguous || 97.5% Confident
Q96B94 - (Q96B94) Similar to KIAA0807 protein || Number of peptides = 3 || ambiguous || 97.5% Confident
RAPA_HUMAN - (P10113) Ras-related protein RAP-1A (C21KG) (KREV-1 protein) (GTP-binding protein SMG-P21A) (G-22K) (P10113) Ras-related protein RAP-1A (C21KG) (KREV-1 protein) (GTP-binding protein SMG-P21A) (G-22K) || Number of peptides = 2 || ambiguous || 97.5% Confident
EF1G_MOUSE - (Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) || Number of peptides = 6 || unambiguous || 97.4% Confident
MLEN_MOUSE - (Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) || Number of peptides = 5 || ambiguous || 97.3% Confident
Q9CPN8 - (Q9CPN8) 10 days embryo cDNA, RIKEN full-length enriched library, clone:2610036B18, full insert sequence (Igf2 mRNA-binding protein 3) || Number of peptides = 2 || unambiguous || 97.3% Confident
Q91ZW2 - (Q91ZW2) GDP-fucose protein O-fucosyltransferase 1 precursor (EC 2.4.1.-) (O-fucosyltransferase) (O-FucT-1) || Number of peptides = 3 || unambiguous || 97.3% Confident
HERP_MOUSE - (Q9JJK5) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein || Number of peptides = 2 || unambiguous || 97.3% Confident
O88811 - (O88811) HRS binding protein (1200004O12RIK protein) (Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2) || Number of peptides = 3 || unambiguous || 97.2% Confident
ODBB_HUMAN - (P21953) 2-oxoisovalerate dehydrogenase beta subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component beta chain (E1)) (BCKDH E1-beta) || Number of peptides = 1 || unambiguous || 97.2% Confident
SMO_MOUSE - (P56726) Smoothened homolog precursor (SMO) || Number of peptides = 2 || unambiguous || 97.2% Confident
CH10_MOUSE - (Q64433) 10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (CPN10) || Number of peptides = 21 || ambiguous || 97.2% Confident
Q924I0 - (Q924I0) Elongation factor G || Number of peptides = 4 || unambiguous || 97.1% Confident
O35405 - (O35405) Schwannoma-associated protein || Number of peptides = 5 || unambiguous || 97.1% Confident
NEO1_MOUSE - (P97798) Neogenin precursor || Number of peptides = 3 || unambiguous || 97.1% Confident
Q9JJ06 - (Q9JJ06) Core1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase (EC 2.4.1.122) || Number of peptides = 1 || ambiguous || 97.1% Confident
Q8R339 - (Q8R339) Hypothetical 67.9 kDa protein || Number of peptides = 2 || unambiguous || 97.0% Confident
Q9CUB4 - (Q9CUB4) 4933430B08Rik protein (Fragment) || Number of peptides = 5 || ambiguous || 97.0% Confident
Q64028 - (Q64028) Early development regulator protein 1 (RAE-28) (Polyhomeotic protein homolog) (MPH1) || Number of peptides = 11 || unambiguous || 96.9% Confident
COXG_MOUSE - (P56391) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1) (AED) || Number of peptides = 1 || ambiguous || 96.9% Confident
Q96T26 - (Q96T26) Lung seven transmembrane receptor 1 || Number of peptides = 2 || ambiguous || 96.8% Confident
H2AO_HUMAN - (P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615) (P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615) || Number of peptides = 2 || ambiguous || 96.6% Confident
Q9JJ28 - (Q9JJ28) Fliih protein || Number of peptides = 5 || unambiguous || 96.6% Confident
Q9WV66 - (Q9WV66) Axotrophin || Number of peptides = 2 || unambiguous || 96.6% Confident
Q8VC94 - (Q8VC94) Hypothetical 19.0 kDa protein || Number of peptides = 1 || ambiguous || 96.6% Confident
NUCG_MOUSE - (O08600) Endonuclease G, mitochondrial precursor (EC 3.1.30.-) (Endo G) || Number of peptides = 2 || unambiguous || 96.6% Confident
YAB1_MOUSE - (Q60936) Hypothetical heart protein (Fragment) || Number of peptides = 6 || unambiguous || 96.5% Confident
EMD_MOUSE - (O08579) Emerin || Number of peptides = 2 || unambiguous || 96.5% Confident
M3K3_MOUSE - (Q61084) Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.1.-) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) || Number of peptides = 1 || ambiguous || 96.5% Confident
Q96GK8 - (Q96GK8) cAMP responsive element binding protein 3 (Luman) || Number of peptides = 1 || unambiguous || 96.5% Confident
Q8WZ39 - (Q8WZ39) Hypothetical protein || Number of peptides = 1 || unambiguous || 96.5% Confident
PHS3_HUMAN - (P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) || Number of peptides = 1 || unambiguous || 96.4% Confident
H2AZ_HUMAN - (P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z) || Number of peptides = 2 || ambiguous || 96.4% Confident
Q9BX80 - (Q9BX80) ATP-binding cassette transporter MRP8 || Number of peptides = 4 || ambiguous || 96.4% Confident
Q8VEL4 - (Q8VEL4) Hypothetical 28.4 kDa protein || Number of peptides = 2 || ambiguous || 96.4% Confident
MBNL_MOUSE - (Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein) || Number of peptides = 2 || ambiguous || 96.4% Confident
CYB5_MOUSE - (P56395) Cytochrome b5 || Number of peptides = 4 || unambiguous || 96.4% Confident
Q8VC42 - (Q8VC42) Hypothetical 74.9 kDa protein || Number of peptides = 2 || ambiguous || 96.3% Confident
Q9Y2K3 - (Q9Y2K3) Hypothetical protein KIAA1000 (Fragment) || Number of peptides = 1 || unambiguous || 96.3% Confident
Q9CVV3 - (Q9CVV3) 1700026P10Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 96.3% Confident
Q8R3Q6 - (Q8R3Q6) Similar to CG15881 gene product (H. sapiens) || Number of peptides = 1 || unambiguous || 96.3% Confident
ITA6_HUMAN - (P23229) Integrin alpha-6 precursor (VLA-6) (CD49f) || Number of peptides = 7 || unambiguous || 96.3% Confident
EHD1_MOUSE - (Q9WVK4) EH-domain containing protein 1 (mPAST1) || Number of peptides = 4 || unambiguous || 96.3% Confident
VINC_MOUSE - (Q64727) Vinculin (Metavinculin) || Number of peptides = 8 || unambiguous || 96.1% Confident
Q9ERN6 - (Q9ERN6) Cardiac Ca2+ release channel || Number of peptides = 12 || unambiguous || 96.1% Confident
Q9DBA2 - (Q9DBA2) 1500000I11Rik protein || Number of peptides = 1 || ambiguous || 96.1% Confident
Q8R4Y7 - (Q8R4Y7) Prominin-related protein || Number of peptides = 7 || unambiguous || 96.0% Confident
TARA_MOUSE - (Q99KW3) Protein Tara (Trio-associated repeat on actin) (Fragment) || Number of peptides = 1 || unambiguous || 95.9% Confident
ATPF_MOUSE - (Q9CQQ7) ATP synthase B chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 1 || ambiguous || 95.8% Confident
O94836 - (O94836) Hypothetical protein KIAA0731 (Fragment) || Number of peptides = 3 || unambiguous || 95.8% Confident
CA39_HUMAN - (Q14050) Collagen alpha 3(IX) chain precursor || Number of peptides = 4 || unambiguous || 95.8% Confident
Q9D1C3 - (Q9D1C3) 2610022G08Rik protein || Number of peptides = 1 || unambiguous || 95.7% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 2 || ambiguous || 95.7% Confident
Q8R3B4 - (Q8R3B4) Similar to dysferlin (Fragment) || Number of peptides = 6 || unambiguous || 95.7% Confident
PDX4_MOUSE - (O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) || Number of peptides = 3 || unambiguous || 95.7% Confident
Z334_HUMAN - (Q9HCZ1) Zinc finger protein 334 || Number of peptides = 1 || unambiguous || 95.6% Confident
ER29_MOUSE - (P57759) Endoplasmic reticulum protein ERp29 precursor || Number of peptides = 11 || unambiguous || 95.6% Confident
Q9H6M4 - (Q9H6M4) Hypothetical protein FLJ22098 (Fragment) || Number of peptides = 4 || unambiguous || 95.6% Confident
Q9BWL4 - (Q9BWL4) Hypothetical protein || Number of peptides = 1 || unambiguous || 95.5% Confident
GTP1_MOUSE - (P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) || Number of peptides = 1 || ambiguous || 95.5% Confident
AAC4_MOUSE - (P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) || Number of peptides = 7 || unambiguous || 95.5% Confident
DD17_HUMAN - (Q92841) Probable RNA-dependent helicase p72 (DEAD-box protein p72) (DEAD-box protein 17) || Number of peptides = 4 || unambiguous || 95.5% Confident
EF1B_MOUSE - (O70251) Elongation factor 1-beta (EF-1-beta) || Number of peptides = 3 || ambiguous || 95.5% Confident
Q9QWR8 - (Q9QWR8) Alpha-N-acetylgalactosaminidase (EC 3.2.1.49) || Number of peptides = 3 || ambiguous || 95.4% Confident
ODO1_MOUSE - (Q60597) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) (Fragment) || Number of peptides = 10 || ambiguous || 95.3% Confident
FAAH_MOUSE - (O08914) Fatty-acid amide hydrolase (EC 3.1.-.-) (Oleamide hydrolase) (Anandamide amidohydrolase) || Number of peptides = 1 || unambiguous || 95.3% Confident
A2MG_MOUSE - (Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) || Number of peptides = 6 || unambiguous || 95.2% Confident
GS27_MOUSE - (O35166) 27 kDa Golgi SNARE protein (Golgi SNAP receptor complex member 2) (Membrin) || Number of peptides = 2 || unambiguous || 95.2% Confident
RL35_HUMAN - (P42766) 60S ribosomal protein L35 || Number of peptides = 5 || unambiguous || 95.2% Confident
ATPG_MOUSE - (Q91VR2) ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 8 || unambiguous || 95.0% Confident
4F2_MOUSE - (P10852) 4F2 cell-surface antigen heavy chain (4F2hc) || Number of peptides = 6 || unambiguous || 95.0% Confident
Q922S1 - (Q922S1) Similar to phenylalanine-tRNA synthetase-like || Number of peptides = 9 || ambiguous || 95.0% Confident
O60466 - (O60466) TGF beta receptor associated protein-1 || Number of peptides = 3 || unambiguous || 94.9% Confident
Q9CPT4 - (Q9CPT4) DNA segment, Chr 17, Wayne state University 104, expressed (Stromal cell-derived growth factor SF20/IL25) || Number of peptides = 3 || unambiguous || 94.9% Confident
Q61123 - (Q61123) MEM3 || Number of peptides = 4 || ambiguous || 94.9% Confident
SYD_MOUSE - (Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) || Number of peptides = 2 || unambiguous || 94.9% Confident
Q9CQN7 - (Q9CQN7) 2810443J12Rik protein || Number of peptides = 1 || ambiguous || 94.9% Confident
Q9CQC7 - (Q9CQC7) 0610006N12Rik protein || Number of peptides = 2 || unambiguous || 94.9% Confident
Q99LR1 - (Q99LR1) Hypothetical 20.9 kDa protein || Number of peptides = 2 || unambiguous || 94.9% Confident
Q9QYF1 - (Q9QYF1) M42C60 protein || Number of peptides = 3 || unambiguous || 94.9% Confident
R37A_HUMAN - (P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a || Number of peptides = 3 || ambiguous || 94.9% Confident
M2B1_MOUSE - (O09159) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24) (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1) || Number of peptides = 7 || unambiguous || 94.7% Confident
RM56_MOUSE - (Q9EP89) Mitochondrial 39S ribosomal protein L56 (MRP-L56) (Serine beta lactamase-like protein LACTB) || Number of peptides = 3 || unambiguous || 94.7% Confident
E4L1_MOUSE - (Q9Z2H5) Band 4.1-like protein 1 (Neuronal protein 4.1) (4.1N) || Number of peptides = 4 || unambiguous || 94.5% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 2 || unambiguous || 94.5% Confident
NTF2_HUMAN - (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) || Number of peptides = 3 || ambiguous || 94.5% Confident
M2B1_HUMAN - (O00754) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24) (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1) || Number of peptides = 6 || unambiguous || 94.5% Confident
THIO_MOUSE - (P10639) Thioredoxin (ATL-derived factor) (ADF) || Number of peptides = 5 || unambiguous || 94.5% Confident
LCB1_MOUSE - (O35704) Serine palmitoyltransferase 1 (EC 2.3.1.50) (Long chain base biosynthesis protein 1) (LCB 1) (Serine-palmitoyl-CoA transferase 1) (SPT 1) (SPT1) || Number of peptides = 3 || unambiguous || 94.4% Confident
HD_HUMAN - (P42858) Huntingtin (Huntington's disease protein) (HD protein) || Number of peptides = 6 || unambiguous || 94.4% Confident
Q9ERL0 - (Q9ERL0) Btk-PH-domain binding protein || Number of peptides = 2 || unambiguous || 94.4% Confident
Q8VHB5 - (Q8VHB5) Carbonic anhydrase 9 || Number of peptides = 1 || ambiguous || 94.4% Confident
Q96MI1 - (Q96MI1) Hypothetical protein FLJ32343 || Number of peptides = 3 || unambiguous || 94.4% Confident
THTR_MOUSE - (P52196) Thiosulfate sulfurtransferase (EC 2.8.1.1) (Rhodanese) || Number of peptides = 4 || ambiguous || 94.3% Confident
Q9P2K2 - (Q9P2K2) Hypothetical protein KIAA1344 (Fragment) || Number of peptides = 3 || unambiguous || 94.3% Confident
CTA2_HUMAN - (Q9UHC6) Contactin associated protein-like 2 precursor (Cell recognition molecule Caspr2) || Number of peptides = 4 || unambiguous || 94.3% Confident
TCPG_MOUSE - (P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin) || Number of peptides = 4 || unambiguous || 94.3% Confident
O95153 - (O95153) Peripheral benzodiazepine receptor interacting protein || Number of peptides = 4 || unambiguous || 94.3% Confident
RS16_MOUSE - (P14131) 40S ribosomal protein S16 || Number of peptides = 2 || ambiguous || 94.3% Confident
GSN2_MOUSE - (Q9CY27) Synaptic glycoprotein SC2 || Number of peptides = 2 || ambiguous || 94.3% Confident
CA64_HUMAN - (Q14031) Collagen alpha 6(IV) chain precursor || Number of peptides = 10 || ambiguous || 94.3% Confident
Q9D650 - (Q9D650) 4731402F03Rik protein || Number of peptides = 5 || ambiguous || 94.2% Confident
P70271 - (P70271) RIL protein || Number of peptides = 1 || unambiguous || 94.1% Confident
PIGO_MOUSE - (Q9JJI6) Phosphatidylinositol-glycan biosynthesis, class O protein (PIG-O) || Number of peptides = 8 || unambiguous || 94.1% Confident
Q9CWH5 - (Q9CWH5) 2410075D05Rik protein || Number of peptides = 6 || unambiguous || 94.0% Confident
Q9CZP1 - (Q9CZP1) 2700038L12Rik protein || Number of peptides = 2 || ambiguous || 93.9% Confident
Q8R4Y4 - (Q8R4Y4) Stabilin-1 || Number of peptides = 9 || unambiguous || 93.9% Confident
PNPH_MOUSE - (P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) || Number of peptides = 3 || unambiguous || 93.9% Confident
AC48_MOUSE - (Q9R0X4) 48 kDa acyl-CoA thioester hydrolase, mitochondrial precursor (EC 3.1.2.-) (p48) (Mt-ACT48) (Protein U8) || Number of peptides = 7 || unambiguous || 93.8% Confident
Q8WVL0 - (Q8WVL0) Similar to RIKEN cDNA 3300001M08 gene || Number of peptides = 1 || ambiguous || 93.6% Confident
TKT_MOUSE - (P40142) Transketolase (EC 2.2.1.1) (TK) (P68) || Number of peptides = 3 || unambiguous || 93.5% Confident
RSP4_MOUSE - (P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor) || Number of peptides = 2 || ambiguous || 93.4% Confident
TMLH_MOUSE - (Q91ZE0) Trimethyllysine dioxygenase, mitochondrial precursor (EC 1.14.11.8) (Epsilon-trimethyllysine 2-oxoglutarate dioxygenase) (TML-alpha-ketoglutarate dioxygenase) (TML hydroxylase) (TML dioxygenase) (TMLD) || Number of peptides = 2 || unambiguous || 93.3% Confident
O43162 - (O43162) Hypothetical protein KIAA0435 || Number of peptides = 1 || unambiguous || 93.3% Confident
PLE1_MOUSE - (Q9QXS1) Plectin 1 (PLTN) (PCN) (Fragment) || Number of peptides = 3 || unambiguous || 93.2% Confident
Q99KK9 - (Q99KK9) Hypothetical 57.0 kDa protein || Number of peptides = 2 || unambiguous || 93.2% Confident
FAAA_MOUSE - (P35505) Fumarylacetoacetase (EC 3.7.1.2) (Fumarylacetoacetate hydrolase) (Beta-diketonase) (FAA) || Number of peptides = 2 || unambiguous || 93.1% Confident
Q9WUB2 - (Q9WUB2) NADH-ubiquinone oxidoreductase B8 subunit || Number of peptides = 5 || ambiguous || 93.1% Confident
EPB2_HUMAN - (P29323) Ephrin type-B receptor 2 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor EPH-3) (DRT) (Receptor protein-tyrosine kinase HEK5) (ERK) || Number of peptides = 1 || unambiguous || 93.1% Confident
O60310 - (O60310) Hypothetical protein KIAA0564 (Fragment) || Number of peptides = 6 || unambiguous || 93.0% Confident
PSB6_MOUSE - (Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y) || Number of peptides = 2 || unambiguous || 93.0% Confident
PGDR_MOUSE - (P05622) Beta platelet-derived growth factor receptor precursor (EC 2.7.1.112) (PDGF-R-beta) || Number of peptides = 1 || unambiguous || 93.0% Confident
PCN2_HUMAN - (O95613) Pericentrin 2 (Kendrin) || Number of peptides = 11 || unambiguous || 92.9% Confident
WDR1_MOUSE - (O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) || Number of peptides = 7 || unambiguous || 92.9% Confident
WDR1_HUMAN - (O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1) || Number of peptides = 3 || unambiguous || 92.9% Confident
PTN6_MOUSE - (P29351) Protein-tyrosine phosphatase, non-receptor type 6 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1C) (PTP-1C) (Hematopoietic cell protein-tyrosine phosphatase) (70Z-SHP) (SH-PTP1) || Number of peptides = 3 || unambiguous || 92.7% Confident
PON2_MOUSE - (Q62086) Serum paraoxonase/arylesterase 2 (EC 3.1.1.2) (EC 3.1.8.1) (PON 2) (Serum aryldiakylphosphatase 2) (A-esterase 2) (Aromatic esterase 2) || Number of peptides = 3 || unambiguous || 92.7% Confident
Q9P107 - (Q9P107) Gem-interacting protein || Number of peptides = 4 || unambiguous || 92.6% Confident
Q9H3H9 - (Q9H3H9) Brain my048 protein (MY0876G05 protein) || Number of peptides = 1 || unambiguous || 92.6% Confident
RS11_HUMAN - (P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11 || Number of peptides = 3 || ambiguous || 92.5% Confident
Q9CZX8 - (Q9CZX8) Ribosomal protein S19 || Number of peptides = 4 || unambiguous || 92.5% Confident
Q91YH5 - (Q91YH5) Similar to likely ortholog of mouse ADP-ribosylation-like factor 6 interacting protein 2 || Number of peptides = 4 || unambiguous || 92.4% Confident
UNRI_MOUSE - (Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) || Number of peptides = 2 || ambiguous || 92.3% Confident
Q9EPA6 - (Q9EPA6) Aspartyl beta-hydroxylase 6.6 kb transcript (Aspartyl beta-hydroxylase 4.5 kb transcript) || Number of peptides = 2 || ambiguous || 92.3% Confident
Q96HG0 - (Q96HG0) Similar to RIKEN cDNA 0610006I08 gene (Fragment) || Number of peptides = 1 || ambiguous || 92.2% Confident
Q96N46 - (Q96N46) Hypothetical protein FLJ31422 || Number of peptides = 1 || unambiguous || 92.2% Confident
PERF_MOUSE - (P10820) Perforin 1 precursor (P1) (Lymphocyte pore forming protein) (Cytolysin) || Number of peptides = 2 || unambiguous || 92.2% Confident
RS30_HUMAN - (Q05472) 40S ribosomal protein S30 (Q05472) 40S ribosomal protein S30 || Number of peptides = 2 || ambiguous || 92.2% Confident
Q9H0V7 - (Q9H0V7) Hypothetical protein || Number of peptides = 1 || ambiguous || 92.2% Confident
DPG1_MOUSE - (P54099) DNA polymerase gamma subunit 1 (EC 2.7.7.7) (Mitochondrial DNA polymerase catalytic subunit) (PolG-alpha) || Number of peptides = 5 || unambiguous || 92.2% Confident
DCE1_MOUSE - (P48318) Glutamate decarboxylase, 67 kDa isoform (EC 4.1.1.15) (GAD-67) (67 kDa glutamic acid decarboxylase) || Number of peptides = 2 || unambiguous || 92.2% Confident
CPT1_HUMAN - (P50416) Carnitine O-palmitoyltransferase I, mitochondrial liver isoform (EC 2.3.1.21) (CPT I) (CPTI-L) || Number of peptides = 2 || unambiguous || 92.2% Confident
Q9Z0M3 - (Q9Z0M3) Cadherin 7 precursor || Number of peptides = 5 || unambiguous || 92.2% Confident
RAC1_HUMAN - (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) || Number of peptides = 2 || ambiguous || 92.1% Confident
Q9JIA5 - (Q9JIA5) Protease (Fragment) || Number of peptides = 2 || unambiguous || 92.1% Confident
143Z_MOUSE - (P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) || Number of peptides = 4 || unambiguous || 92.0% Confident
Q9EP71 - (Q9EP71) NORPEG-like protein (Ankycorbin) || Number of peptides = 10 || unambiguous || 91.9% Confident
Q9P2L2 - (Q9P2L2) Hypothetical protein KIAA1334 (Fragment) || Number of peptides = 1 || unambiguous || 91.9% Confident
Q923I9 - (Q923I9) Abl interactor 1 || Number of peptides = 2 || unambiguous || 91.9% Confident
NTC1_MOUSE - (Q01705) Neurogenic locus notch homolog protein 1 precursor (Notch 1) (Motch A) (mT14) (p300) || Number of peptides = 4 || unambiguous || 91.8% Confident
Q9BXA5 - (Q9BXA5) G-protein coupled receptor 91 || Number of peptides = 5 || unambiguous || 91.8% Confident
Q99LJ3 - (Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) || Number of peptides = 2 || unambiguous || 91.7% Confident
O95499 - (O95499) Olfactory receptor 89 || Number of peptides = 2 || unambiguous || 91.5% Confident
SNAA_MOUSE - (Q9DB05) Alpha-soluble NSF attachment protein (SNAP-alpha) (N-ethylmaleimide-sensitive factor attachment protein, alpha) || Number of peptides = 1 || unambiguous || 91.3% Confident
Q96P52 - (Q96P52) WD40-and FYVE-domain containing protein 3 || Number of peptides = 3 || unambiguous || 91.2% Confident
Q8VGC4 - (Q8VGC4) Olfactory receptor MOR114-4 || Number of peptides = 2 || unambiguous || 91.0% Confident
Q9DBD7 - (Q9DBD7) 1300016K07Rik protein || Number of peptides = 10 || ambiguous || 91.0% Confident
FGR3_HUMAN - (P22607) Fibroblast growth factor receptor 3 precursor (EC 2.7.1.112) (FGFR-3) || Number of peptides = 6 || unambiguous || 91.0% Confident
Q9H8F9 - (Q9H8F9) Hypothetical protein FLJ13664 || Number of peptides = 8 || unambiguous || 90.8% Confident
ATPG_HUMAN - (P36542) ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 3 || ambiguous || 90.8% Confident
Q9P2F2 - (Q9P2F2) Hypothetical protein KIAA1395 (Fragment) || Number of peptides = 4 || unambiguous || 90.8% Confident
CYB_MOUSE - (P00158) Cytochrome B || Number of peptides = 2 || unambiguous || 90.6% Confident
Q9CTD4 - (Q9CTD4) 6030455P07Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 90.5% Confident
PUR9_MOUSE - (Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] || Number of peptides = 3 || unambiguous || 90.4% Confident
M3K4_MOUSE - (O08648) Mitogen-activated protein kinase kinase kinase 4 (EC 2.7.1.-) (MAPK/ERK kinase kinase 4) (MEK kinase 4) (MEKK 4) || Number of peptides = 7 || unambiguous || 90.4% Confident
Q9D517 - (Q9D517) DNA segment, Chr 10, Johns Hopkins University 12, expressed || Number of peptides = 3 || unambiguous || 90.4% Confident
Q9CR44 - (Q9CR44) DNA segment, Chr 4, Wayne state University 125, expressed || Number of peptides = 1 || unambiguous || 90.2% Confident
RBP2_HUMAN - (P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) || Number of peptides = 5 || unambiguous || 90.2% Confident
Q9UNJ2 - (Q9UNJ2) Myosin-IXa || Number of peptides = 6 || unambiguous || 90.1% Confident
RGS9_MOUSE - (O54828) Regulator of G-protein signaling 9 (RGS9) || Number of peptides = 10 || unambiguous || 90.0% Confident
KI67_HUMAN - (P46013) Antigen KI-67 || Number of peptides = 15 || unambiguous || 90.0% Confident
PER3_MOUSE - (O70361) Period circadian protein 3 (mPER3) || Number of peptides = 1 || unambiguous || 89.9% Confident
Q8VHA6 - (Q8VHA6) SOCS box protein ASB-18 || Number of peptides = 3 || unambiguous || 89.9% Confident
RW1_MOUSE - (O70472) RW1 protein || Number of peptides = 7 || unambiguous || 89.8% Confident
O08995 - (O08995) Myelin transcription factor 1 || Number of peptides = 6 || unambiguous || 89.8% Confident
Q9D052 - (Q9D052) 2610103J23Rik protein || Number of peptides = 1 || unambiguous || 89.8% Confident
Q96S81 - (Q96S81) HNap1 binding protein || Number of peptides = 1 || ambiguous || 89.7% Confident
GUAD_MOUSE - (Q9R111) Guanine deaminase (EC 3.5.4.3) (Guanase) (Guanine aminase) (Guanine aminohydrolase) (GAH) || Number of peptides = 7 || unambiguous || 89.7% Confident
Q9Z1J0 - (Q9Z1J0) Kinesin-related mitotic motor protein (Fragment) || Number of peptides = 3 || unambiguous || 89.7% Confident
ART1_MOUSE - (Q9EQH2) Adipocyte-derived leucine aminopeptidase precursor (EC 3.4.11.-) (A-LAP) (ARTS-1) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (VEGF induced aminopeptidase) || Number of peptides = 3 || unambiguous || 89.7% Confident
CNRB_HUMAN - (P35913) Rod cGMP-specific 3',5'-cyclic phosphodiesterase beta-subunit (EC 3.1.4.17) (GMP-PDE beta) || Number of peptides = 3 || unambiguous || 89.7% Confident
Q9JHL1 - (Q9JHL1) MSlc9a3r2/E3karp/Sip-1/Tka-1/Octs2 || Number of peptides = 2 || unambiguous || 89.7% Confident
Q924D2 - (Q924D2) Myosin light chain kinase (Fragment) || Number of peptides = 2 || unambiguous || 89.6% Confident
HDA6_MOUSE - (Q9Z2V5) Histone deacetylase 6 (HD6) (Histone deacetylase mHDA2) || Number of peptides = 4 || unambiguous || 89.5% Confident
RL10_MOUSE - (P45634) 60S ribosomal protein L10 (QM protein homolog) || Number of peptides = 4 || ambiguous || 89.5% Confident
GLI3_MOUSE - (Q61602) Zinc finger protein GLI3 || Number of peptides = 5 || unambiguous || 89.4% Confident
Q8TC20 - (Q8TC20) Hypothetical protein || Number of peptides = 2 || unambiguous || 89.2% Confident
Q9CY68 - (Q9CY68) 7 days embryo cDNA, RIKEN full-length enriched library, clone:C430041K09, full insert sequence || Number of peptides = 1 || unambiguous || 88.7% Confident
RHOI_HUMAN - (O95661) Rho-related GTP-binding protein RhoI || Number of peptides = 1 || unambiguous || 88.5% Confident
LMG2_HUMAN - (Q13753) Laminin gamma-2 chain precursor (Kalinin/nicein/epiligrin 100 kDa subunit) (Laminin B2t chain) || Number of peptides = 4 || unambiguous || 88.4% Confident
Q99J30 - (Q99J30) Similar to hypothetical protein FLJ14038 || Number of peptides = 2 || ambiguous || 88.3% Confident
Q9NYU2 - (Q9NYU2) UDP-glucose:glycoprotein glucosyltransferase 1 precursor || Number of peptides = 6 || unambiguous || 88.2% Confident
Q8R332 - (Q8R332) Hypothetical 59.4 kDa protein || Number of peptides = 4 || unambiguous || 88.0% Confident
IBP4_MOUSE - (P47879) Insulin-like growth factor binding protein 4 precursor (IGFBP-4) (IBP-4) (IGF-binding protein 4) || Number of peptides = 2 || unambiguous || 87.7% Confident
MUTA_HUMAN - (P22033) Methylmalonyl-CoA mutase, mitochondrial precursor (EC 5.4.99.2) (MCM) || Number of peptides = 6 || ambiguous || 87.5% Confident
WN15_HUMAN - (O14905) WNT-15 protein precursor (WNT-14B) || Number of peptides = 3 || unambiguous || 87.4% Confident
Q91YS0 - (Q91YS0) Similar to diacylglycerol kinase (Fragment) || Number of peptides = 2 || unambiguous || 87.4% Confident
K2C8_MOUSE - (P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A) || Number of peptides = 3 || ambiguous || 87.4% Confident
O70481 - (O70481) Ubiquitin-protein ligase E3 COMPONEN N-recognin (Ubiquitin-protein ligase E3-alpha) || Number of peptides = 4 || unambiguous || 87.2% Confident
O95204 - (O95204) Metalloprotease 1 || Number of peptides = 2 || unambiguous || 87.1% Confident
LKHA_MOUSE - (P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 2 || ambiguous || 87.1% Confident
CAMG_MOUSE - (P49070) Calcium-signal modulating cyclophilin ligand (CAML) || Number of peptides = 3 || unambiguous || 87.1% Confident
OCRL_HUMAN - (Q01968) Inositol polyphosphate 5-phosphatase OCRL-1 (EC 3.1.3.-) (Lowe's oculocerebrorenal syndrome protein) || Number of peptides = 2 || unambiguous || 86.9% Confident
Q9NRJ2 - (Q9NRJ2) MOST2 || Number of peptides = 1 || unambiguous || 86.8% Confident
Y152_HUMAN - (Q14165) Hypothetical protein KIAA0152 || Number of peptides = 4 || unambiguous || 86.5% Confident
COXA_MOUSE - (P12787) Cytochrome c oxidase polypeptide Va, mitochondrial precursor (EC 1.9.3.1) || Number of peptides = 1 || ambiguous || 85.9% Confident
Q9CVH7 - (Q9CVH7) 2010009P05Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 85.7% Confident
Q8TEJ3 - (Q8TEJ3) FLJ00204 protein (Fragment) || Number of peptides = 4 || unambiguous || 85.7% Confident
O89019 - (O89019) Inversin || Number of peptides = 8 || unambiguous || 85.7% Confident
BGLR_MOUSE - (P12265) Beta-glucuronidase precursor (EC 3.2.1.31) || Number of peptides = 2 || unambiguous || 85.6% Confident
SA18_MOUSE - (Q9DB41) Solute carrier family 25, member 18 (Fragment) || Number of peptides = 2 || unambiguous || 85.4% Confident
Q9Y2L9 - (Q9Y2L9) Hypothetical protein KIAA1016 (Fragment) || Number of peptides = 7 || unambiguous || 85.4% Confident
Q9HCB6 - (Q9HCB6) VSGP/F-spondin || Number of peptides = 1 || ambiguous || 85.3% Confident
NCPR_MOUSE - (P37040) NADPH-cytochrome P450 reductase (EC 1.6.2.4) (CPR) (P450R) || Number of peptides = 18 || unambiguous || 85.3% Confident
Q9WV69 - (Q9WV69) Dematin 52 kDa subunit || Number of peptides = 2 || ambiguous || 85.1% Confident
PF2R_HUMAN - (P43088) Prostaglandin F2-alpha receptor (Prostanoid FP receptor) (PGF receptor) (PGF2 alpha receptor) || Number of peptides = 1 || unambiguous || 85.1% Confident
CAPB_MOUSE - (P47757) F-actin capping protein beta subunit (CapZ beta) || Number of peptides = 1 || ambiguous || 85.0% Confident
CLR2_MOUSE - (Q9R0M0) Cadherin EGF LAG seven-pass G-type receptor 2 precursor (Flamingo 1) (mFmi1) || Number of peptides = 16 || unambiguous || 84.8% Confident
O95303 - (O95303) Gamma-filamin (Filamin 2) || Number of peptides = 1 || unambiguous || 84.8% Confident
Q96JN5 - (Q96JN5) Hypothetical protein KIAA1790 (Fragment) || Number of peptides = 2 || unambiguous || 84.8% Confident
RXRA_MOUSE - (P28700) Retinoic acid receptor RXR-alpha || Number of peptides = 1 || ambiguous || 84.8% Confident
Z197_HUMAN - (O14709) Zinc finger protein 197 (ZnF20) || Number of peptides = 3 || unambiguous || 84.5% Confident
Q96AA2 - (Q96AA2) Obscurin || Number of peptides = 26 || unambiguous || 84.4% Confident
Q9CY00 - (Q9CY00) 2510042P03Rik protein || Number of peptides = 1 || unambiguous || 84.0% Confident
Q9D0E1 - (Q9D0E1) 2610023M21Rik protein || Number of peptides = 2 || ambiguous || 83.8% Confident
RL19_HUMAN - (P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19 || Number of peptides = 1 || ambiguous || 83.5% Confident
Q96GW7 - (Q96GW7) Chondroitin sulfate proteoglycan BEHAB/brevican || Number of peptides = 1 || ambiguous || 83.5% Confident
RL23_HUMAN - (P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) || Number of peptides = 3 || ambiguous || 83.4% Confident
Q8VIJ6 - (Q8VIJ6) PTB-associated splicing factor || Number of peptides = 5 || unambiguous || 83.4% Confident
CO1C_MOUSE - (Q9WUM4) Coronin 1C (Coronin 3) || Number of peptides = 4 || ambiguous || 83.3% Confident
HO1_MOUSE - (P14901) Heme oxygenase 1 (EC 1.14.99.3) (HO-1) (P32 protein) || Number of peptides = 2 || unambiguous || 83.0% Confident
PCCA_HUMAN - (P05165) Propionyl-CoA carboxylase alpha chain, mitochondrial precursor (EC 6.4.1.3) (PCCase alpha subunit) (Propanoyl-CoA:carbon dioxide ligase alpha subunit) || Number of peptides = 5 || unambiguous || 82.8% Confident
Q99ML9 - (Q99ML9) Arkadia || Number of peptides = 3 || unambiguous || 82.8% Confident
Q9D990 - (Q9D990) 4632415H16Rik protein || Number of peptides = 1 || unambiguous || 82.8% Confident
Q9D1D4 - (Q9D1D4) 1110014C03Rik protein || Number of peptides = 4 || ambiguous || 82.7% Confident
ML1A_MOUSE - (Q61184) Melatonin receptor type 1A (Mel-1A-R) || Number of peptides = 1 || unambiguous || 82.6% Confident
NCO2_MOUSE - (Q61026) Nuclear receptor coactivator 2 (Transcriptional intermediary factor 2) (Glucocorticoid receptor-interacting protein 1) (GRIP-1) || Number of peptides = 3 || unambiguous || 82.5% Confident
O35737 - (O35737) Heterogeneous nuclear ribonucleoprotein H || Number of peptides = 1 || ambiguous || 82.4% Confident
RS2_MOUSE - (P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein) || Number of peptides = 5 || ambiguous || 82.4% Confident
143B_MOUSE - (Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 2 || ambiguous || 82.4% Confident
Q96JP8 - (Q96JP8) Fibrillin3 || Number of peptides = 9 || unambiguous || 82.4% Confident
Q9DCP4 - (Q9DCP4) 0610012H03Rik protein || Number of peptides = 3 || unambiguous || 82.3% Confident
Q9UKC7 - (Q9UKC7) F-box protein Fbl6 (Fragment) || Number of peptides = 3 || unambiguous || 82.2% Confident
Q9H2S5 - (Q9H2S5) HZFw1 protein || Number of peptides = 3 || unambiguous || 82.2% Confident
DHB8_HUMAN - (Q92506) Estradiol 17 beta-dehydrogenase 8 (EC 1.1.1.62) (17-beta-HSD 8) (17-beta-hydroxysteroid dehydrogenase 8) (Ke6 protein) (Ke-6) || Number of peptides = 1 || unambiguous || 82.2% Confident
RLA0_MOUSE - (P14869) 60S acidic ribosomal protein P0 (L10E) || Number of peptides = 4 || ambiguous || 82.0% Confident
ATH1_MOUSE - (P48985) Atonal protein homolog 1 (Helix-loop-helix protein mATH-1) (MATH1) || Number of peptides = 3 || unambiguous || 82.0% Confident
SUT3_HUMAN - (O75486) Transcription initiation protein SPT3 homolog (SPT3-like protein) || Number of peptides = 2 || unambiguous || 82.0% Confident
Q9C0D2 - (Q9C0D2) Hypothetical protein KIAA1731 (Fragment) || Number of peptides = 3 || unambiguous || 81.9% Confident
Q96BY6 - (Q96BY6) Hypothetical protein || Number of peptides = 1 || unambiguous || 81.8% Confident
CES2_HUMAN - (Q9BXF3) Cat eye syndrome critical region protein 2 || Number of peptides = 3 || unambiguous || 81.8% Confident
Q96T88 - (Q96T88) Nuclear zinc finger protein Np95 || Number of peptides = 4 || unambiguous || 81.8% Confident
SAA2_MOUSE - (P05367) Serum amyloid A-2 protein precursor [Contains: Amyloid protein A (Amyloid fibril protein AA)] || Number of peptides = 1 || unambiguous || 81.8% Confident
O35379 - (O35379) Multidrug resistance protein || Number of peptides = 5 || unambiguous || 81.7% Confident
Q14981 - (Q14981) NuMA protein || Number of peptides = 3 || unambiguous || 81.6% Confident
Q9JI84 - (Q9JI84) EPCS24 (Fragment) || Number of peptides = 2 || ambiguous || 81.6% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 2 || ambiguous || 81.6% Confident
Q99MD7 - (Q99MD7) UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 || Number of peptides = 4 || unambiguous || 81.4% Confident
BTK_MOUSE - (P35991) Tyrosine-protein kinase BTK (EC 2.7.1.112) (Bruton's tyrosine kinase) (Agammaglobulinaemia tyrosine kinase) (ATK) (B cell progenitor kinase) (BPK) (Kinase EMB) || Number of peptides = 3 || unambiguous || 81.4% Confident
Q9NVU6 - (Q9NVU6) Hypothetical protein FLJ10499 || Number of peptides = 1 || unambiguous || 81.1% Confident
Q8WYP5 - (Q8WYP5) Transcription factor ELYS || Number of peptides = 8 || unambiguous || 81.1% Confident
RB5B_HUMAN - (P35239) Ras-related protein Rab-5B (P35239) Ras-related protein Rab-5B || Number of peptides = 1 || ambiguous || 81.0% Confident
O14745 - (O14745) Ezrin-radixin-moesin binding phosphoprotein-50 (Solute carrier family 9 (Sodium/hydrogen exchanger), isoform 3 regulatory factor 1) (Similar to solute carrier family 9 (Sodium/hydrogen exchanger), isoform 3 regulatory factor 1) || Number of peptides = 3 || unambiguous || 81.0% Confident
Q9UL51 - (Q9UL51) Hyperpolarization-activated, cyclic nucleotide-gated channel 2 || Number of peptides = 3 || unambiguous || 80.9% Confident
Q9D8I8 - (Q9D8I8) 1810074P20Rik protein || Number of peptides = 2 || unambiguous || 80.8% Confident
Q921N6 - (Q921N6) Similar to hypothetical protein FLJ20596 || Number of peptides = 1 || unambiguous || 80.7% Confident
Q9BUI8 - (Q9BUI8) Hypothetical protein || Number of peptides = 1 || unambiguous || 80.6% Confident
YB1_MOUSE - (P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) || Number of peptides = 2 || ambiguous || 80.5% Confident
Q96EG1 - (Q96EG1) Similar to KIAA1001 protein || Number of peptides = 1 || ambiguous || 80.5% Confident
VIL1_HUMAN - (P09327) Villin 1 || Number of peptides = 1 || ambiguous || 80.4% Confident
PLSB_MOUSE - (Q61586) Glycerol-3-phosphate acyltransferase, mitochondrial precursor (EC 2.3.1.15) (GPAT) (P90) || Number of peptides = 4 || unambiguous || 80.2% Confident
IF2G_MOUSE - (Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X) || Number of peptides = 3 || ambiguous || 80.2% Confident
Q9D184 - (Q9D184) 2810434B10Rik protein || Number of peptides = 1 || ambiguous || 80.2% Confident
Q9H4S7 - (Q9H4S7) BA563A22B.1 (Contains a novel protein similar to otoferlin (A FER-1-like protein)) (Fragment) || Number of peptides = 4 || unambiguous || 80.1% Confident
Q9H6U1 - (Q9H6U1) Hypothetical protein FLJ21870 || Number of peptides = 2 || unambiguous || 80.1% Confident
Q925Q8 - (Q925Q8) Dachshund-like protein DACH2 || Number of peptides = 3 || unambiguous || 80.0% Confident
MLES_HUMAN - (P24572) Myosin light chain alkali, smooth-muscle isoform (MLC3SM) (LC17B) (LC17-GI) || Number of peptides = 1 || unambiguous || 80.0% Confident
CDB6_HUMAN - (Q9Y5E3) Protocadherin beta 6 precursor (PCDH-beta6) || Number of peptides = 2 || unambiguous || 79.8% Confident
Q8WUG8 - (Q8WUG8) Similar to hypothetical protein FLJ20311 || Number of peptides = 4 || unambiguous || 79.8% Confident
Q61408 - (Q61408) Complement factor H-related protein || Number of peptides = 4 || unambiguous || 79.7% Confident
Q9BRP7 - (Q9BRP7) Hypothetical protein (Fragment) || Number of peptides = 3 || unambiguous || 79.7% Confident
Q9Y4D7 - (Q9Y4D7) Hypothetical protein KIAA0620 (Fragment) || Number of peptides = 10 || unambiguous || 79.7% Confident
RS17_MOUSE - (P06584) 40S ribosomal protein S17 || Number of peptides = 4 || ambiguous || 79.7% Confident
143E_HUMAN - (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) || Number of peptides = 3 || ambiguous || 79.6% Confident
Q9CUR2 - (Q9CUR2) 4921517N04Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 79.6% Confident
DBPA_HUMAN - (P16989) DNA-binding protein A (Cold shock domain protein A) (Single-strand DNA binding protein NF-GMB) || Number of peptides = 2 || ambiguous || 79.6% Confident
Q9H760 - (Q9H760) Hypothetical protein FLJ21277 || Number of peptides = 2 || unambiguous || 79.5% Confident
ENP1_MOUSE - (P55772) Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (NTPDase1) (Ecto-ATP diphosphohydrolase) (ATPDase) (Lymphoid cell activation antigen) (Ecto-apyrase) (CD39 antigen) || Number of peptides = 1 || unambiguous || 79.5% Confident
Q99LM1 - (Q99LM1) Hypothetical 41.3 kDa protein || Number of peptides = 7 || unambiguous || 79.5% Confident
Q9CZC6 - (Q9CZC6) 2810021B07Rik protein || Number of peptides = 1 || unambiguous || 79.3% Confident
Q8WUV1 - (Q8WUV1) Hypothetical protein || Number of peptides = 3 || unambiguous || 79.3% Confident
TGF2_MOUSE - (P27090) Transforming growth factor beta 2 precursor (TGF-beta 2) || Number of peptides = 1 || unambiguous || 79.3% Confident
ECM_HUMAN - (Q13201) Endothelial cell multimerin precursor || Number of peptides = 7 || unambiguous || 79.2% Confident
STN3_MOUSE - (O70166) Stathmin 3 (SCG10-like protein) (SCG10-related protein HiAT3) (Hippocampus abundant transcript 3) || Number of peptides = 1 || ambiguous || 79.2% Confident
Q9DAF7 - (Q9DAF7) 1700011M07Rik protein || Number of peptides = 4 || ambiguous || 79.0% Confident
O14792 - (O14792) Heparan sulfate 3-O-sulfotransferase-1 precursor || Number of peptides = 4 || unambiguous || 78.9% Confident
NRP1_HUMAN - (O14786) Neuropilin-1 precursor (Vascular endothelial cell growth factor 165 receptor) || Number of peptides = 5 || unambiguous || 78.9% Confident
Q96MR0 - (Q96MR0) Hypothetical protein FLJ32020 || Number of peptides = 2 || unambiguous || 78.8% Confident
T172_HUMAN - (O14981) TBP-associated factor 172 (TAF-172) (TAF(II)170) || Number of peptides = 5 || unambiguous || 78.7% Confident
NLD2_MOUSE - (Q9CZR2) N-acetylated-alpha-linked acidic dipeptidase II (EC 3.4.17.21) (NAALADase II) (Fragment) || Number of peptides = 2 || unambiguous || 78.6% Confident
Q9DAX9 - (Q9DAX9) 1300003O07Rik protein (RIKEN cDNA 1300003O07 gene) || Number of peptides = 3 || ambiguous || 78.4% Confident
Q9UPV0 - (Q9UPV0) Hypothetical protein KIAA1052 || Number of peptides = 4 || unambiguous || 78.3% Confident
STA4_MOUSE - (P42228) Signal transducer and activator of transcription 4 || Number of peptides = 8 || unambiguous || 78.3% Confident
Q9QWY8 - (Q9QWY8) ADP-ribosylation factor-directed GTPase activating protein isoform a || Number of peptides = 7 || unambiguous || 78.2% Confident
Q9UKB3 - (Q9UKB3) J domain containing protein 1 isoform A (BA57G10.2) (A J domain containing protein 1 (JDP1) isoform B) || Number of peptides = 1 || unambiguous || 78.2% Confident
NME4_MOUSE - (Q03391) Glutamate [NMDA] receptor subunit epsilon 4 precursor (N-methyl D-aspartate receptor subtype 2D) (NR2D) (NMDAR2D) || Number of peptides = 9 || unambiguous || 78.2% Confident
IMA1_MOUSE - (Q60960) Importin alpha-1 subunit (Karyopherin alpha-1 subunit) (SRP1-beta) (RAG cohort protein 2) (Nucleoprotein interactor 1) (Importin alpha S1) || Number of peptides = 3 || ambiguous || 78.1% Confident
IMA5_MOUSE - (O35345) Importin alpha-6 subunit (Karyopherin alpha-5 subunit) (Importin alpha S2) || Number of peptides = 1 || ambiguous || 78.1% Confident
LMA4_MOUSE - (P97927) Laminin alpha-4 chain precursor || Number of peptides = 6 || unambiguous || 78.0% Confident
PTPJ_MOUSE - (Q64455) Protein-tyrosine phosphatase eta precursor (EC 3.1.3.48) (R-PTP-eta) (HPTP beta-like tyrosine phosphatase) || Number of peptides = 5 || unambiguous || 77.9% Confident
RS5_MOUSE - (P97461) 40S ribosomal protein S5 || Number of peptides = 2 || ambiguous || 77.9% Confident
CLC4_HUMAN - (P51793) Chloride channel protein 4 (ClC-4) || Number of peptides = 2 || unambiguous || 77.8% Confident
Q8TD91 - (Q8TD91) Hepatocellular carcinoma-associated protein HCA2 || Number of peptides = 3 || unambiguous || 77.7% Confident
RL26_HUMAN - (Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26 || Number of peptides = 3 || ambiguous || 77.6% Confident
GRAD_MOUSE - (P11033) Granzyme D precursor (EC 3.4.21.-) || Number of peptides = 4 || unambiguous || 77.4% Confident
Q8VI56 - (Q8VI56) LDLR dan || Number of peptides = 9 || unambiguous || 77.2% Confident
IVD_HUMAN - (P26440) Isovaleryl-CoA dehydrogenase, mitochondrial precursor (EC 1.3.99.10) (IVD) || Number of peptides = 4 || unambiguous || 77.1% Confident
Q9NWB7 - (Q9NWB7) Hypothetical protein (HIP1-interacting protein HIPPI) (MHS4R2) (DERP8) (Dermal papilla derived protein 8) || Number of peptides = 2 || unambiguous || 77.0% Confident
FLIH_HUMAN - (Q13045) Flightless-I protein homolog || Number of peptides = 3 || unambiguous || 77.0% Confident
VNN2_HUMAN - (O95498) Vascular non-inflammatory molecule 2 precursor (Vanin 2) (Glycosylphosphatidyl inositol-anchored protein GPI-80) (FOAP-4 protein) || Number of peptides = 2 || unambiguous || 76.9% Confident
ZEP1_MOUSE - (Q03172) Zinc finger protein 40 (Transcription factor alphaA-CRYBP1) (Alpha A-crystallin-binding protein I) (Alpha A-CRYBP1) || Number of peptides = 9 || unambiguous || 76.8% Confident
Q9H4H6 - (Q9H4H6) DJ620E11.1.1 (Novel helicase C-terminal domain and SNF2 N-terminal domains containing protein, similar to KIAA0308 (Isoform 1)) (Fragment) || Number of peptides = 2 || ambiguous || 76.7% Confident
IBP5_MOUSE - (Q07079) Insulin-like growth factor binding protein 5 precursor (IGFBP-5) (IBP-5) (IGF-binding protein 5) || Number of peptides = 2 || ambiguous || 76.7% Confident
Q9CU46 - (Q9CU46) 6330406L22Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 76.7% Confident
PRLP_MOUSE - (Q9JK53) Prolargin precursor (Proline-arginine-rich end leucine-rich repeat protein) || Number of peptides = 1 || unambiguous || 76.5% Confident
Q9D870 - (Q9D870) 2010110O17Rik protein || Number of peptides = 1 || ambiguous || 76.4% Confident
BIG1_HUMAN - (Q9Y6D6) Brefeldin A-inhibited guanine nucleotide-exchange protein 1 (Brefeldin A-inhibited GEP 1) (p200 ARF-GEP1) (p200 ARF guanine nucleotide exchange factor) || Number of peptides = 4 || unambiguous || 76.4% Confident
UBC8_HUMAN - (O14933) Ubiquitin-conjugating enzyme E2-18 kDa UbcH8 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Retinoic acid induced gene B protein) (RIG-B) || Number of peptides = 2 || unambiguous || 76.3% Confident
Q9HCI8 - (Q9HCI8) Hypothetical protein KIAA1584 (Fragment) || Number of peptides = 3 || unambiguous || 76.3% Confident
DRG1_MOUSE - (P32233) Developmentally regulated GTP-binding protein 1 (DRG 1) (Nedd3 protein) || Number of peptides = 3 || ambiguous || 76.3% Confident
RS29_HUMAN - (P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 || Number of peptides = 1 || ambiguous || 76.1% Confident
SMA4_MOUSE - (P97471) Mothers against decapentaplegic homolog 4 (SMAD 4) (Mothers against DPP homolog 4) (Deletion target in pancreatic carcinoma 4 homolog) (Smad4) || Number of peptides = 4 || unambiguous || 75.9% Confident
Q91VV3 - (Q91VV3) Similar to hypothetical protein FLJ10783 || Number of peptides = 4 || unambiguous || 75.9% Confident
MYOF_HUMAN - (Q9NZM1) Myoferlin (Fer-1 like protein 3) || Number of peptides = 10 || unambiguous || 75.8% Confident
SHK2_HUMAN - (Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2) || Number of peptides = 4 || unambiguous || 75.7% Confident
BAG5_HUMAN - (Q9UL15) BAG-family molecular chaperone regulator-5 (BAG-5) || Number of peptides = 2 || unambiguous || 75.6% Confident
IQG1_MOUSE - (Q9JKF1) Ras GTPase-activating-like protein IQGAP1 || Number of peptides = 4 || unambiguous || 75.5% Confident
GATM_MOUSE - (Q9D964) Glycine amidinotransferase, mitochondrial precursor (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) || Number of peptides = 3 || unambiguous || 75.5% Confident
TAG2_MOUSE - (Q9WVA4) Transgelin 2 || Number of peptides = 1 || ambiguous || 75.5% Confident
Q8R0C7 - (Q8R0C7) Similar to hypothetical protein FLJ10900 (Fragment) || Number of peptides = 1 || unambiguous || 75.4% Confident
Q9CYY0 - (Q9CYY0) 2810431B21Rik protein || Number of peptides = 1 || ambiguous || 75.3% Confident
RP3A_MOUSE - (P47708) Rabphilin-3A || Number of peptides = 2 || ambiguous || 75.3% Confident
CATB_MOUSE - (P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) || Number of peptides = 3 || unambiguous || 75.2% Confident
RIN1_HUMAN - (Q13671) Ras interaction/interference protein 1 (Ras inhibitor JC99) || Number of peptides = 3 || unambiguous || 75.2% Confident
RS3A_MOUSE - (P97351) 40S ribosomal protein S3a || Number of peptides = 4 || ambiguous || 75.1% Confident
ODO1_HUMAN - (Q02218) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) || Number of peptides = 3 || unambiguous || 75.0% Confident
P97789 - (P97789) 5'-3' exonuclease || Number of peptides = 6 || unambiguous || 75.0% Confident
A2BP_MOUSE - (Q9JJ43) Ataxin 2-binding protein || Number of peptides = 1 || ambiguous || 75.0% Confident
Z132_HUMAN - (P52740) Zinc finger protein 132 || Number of peptides = 2 || unambiguous || 75.0% Confident
Q8R000 - (Q8R000) Hypothetical 37.8 kDa protein || Number of peptides = 2 || unambiguous || 74.9% Confident
Q91WA7 - (Q91WA7) Hypothetical 136.5 kDa protein || Number of peptides = 9 || unambiguous || 74.7% Confident
PAC2_MOUSE - (Q9WVE8) Protein kinase C and casein kinase substrate in neurons protein 2 || Number of peptides = 3 || unambiguous || 74.6% Confident
Q9JL37 - (Q9JL37) ATP-binding cassette protein (Fragment) || Number of peptides = 2 || ambiguous || 74.6% Confident
Q92580 - (Q92580) Hypothetical protein KIAA0268 (Fragment) || Number of peptides = 5 || unambiguous || 74.4% Confident
KDGD_HUMAN - (Q16760) Diacylglycerol kinase, delta (EC 2.7.1.107) (Diglyceride kinase) (DGK-delta) (DAG kinase delta) (130 kDa diacylglycerol kinase) (Fragment) || Number of peptides = 4 || unambiguous || 74.4% Confident
GPI8_MOUSE - (Q9CXY9) GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) (Phosphatidylinositol-glycan biosynthesis, class K protein) (PIG-K) || Number of peptides = 4 || unambiguous || 74.4% Confident
Q9JLI2 - (Q9JLI2) Collagen type V alpha 3 chain || Number of peptides = 4 || unambiguous || 74.1% Confident
HIR5_MOUSE - (Q9QZ23) HIRA-interacting protein 5 (mHIRIP5) || Number of peptides = 4 || unambiguous || 74.1% Confident
Q62383 - (Q62383) Supt6h || Number of peptides = 7 || ambiguous || 74.1% Confident
Q61965 - (Q61965) Laminin, gamma 2 (Laminin-5 beta-1 chain) (Gamma 2 chain) (Nicein) (Kalinin) (Fragment) || Number of peptides = 2 || unambiguous || 74.0% Confident
Q8VC15 - (Q8VC15) Similar to phosphatidylinositol 4-kinase type II || Number of peptides = 2 || unambiguous || 74.0% Confident
Q9HCE3 - (Q9HCE3) Hypothetical protein KIAA1629 (Zinc finger protein) (Fragment) || Number of peptides = 7 || unambiguous || 74.0% Confident
ROXN_HUMAN - (Q9UGR2) Rotavirus 'X' associated non-structural protein (RoXaN) || Number of peptides = 2 || unambiguous || 74.0% Confident
Q8R2Q7 - (Q8R2Q7) Similar to hypothetical protein FLJ20318 || Number of peptides = 3 || unambiguous || 73.7% Confident
TIE1_MOUSE - (Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112) || Number of peptides = 3 || unambiguous || 73.7% Confident
Q8R3R7 - (Q8R3R7) Hypothetical 29.5 kDa protein || Number of peptides = 2 || unambiguous || 73.7% Confident
Q9JJN2 - (Q9JJN2) Zinc-finger homeodomain protein 4 || Number of peptides = 8 || unambiguous || 73.7% Confident
O89064 - (O89064) Putative RNA helicase (Fragment) || Number of peptides = 2 || unambiguous || 73.7% Confident
Q96L91 - (Q96L91) P400 SWI2/SNF2-related protein || Number of peptides = 10 || unambiguous || 73.7% Confident
CGD1_MOUSE - (P25322) G1/S-specific cyclin D1 || Number of peptides = 3 || unambiguous || 73.6% Confident
T4S6_MOUSE - (O70401) Transmembrane 4 superfamily, member 6 (Tetraspanin 6) (Tspan-6) || Number of peptides = 2 || unambiguous || 73.1% Confident
MEM1_HUMAN - (P55160) Membrane-associated protein HEM-1 (Hematopoietic protein 1) || Number of peptides = 5 || unambiguous || 73.1% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 1 || ambiguous || 73.1% Confident
ZA70_MOUSE - (P43404) Tyrosine-protein kinase ZAP-70 (EC 2.7.1.112) (70 kDa zeta-associated protein) (Syk-related tyrosine kinase) || Number of peptides = 5 || unambiguous || 73.1% Confident
GEFH_HUMAN - (Q92974) GEF-H1 protein (Proliferating cell nucleolar antigen P40) || Number of peptides = 5 || ambiguous || 73.1% Confident
O15032 - (O15032) Hypothetical protein KIAA0316 (Fragment) || Number of peptides = 11 || unambiguous || 73.1% Confident
CML2_HUMAN - (Q99527) Chemokine receptor-like 2 (IL8-related receptor DRY12) (Flow-induced endothelial G protein-coupled receptor) (FEG-1) (G protein-coupled receptor GPR30) (GPCR-BR) || Number of peptides = 4 || unambiguous || 73.0% Confident
Q92884 - (Q92884) Tissue plasminogen activator (Fragment) || Number of peptides = 1 || ambiguous || 73.0% Confident
Q8TAA1 - (Q8TAA1) Similar to ribonuclease pancreatic (RNase 1) (RNase A) || Number of peptides = 3 || unambiguous || 73.0% Confident
ACM5_HUMAN - (P08912) Muscarinic acetylcholine receptor M5 || Number of peptides = 3 || unambiguous || 73.0% Confident
Q9DBE8 - (Q9DBE8) 1300013N08Rik protein || Number of peptides = 1 || ambiguous || 72.7% Confident
DCC_HUMAN - (P43146) Tumor suppressor protein DCC precursor (Colorectal cancer suppressor) || Number of peptides = 4 || unambiguous || 72.3% Confident
O75122 - (O75122) Hypothetical protein KIAA0627 (Fragment) || Number of peptides = 7 || unambiguous || 72.2% Confident
Q9ESV3 - (Q9ESV3) Fanconi anemia group A || Number of peptides = 5 || unambiguous || 72.1% Confident
CAZ3_MOUSE - (P70190) F-actin capping protein alpha-3 subunit (CapZ alpha-3) (Germ cell-specific protein 3) || Number of peptides = 1 || unambiguous || 72.1% Confident
Q9D6Z2 - (Q9D6Z2) 2310044E02Rik protein || Number of peptides = 4 || unambiguous || 72.0% Confident
Q96M26 - (Q96M26) Hypothetical protein FLJ32880 || Number of peptides = 2 || unambiguous || 72.0% Confident
ORP5_HUMAN - (Q9H0X9) Oxysterol binding protein-related protein 5 (OSBP-related protein 5) (ORP-5) || Number of peptides = 3 || ambiguous || 72.0% Confident
HEMZ_MOUSE - (P22315) Ferrochelatase, mitochondrial precursor (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme synthetase) || Number of peptides = 2 || unambiguous || 72.0% Confident
KR18_HUMAN - (Q9HCG1) Zinc finger protein Kr18 (HKr18) || Number of peptides = 2 || unambiguous || 71.9% Confident
Q9D0U3 - (Q9D0U3) 1190001G19Rik protein || Number of peptides = 1 || ambiguous || 71.9% Confident
Q96C40 - (Q96C40) Hypothetical protein || Number of peptides = 1 || unambiguous || 71.7% Confident
Q9EQK0 - (Q9EQK0) Spinster-like protein || Number of peptides = 4 || unambiguous || 71.6% Confident
AD20_HUMAN - (O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 20) || Number of peptides = 2 || unambiguous || 71.5% Confident
Q9QXL0 - (Q9QXL0) DBCCR1 || Number of peptides = 7 || unambiguous || 71.5% Confident
Q9CXD8 - (Q9CXD8) 6130401L20Rik protein || Number of peptides = 1 || unambiguous || 71.4% Confident
Q8VGP3 - (Q8VGP3) Olfactory receptor MOR227-1 || Number of peptides = 2 || unambiguous || 71.3% Confident
RBL1_MOUSE - (Q64701) Retinoblastoma-like protein 1 (107 kDa retinoblastoma-associated protein) (PRB1) (P107) || Number of peptides = 4 || unambiguous || 71.2% Confident
IF16_HUMAN - (Q16666) Gamma-interferon-inducible protein Ifi-16 (Interferon-inducible myeloid differentiation transcriptional activator) (IFI 16) || Number of peptides = 3 || unambiguous || 71.2% Confident
Q9D7A8 - (Q9D7A8) 2310016N05Rik protein (RIKEN cDNA 2310016N05 gene) || Number of peptides = 3 || unambiguous || 71.1% Confident
Z272_HUMAN - (Q14592) Zinc finger protein 272 (Zinc finger protein HZF8) (Fragment) || Number of peptides = 1 || unambiguous || 70.9% Confident
Q99JV6 - (Q99JV6) Hypothetical 67.2 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 70.9% Confident
Q9D2Q2 - (Q9D2Q2) 2310079F23Rik protein || Number of peptides = 3 || unambiguous || 70.8% Confident
Q9EP72 - (Q9EP72) Hypothetical 26.3 kDa protein || Number of peptides = 1 || unambiguous || 70.7% Confident
BAR1_HUMAN - (Q99728) BRCA1-associated RING domain protein 1 (BARD-1) || Number of peptides = 3 || unambiguous || 70.7% Confident
Q9Z151 - (Q9Z151) Class I MHC-restricted T cell associated molecule || Number of peptides = 1 || unambiguous || 70.7% Confident
Q9D7W7 - (Q9D7W7) 2210019G11Rik protein || Number of peptides = 2 || unambiguous || 70.4% Confident
FAS_MOUSE - (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) || Number of peptides = 6 || unambiguous || 70.4% Confident
Q9CYH2 - (Q9CYH2) 5730469M10Rik protein || Number of peptides = 5 || unambiguous || 70.3% Confident
PSA2_MOUSE - (P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) || Number of peptides = 1 || ambiguous || 70.3% Confident
Q9BTZ1 - (Q9BTZ1) Hypothetical protein || Number of peptides = 1 || unambiguous || 70.3% Confident
RPOM_HUMAN - (O00411) DNA-directed RNA polymerase, mitochondrial precursor (EC 2.7.7.6) (MTRPOL) || Number of peptides = 8 || unambiguous || 70.2% Confident
Q96SE0 - (Q96SE0) Lung alpha/beta hydrolase protein 1 || Number of peptides = 2 || unambiguous || 70.0% Confident
Q9D5E4 - (Q9D5E4) 4930449E07Rik protein (RIKEN cDNA 4930449E07 gene) || Number of peptides = 1 || unambiguous || 69.8% Confident
TP2A_HUMAN - (P11388) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3) || Number of peptides = 4 || unambiguous || 69.8% Confident
Q9BWX7 - (Q9BWX7) BA342L8.1 (Novel protein similar to C21ORF13) || Number of peptides = 2 || unambiguous || 69.8% Confident
Q96G74 - (Q96G74) Hypothetical protein || Number of peptides = 1 || unambiguous || 69.8% Confident
MEPB_HUMAN - (Q16820) Meprin A beta-subunit precursor (EC 3.4.24.18) (Endopeptidase-2) (N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase beta subunit) (PABA peptide hydrolase) (PPH beta) || Number of peptides = 2 || unambiguous || 69.8% Confident
Q8R2V4 - (Q8R2V4) Similar to eukaryotic translation initiation factor 4 gamma, 1 (Fragment) || Number of peptides = 3 || unambiguous || 69.8% Confident
CATL_MOUSE - (P06797) Cathepsin L precursor (EC 3.4.22.15) (Major excreted protein) (MEP) || Number of peptides = 1 || unambiguous || 69.6% Confident
IRX5_HUMAN - (P78411) Iroquois-class homeodomain protein IRX-5 (Iroquois homeobox protein 5) (IRX-2A) || Number of peptides = 2 || unambiguous || 69.6% Confident
Q9UIM0 - (Q9UIM0) Hypothetical protein KIAA0453 (Fragment) || Number of peptides = 2 || unambiguous || 69.4% Confident
ACLY_HUMAN - (P53396) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) || Number of peptides = 1 || unambiguous || 69.4% Confident
O94842 - (O94842) Hypothetical protein KIAA0737 || Number of peptides = 1 || unambiguous || 69.3% Confident
P97393 - (P97393) P190-B || Number of peptides = 4 || unambiguous || 69.2% Confident
Q9DA00 - (Q9DA00) 1700024G10Rik protein || Number of peptides = 4 || unambiguous || 69.0% Confident
Q9H2M8 - (Q9H2M8) DC28 || Number of peptides = 9 || unambiguous || 68.8% Confident
Q96NJ9 - (Q96NJ9) Hypothetical protein FLJ30707 || Number of peptides = 2 || unambiguous || 68.6% Confident
Q9C033 - (Q9C033) Tripartite motif protein TRIM5 isoform gamma || Number of peptides = 3 || ambiguous || 68.6% Confident
Q96K47 - (Q96K47) Hypothetical protein FLJ14701 || Number of peptides = 1 || unambiguous || 68.3% Confident
Q96K49 - (Q96K49) Hypothetical protein FLJ14681 || Number of peptides = 1 || unambiguous || 68.3% Confident
Q9H2I6 - (Q9H2I6) DC44 || Number of peptides = 2 || unambiguous || 68.1% Confident
OPSX_MOUSE - (O35214) Visual pigment-like receptor peropsin || Number of peptides = 6 || unambiguous || 68.0% Confident
Q9D7R0 - (Q9D7R0) 1500031J01Rik protein || Number of peptides = 4 || ambiguous || 67.9% Confident
Q15198 - (Q15198) PDGF receptor beta-like tumor suppressor (Similar to platelet-derived growth factor receptor-like) || Number of peptides = 1 || unambiguous || 67.8% Confident
GELS_MOUSE - (P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) || Number of peptides = 3 || unambiguous || 67.7% Confident
APOH_MOUSE - (Q01339) Beta-2-glycoprotein I precursor (Apolipoprotein H) (Apo-H) (B2GPI) (Beta(2)GPI) (Activated protein C-binding protein) (APC inhibitor) || Number of peptides = 2 || unambiguous || 67.7% Confident
DONS_HUMAN - (Q9NYP3) Downstream of son gene protein (Protein C21orf60) (B17) || Number of peptides = 2 || unambiguous || 67.6% Confident
I12A_HUMAN - (P29459) Interleukin-12 alpha chain precursor (IL-12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (NK cell stimulatory factor chain 1) (NKSF1) || Number of peptides = 4 || unambiguous || 67.6% Confident
MAPB_MOUSE - (P14873) Microtubule-associated protein 1B (MAP 1B) (MAP1.2) (MAP1(X)) [Contains: MAP1 light chain LC1] || Number of peptides = 10 || unambiguous || 67.6% Confident
Q96RY5 - (Q96RY5) Hypothetical protein || Number of peptides = 2 || unambiguous || 67.6% Confident
Q9CS85 - (Q9CS85) 5730419I09Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 67.4% Confident
Q9UPG2 - (Q9UPG2) Phosphatidylinositol 4-kinase 230 || Number of peptides = 3 || unambiguous || 67.3% Confident
CDK4_MOUSE - (P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) || Number of peptides = 4 || unambiguous || 67.3% Confident
Q9D317 - (Q9D317) 9030613J17Rik protein || Number of peptides = 1 || ambiguous || 67.1% Confident
Q8R0N5 - (Q8R0N5) Similar to quinone reductase-like protein (Fragment) || Number of peptides = 3 || unambiguous || 67.0% Confident
Q9JMB6 - (Q9JMB6) MILI (Miwi like) || Number of peptides = 5 || unambiguous || 67.0% Confident
Q8R0Z8 - (Q8R0Z8) Hypothetical 13.8 kDa protein || Number of peptides = 5 || unambiguous || 67.0% Confident
GTA4_MOUSE - (P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4) || Number of peptides = 1 || unambiguous || 66.9% Confident
GTA1_HUMAN - (P08263) Glutathione S-transferase A1 (EC 2.5.1.18) (GTH1) (HA subunit 1) (GST-epsilon) (GSTA1-1) (GST class-alpha) || Number of peptides = 2 || ambiguous || 66.9% Confident
Q9D1P4 - (Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) || Number of peptides = 2 || unambiguous || 66.9% Confident
GSHP_MOUSE - (P46412) Plasma glutathione peroxidase precursor (EC 1.11.1.9) (GSHPx-P) || Number of peptides = 1 || ambiguous || 66.8% Confident
Q8TEP4 - (Q8TEP4) FLJ00149 protein (Fragment) || Number of peptides = 5 || unambiguous || 66.6% Confident
Q9JJA8 - (Q9JJA8) Brain cDNA, clone MNCb-5081 || Number of peptides = 1 || unambiguous || 66.6% Confident
Q9P2D4 - (Q9P2D4) Hypothetical protein KIAA1413 (Fragment) || Number of peptides = 4 || unambiguous || 66.5% Confident
Q8TE97 - (Q8TE97) Hypothetical protein FLJ23755 || Number of peptides = 1 || unambiguous || 66.5% Confident
RB37_MOUSE - (Q9JKM7) Ras-related protein Rab-37 || Number of peptides = 1 || unambiguous || 66.4% Confident
Q921W8 - (Q921W8) Similar to secreted and transmembrane 1 || Number of peptides = 2 || unambiguous || 66.4% Confident
Q9D061 - (Q9D061) 2610100E10Rik protein || Number of peptides = 2 || unambiguous || 66.4% Confident
CLDH_HUMAN - (P56750) Claudin-17 || Number of peptides = 1 || unambiguous || 66.4% Confident
Q9CZJ2 - (Q9CZJ2) 2700081N06Rik protein (RIKEN cDNA 2700081N06 gene) || Number of peptides = 4 || unambiguous || 66.0% Confident
Q60873 - (Q60873) P58 || Number of peptides = 2 || ambiguous || 66.0% Confident
ATS9_HUMAN - (Q9P2N4) ADAMTS-9 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase with thrombospondin motifs 9) (ADAM-TS 9) (ADAM-TS9) || Number of peptides = 3 || unambiguous || 66.0% Confident
O75560 - (O75560) Melastatin 1 || Number of peptides = 4 || unambiguous || 65.9% Confident
Q9CXH3 - (Q9CXH3) 3300002I08Rik protein || Number of peptides = 2 || unambiguous || 65.9% Confident
IHBE_MOUSE - (O08717) Inhibin beta E chain precursor (Activin beta-E chain) || Number of peptides = 3 || unambiguous || 65.7% Confident
Q9EQU1 - (Q9EQU1) Deubiquitinating enzyme UBPY || Number of peptides = 3 || ambiguous || 65.7% Confident
ZS11_HUMAN - (Q9Y6I9) Putative secreted protein ZSIG11 precursor || Number of peptides = 2 || unambiguous || 65.7% Confident
EZH2_MOUSE - (Q61188) Enhancer of zeste homolog 2 (ENX-1) || Number of peptides = 4 || unambiguous || 65.5% Confident
Q8R1E5 - (Q8R1E5) Hypothetical 45.7 kDa protein || Number of peptides = 1 || ambiguous || 65.3% Confident
MGL2_HUMAN - (Q9UJ55) MAGE-like protein 2 (Necdin-like protein 1) (Protein nM15) || Number of peptides = 1 || unambiguous || 65.3% Confident
Q9H2F5 - (Q9H2F5) Enhancer of polycomb || Number of peptides = 1 || unambiguous || 65.0% Confident
Q9NYU1 - (Q9NYU1) UDP-glucose:glycoprotein glucosyltransferase 2 precursor || Number of peptides = 3 || unambiguous || 65.0% Confident
Q8R2V0 - (Q8R2V0) Similar to KIAA0582 protein || Number of peptides = 2 || unambiguous || 64.9% Confident
Q96NX9 - (Q96NX9) Dachshund 2 || Number of peptides = 3 || unambiguous || 64.8% Confident
Q9CQI2 - (Q9CQI2) Lipin 1 || Number of peptides = 7 || unambiguous || 64.7% Confident
Q8WVP0 - (Q8WVP0) Kinesin-like 5 (Mitotic kinesin-like protein 1) || Number of peptides = 1 || unambiguous || 64.7% Confident
Q07900 - (Q07900) M130 antigen cytoplasmic variant 2 precursor || Number of peptides = 2 || unambiguous || 64.7% Confident
DHB3_HUMAN - (P37058) Estradiol 17 beta-dehydrogenase 3 (EC 1.1.1.62) (17-beta-HSD 3) (Testicular 17-beta-hydroxysteroid dehydrogenase) || Number of peptides = 1 || unambiguous || 64.7% Confident
O95660 - (O95660) CD84 || Number of peptides = 2 || unambiguous || 64.7% Confident
Q9CWM7 - (Q9CWM7) 2410017I18Rik protein || Number of peptides = 3 || unambiguous || 64.7% Confident
P70336 - (P70336) Rho-associated, coiled-coil forming protein kinase p160 ROCK-2 || Number of peptides = 8 || unambiguous || 64.3% Confident
PARG_HUMAN - (Q9HBI0) Gamma-parvin || Number of peptides = 2 || unambiguous || 64.2% Confident
MAPE_HUMAN - (P78395) Melanoma antigen preferentially expressed in tumors (Preferentially expressed antigen of melanoma) (OPA-interacting protein 4) (OIP4) || Number of peptides = 2 || unambiguous || 64.2% Confident
ICE4_HUMAN - (P49662) Caspase-4 precursor (EC 3.4.22.-) (CASP-4) (ICH-2 protease) (TX protease) (ICE(rel)-II) || Number of peptides = 6 || unambiguous || 64.2% Confident
Q8VDN2 - (Q8VDN2) ATPase, Na+K+ transporting, alpha 1 polypeptide (Hypothetical 113.0 kDa protein) || Number of peptides = 2 || unambiguous || 64.1% Confident
WDRA_HUMAN - (Q9HBG6) WD-repeat protein 10 || Number of peptides = 9 || ambiguous || 64.1% Confident
Q9BTZ2 - (Q9BTZ2) Peroxisomal short-chain alcohol dehydrogenase || Number of peptides = 2 || ambiguous || 64.1% Confident
Q8VEZ3 - (Q8VEZ3) Olfactory receptor MOR228-2 || Number of peptides = 1 || unambiguous || 64.1% Confident
GTSE_HUMAN - (Q9NYZ3) G2 and S phase expressed protein 1 (B99 homolog) || Number of peptides = 1 || unambiguous || 64.1% Confident
MET_HUMAN - (P08581) Hepatocyte growth factor receptor precursor (EC 2.7.1.112) (Met proto-oncogene tyrosine kinase) (c-met) (HGF receptor) (HGF-SF receptor) || Number of peptides = 7 || unambiguous || 64.0% Confident
TRM2_MOUSE - (Q9ESN6) Tripartite motif protein 2 (Neural activity-related ring finger protein) || Number of peptides = 2 || ambiguous || 63.9% Confident
ATX1_HUMAN - (P54253) Ataxin-1 (Spinocerebellar ataxia type 1 protein) || Number of peptides = 2 || unambiguous || 63.9% Confident
COXE_MOUSE - (P43024) Cytochrome c oxidase polypeptide VIa-liver, mitochondrial precursor (EC 1.9.3.1) || Number of peptides = 3 || ambiguous || 63.8% Confident
Q91VF5 - (Q91VF5) Putative emu1 protein precursor || Number of peptides = 1 || unambiguous || 63.8% Confident
KHL1_MOUSE - (Q9JI74) Kelch-like protein 1 || Number of peptides = 8 || unambiguous || 63.8% Confident
Q9JMB8 - (Q9JMB8) Neural recognition molecule NB-3 || Number of peptides = 10 || unambiguous || 63.7% Confident
CUG1_MOUSE - (P28659) CUG triplet repeat RNA-binding protein 1 (CUG-BP1) (RNA-binding protein BRUNOL-2) (Deadenylation factor CUG-BP) (Deadenylation factor EDEN-BP) (Brain protein F41) || Number of peptides = 2 || ambiguous || 63.7% Confident
Q9CX74 - (Q9CX74) 4122402O22Rik protein || Number of peptides = 2 || unambiguous || 63.6% Confident
Q9D9M2 - (Q9D9M2) Ubiquitin hydrolyzing enzyme 1 (Deubiquitinating enzyme UBH1) || Number of peptides = 2 || ambiguous || 63.6% Confident
Q8R592 - (Q8R592) Similar to KIAA0095 gene product || Number of peptides = 3 || unambiguous || 63.4% Confident
DD24_MOUSE - (Q9ESV0) ATP-dependent RNA helicase DDX24 (DEAD-box protein 24) || Number of peptides = 1 || unambiguous || 63.4% Confident
Q9CTY5 - (Q9CTY5) 2900075B16Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 63.4% Confident
SOC4_HUMAN - (Q8WXH5) Suppressor of cytokine signaling 4 (SOCS-4) || Number of peptides = 2 || unambiguous || 63.3% Confident
P11D_MOUSE - (O35904) Phosphatidylinositol 3-kinase catalytic subunit, delta isoform (EC 2.7.1.137) (PI3-kinase p110 subunit delta) (PtdIns-3-kinase p110) (PI3K) (p110delta) || Number of peptides = 4 || unambiguous || 63.1% Confident
RM39_MOUSE - (Q9JKF7) Mitochondrial 60s ribosomal protein L39 (L39mt) (MRP-L39) (Protein PRED22 homolog) || Number of peptides = 2 || unambiguous || 63.1% Confident
Q9JLZ8 - (Q9JLZ8) Toll/interleukin-1 receptor 8 || Number of peptides = 4 || unambiguous || 63.0% Confident
O70349 - (O70349) Hypothetical 136.7 kDa protein || Number of peptides = 5 || unambiguous || 63.0% Confident
CPZ2_MOUSE - (P56654) Cytochrome P450 2C37 (EC 1.14.14.1) (CYPIIC37) || Number of peptides = 3 || unambiguous || 63.0% Confident
DMA1_MOUSE - (Q9JI44) DNA methyltransferase 1-associated protein 1 (DNMT1-associated protein 1) (DNMAP1) (MAT1-mediated transcriptional repressor) || Number of peptides = 4 || ambiguous || 63.0% Confident
Q9D7Y9 - (Q9D7Y9) 2210009G21Rik protein || Number of peptides = 5 || unambiguous || 62.9% Confident
Q9H9J2 - (Q9H9J2) Mitochondrial 39S ribosomal protein L45 (MRP-L45) || Number of peptides = 1 || unambiguous || 62.9% Confident
Q99K37 - (Q99K37) Similar to HNOEL-iso protein || Number of peptides = 3 || unambiguous || 62.9% Confident
Q91YJ5 - (Q91YJ5) Similar to mitochondrial translational initiation factor 2 || Number of peptides = 4 || unambiguous || 62.8% Confident
Q91V60 - (Q91V60) Thymus LIM protein TLP-A || Number of peptides = 1 || ambiguous || 62.7% Confident
TNP2_HUMAN - (Q03169) Tumor necrosis factor, alpha-induced protein 2 (B94 protein) || Number of peptides = 2 || unambiguous || 62.5% Confident
IRF3_HUMAN - (Q14653) Interferon regulatory factor 3 (IRF-3) || Number of peptides = 1 || unambiguous || 62.4% Confident
NCR2_HUMAN - (Q9Y618) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC) (CTG26) || Number of peptides = 8 || unambiguous || 62.4% Confident
O95944 - (O95944) NK cell activating receptor (NKp44) || Number of peptides = 1 || ambiguous || 62.4% Confident
IF4G_HUMAN - (Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) || Number of peptides = 2 || unambiguous || 62.3% Confident
MAOX_MOUSE - (P06801) NADP-dependent malic enzyme (EC 1.1.1.40) (NADP-ME) (Malic enzyme 1) || Number of peptides = 8 || unambiguous || 62.2% Confident
SAL3_MOUSE - (Q62255) Sal-like protein 3 (Spalt-like protein 3) (MSal) (Fragment) || Number of peptides = 5 || unambiguous || 62.2% Confident
Q9CPY3 - (Q9CPY3) 2610036L13Rik protein || Number of peptides = 2 || unambiguous || 62.1% Confident
SNXE_HUMAN - (Q9Y5W7) Sorting nexin 14 || Number of peptides = 3 || unambiguous || 62.1% Confident
KFP3_HUMAN - (Q92845) Kinesin-associated protein 3 (Smg GDS-associated protein) || Number of peptides = 1 || unambiguous || 62.1% Confident
PTPE_HUMAN - (P23469) Protein-tyrosine phosphatase epsilon precursor (EC 3.1.3.48) (R-PTP-epsilon) || Number of peptides = 4 || ambiguous || 62.1% Confident
CNG1_HUMAN - (P29973) cGMP-gated cation channel alpha 1 (CNG channel alpha 1) (CNG-1) (CNG1) (Cyclic nucleotide gated channel alpha 1) (Cyclic nucleotide gated channel, photoreceptor) (Cyclic-nucleotide-gated cation channel 1) (Rod photoreceptor cGMP-gated channel alpha subunit) || Number of peptides = 1 || unambiguous || 62.1% Confident
Q9D511 - (Q9D511) 4930528G09Rik protein || Number of peptides = 3 || unambiguous || 62.1% Confident
Q9BQQ7 - (Q9BQQ7) Transmembrane protein 7 || Number of peptides = 1 || unambiguous || 62.1% Confident
Q924W7 - (Q924W7) Suppression of tumorigenicity 5 || Number of peptides = 2 || unambiguous || 62.1% Confident
Q9WU59 - (Q9WU59) Hedgehog-interacting protein || Number of peptides = 2 || unambiguous || 62.1% Confident
Q8VFN8 - (Q8VFN8) Olfactory receptor MOR219-1 || Number of peptides = 2 || unambiguous || 61.9% Confident
KIR3_HUMAN - (P37023) Serine/threonine-protein kinase receptor R3 precursor (EC 2.7.1.37) (SKR3) (Activin receptor-like kinase 1) (ALK-1) (TGF-B superfamily receptor type I) (TSR-I) || Number of peptides = 1 || unambiguous || 61.9% Confident
Q9UBK3 - (Q9UBK3) EVI1 (Fragment) || Number of peptides = 1 || unambiguous || 61.9% Confident
O35392 - (O35392) Forkhead 2 || Number of peptides = 3 || unambiguous || 61.9% Confident
EPA1_MOUSE - (Q60750) Ephrin type-A receptor 1 (EC 2.7.1.112) (Tyrosine-protein kinase receptor ESK) (Fragment) || Number of peptides = 1 || unambiguous || 61.9% Confident
Q921C3 - (Q921C3) WDR9 protein, form A || Number of peptides = 9 || unambiguous || 61.9% Confident
Q9CX01 - (Q9CX01) 2400003B18Rik protein || Number of peptides = 2 || unambiguous || 61.9% Confident
Q96K91 - (Q96K91) Hypothetical protein FLJ14435 || Number of peptides = 1 || unambiguous || 61.9% Confident
NRG2_MOUSE - (P56974) Pro-neuregulin-2 precursor (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Divergent of neuregulin 1) (DON-1)] || Number of peptides = 6 || unambiguous || 61.9% Confident
TBG1_MOUSE - (Q9Z310) Tubulin gamma-1 chain (Gamma-1 tubulin) (Gamma-tubulin complex component 1) (GCP-1) || Number of peptides = 2 || ambiguous || 61.9% Confident
ATS1_HUMAN - (Q9UHI8) ADAMTS-1 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase with thrombospondin motifs 1) (ADAM-TS 1) (ADAM-TS1) (METH-1) || Number of peptides = 3 || unambiguous || 61.9% Confident
Q925L1 - (Q925L1) Protocadherin-betaT || Number of peptides = 4 || unambiguous || 61.9% Confident
TFS2_MOUSE - (P10712) Transcription elongation factor S-II (Transcription elongation factor A) || Number of peptides = 2 || ambiguous || 61.9% Confident
FCE2_MOUSE - (P20693) Low affinity immunoglobulin epsilon FC receptor (Lymphocyte IGE receptor) (FC-epsilon-RII) (CD23) || Number of peptides = 1 || ambiguous || 61.9% Confident
TBX1_HUMAN - (O43435) T-box transcription factor TBX1 (T-box protein 1) (Testis-specific T-box protein) || Number of peptides = 2 || unambiguous || 61.9% Confident
LBC_HUMAN - (Q12802) LBC oncogene (P47) (Lymphoid blast crisis oncogene) || Number of peptides = 3 || unambiguous || 61.9% Confident
NTC3_MOUSE - (Q61982) Neurogenic locus notch homolog protein 3 precursor (Notch 3) || Number of peptides = 11 || unambiguous || 61.9% Confident
Q9ERC7 - (Q9ERC7) Pumilio 2 || Number of peptides = 3 || ambiguous || 61.8% Confident
AA1R_HUMAN - (P30542) Adenosine A1 receptor || Number of peptides = 1 || unambiguous || 61.7% Confident
Q8R2V9 - (Q8R2V9) Similar to SEC24 related gene family, member C (S. cerevisiae) (Fragment) || Number of peptides = 1 || unambiguous || 61.6% Confident
DNL1_HUMAN - (P18858) DNA ligase I (EC 6.5.1.1) (Polydeoxyribonucleotide synthase [ATP]) || Number of peptides = 4 || unambiguous || 61.6% Confident
CYGD_HUMAN - (Q02846) Retinal guanylyl cyclase 1 precursor (EC 4.6.1.2) (Guanylate cyclase 2D, retinal) (RETGC-1) (Rod outer segment membrane guanylate cyclase) (ROS-GC) || Number of peptides = 4 || unambiguous || 61.6% Confident
Q9D5Y0 - (Q9D5Y0) 4921507P07Rik protein || Number of peptides = 3 || unambiguous || 61.6% Confident
MLH1_HUMAN - (P40692) DNA mismatch repair protein Mlh1 (MutL protein homolog 1) || Number of peptides = 2 || unambiguous || 61.6% Confident
Q9CYP4 - (Q9CYP4) 5630401D24Rik protein || Number of peptides = 1 || ambiguous || 61.5% Confident
Q9WTM5 - (Q9WTM5) DNA helicase || Number of peptides = 4 || ambiguous || 61.3% Confident
O88313 - (O88313) G-protein coupled receptor || Number of peptides = 1 || ambiguous || 61.3% Confident
Q61161 - (Q61161) Rab8-interacting protein || Number of peptides = 4 || unambiguous || 61.2% Confident
Q8VGT7 - (Q8VGT7) Olfactory receptor MOR264-2 || Number of peptides = 1 || unambiguous || 61.2% Confident
PA24_MOUSE - (P47713) Cytosolic phospholipase A2 (CPLA2) [Includes: Phospholipase A2 (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase); Lysophospholipase (EC 3.1.1.5)] || Number of peptides = 2 || ambiguous || 61.2% Confident
Q9C0C4 - (Q9C0C4) Hypothetical protein KIAA1739 (Fragment) || Number of peptides = 1 || unambiguous || 61.2% Confident
CP11_MOUSE - (P00184) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1) (P450-P1) || Number of peptides = 1 || ambiguous || 61.1% Confident
GLP1_MOUSE - (O35659) Glucagon-like peptide 1 receptor precursor (GLP-1 receptor) (GLP-1-R) (GLP-1R) || Number of peptides = 3 || unambiguous || 61.1% Confident
Q9D418 - (Q9D418) 4930560E09Rik protein || Number of peptides = 3 || ambiguous || 61.1% Confident
O88842 - (O88842) Faciogenital dysplasia protein 3 || Number of peptides = 7 || unambiguous || 61.1% Confident
Q99NC4 - (Q99NC4) Drctnnb1a || Number of peptides = 1 || ambiguous || 61.1% Confident
CASL_HUMAN - (Q14511) Enhancer of filmentation 1 (HEF1) (CRK-associated substrate-related protein) (CAS-L) (PP105) (Neural precursor cell expressed developmentally down-regulated 9) || Number of peptides = 2 || unambiguous || 61.1% Confident
Q9D8Z4 - (Q9D8Z4) 1810015E19Rik protein || Number of peptides = 1 || unambiguous || 61.0% Confident
ALK1_MOUSE - (P97430) Antileukoproteinase 1 precursor (ALP) (Secretory leukocyte protease inhibitor) || Number of peptides = 1 || unambiguous || 61.0% Confident
RAN_HUMAN - (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) || Number of peptides = 2 || ambiguous || 61.0% Confident
Q9CSU0 - (Q9CSU0) 2610304G08Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 61.0% Confident
Q9H705 - (Q9H705) Hypothetical protein FLJ21611 || Number of peptides = 1 || unambiguous || 61.0% Confident
Q8VFU7 - (Q8VFU7) Olfactory receptor MOR210-1 || Number of peptides = 1 || unambiguous || 60.8% Confident
NR61_HUMAN - (Q15406) Orphan nuclear receptor NR6A1 (Germ cell nuclear factor) (GCNF) (Retinoid receptor-related testis specific receptor) (RTR) || Number of peptides = 1 || unambiguous || 60.8% Confident
MN1_HUMAN - (Q10571) Probable tumor suppressor protein MN1 || Number of peptides = 7 || unambiguous || 60.8% Confident
Q8VEG5 - (Q8VEG5) Hypothetical 26.9 kDa protein || Number of peptides = 1 || unambiguous || 60.7% Confident
DPOE_HUMAN - (Q07864) DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7) (DNA polymerase II subunit A) || Number of peptides = 2 || unambiguous || 60.7% Confident
Y176_HUMAN - (Q14681) Hypothetical protein KIAA0176 (Fragment) || Number of peptides = 1 || unambiguous || 60.7% Confident
Q9CT85 - (Q9CT85) 2310034D06Rik protein (Fragment) || Number of peptides = 5 || ambiguous || 60.6% Confident
MASP_MOUSE - (P70124) Maspin precursor (Protease inhibitor 5) || Number of peptides = 1 || unambiguous || 60.5% Confident
Q9C0F7 - (Q9C0F7) Hypothetical protein KIAA1706 (Hypothetical protein FLJ14480) (Fragment) || Number of peptides = 2 || unambiguous || 60.5% Confident
Q9CWS0 - (Q9CWS0) 2410006N07Rik protein || Number of peptides = 1 || unambiguous || 60.3% Confident
Q9D107 - (Q9D107) 2010015D08Rik protein || Number of peptides = 2 || ambiguous || 60.3% Confident
Q8VIB4 - (Q8VIB4) Dystrophin-like protein (Fragment) || Number of peptides = 1 || unambiguous || 60.3% Confident
Q8VGA2 - (Q8VGA2) Olfactory receptor MOR206-2 || Number of peptides = 1 || unambiguous || 60.3% Confident
AD19_MOUSE - (O35674) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 19) (Meltrin beta) || Number of peptides = 3 || unambiguous || 60.2% Confident
Q9UJX3 - (Q9UJX3) Anaphase-promoting complex subunit 7 || Number of peptides = 2 || unambiguous || 60.1% Confident
O14712 - (O14712) Cell cycle progression restoration 8 protein || Number of peptides = 3 || unambiguous || 60.1% Confident
ITB3_MOUSE - (O54890) Integrin beta-3 precursor (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD61 antigen) || Number of peptides = 5 || unambiguous || 60.1% Confident
Q9H7P8 - (Q9H7P8) FLJ00019 protein (Fragment) || Number of peptides = 4 || unambiguous || 60.1% Confident
KPCT_MOUSE - (Q02111) Protein kinase C, theta type (EC 2.7.1.-) (nPKC-theta) || Number of peptides = 2 || ambiguous || 59.9% Confident
Q9Y2H3 - (Q9Y2H3) Hypothetical protein KIAA0967 || Number of peptides = 4 || unambiguous || 59.9% Confident
CD22_HUMAN - (P20273) B-cell receptor CD22 precursor (Leu-14) (B-lymphocyte cell adhesion molecule) (BL-CAM) || Number of peptides = 5 || unambiguous || 59.7% Confident
Q8WXX0 - (Q8WXX0) Ciliary dynein heavy chain 7 || Number of peptides = 7 || unambiguous || 59.7% Confident
Q9BV97 - (Q9BV97) Hypothetical protein || Number of peptides = 1 || unambiguous || 59.7% Confident
LMA2_HUMAN - (P24043) Laminin alpha-2 chain precursor (Laminin M chain) (Merosin heavy chain) || Number of peptides = 8 || unambiguous || 59.7% Confident
AD07_HUMAN - (Q9H2U9) ADAM 7 precursor (A disintegrin and metalloproteinase domain 7) (Sperm maturation-related glycoprotein GP-83) || Number of peptides = 3 || unambiguous || 59.6% Confident
O88576 - (O88576) Sodium- and chloride-dependent transporter XTRP2 || Number of peptides = 2 || unambiguous || 59.5% Confident
AMBP_MOUSE - (Q07456) AMBP protein precursor [Contains: Alpha-1-microglobulin; Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (HI-30)] || Number of peptides = 3 || ambiguous || 59.5% Confident
IP3T_HUMAN - (Q14573) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3 inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) || Number of peptides = 10 || unambiguous || 59.5% Confident
RL2A_MOUSE - (P14115) 60S ribosomal protein L27a (L29) || Number of peptides = 1 || ambiguous || 59.5% Confident
MYBB_MOUSE - (P48972) Myb-related protein B (B-Myb) || Number of peptides = 5 || unambiguous || 59.4% Confident
RL24_HUMAN - (P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30) || Number of peptides = 2 || ambiguous || 59.4% Confident
O60303 - (O60303) Hypothetical protein KIAA0556 (Fragment) || Number of peptides = 3 || unambiguous || 59.4% Confident
Q9CS61 - (Q9CS61) 5730521P14Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 59.3% Confident
Q9D5S7 - (Q9D5S7) 4921528H16Rik protein || Number of peptides = 1 || unambiguous || 59.3% Confident
TRX2_HUMAN - (Q9UMN6) Trithorax homolog 2 (Mixed lineage leukemia gene homolog 2 protein) || Number of peptides = 10 || unambiguous || 59.3% Confident
Q9CXZ2 - (Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence || Number of peptides = 2 || ambiguous || 59.1% Confident
SOX5_MOUSE - (P35710) Transcription factor SOX-5 || Number of peptides = 1 || ambiguous || 59.1% Confident
Q9CXL7 - (Q9CXL7) 3110079O15Rik protein || Number of peptides = 1 || unambiguous || 59.1% Confident
DCT2_MOUSE - (Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) || Number of peptides = 2 || ambiguous || 59.0% Confident
P70696 - (P70696) Histone H2B || Number of peptides = 1 || unambiguous || 59.0% Confident
Q9CZS1 - (Q9CZS1) 2700007F14Rik protein (Aldehyde dehydrogenase 1 family, member B1) || Number of peptides = 2 || ambiguous || 58.8% Confident
O00261 - (O00261) Collagen type XIV (Fragment) || Number of peptides = 8 || unambiguous || 58.7% Confident
Q9H3L8 - (Q9H3L8) My001 protein || Number of peptides = 2 || unambiguous || 58.7% Confident
BAI2_HUMAN - (O60241) Brain-specific angiogenesis inhibitor 2 precursor || Number of peptides = 10 || unambiguous || 58.7% Confident
MAP4_MOUSE - (P27546) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 3 || unambiguous || 58.6% Confident
O43656 - (O43656) Hepatitis A virus cellular receptor 1 || Number of peptides = 2 || ambiguous || 58.6% Confident
Q9JJ26 - (Q9JJ26) Pyrin || Number of peptides = 1 || unambiguous || 58.6% Confident
O15083 - (O15083) Hypothetical protein KIAA0378 (Fragment) || Number of peptides = 1 || unambiguous || 58.6% Confident
Q99LI0 - (Q99LI0) Similar to thyroid hormone receptor interactor 10 || Number of peptides = 2 || ambiguous || 58.6% Confident
Q9Y6A8 - (Q9Y6A8) Vesicle transport-related protein || Number of peptides = 4 || ambiguous || 58.6% Confident
Q9CW46 - (Q9CW46) 1300006N24Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 58.5% Confident
DJB4_HUMAN - (Q9UDY4) DnaJ homolog subfamily B member 4 (Heat shock 40 kDa protein 1 homolog) (Heat shock protein 40 homolog) (HSP40 homolog) || Number of peptides = 1 || unambiguous || 58.5% Confident
O15033 - (O15033) Hypothetical protein KIAA0317 || Number of peptides = 2 || unambiguous || 58.5% Confident
Q9NVZ4 - (Q9NVZ4) Hypothetical protein FLJ10415 || Number of peptides = 5 || unambiguous || 58.3% Confident
ABB1_MOUSE - (Q9QXJ1) Amyloid beta A4 precursor protein-binding family B member 1 (Fe65 protein) || Number of peptides = 1 || unambiguous || 58.2% Confident
TP2A_MOUSE - (Q01320) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3) || Number of peptides = 7 || unambiguous || 58.2% Confident
EPA8_HUMAN - (P29322) Ephrin type-A receptor 8 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor EEK) (EPH-and ELK-related kinase) (HEK3) || Number of peptides = 5 || unambiguous || 58.1% Confident
CMC2_MOUSE - (Q9QXX4) Calcium-binding mitochondrial carrier protein Aralar2 (Solute carrier family 25, member 13) (Citrin) || Number of peptides = 3 || unambiguous || 58.1% Confident
CMC1_HUMAN - (O75746) Calcium-binding mitochondrial carrier protein Aralar1 (Solute carrier family 25, member 12) || Number of peptides = 4 || unambiguous || 58.1% Confident
Z147_MOUSE - (Q61510) Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp) || Number of peptides = 5 || unambiguous || 58.0% Confident
ENP5_HUMAN - (O75356) Ectonucleoside triphosphate diphosphohydrolase 5 precursor (EC 3.6.1.6) (NTPDase5) (Nucleoside diphosphatase) (CD39 antigen-like 4) (ER-UDPase) || Number of peptides = 3 || unambiguous || 57.9% Confident
CADN_MOUSE - (Q99PF4) Cadherin 23 precursor (Otocadherin) || Number of peptides = 7 || unambiguous || 57.8% Confident
CD9_MOUSE - (P40240) CD9 antigen || Number of peptides = 1 || unambiguous || 57.8% Confident
PGCB_MOUSE - (Q61361) Brevican core protein precursor || Number of peptides = 2 || unambiguous || 57.8% Confident
Q9WVQ1 - (Q9WVQ1) Activin receptor interacting protein 1 || Number of peptides = 4 || unambiguous || 57.7% Confident
Q8TEG9 - (Q8TEG9) FLJ00228 protein (Fragment) || Number of peptides = 7 || unambiguous || 57.6% Confident
Q99JQ1 - (Q99JQ1) Hypothetical 7.4 kDa protein || Number of peptides = 1 || unambiguous || 57.6% Confident
Q8R365 - (Q8R365) Similar to hypothetical protein FLJ21140 (Fragment) || Number of peptides = 1 || unambiguous || 57.4% Confident
Q9CWV2 - (Q9CWV2) 2410003J24Rik protein || Number of peptides = 5 || unambiguous || 57.3% Confident
FRT1_HUMAN - (Q92837) Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas) || Number of peptides = 1 || ambiguous || 57.3% Confident
Q9DB87 - (Q9DB87) 1500003N10Rik protein || Number of peptides = 2 || unambiguous || 57.3% Confident
P97499 - (P97499) Telomerase protein-1 || Number of peptides = 4 || unambiguous || 57.2% Confident
Q13478 - (Q13478) IL-1Rrp precursor || Number of peptides = 1 || unambiguous || 57.2% Confident
EP42_MOUSE - (P49222) Erythrocyte membrane protein band 4.2 (P4.2) (Pallidin) || Number of peptides = 4 || unambiguous || 57.2% Confident
Q8TDD1 - (Q8TDD1) ATP-dependent RNA helicase || Number of peptides = 1 || unambiguous || 57.2% Confident
Q9R070 - (Q9R070) Ca(2+)-sensitive chloride channel 2 || Number of peptides = 5 || unambiguous || 57.1% Confident
Q9D3P6 - (Q9D3P6) DNA segment, human D0S6743E || Number of peptides = 2 || ambiguous || 57.1% Confident
Q8VCD5 - (Q8VCD5) Similar to cofactor required for Sp1 transcriptional activation, subunit 6 (77 kDa) || Number of peptides = 2 || unambiguous || 57.0% Confident
Q96M49 - (Q96M49) Hypothetical protein FLJ32827 (Fragment) || Number of peptides = 3 || unambiguous || 57.0% Confident
P531_HUMAN - (Q12888) Tumor suppressor p53-binding protein 1 (p53-binding protein 1) (53BP1) || Number of peptides = 5 || unambiguous || 57.0% Confident
ITN1_HUMAN - (Q15811) Intersectin 1 (SH3 domain-containing protein 1A) (SH3P17) || Number of peptides = 5 || unambiguous || 57.0% Confident
Q8TF39 - (Q8TF39) Hypothetical protein KIAA1962 (Fragment) || Number of peptides = 3 || unambiguous || 57.0% Confident
Q9H4G6 - (Q9H4G6) DJ885L7.9.1 (Death associated transcription factor 1 (Contains KIAA0333), isoform 1) (Fragment) || Number of peptides = 7 || ambiguous || 57.0% Confident
CFAH_MOUSE - (P06909) Complement factor H precursor (Protein beta-1-H) || Number of peptides = 3 || unambiguous || 57.0% Confident
CLH2_HUMAN - (P53675) Clathrin heavy chain 2 (CLH-22) || Number of peptides = 7 || unambiguous || 57.0% Confident
Q9H991 - (Q9H991) Hypothetical protein FLJ12916 || Number of peptides = 5 || unambiguous || 56.9% Confident
Q8R0E5 - (Q8R0E5) RIKEN cDNA 1700022C21 gene || Number of peptides = 1 || unambiguous || 56.8% Confident
Q8R2T7 - (Q8R2T7) Similar to oxysterol binding protein-like 10 || Number of peptides = 1 || unambiguous || 56.8% Confident
Q14221 - (Q14221) Endosome-associated protein || Number of peptides = 7 || ambiguous || 56.7% Confident
VGR2_HUMAN - (P35968) Vascular endothelial growth factor receptor 2 precursor (EC 2.7.1.112) (VEGFR-2) (Kinase insert domain receptor) (Protein-tyrosine kinase receptor Flk-1) || Number of peptides = 4 || unambiguous || 56.7% Confident
Q9Z0T6 - (Q9Z0T6) Polycystic kidney disease and receptor for egg jelly related protein || Number of peptides = 7 || unambiguous || 56.7% Confident
TAU_HUMAN - (P10636) Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) || Number of peptides = 5 || unambiguous || 56.7% Confident
Q8WZ42 - (Q8WZ42) Titin || Number of peptides = 91 || unambiguous || 56.7% Confident
MCCB_HUMAN - (Q9HCC0) Methylcrotonyl-CoA carboxylase beta chain, mitochondrial precursor (EC 6.4.1.4) (3-Methylcrotonyl-CoA carboxylase 2) (MCCase beta subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase beta subunit) || Number of peptides = 4 || unambiguous || 56.6% Confident
ABF1_MOUSE - (Q61329) Alpha-fetoprotein enhancer binding protein (AT motif-binding factor) (AT-binding transcription factor 1) || Number of peptides = 8 || unambiguous || 56.6% Confident
MY9B_MOUSE - (Q9QY06) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 11 || unambiguous || 56.5% Confident
Q8VIM6 - (Q8VIM6) Stereocilin || Number of peptides = 4 || unambiguous || 56.5% Confident
CBX2_MOUSE - (P30658) Chromobox protein homolog 2 (Modifier 3 protein) (M33) || Number of peptides = 1 || unambiguous || 56.5% Confident
Q9BZF9 - (Q9BZF9) Uveal autoantigen || Number of peptides = 5 || unambiguous || 56.4% Confident
Q99974 - (Q99974) POMBE CDC5-related protein (KIAA0432) (CDC5 (Cell division cycle 5, S. POMBE, homolog)-like) || Number of peptides = 2 || unambiguous || 56.3% Confident
Q9CXG2 - (Q9CXG2) 3732413A17Rik protein || Number of peptides = 1 || ambiguous || 56.1% Confident
OSTC_HUMAN - (P02818) Osteocalcin precursor (Gamma-carboxyglutamic acid-containing protein) (Bone Gla-protein) (BGP) || Number of peptides = 3 || unambiguous || 56.1% Confident
SP24_HUMAN - (Q13103) Secreted phosphoprotein 24 precursor (SPP-24) || Number of peptides = 1 || unambiguous || 56.1% Confident
O35596 - (O35596) Transcription factor || Number of peptides = 4 || ambiguous || 56.1% Confident
P97858 - (P97858) UGTREL1 (Solute carrier family 35 (UDP-galactose transporter), member 2) || Number of peptides = 3 || unambiguous || 56.0% Confident
Q9H703 - (Q9H703) Hypothetical protein FLJ21613 || Number of peptides = 3 || unambiguous || 56.0% Confident
CGBP_MOUSE - (Q9CWW7) CpG binding protein (Protein containing PHD finger and CXXC domain 1) || Number of peptides = 1 || ambiguous || 55.8% Confident
COMP_HUMAN - (P49747) Cartilage oligomeric matrix protein precursor (COMP) || Number of peptides = 2 || unambiguous || 55.8% Confident
O75118 - (O75118) Hypothetical protein KIAA0622 (Fragment) || Number of peptides = 5 || unambiguous || 55.8% Confident
LGMN_MOUSE - (O89017) Legumain precursor (EC 3.4.22.34) (Asparaginyl endopeptidase) (Protease, cysteine 1) || Number of peptides = 4 || unambiguous || 55.7% Confident
Q13443 - (Q13443) Cellular disintegrin-related protein precursor (EC 3.4.24.-) (Metalloprotease/disintegrin/cysteine-rich protein 9) (MDC9) (MYELOMA cell metalloproteinase) (MCMP) || Number of peptides = 3 || unambiguous || 55.7% Confident
Q9JKZ9 - (Q9JKZ9) Acupuncture induced gene 1 || Number of peptides = 1 || unambiguous || 55.6% Confident
Q8TEY7 - (Q8TEY7) PVHL-interacting deubiquitinating enzyme 1 type I || Number of peptides = 2 || ambiguous || 55.6% Confident
Q9H0R5 - (Q9H0R5) Hypothetical protein || Number of peptides = 3 || ambiguous || 55.6% Confident
CIK4_MOUSE - (Q61423) Voltage-gated potassium channel protein Kv1.4 || Number of peptides = 2 || unambiguous || 55.6% Confident
AF6_HUMAN - (P55196) AF-6 protein || Number of peptides = 3 || ambiguous || 55.6% Confident
Q920I5 - (Q920I5) F-LANa || Number of peptides = 1 || unambiguous || 55.6% Confident
Q9NPB8 - (Q9NPB8) Hypothetical protein KIAA1434 (DJ1022P6.2) (Fragment) || Number of peptides = 2 || unambiguous || 55.3% Confident
O70471 - (O70471) Channel interacting PDZ domain protein || Number of peptides = 4 || unambiguous || 55.1% Confident
Q96BZ4 - (Q96BZ4) Hypothetical protein || Number of peptides = 1 || unambiguous || 55.1% Confident
Q922W2 - (Q922W2) Unknown (Protein for MGC:7055) || Number of peptides = 4 || ambiguous || 55.0% Confident
Q9Y6X7 - (Q9Y6X7) Hypothetical protein KIAA0864 (Fragment) || Number of peptides = 7 || unambiguous || 55.0% Confident
Q9ER97 - (Q9ER97) Neuroglobin || Number of peptides = 1 || ambiguous || 55.0% Confident
FOLC_MOUSE - (P48760) Folylpolyglutamate synthase, mitochondrial precursor (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (FPGS) || Number of peptides = 6 || unambiguous || 55.0% Confident
Q9UFX9 - (Q9UFX9) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 55.0% Confident
Q91ZS2 - (Q91ZS2) MASS1 || Number of peptides = 13 || unambiguous || 55.0% Confident
Q9BY89 - (Q9BY89) Hypothetical protein KIAA1671 (Fragment) || Number of peptides = 2 || unambiguous || 54.9% Confident
RT17_MOUSE - (Q9CQE3) 28S ribosomal protein S17, mitochondrial precursor (MRP-S17) || Number of peptides = 1 || unambiguous || 54.9% Confident
UBAY_MOUSE - (P31254) Ubiquitin-activating enzyme E1 Y (Fragment) || Number of peptides = 3 || ambiguous || 54.9% Confident
AS12_HUMAN - (Q8WXK4) Ankyrin repeat and SOCS box containing protein 12 (ASB-12) || Number of peptides = 1 || unambiguous || 54.9% Confident
MOT4_MOUSE - (P57787) Monocarboxylate transporter 4 (MCT 4) || Number of peptides = 5 || unambiguous || 54.9% Confident
CO7S_HUMAN - (O60397) Cytochrome c oxidase subunit VIIa-L related protein, mitochondrial precursor || Number of peptides = 1 || unambiguous || 54.9% Confident
O35615 - (O35615) FOG || Number of peptides = 7 || unambiguous || 54.8% Confident
RFL3_HUMAN - (O75679) Ret finger protein-like 3 || Number of peptides = 2 || unambiguous || 54.8% Confident
ASB3_HUMAN - (Q9Y575) Ankyrin repeat and SOCS box containing protein 3 (ASB-3) || Number of peptides = 1 || unambiguous || 54.8% Confident
O88207 - (O88207) Collagen a1(V) || Number of peptides = 6 || unambiguous || 54.8% Confident
Q96ID7 - (Q96ID7) Similar to hypothetical protein PRO1722 || Number of peptides = 2 || unambiguous || 54.8% Confident
Q9NXW7 - (Q9NXW7) Hypothetical protein FLJ20015 || Number of peptides = 2 || unambiguous || 54.8% Confident
Q91V93 - (Q91V93) DBC2 protein || Number of peptides = 2 || unambiguous || 54.8% Confident
Q9CQC8 - (Q9CQC8) DNA segment, Chr 9, Wayne state University 18, expressed || Number of peptides = 5 || unambiguous || 54.7% Confident
CPZ5_MOUSE - (P56657) Cytochrome P450 2C40 (EC 1.14.14.1) (CYPIIC40) || Number of peptides = 2 || ambiguous || 54.5% Confident
GPV_MOUSE - (O08742) Platelet glycoprotein V precursor (GPV) (CD42D) || Number of peptides = 1 || unambiguous || 54.5% Confident
TRL3_HUMAN - (Q9HCF6) Long transient receptor potential channel 3 (LTrpC3) (Fragment) || Number of peptides = 2 || unambiguous || 54.5% Confident
Q9R0L6 - (Q9R0L6) Pericentriolar material-1 || Number of peptides = 4 || ambiguous || 54.4% Confident
Q9BR09 - (Q9BR09) DJ337O18.6 (Novel protein similar to Drosophila neuralized (Neu)) (Hypothetical protein FLJ30259) || Number of peptides = 3 || unambiguous || 54.4% Confident
O75433 - (O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog) || Number of peptides = 3 || unambiguous || 54.4% Confident
Q9D2Q3 - (Q9D2Q3) 2310057M21Rik protein || Number of peptides = 1 || unambiguous || 54.4% Confident
O15080 - (O15080) Hypothetical protein KIAA0375 (Fragment) || Number of peptides = 8 || unambiguous || 54.2% Confident
Q9BW18 - (Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit || Number of peptides = 2 || ambiguous || 54.2% Confident
Q9CR16 - (Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) || Number of peptides = 4 || unambiguous || 54.2% Confident
NOX1_HUMAN - (Q9Y5S8) NADPH oxidase homolog 1 (NOX-1) (NOH-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (Mitogenic oxidase 1) (MOX1) || Number of peptides = 5 || unambiguous || 54.0% Confident
TISR_HUMAN - (Q9Y5M6) Oculomedin (Trabecular meshwork inducible stretch response protein) (TISR) || Number of peptides = 2 || unambiguous || 54.0% Confident
Q8R0T2 - (Q8R0T2) Similar to hypothetical protein FLJ23436 || Number of peptides = 1 || ambiguous || 54.0% Confident
Q8VGM5 - (Q8VGM5) Olfactory receptor MOR233-2 || Number of peptides = 1 || ambiguous || 54.0% Confident
IF34_HUMAN - (O75821) Eukaryotic translation initiation factor 3 subunit 4 (eIF-3 delta) (eIF3 p44) (eIF-3 RNA-binding subunit) (eIF3 p42) || Number of peptides = 1 || unambiguous || 53.9% Confident
Q8WXF6 - (Q8WXF6) Myocyte inner nuclear membrane protein || Number of peptides = 2 || ambiguous || 53.9% Confident
O54802 - (O54802) Nucleosome assembly protein 1-like 3 (MB20) || Number of peptides = 1 || unambiguous || 53.9% Confident
Q96SY5 - (Q96SY5) Hypothetical protein FLJ14564 (Fragment) || Number of peptides = 5 || ambiguous || 53.9% Confident
Q8WXD9 - (Q8WXD9) Cask-interacting protein 1 || Number of peptides = 6 || unambiguous || 53.9% Confident
Q9CSF9 - (Q9CSF9) 2410005K20Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 53.8% Confident
RFXK_MOUSE - (Q9Z205) DNA-binding protein RFXANK (Regulatory factor X subunit B) (RFX-B) (Regulatory factor X-associated ankyrin-containing protein) (Ankyrin repeat-containing adapter protein Tvl-1) || Number of peptides = 6 || unambiguous || 53.8% Confident
TSC2_MOUSE - (Q61037) Tuberin (Tuberous sclerosis 2 homolog protein) || Number of peptides = 4 || unambiguous || 53.8% Confident
UROM_HUMAN - (P07911) Uromodulin precursor (Tamm-Horsfall urinary glycoprotein) (THP) || Number of peptides = 3 || unambiguous || 53.8% Confident
Q9NYV6 - (Q9NYV6) RRN3 || Number of peptides = 3 || ambiguous || 53.7% Confident
BFS2_HUMAN - (Q13515) Phakinin (Beaded filament structural protein 2) (Lens fiber cell beaded filament protein CP 49) (CP49) (49 kDa cytoskeletal protein) (CP 47) (CP47) (Lens intermediate filament like-light) (LIFL-L) || Number of peptides = 4 || unambiguous || 53.7% Confident
IL22_HUMAN - (Q9GZX6) Interleukin-22 precursor (IL-22) (IL-10-related T-cell-derived inducible factor) (IL-TIF) || Number of peptides = 2 || unambiguous || 53.6% Confident
OSB2_HUMAN - (Q969R2) Oxysterol-binding protein 2 (Oxysterol binding protein-related protein 4) (OSBP-related protein 4) (ORP-4) || Number of peptides = 5 || unambiguous || 53.6% Confident
PPCE_HUMAN - (P48147) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) || Number of peptides = 1 || ambiguous || 53.5% Confident
DMC1_MOUSE - (Q61880) Meiotic recombination protein DMC1/LIM15 homolog || Number of peptides = 3 || unambiguous || 53.5% Confident
GATB_HUMAN - (O75879) Probable glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial precursor (EC 6.3.5.-) (Glu-ADT subunit B) (Cytochrome oxidase assembly factor PET112 homolog) || Number of peptides = 4 || unambiguous || 53.5% Confident
DPG2_MOUSE - (Q9QZM2) DNA polymerase gamma subunit 2, mitochondrial precursor (EC 2.7.7.7) (Mitochondrial DNA polymerase accessory subunit) (PolG-beta) (MtPolB) (DNA polymerase gamma accessory 55 kDa subunit) (p55) || Number of peptides = 5 || unambiguous || 53.5% Confident
ASAH_MOUSE - (Q9WV54) Acid ceramidase precursor (EC 3.5.1.23) (Acylsphingosine deacylase) (N-acylsphingosine amidohydrolase) (AC) || Number of peptides = 8 || unambiguous || 53.3% Confident
Q9DCK5 - (Q9DCK5) 0610030G03Rik protein || Number of peptides = 2 || unambiguous || 53.3% Confident
TTLL_HUMAN - (O95922) Tubulin tyrosine ligase-like protein 1 || Number of peptides = 5 || ambiguous || 53.3% Confident
Q9UI07 - (Q9UI07) Heat shock protein hsp70-related protein || Number of peptides = 3 || ambiguous || 53.3% Confident
O88738 - (O88738) Ubiquitin-conjugating enzyme || Number of peptides = 11 || unambiguous || 53.3% Confident
Q9EP91 - (Q9EP91) Transcription complex subunit NF-ATc4 || Number of peptides = 4 || unambiguous || 53.3% Confident
Q9JJE4 - (Q9JJE4) Brain cDNA, clone MNCb-0914 (1500004C10Rik protein) (RIKEN cDNA 1500004C10 gene) || Number of peptides = 2 || ambiguous || 53.3% Confident
Q9C0K7 - (Q9C0K7) Amyotrophic lateral sclerosis 2 (Hypothetical protein FLJ14731) (Amyotrophic lateral sclerosis 2 (Juvenile) chromosome region, candidate 2) || Number of peptides = 3 || unambiguous || 53.3% Confident
Q9NTT5 - (Q9NTT5) DJ202D23.2 (Novel protein similar to C21ORF5 (KIAA0933)) (Fragment) || Number of peptides = 2 || ambiguous || 53.3% Confident
LMP2_MOUSE - (P17047) Lysosome-associated membrane glycoprotein 2 precursor (LAMP-2) (Lysosomal membrane glycoprotein-type B) (LGP-B) (CD107B) || Number of peptides = 3 || unambiguous || 53.2% Confident
O88741 - (O88741) Ganglioside-induced differentiation associated protein 1 || Number of peptides = 2 || unambiguous || 53.2% Confident
C2TA_MOUSE - (P79621) MHC class II transactivator CIITA || Number of peptides = 2 || ambiguous || 53.2% Confident
Q9BSR9 - (Q9BSR9) Hypothetical protein (Fragment) || Number of peptides = 3 || ambiguous || 53.1% Confident
RL39_HUMAN - (P02404) 60S ribosomal protein L39 || Number of peptides = 1 || unambiguous || 53.1% Confident
DJA1_MOUSE - (P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) || Number of peptides = 5 || ambiguous || 53.1% Confident
Q8R153 - (Q8R153) Similar to hypothetical protein FLJ11078 || Number of peptides = 2 || unambiguous || 53.0% Confident
Q9Y4C1 - (Q9Y4C1) Hypothetical protein KIAA0742 (Fragment) || Number of peptides = 1 || unambiguous || 53.0% Confident
Q9QWV2 - (Q9QWV2) Sacm21 || Number of peptides = 1 || ambiguous || 53.0% Confident
Q9QXV2 - (Q9QXV2) REV1 protein || Number of peptides = 9 || ambiguous || 53.0% Confident
Q9DAH6 - (Q9DAH6) 1700010I14Rik protein || Number of peptides = 1 || unambiguous || 53.0% Confident
CO1A_MOUSE - (O89053) Coronin-like protein p57 (Coronin 1A) || Number of peptides = 1 || ambiguous || 53.0% Confident
TRUA_MOUSE - (Q9WU56) tRNA pseudouridine synthase A (EC 4.2.1.70) (Pseudouridylate synthase I) (Pseudouridine synthase I) (Uracil hydrolyase) || Number of peptides = 1 || ambiguous || 52.9% Confident
Q9CVW2 - (Q9CVW2) 2310005D06Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 52.9% Confident
Q9DC49 - (Q9DC49) Repeat family 3 gene || Number of peptides = 1 || ambiguous || 52.9% Confident
VATC_HUMAN - (P21283) Vacuolar ATP synthase subunit C (EC 3.6.3.14) (V-ATPase C subunit) (Vacuolar proton pump C subunit) || Number of peptides = 2 || unambiguous || 52.8% Confident
Q9Y6R5 - (Q9Y6R5) Germinal center kinase related protein kinase || Number of peptides = 4 || unambiguous || 52.8% Confident
Q8R123 - (Q8R123) Hypothetical 54.8 kDa protein || Number of peptides = 2 || unambiguous || 52.8% Confident
Q96BP3 - (Q96BP3) Hypothetical protein KIAA0073 || Number of peptides = 1 || unambiguous || 52.7% Confident
Q9GZT1 - (Q9GZT1) RNA binding protein MCG10 || Number of peptides = 1 || ambiguous || 52.7% Confident
CTN1_MOUSE - (P26231) Alpha-1 catenin (102 kDa cadherin-associated protein) (CAP102) (Alpha E-catenin) || Number of peptides = 3 || ambiguous || 52.7% Confident
EVI1_MOUSE - (P14404) Ecotropic virus integration 1 site protein || Number of peptides = 2 || unambiguous || 52.6% Confident
Q9JHW9 - (Q9JHW9) Retinaldehyde dehydrogenase 3 (EC 1.2.1.3) || Number of peptides = 2 || ambiguous || 52.6% Confident
Q96AM3 - (Q96AM3) Hypothetical protein || Number of peptides = 1 || ambiguous || 52.6% Confident
ADML_HUMAN - (P35318) ADM precursor [Contains: Adrenomedullin (AM); Proadrenomedullin N-20 terminal peptide (ProAM-N20) (ProAM N-terminal 20 peptide) (PAMP)] || Number of peptides = 2 || unambiguous || 52.6% Confident
Q9H1Q5 - (Q9H1Q5) BA12M19.2.1 (Vacuolar protein sorting protein 16 (VPS16)) || Number of peptides = 2 || unambiguous || 52.6% Confident
Q9DBU4 - (Q9DBU4) RAD21 homolog (S. pombe) || Number of peptides = 2 || ambiguous || 52.5% Confident
DDC_MOUSE - (O88533) Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28) (AADC) (DOPA decarboxylase) (DDC) || Number of peptides = 2 || unambiguous || 52.5% Confident
ARVC_MOUSE - (P98203) Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog (Fragment) || Number of peptides = 2 || ambiguous || 52.5% Confident
OTC_MOUSE - (P11725) Ornithine carbamoyltransferase, mitochondrial precursor (EC 2.1.3.3) (OTCase) (Ornithine transcarbamylase) || Number of peptides = 1 || unambiguous || 52.5% Confident
CP2B_MOUSE - (O35084) 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (EC 1.14.-.-) (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha) || Number of peptides = 2 || unambiguous || 52.5% Confident
Q96MC4 - (Q96MC4) Hypothetical protein FLJ32655 || Number of peptides = 4 || unambiguous || 52.5% Confident
Q9DCS3 - (Q9DCS3) Nuclear receptor binding factor 1 || Number of peptides = 4 || unambiguous || 52.5% Confident
FBL1_MOUSE - (Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) || Number of peptides = 3 || unambiguous || 52.4% Confident
Q91XX0 - (Q91XX0) Protocadherin gamma C4 || Number of peptides = 6 || unambiguous || 52.4% Confident
EPLI_MOUSE - (Q9ERG0) Epithelial protein lost in neoplasm (mEPLIN) || Number of peptides = 4 || unambiguous || 52.4% Confident
NCR2_MOUSE - (Q9WU42) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC) || Number of peptides = 8 || unambiguous || 52.4% Confident
ATS2_HUMAN - (O95450) ADAMTS-2 precursor (EC 3.4.24.14) (A disintegrin and metalloproteinase with thrombospondin motifs 2) (ADAM-TS 2) (ADAM-TS2) (Procollagen I/II amino-propeptide processing enzyme) (Procollagen I N-proteinase) (PC I-NP) (Procollagen N-endopeptidase) (pNPI) (Procollagen I/II amino-propeptide processing enzyme) || Number of peptides = 4 || unambiguous || 52.2% Confident
SR68_HUMAN - (Q9UHB9) Signal recognition particle 68 kDa protein (SRP68) || Number of peptides = 2 || unambiguous || 52.2% Confident
Q9D1B9 - (Q9D1B9) 1110015G04Rik protein (RIKEN cDNA 1110015G04 gene) (Similar to melanoma-associated antigen recognised by cytotoxic T lymphocytes) || Number of peptides = 2 || unambiguous || 52.2% Confident
Q9NTU6 - (Q9NTU6) Hypothetical protein || Number of peptides = 3 || unambiguous || 52.2% Confident
Q9Y3T6 - (Q9Y3T6) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 52.2% Confident
CP4Y_HUMAN - (Q02928) Cytochrome P450 4A11 precursor (EC 1.14.15.3) (CYPIVA11) (Fatty acid omega-hydroxylase) (P-450 HK omega) (Lauric acid omega-hydroxylase) (CYP4AII) (P450-HL-omega) || Number of peptides = 3 || unambiguous || 52.2% Confident
ITK_HUMAN - (Q08881) Tyrosine-protein kinase ITK/TSK (EC 2.7.1.112) (T-cell-specific kinase) (Tyrosine-protein kinase Lyk) (Kinase EMT) || Number of peptides = 1 || unambiguous || 52.2% Confident
CONT_MOUSE - (P12960) Contactin precursor (Neural cell surface protein F3) || Number of peptides = 4 || unambiguous || 52.2% Confident
Q14674 - (Q14674) Hypothetical protein KIAA0165 || Number of peptides = 6 || unambiguous || 52.1% Confident
ACH7_HUMAN - (P36544) Neuronal acetylcholine receptor protein, alpha-7 chain precursor || Number of peptides = 2 || unambiguous || 52.0% Confident
Q9D3N0 - (Q9D3N0) 5430405H02Rik protein || Number of peptides = 1 || unambiguous || 52.0% Confident
GLUC_MOUSE - (P55095) Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP); Glucagon; Glucagon-like peptide 1 (GLP1); Glucagon-like peptide 2 (GLP2)] || Number of peptides = 1 || unambiguous || 52.0% Confident
Q9WVB4 - (Q9WVB4) SLIT3 (Fragment) || Number of peptides = 8 || unambiguous || 52.0% Confident
Q9C093 - (Q9C093) Hypothetical protein KIAA1770 (Fragment) || Number of peptides = 2 || unambiguous || 51.9% Confident
Q9JMA4 - (Q9JMA4) NK receptor Ly-49Q || Number of peptides = 6 || unambiguous || 51.7% Confident
Q9NWH4 - (Q9NWH4) Hypothetical protein || Number of peptides = 1 || unambiguous || 51.7% Confident
Q9BX57 - (Q9BX57) DJ823N20.1.3 (V-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog, isoform 3) (Fragment) || Number of peptides = 2 || unambiguous || 51.7% Confident
Q8TDG4 - (Q8TDG4) DNA helicase HEL308 || Number of peptides = 8 || unambiguous || 51.7% Confident
Q969I6 - (Q969I6) Amino acid transporter hNAT3 (Amino acid transporter system A3) (System A amino acid transporter 3) || Number of peptides = 2 || unambiguous || 51.6% Confident
PTGI_MOUSE - (O35074) Prostacyclin synthase (EC 5.3.99.4) (Prostaglandin I2 synthase) || Number of peptides = 2 || ambiguous || 51.6% Confident
Q8VHA7 - (Q8VHA7) Myotubularin-related protein 2 || Number of peptides = 1 || ambiguous || 51.6% Confident
APP1_MOUSE - (Q03157) Amyloid-like protein 1 precursor (APLP) || Number of peptides = 4 || unambiguous || 51.4% Confident
Q9CU51 - (Q9CU51) 6330403N15Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 51.4% Confident
HRG_HUMAN - (P04196) Histidine-rich glycoprotein precursor (Histidine-proline rich glycoprotein) (HPRG) || Number of peptides = 1 || unambiguous || 51.4% Confident
Q8WYK1 - (Q8WYK1) Caspr5 || Number of peptides = 3 || unambiguous || 51.4% Confident
O95196 - (O95196) Neuroglycan C || Number of peptides = 4 || unambiguous || 51.4% Confident
PEXE_MOUSE - (Q9R0A0) Peroxisomal membrane protein PEX14 (Peroxin-14) (Peroxisomal membrane anchor protein PEX14) (PTS1 receptor docking protein) || Number of peptides = 2 || unambiguous || 51.3% Confident
Y197_MOUSE - (Q9Z0W3) Protein KIAA0197 (GTL-13) || Number of peptides = 2 || unambiguous || 51.3% Confident
Q12937 - (Q12937) BS-84 || Number of peptides = 1 || unambiguous || 51.3% Confident
DLP1_MOUSE - (Q9D415) Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (SAP90/PSD-95-associated protein 1) (SAPAP1) (PSD-95/SAP90 binding protein 1) (Fragment) || Number of peptides = 1 || ambiguous || 51.3% Confident
AATM_HUMAN - (P00505) Aspartate aminotransferase, mitochondrial precursor (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-2) || Number of peptides = 1 || unambiguous || 51.3% Confident
Q9BW29 - (Q9BW29) Similar to hyaluronoglucosaminidase 2 || Number of peptides = 3 || ambiguous || 51.3% Confident
Q8VG83 - (Q8VG83) Olfactory receptor MOR209-1 || Number of peptides = 1 || unambiguous || 51.2% Confident
Q8VFC4 - (Q8VFC4) Olfactory receptor MOR208-3 || Number of peptides = 2 || unambiguous || 51.2% Confident
CAML_MOUSE - (P11627) Neural cell adhesion molecule L1 precursor (N-CAM L1) || Number of peptides = 6 || unambiguous || 51.2% Confident
BIR1_HUMAN - (Q13075) Baculoviral IAP repeat-containing protein 1 (Neuronal apoptosis inhibitory protein) || Number of peptides = 6 || ambiguous || 51.1% Confident
U520_HUMAN - (O75643) U5 small nuclear ribonucleoprotein 200 kDa helicase (U5 snRNP-specific 200 kDa protein) (U5-200KD) (Fragment) || Number of peptides = 5 || ambiguous || 51.1% Confident
Q9ERQ9 - (Q9ERQ9) WAVE-1 || Number of peptides = 1 || ambiguous || 51.1% Confident
K1CR_HUMAN - (P05783) Keratin, type I cytoskeletal 18 (Cytokeratin 18) (K18) (CK 18) || Number of peptides = 3 || unambiguous || 51.1% Confident
RB35_HUMAN - (Q15286) Ras-related protein Rab-35 (RAB-1C) (GTP-binding protein RAY) || Number of peptides = 1 || unambiguous || 51.0% Confident
Q91V18 - (Q91V18) Beta-1,3-N-acetylglucosaminyltransferase (Beta-1,3-N-acetylglucosaminyltransferase 1) || Number of peptides = 3 || ambiguous || 51.0% Confident
Q9DB99 - (Q9DB99) 1500001J14Rik protein || Number of peptides = 4 || ambiguous || 51.0% Confident
Q8R2X0 - (Q8R2X0) Similar to EH-domain containing 2 || Number of peptides = 2 || ambiguous || 51.0% Confident
SM4G_MOUSE - (Q9WUH7) Semaphorin 4G precursor || Number of peptides = 3 || unambiguous || 51.0% Confident
Q9CXB0 - (Q9CXB0) 8430419L09Rik protein || Number of peptides = 2 || unambiguous || 51.0% Confident
Q9CX99 - (Q9CX99) 8430435N19Rik protein || Number of peptides = 1 || unambiguous || 51.0% Confident
Q9QZT5 - (Q9QZT5) Prion protein-like protein Dpl || Number of peptides = 1 || ambiguous || 51.0% Confident
Q9HA90 - (Q9HA90) Hypothetical protein || Number of peptides = 2 || unambiguous || 51.0% Confident
Q96M03 - (Q96M03) Hypothetical protein FLJ32934 || Number of peptides = 2 || unambiguous || 51.0% Confident
CDN7_MOUSE - (Q60773) Cyclin-dependent kinase 4 inhibitor D (p19-INK4d) || Number of peptides = 3 || unambiguous || 51.0% Confident
Q9D4W6 - (Q9D4W6) 4930571B16Rik protein || Number of peptides = 1 || unambiguous || 51.0% Confident
HFE_HUMAN - (Q30201) Hereditary hemochromatosis protein precursor (HLA-H) || Number of peptides = 2 || ambiguous || 51.0% Confident
Q9BQU7 - (Q9BQU7) BA261N11.4.1 (KIAA1510, isoform 1) || Number of peptides = 6 || unambiguous || 50.9% Confident
Q91YK0 - (Q91YK0) Similar to hypothetical protein FLJ20156 || Number of peptides = 1 || unambiguous || 50.9% Confident
Q9DBN8 - (Q9DBN8) Cell division cycle 25 homolog B (S. cerevisiae) || Number of peptides = 2 || unambiguous || 50.9% Confident
Q8TE78 - (Q8TE78) Hypothetical protein FLJ23843 || Number of peptides = 4 || unambiguous || 50.9% Confident
Q9D2G2 - (Q9D2G2) 4930529O08Rik protein (RIKEN cDNA 4930529O08 gene) || Number of peptides = 2 || ambiguous || 50.9% Confident
O35053 - (O35053) Collagen a1 XIX chain || Number of peptides = 8 || unambiguous || 50.8% Confident
FUCO_HUMAN - (P04066) Tissue alpha-L-fucosidase precursor (EC 3.2.1.51) (Alpha-L-fucosidase I) (Alpha-L-fucoside fucohydrolase) || Number of peptides = 4 || unambiguous || 50.8% Confident
Q9CSI0 - (Q9CSI0) 2810021H22Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 50.8% Confident
Q99JU6 - (Q99JU6) Similar to hypothetical protein FLJ12443 || Number of peptides = 2 || unambiguous || 50.8% Confident
SPH2_HUMAN - (Q9NRA0) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2) || Number of peptides = 4 || unambiguous || 50.8% Confident
RGL2_HUMAN - (O15211) Ral guanine nucleotide dissociation stimulator-like 2 (RalGDS-like factor) (RAS-associated protein RAB2L) || Number of peptides = 4 || unambiguous || 50.7% Confident
NUDM_HUMAN - (O95299) NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-42KD) (CI-42KD) || Number of peptides = 1 || ambiguous || 50.7% Confident
TUB_MOUSE - (P50586) Tubby protein || Number of peptides = 1 || ambiguous || 50.7% Confident
CA2B_MOUSE - (Q64739) Collagen alpha 2(XI) chain precursor || Number of peptides = 8 || unambiguous || 50.7% Confident
Q8R4G6 - (Q8R4G6) N-acetylglucosaminyltransferase V || Number of peptides = 4 || unambiguous || 50.7% Confident
O15023 - (O15023) Hypothetical protein KIAA0305 (Endofin) || Number of peptides = 6 || unambiguous || 50.7% Confident
RYR3_HUMAN - (Q15413) Ryanodine receptor 3 (Brain-type ryanodine receptor) (RyR3) (RYR-3) (Brain ryanodine receptor-calcium release channel) || Number of peptides = 16 || unambiguous || 50.7% Confident
Q8VCT4 - (Q8VCT4) Carboxylesterase 3 || Number of peptides = 2 || ambiguous || 50.6% Confident
Q9Y4K2 - (Q9Y4K2) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 50.6% Confident
MXI1_MOUSE - (P50540) MAX interacting protein 1 (MXI1 protein) || Number of peptides = 2 || ambiguous || 50.6% Confident
ICEE_MOUSE - (O89094) Caspase-14 precursor (EC 3.4.22.-) (CASP-14) (Mini-ICE) (MICE) || Number of peptides = 1 || unambiguous || 50.6% Confident
Q64453 - (Q64453) Mino levulinate synthase (EC 2.3.1.37) (Fragment) || Number of peptides = 1 || ambiguous || 50.6% Confident
Q9JMD4 - (Q9JMD4) Voltage-gated sodium channel alpha subunit NaT/Scn11a || Number of peptides = 5 || ambiguous || 50.4% Confident
Q9H4Q4 - (Q9H4Q4) PR-domain containing protein 12 || Number of peptides = 2 || unambiguous || 50.4% Confident
TBD_MOUSE - (Q9R1K7) Tubulin delta chain (Delta tubulin) || Number of peptides = 2 || unambiguous || 50.3% Confident
Q9D4X7 - (Q9D4X7) 2610020H15Rik protein || Number of peptides = 3 || ambiguous || 50.3% Confident
Q9CX83 - (Q9CX83) 3010033I09Rik protein (RIKEN cDNA 3010033I09 gene) || Number of peptides = 2 || ambiguous || 50.2% Confident
Q9D693 - (Q9D693) 4631423C22Rik protein || Number of peptides = 4 || ambiguous || 50.2% Confident
Q96N41 - (Q96N41) Hypothetical protein FLJ31438 || Number of peptides = 1 || unambiguous || 50.2% Confident
O08784 - (O08784) Treacle protein (Treacher collins syndrome protein) (Putative nucleolar trafficking phosphoprotein) || Number of peptides = 3 || unambiguous || 50.1% Confident
RIP3_MOUSE - (P97434) Rho-interacting protein 3 (p116RIP) (RIP3) || Number of peptides = 4 || unambiguous || 50.1% Confident
O60267 - (O60267) Hypothetical protein KIAA0512 (Armadillo repeat protein ALEX2) (Similar to armadillo repeat protein ALEX2) || Number of peptides = 2 || unambiguous || 50.0% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/data/search/2002-TK-LungDevo/lung_E18_mito_3
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
UQ99KT499.6%51719.4%263283816.4(Q99KT4) Hypothetical 28.4 kDa protein (Fragment)
*	TK010303_lung_E18_mito_3_step03.3383.3383.3	1.8648	0.0723	3385.71	19	1500.0%	1	K.VGERADYMALAIVDGHLQLSYDLGSQPVVLR.S
*	TK010303_lung_E18_mito_3_step08.2912.2912.2	3.1208	0.2619	2332.65	1	3680.0%	4	R.QLHLLEDAVTKPELRPCPTL.-
UA2M1_HUMAN99.6%5254.6%435496559.5(P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain) (P20172) Clathrin coat assembly protein AP50 (Clathrin coat associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein complex 2 medium chain) (AP-2 mu 2 chain)
	TK010303_lung_E18_mito_3_step10.4205.4205.2	1.7407	0.1884	2248.31	8	2890.0%	5	K.WARPPISMNFEVPFAPSGLK.V
UQ9D0G099.6%228.6%442499399.4(Q9D0G0) 2610020A16Rik protein
	TK010303_lung_E18_mito_3_step04.3015.3015.3	1.6512	0.0272	2320.69	5	2760.0%	1	K.QLPEFVPLDYSIPTEIPVMK.C
	TK010303_lung_E18_mito_3_step03.2367.2367.2	3.2941	0.602	2189.77	1	5880.0%	1	K.TADPCCYGHTQFHLIPDR.L
UD3D2_MOUSE99.6%91535.3%289320788.7(P42125) 3,2-trans-enoyl-CoA isomerase, mitochondrial precursor (EC 5.3.3.8) (Dodecenoyl-CoA delta-isomerase)
*	TK010303_lung_E18_mito_3_step10.2027.2027.2	1.2645	0.0149	1965.79	8	2940.0%	1	K.VGVVDEVVPEDQVHSKAR.S
*	TK010303_lung_E18_mito_3_step07.3722.3722.2	2.1986	0.155	2395.49	2	2750.0%	1	R.NPPVNSLSLECLTEFTISLEK.L
*	TK010303_lung_E18_mito_3_step02.1830.1830.1	2.2986	0.4754	1281.55	1	5560.0%	3	R.NPAHYAEYWK.N
*	TK010303_lung_E18_mito_3_step01.1474.1474.1	2.0665	0.3193	1499.44	1	4640.0%	1	R.VLVETEGPAGVAVMK.L
*	TK010303_lung_E18_mito_3_step02.1896.1896.1	1.0428	0.0715	1020.41	1	5710.0%	1	K.SLHMYLEK.L
*	TK010303_lung_E18_mito_3_step02.1948.1948.2	3.7979	0.5507	1656.87	1	6000.0%	1	K.RVLVETEGPAGVAVMK.L
*	TK010303_lung_E18_mito_3_step03.3280.3280.3	1.7726	0.2028	3119.54	8	1610.0%	1	K.DMYVNTIGHREADGALQLGTLFSPAEALK.V
UQ91YP299.6%337.5%704804296.4(Q91YP2) Hypothetical 80.4 kDa protein
*	TK010303_lung_E18_mito_3_step05.4265.4265.2	1.2287	0.2239	2323.9	25	2000.0%	1	K.AELGALPDDFIDSLEKTDEDK.Y
	TK010303_lung_E18_mito_3_step12.2669.2669.2	3.9922	0.5799	2596.27	1	4500.0%	1	R.TYFHEFGHVMHQICAQTDFAR.F
*	TK010303_lung_E18_mito_3_step11.1279.1279.1	1.6719	0.3285	1301.65	2	5000.0%	1	K.RNGLHLPEHVK.N
UG6PI_MOUSE99.6%337.9%557626377.9(P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK)
*	TK010303_lung_E18_mito_3_step08.3140.3140.3	1.6698	0.1123	3688.7	46	1210.0%	1	K.SGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK.M
	TK010303_lung_E18_mito_3_step09.1962.1962.1	1.1665	0.0377	1146.51	254	3890.0%	1	R.AVLHVALRNR.S
	TK010303_lung_E18_mito_3_step10.2767.2767.3	5.0671	0.5735	3320.2	1	2590.0%	1	R.VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK.M
URT06_MOUSE99.6%1119.2%125143099.5(P58064) Mitochondrial 28S ribosomal protein S6 (MRP-S6)
*	TK010303_lung_E18_mito_3_step02.3884.3884.2	3.3013	0.5019	2683.95	1	3700.0%	1	R.GGYFLVDFYAPTSAVENILEHLAR.D
UMPRI_MOUSE99.6%25838.4%24832738145.7(Q07113) Cation-independent mannose-6-phosphate receptor precursor (CI Man-6-P receptor) (CI-MPR) (Insulin-like growth factor II receptor) (300 kDa mannose 6-phosphate receptor) (MPR 300) (MPR300)
*	TK010303_lung_E18_mito_3_step03.3121.3121.2	4.4414	0.6209	2431.41	1	5000.0%	7	K.TLGTPEFVTATDCVHYFEWR.T
*	TK010303_lung_E18_mito_3_step04.4390.4390.2	1.2984	0.0098	2946.16	3	2170.0%	1	K.QTCTLFFSWHTPLACEQATECTVR.N
*	TK010303_lung_E18_mito_3_step08.3936.3936.2	2.115	0.3461	2401.8	1	3160.0%	1	R.GEPVFTGEVDCTYFFTWDTK.Y
*	TK010303_lung_E18_mito_3_step01.3235.3235.1	1.3447	0.0205	1428.83	25	3180.0%	1	K.SYDECVLEGRAK.L
*	TK010303_lung_E18_mito_3_step03.2695.2695.3	1.9635	0.1173	2725.92	1	2390.0%	1	K.DGRGEPVFTGEVDCTYFFTWDTK.Y
*	TK010303_lung_E18_mito_3_step03.1972.1972.3	1.0748	0.0067	2128.93	17	2080.0%	1	K.EKGHIQLSYTDGDDCGSDK.K
*	TK010303_lung_E18_mito_3_step10.2591.2591.3	2.8884	0.23	3767.44	1	1640.0%	1	R.LVLTYVKEEGEKPDFCNGHSPAVTVTFVCPSER.R
*	TK010303_lung_E18_mito_3_step07.3037.3037.2	2.3993	0.4245	2382.03	1	2890.0%	3	R.SDGCFYEFEWHTAAACVLSK.T
*	TK010303_lung_E18_mito_3_step01.0047.0047.1	1.1297	0.111	765.58	1	7500.0%	1	K.FVSSPTK.E
*	TK010303_lung_E18_mito_3_step07.2682.2682.2	2.9985	0.2548	1757.74	1	5830.0%	2	R.YEVEWITEYACHR.D
*	TK010303_lung_E18_mito_3_step07.1518.1518.1	1.7967	0.1472	1455.66	2	5000.0%	2	K.DLRPQRPVGMER.S
*	TK010303_lung_E18_mito_3_step09.3128.3128.2	3.6305	0.4342	2990.61	1	3120.0%	3	K.VSKEEETDENETEWLMEEIQVPAPR.L
UQ9CY3099.6%115928.8%153183019.1(Q9CY30) 2510015F01Rik protein
	TK010303_lung_E18_mito_3_step08.4373.4373.2	1.7774	0.1164	2749.95	1	2500.0%	7	R.IINTEQYMHSLTWQQALTGLLER.M
	TK010303_lung_E18_mito_3_step12.2369.2369.2	2.819	0.455	2575.9	1	4500.0%	3	R.RTPLQHEAPLWMDQLCTGCMK.T
	TK010303_lung_E18_mito_3_step02.2741.2741.2	4.0524	0.6442	2417.32	1	5260.0%	1	R.TPLQHEAPLWMDQLCTGCMK.T
URM03_MOUSE99.6%103415.5%348391109.6(Q99N95) Mitochondrial 60S ribosomal protein L3 (L3mt)
	TK010303_lung_E18_mito_3_step07.2756.2756.2	1.1408	0.0026	2148.09	1	3330.0%	1	K.HNIIYVNGSVPGHKNCLVK.I
*	TK010303_lung_E18_mito_3_step08.2438.2438.2	3.4914	0.5019	1762.19	1	7140.0%	4	K.HAVTLLQVQDCHVLK.Y
*	TK010303_lung_E18_mito_3_step10.3055.3055.2	4.0716	0.6046	2418.62	1	4740.0%	4	K.LNPLKDEPWPLHPWEPGSFR.V
	TK010303_lung_E18_mito_3_step05.1805.1805.1	2.8292	0.5142	1536.99	1	5770.0%	1	K.HNIIYVNGSVPGHK.N
UQ96FL399.6%114.3%322362808.8(Q96FL3) Similar to hypothetical protein FLJ20647 (Fragment)
*	TK010303_lung_E18_mito_3_step08.2542.2542.2	3.3733	0.5768	1666.31	1	5770.0%	1	K.LVINDLTYHVRPPK.R
ULMG1_MOUSE99.6%687.2%16071772985.2(P02468) Laminin gamma-1 chain precursor (Laminin B2 chain)
*	TK010303_lung_E18_mito_3_step08.4318.4318.3	2.5397	0.2123	3772.75	5	1470.0%	2	K.CSDGYYGDSTLGTSSDCQPCPCPGGSSCAIVPKTK.E
*	TK010303_lung_E18_mito_3_step09.3627.3627.3	1.6779	0.0842	3891.21	6	1410.0%	1	R.CETNHFGFGPEGCKPCDCHHEGSLSLQCKDDGR.C
*	TK010303_lung_E18_mito_3_step05.2477.2477.3	1.9876	0.0281	2884.31	4	1900.0%	1	K.LQELESLIANLGTGDDMVTDQAFEDR.L
*	TK010303_lung_E18_mito_3_step05.3093.3093.2	3.5181	0.475	2434.34	1	4210.0%	1	R.LHEATDYPWRPALSPFEFQK.L
*	TK010303_lung_E18_mito_3_step11.2840.2840.3	2.0118	0.1749	3106.91	1	1940.0%	1	R.VKLQELESLIANLGTGDDMVTDQAFEDR.L
UDGK_MOUSE99.6%83026.0%277322238.1(Q9QX60) Deoxyguanosine kinase, mitochondrial precursor (EC 2.7.1.113) (dGK)
*	TK010303_lung_E18_mito_3_step02.2846.2846.2	2.9378	0.4587	2746.74	1	2920.0%	1	K.THPEWQVATEPIAAWQNIQAAGAQK.D
*	TK010303_lung_E18_mito_3_step07.3228.3228.2	1.5429	0.2959	2573.32	3	2000.0%	5	K.GIELAYLQQLHSQHEDWFINK.T
*	TK010303_lung_E18_mito_3_step11.3772.3772.2	1.8303	0.3474	2950.43	1	2400.0%	2	K.LHFEALQHVPVLVLDVTEDFSENAAR.Q
URS3_MOUSE99.6%149210.7%243266749.7(P17073) 40S ribosomal protein S3
	TK010303_lung_E18_mito_3_step08.2552.2552.2	3.1758	0.5952	2912.23	1	3200.0%	1	K.KPLPDHVSIVEPKDEILPTTPISEQK.G
	TK010303_lung_E18_mito_3_step01.1316.1316.1	1.7919	0.3627	1470.73	2	3750.0%	1	K.DEILPTTPISEQK.G
	TK010303_lung_E18_mito_3_step05.1960.1960.1	1.8856	0.2803	1460.8	1	5000.0%	9	K.KPLPDHVSIVEPK.D
UVIME_MOUSE99.6%72270026.0%465535575.1(P20152) Vimentin
	TK010303_lung_E18_mito_3_step03.3451.3451.2	1.483	0.085	2396.99	14	2110.0%	1	R.EYQDLLNVKMALDIEIATYR.K
*	TK010303_lung_E18_mito_3_step01.2892.2892.1	1.7612	0.0632	1560.09	1	4230.0%	1	R.ISLPLPTFSSLNLR.E
	TK010303_lung_E18_mito_3_step04.3474.3474.2	1.6265	0.2268	2129.75	1	3060.0%	1	R.LLQDSVDFSLADAINTEFK.N
	TK010303_lung_E18_mito_3_step01.2523.2523.1	1.9381	0.0448	1170.64	1	6670.0%	1	K.ILLAELEQLK.G
	TK010303_lung_E18_mito_3_step01.0626.0626.1	1.1679	0.0423	1094.66	22	3890.0%	2	K.FADLSEAANR.N
	TK010303_lung_E18_mito_3_step02.2681.2681.1	2.3522	0.1953	1537.5	2	5000.0%	8	R.KVESLQEEIAFLK.K
*	TK010303_lung_E18_mito_3_step08.3293.3293.3	2.6688	0.2843	3913.65	1	1970.0%	5	K.LHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALR.D
*	TK010303_lung_E18_mito_3_step10.3785.3785.3	4.4711	0.5295	4042.01	1	2350.0%	51	K.KLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALR.D
	TK010303_lung_E18_mito_3_step01.1386.1386.1	1.2897	0.1525	1121.5	2	6250.0%	1	R.EYQDLLNVK.M
UQ9R0E299.6%558.8%728835956.5(Q9R0E2) Lysyl hydroxylase 1 (Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1)
*	TK010303_lung_E18_mito_3_step07.3462.3462.3	1.9466	0.1381	2986.08	14	1800.0%	1	R.YKPDEQPSLMPHHDASTFTVNIALNR.V
*	TK010303_lung_E18_mito_3_step07.1597.1597.1	2.4607	0.4845	1397.71	1	6360.0%	1	R.LTHYHEGLPTTK.G
*	TK010303_lung_E18_mito_3_step07.2762.2762.3	1.7967	0.1291	2528.73	5	2100.0%	1	K.IQSLGLGEDWSVDGGPAAAGGGQKVR.L
UP7066399.6%61212.9%650723164.6(P70663) SPARC-like protein 1 precursor (Matrix glycoprotein Sc1) (Extracellular matrix protein 2) (Extracellular matrix-associated protein)
	TK010303_lung_E18_mito_3_step12.2540.2540.2	2.4595	0.4748	2963.6	1	2730.0%	3	K.NYHMYVYPVHWQFNELDQHPADR.I
	TK010303_lung_E18_mito_3_step10.2078.2078.2	3.6877	0.5487	1665.03	1	7310.0%	1	K.KGHQLQLDYFGACK.S
	TK010303_lung_E18_mito_3_step11.2947.2947.2	1.4526	0.022	2584.29	4	2000.0%	1	R.ASLVPMEHCITRFFEECDPNK.D
*	TK010303_lung_E18_mito_3_step03.3945.3945.2	1.178	0.0855	2719.7	48	1400.0%	1	K.HQSEQGNQGQESDSEAEGEDKASGSK.E
UCBR2_MOUSE99.6%71146151.6%244259589.0(P08074) Lung carbonyl reductase [NADPH] (EC 1.1.1.184) (NADPH-dependent carbonyl reductase) (LCR) (Adipocyte P27 protein) (AP27)
*	TK010303_lung_E18_mito_3_step11.4265.4265.2	3.2369	0.49	2068.56	1	4710.0%	15	K.FAEVEDVVNSILFLLSDR.S
*	TK010303_lung_E18_mito_3_step01.0183.0183.1	1.1949	0.0514	854.38	1	6430.0%	1	K.GAMTMLTK.A
*	TK010303_lung_E18_mito_3_step01.1726.1726.1	1.7873	0.2446	1575.6	1	4640.0%	2	R.VNSVNPTVVLTDMGK.K
*	TK010303_lung_E18_mito_3_step01.4151.4151.2	1.7717	0.2153	2896.6	1	2040.0%	33	K.ALGGIGPVDLLVNNAALVIMQPFLEVTK.E
*	TK010303_lung_E18_mito_3_step06.3558.3558.3	2.2257	0.0756	3514.31	14	1330.0%	3	K.ALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDR.S
*	TK010303_lung_E18_mito_3_step01.0024.0024.1	0.9891	0.0444	644.44	14	6000.0%	1	K.VVAVTR.T
*	TK010303_lung_E18_mito_3_step11.3472.3472.2	1.6719	0.2014	2910.18	1	2410.0%	11	R.GVPGSIVNVSSMVAHVTFPNLITYSSTK.G
*	TK010303_lung_E18_mito_3_step01.0715.0715.1	1.2063	0.214	1049.65	1	5560.0%	3	R.TNSDLVSLAK.E
	TK010303_lung_E18_mito_3_step01.0030.0030.1	1.62	0.2623	716.35	20	5000.0%	1	R.ALVTGAGK.G
UO3537199.6%3316.2%445521525.6(O35371) Peripherial benzodiazepine receptor associated protein
*	TK010303_lung_E18_mito_3_step01.3183.3183.2	1.3109	0.105	2750.15	102	1670.0%	1	K.QVLLGPYNPDTSPEVGFFDVLGNDR.R
	TK010303_lung_E18_mito_3_step02.3022.3022.2	1.4836	0.0663	2155.41	2	3060.0%	1	R.EWAALGNMSKEDAMVEFVK.L
	TK010303_lung_E18_mito_3_step03.2721.2721.3	4.1954	0.3022	3463.3	1	2590.0%	1	R.QLQEQHYQQYMQQLYQVQLAQQQAALQK.Q
USAP_MOUSE99.6%19997.7%557614225.2(Q61207) Sulfated glycoprotein 1 precursor (SGP-1) (Prosaposin)
*	TK010303_lung_E18_mito_3_step02.2410.2410.1	2.1925	0.186	1372.63	1	6000.0%	3	K.LVLYLEHNLEK.N
*	TK010303_lung_E18_mito_3_step04.2631.2631.2	1.4298	0.1354	2413.77	6	2250.0%	1	K.ANEDVCQDCMKLVSDVQTAVK.T
*	TK010303_lung_E18_mito_3_step09.2739.2739.2	3.9024	0.5124	1502.03	1	8180.0%	4	K.KLVLYLEHNLEK.N
*	TK010303_lung_E18_mito_3_step01.2003.2003.1	1.0245	0.0269	1048.48	57	4440.0%	3	R.LGPGVSDICK.N
UUCR2_MOUSE99.6%124617.9%453482359.3(Q9DB77) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial precursor (EC 1.10.2.2) (Complex III subunit II)
*	TK010303_lung_E18_mito_3_step03.2164.2164.1	1.5143	0.2336	1001.46	1	5710.0%	2	R.RWEVAALR.S
*	TK010303_lung_E18_mito_3_step04.2643.2643.1	1.5142	0.1079	1410.68	17	3460.0%	1	R.MALVGLGVSHSVLK.Q
*	TK010303_lung_E18_mito_3_step02.2377.2377.2	2.4033	0.1952	2182.44	1	3820.0%	5	K.ITSEELHYFVQNHFTSAR.M
*	TK010303_lung_E18_mito_3_step12.3756.3756.3	4.7296	0.5699	4151.44	1	2060.0%	4	R.EQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIK.R
UP137_MOUSE99.6%7376.9%656735485.4(Q60865) GPI-anchored protein p137 (p137GPI)
*	TK010303_lung_E18_mito_3_step08.3474.3474.2	1.1477	0.0042	2927.31	87	1400.0%	1	R.TDLKQGLSGVPILSEEELSLLDEFYK.L
	TK010303_lung_E18_mito_3_step06.3478.3478.2	4.6662	0.6113	2298.26	1	5830.0%	6	R.LNEQYEHASIHLWDLLEGK.E
UQ9CQF999.6%81813.5%505564956.9(Q9CQF9) 1200015P13Rik protein (RIKEN cDNA 1200015P13 gene)
*	TK010303_lung_E18_mito_3_step10.2150.2150.2	5.2063	0.6814	2306.02	1	6250.0%	3	K.VQGHDYEAGGSVIHPLNLHMK.R
*	TK010303_lung_E18_mito_3_step10.2091.2091.2	3.4247	0.4703	1773.66	1	6920.0%	2	R.KPWLSYPHYEPPQK.C
*	TK010303_lung_E18_mito_3_step09.2190.2190.2	1.6207	0.1092	1348.96	5	5000.0%	1	K.LMHAIGGDDYVR.L
*	TK010303_lung_E18_mito_3_step08.4317.4317.2	1.2995	0.1757	2309.52	5	2250.0%	2	K.TGSETHSDFYDIVLVAAPLNR.K
UQ99LB799.6%143416.6%9191016826.7(Q99LB7) Similar to CG6385 gene product
*	TK010303_lung_E18_mito_3_step11.4300.4300.2	1.3262	0.0684	2328.88	34	1940.0%	3	R.LLGDEYTFDFPPHHHMIQK.E
*	TK010303_lung_E18_mito_3_step11.1105.1105.1	1.6903	0.0202	1250.54	1	6110.0%	1	R.FHHSLTDHTR.W
	TK010303_lung_E18_mito_3_step09.3146.3146.2	1.9426	0.2343	2538.37	1	3100.0%	4	R.HWHADLRPDDSPLEAGLAFTCK.L
*	TK010303_lung_E18_mito_3_step04.4034.4034.3	1.4631	0.133	4726.84	58	910.0%	1	R.GFFLGCGFNSAGMMLGGGCGQELAHWIVHGRPEKDMYSYDIR.R
	TK010303_lung_E18_mito_3_step11.3568.3568.2	1.787	0.1984	2779.87	11	2170.0%	1	R.HWHADLRPDDSPLEAGLAFTCKLK.T
	TK010303_lung_E18_mito_3_step04.2550.2550.2	2.7454	0.0505	2184.85	2	3820.0%	2	R.RDPLHEELLGQGCVFQER.Q
	TK010303_lung_E18_mito_3_step11.1913.1913.2	2.6604	0.4687	1723.99	1	5000.0%	1	K.VPLVAMHHAYVVTER.I
*	TK010303_lung_E18_mito_3_step01.3614.3614.2	3.5458	0.5027	2845.84	1	3120.0%	1	R.DILQDVLDADLSNEAFPFSTHQLVR.A
UQ99NB199.6%11398.4%682746237.0(Q99NB1) Acetyl-CoA synthetase 2
*	TK010303_lung_E18_mito_3_step08.1764.1764.1	2.3494	0.364	1505.74	1	5000.0%	5	K.SCPTVQHVLVAHR.T
*	TK010303_lung_E18_mito_3_step02.2785.2785.2	3.0907	0.4331	2204.96	1	4170.0%	2	R.TLGSVGEPINHEAWEWLHK.V
*	TK010303_lung_E18_mito_3_step01.3752.3752.2	2.3711	0.308	2682.66	1	2500.0%	1	R.GQDLGDTTTLEDPSVITEILSAFQK.Y
UITH2_MOUSE99.6%6129.8%9461059287.3(Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2)
*	TK010303_lung_E18_mito_3_step07.2989.2989.2	3.0909	0.5575	2255.5	1	3680.0%	3	R.FLHVPDTFEGHFQGVPVISK.G
*	TK010303_lung_E18_mito_3_step02.2809.2809.2	1.1679	0.0088	3077.53	20	1540.0%	1	K.NVKQSIQDNISLFSLGIGFDVDYDFLK.R
*	TK010303_lung_E18_mito_3_step01.3398.3398.1	1.2379	0.0082	1350.88	21	4000.0%	1	K.LGFYFQKEGMK.I
*	TK010303_lung_E18_mito_3_step08.3202.3202.3	1.9548	0.0481	3901.25	6	1400.0%	1	R.VHGLLGQFMQEPAIHIFNERPGKEPGKPEASMEVK.G
UO8832599.6%6811.0%739825966.6(O88325) Alpha-N-acetylglucosaminidase
*	TK010303_lung_E18_mito_3_step11.4087.4087.3	2.2449	0.3344	4364.61	6	1320.0%	1	R.VYLALGLTQSEIDTYFTGPAFLAWGRMGNLHTWDGPLPR.S
*	TK010303_lung_E18_mito_3_step04.3431.3431.2	2.1547	0.3873	1768.92	1	4060.0%	1	R.SFGMIPVLPAFAGHVPK.A
*	TK010303_lung_E18_mito_3_step01.2410.2410.1	1.6637	0.0622	1569.47	50	2500.0%	1	K.NVFPLEQAFVYNK.K
*	TK010303_lung_E18_mito_3_step11.2151.2151.1	1.7822	0.0665	1555.63	3	3640.0%	2	R.SWHLSQVYLQHR.I
UQ9D0F399.6%93510.1%517577896.3(Q9D0F3) 2610020P13Rik protein
*	TK010303_lung_E18_mito_3_step03.2732.2732.2	3.3622	0.5758	2618.05	1	4130.0%	5	R.LVSGIQHPGSAGVYETTQHFMDIK.E
*	TK010303_lung_E18_mito_3_step11.2504.2504.2	4.2751	0.6628	2945.47	1	4070.0%	3	K.GPHLVQSDGTVPFWAHAGNAIPSADQIR.I
UADT1_MOUSE99.6%3044228.5%298329049.7(P48962) ADP,ATP carrier protein, heart/skeletal muscle isoform T1 (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) (mANC1)
	TK010303_lung_E18_mito_3_step08.4368.4368.2	1.5489	0.2317	2800.52	2	2120.0%	20	R.YFAGNLASGGAAGATSLCFVYPLDFAR.T
	TK010303_lung_E18_mito_3_step01.2587.2587.1	2.7743	0.4044	1449.83	1	5450.0%	2	R.YFPTQALNFAFK.D
	TK010303_lung_E18_mito_3_step11.1608.1608.2	1.2304	0.1971	2495.91	127	2050.0%	1	K.GAWSNVLRGMGGAFVLVLYDEIK.K
	TK010303_lung_E18_mito_3_step01.0218.0218.1	1.4473	0.0728	1138.59	5	5000.0%	1	K.LLLQVQHASK.Q
*	TK010303_lung_E18_mito_3_step01.3848.3848.1	2.4681	0.1601	1222.14	1	6250.0%	6	K.DFLAGGIAAAVSK.T
UO7034199.6%4107.5%321374554.4(O70341) Taipoxin-associated calcium binding protein 49
*	TK010303_lung_E18_mito_3_step03.3804.3804.2	2.7221	0.3495	2691.67	1	3410.0%	1	K.IDSDSDGFLTENELSQWIQMSFK.H
*	TK010303_lung_E18_mito_3_step08.3752.3752.2	3.6857	0.5608	2820.43	1	3700.0%	3	K.KIDSDSDGFLTENELSQWIQMSFK.H
UFKB3_MOUSE99.6%3912.5%224251489.3(Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase)
*	TK010303_lung_E18_mito_3_step06.2883.2883.2	1.6767	0.0073	3128.4	55	1480.0%	3	K.KGDVVHCWYTGTLPDGTVFDTNIQTSSK.K
USPCO_MOUSE99.6%271199.2%23632744216.0(Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain)
	TK010303_lung_E18_mito_3_step04.3365.3365.2	1.224	0.0233	2316.02	21	2110.0%	2	R.KFANSLVGVQQQLQAFNTYR.T
	TK010303_lung_E18_mito_3_step04.3434.3434.2	3.5648	0.5794	2342.44	1	4740.0%	3	K.HQILEQAVEDYAETVHQLSK.T
*	TK010303_lung_E18_mito_3_step04.3262.3262.2	1.8156	0.0419	1914.61	29	2940.0%	1	R.MAGTMETSEMVNGAAEQR.T
	TK010303_lung_E18_mito_3_step05.2641.2641.2	5.2891	0.6566	1985.83	1	6880.0%	3	R.MHTTFEHDIQALGTQVR.Q
	TK010303_lung_E18_mito_3_step10.3001.3001.2	4.9568	0.5539	2486.74	1	5710.0%	9	K.SNAHYNLQNAFNLAEQHLGLTK.L
	TK010303_lung_E18_mito_3_step08.2888.2888.2	1.8491	0.2598	2258.88	2	2940.0%	2	R.VAHMEFCYQELCQLAAER.R
	TK010303_lung_E18_mito_3_step09.3559.3559.2	2.5685	0.3309	2468.02	1	3250.0%	2	K.KHQILEQAVEDYAETVHQLSK.T
	TK010303_lung_E18_mito_3_step02.2226.2226.2	1.943	0.0941	2635.96	1	3000.0%	1	K.LLTQHENIKNEIDNYEEDYQK.M
	TK010303_lung_E18_mito_3_step05.2864.2864.2	3.9237	0.5975	2290.43	1	4120.0%	1	R.SWHNVYCVINNQEMGFYK.D
*	TK010303_lung_E18_mito_3_step09.2855.2855.3	3.8617	0.4771	4011.99	1	2140.0%	2	K.HKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVK.G
	TK010303_lung_E18_mito_3_step11.3172.3172.3	1.8774	0.0334	3125.74	1	2210.0%	1	K.LESEHPDQAQAILSRLAEISDVWEEMK.T
UTPP1_MOUSE99.6%167823.3%562613426.6(O89023) Tripeptidyl-peptidase I precursor (EC 3.4.14.9) (TPP-I) (Tripeptidyl aminopeptidase) (Lysosomal pepstatin insensitive protease) (LPIC)
*	TK010303_lung_E18_mito_3_step12.2368.2368.2	2.571	0.061	1564.41	1	5770.0%	1	R.ILNGRPPLGFLNPR.L
*	TK010303_lung_E18_mito_3_step04.2121.2121.3	1.9016	0.0465	3304.56	5	1470.0%	1	R.SPHPYQLPQALAPHVDFVGGLHRFPPSSPR.Q
*	TK010303_lung_E18_mito_3_step02.2920.2920.3	1.8332	0.1881	4777.18	1	1140.0%	1	R.AYPDVAALSDGYWVVSNMVPIPWVSGTSASTPVFGGILSLINEHR.I
	TK010303_lung_E18_mito_3_step01.1663.1663.1	0.9251	0.0858	556.41	3	6250.0%	1	K.TLLNP.-
*	TK010303_lung_E18_mito_3_step10.2309.2309.2	4.5643	0.6711	2237.15	1	5500.0%	8	K.FRPSFPASSPYVTTVGGTSFK.N
*	TK010303_lung_E18_mito_3_step07.3453.3453.2	1.2271	0.0599	2500.13	75	1590.0%	1	R.HKFRPSFPASSPYVTTVGGTSFK.N
*	TK010303_lung_E18_mito_3_step01.1355.1355.1	1.2495	0.1436	1450.67	1	4620.0%	3	R.LFGGSFTHQASVAK.V
UALBU_MOUSE99.6%2510117.6%608686936.1(P07724) Serum albumin precursor
*	TK010303_lung_E18_mito_3_step01.0662.0662.1	1.1364	0.037	844.53	2	5710.0%	1	R.NLGRVGTK.C
*	TK010303_lung_E18_mito_3_step11.2196.2196.1	1.854	0.3286	1458.65	1	4090.0%	3	R.RHPDYSVSLLLR.L
*	TK010303_lung_E18_mito_3_step05.2830.2830.2	3.2595	0.5769	1903.4	1	6000.0%	3	K.ENPTTFMGHYLHEVAR.R
*	TK010303_lung_E18_mito_3_step03.2647.2647.1	1.4234	0.2692	1300.63	2	5000.0%	2	R.HPDYSVSLLLR.L
*	TK010303_lung_E18_mito_3_step06.3922.3922.3	3.297	0.4782	3630.53	1	2020.0%	6	K.KAHCLSEVEHDTMPADLPAIAADFVEDQEVCK.N
*	TK010303_lung_E18_mito_3_step03.2465.2465.2	2.906	0.4235	1886.79	1	3670.0%	6	R.RPCFSALTVDETYVPK.E
*	TK010303_lung_E18_mito_3_step01.1654.1654.1	1.1145	0.012	975.72	12	5620.0%	1	K.QTALAELVK.H
*	TK010303_lung_E18_mito_3_step01.1290.1290.1	1.9024	0.3444	1597.76	1	3080.0%	1	K.DTCFSTEGPNLVTR.C
UQ8R08699.6%51113.9%488540486.1(Q8R086) Similar to sulfite oxidase
*	TK010303_lung_E18_mito_3_step05.2677.2677.2	4.02	0.6012	2144.64	1	6000.0%	3	R.LHVVGAPGGQSLSLSLDDLHK.F
*	TK010303_lung_E18_mito_3_step08.2264.2264.2	1.8983	0.1561	1673.14	18	3080.0%	1	R.NHLPVPNLDPHTYR.L
*	TK010303_lung_E18_mito_3_step05.2669.2669.3	1.7761	0.0959	3651.25	18	1480.0%	1	R.ELLAEYKIGELNPEDSMSPSVEASDPYADDPIR.H
UHO2_MOUSE99.6%91536.5%315357395.9(O70252) Heme oxygenase 2 (EC 1.14.99.3) (HO-2)
*	TK010303_lung_E18_mito_3_step12.2407.2407.2	4.3565	0.5498	2154.62	1	5880.0%	1	R.NKDHPAFAPLYFPTELHR.K
*	TK010303_lung_E18_mito_3_step08.2594.2594.2	5.0582	0.6519	2211.5	1	6390.0%	3	R.IHYVGQNEPELLVAHAYTR.Y
*	TK010303_lung_E18_mito_3_step03.2583.2583.3	1.8983	0.1883	4454.62	1	1460.0%	1	K.GTLGGSNCPFQTTVAVLRKPSLQLILAASVALVAGLLAWYYM.-
*	TK010303_lung_E18_mito_3_step04.2907.2907.2	1.8296	0.0942	2658.67	18	2050.0%	1	K.LPSTGEGTQFYLFEHVDNAQQFK.Q
*	TK010303_lung_E18_mito_3_step12.2049.2049.2	1.4919	0.0274	2041.22	11	2810.0%	1	K.DHPAFAPLYFPTELHRK.A
*	TK010303_lung_E18_mito_3_step04.2947.2947.2	4.1509	0.5121	1911.81	1	5670.0%	1	K.DHPAFAPLYFPTELHR.K
	TK010303_lung_E18_mito_3_step01.2392.2392.1	1.5472	0.0555	1442.53	5	4550.0%	1	R.AENTQFVKDFLK.G
UPDK2_MOUSE99.6%359.6%407460696.6(Q9JK42) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial precursor (EC 2.7.1.99) (Pyruvate dehydrogenase kinase isoform 2)
	TK010303_lung_E18_mito_3_step03.3159.3159.2	1.0695	0.1605	2213.79	153	1940.0%	1	K.DPEDHRTLSQFTDALVTIR.N
	TK010303_lung_E18_mito_3_step09.2727.2727.2	4.2782	0.4249	2235.49	1	5790.0%	2	R.MLINQHTLIFDGSTNPAHPK.H
UQ9DCH499.6%2210.8%361380005.6(Q9DCH4) 0610037M02Rik protein
	TK010303_lung_E18_mito_3_step05.3220.3220.2	3.1843	0.5342	1712.44	1	5710.0%	1	R.LHPVILASIVDSYER.R
	TK010303_lung_E18_mito_3_step02.4542.4542.2	1.0438	0.0422	2555.16	30	1740.0%	1	K.AYVSTLMGVPGRTMGVMFTPLTVK.Y
UO3511499.6%114317.2%478540445.1(O35114) CD36 antigen (Collagen type I receptor, thrombospondin receptor)-like 2 (MLGP85/LIMP II)
*	TK010303_lung_E18_mito_3_step11.2601.2601.3	1.7719	0.0306	2085.56	22	2350.0%	1	K.EEHESFVDINPLTGIILR.G
*	TK010303_lung_E18_mito_3_step10.3163.3163.2	1.6384	0.1577	2141.11	33	2500.0%	5	R.SVHITFSSFENVEGLPAFR.Y
*	TK010303_lung_E18_mito_3_step11.2987.2987.2	4.0543	0.567	2750.87	1	4130.0%	4	K.GMHPNKEEHESFVDINPLTGIILR.G
*	TK010303_lung_E18_mito_3_step08.4229.4229.3	1.7545	0.0772	4675.55	9	1250.0%	1	K.LFVIHTVHELLWGYKDEILSLVHIFKPDVSPNFGLFYER.N
UCYPC_MOUSE99.6%82832.1%212227947.5(P30412) Peptidyl-prolyl cis-trans isomerase C (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin C)
*	TK010303_lung_E18_mito_3_step03.3163.3163.3	5.8156	0.1237	3581.98	1	2810.0%	5	K.VLDGMTVVHSIELQATDGHDRPLTDCTIVNSGK.I
*	TK010303_lung_E18_mito_3_step01.2726.2726.1	1.5784	0.1287	1189.84	1	6670.0%	1	K.TPFVVEVPDW.-
*	TK010303_lung_E18_mito_3_step12.2355.2355.2	1.2833	0.0455	2619.47	24	1880.0%	1	R.IVIGLFGNVVPKTVENFVALATGEK.G
	TK010303_lung_E18_mito_3_step01.2084.2084.1	1.5544	0.3017	1378.72	1	5420.0%	1	K.TVENFVALATGEK.G
UNCB2_MOUSE99.6%469.8%420503055.1(P81117) Nucleobindin 2 precursor (DNA-binding protein NEFA)
*	TK010303_lung_E18_mito_3_step06.1750.1750.2	2.1622	0.3711	1998.27	1	4000.0%	2	K.QFEHLNHQNPNTFESR.D
*	TK010303_lung_E18_mito_3_step02.3313.3313.2	3.3093	0.5818	2478.29	1	4500.0%	1	K.LHDVNNDGFLDEQELEALFTR.E
*	TK010303_lung_E18_mito_3_step02.4321.4321.2	1.3308	0.0029	3001.7	14	1880.0%	1	K.TFFKLHDVNNDGFLDEQELEALFTR.E
UTTHY_MOUSE99.6%74915.6%147157766.2(P07309) Transthyretin precursor (Prealbumin)
*	TK010303_lung_E18_mito_3_step04.3522.3522.2	2.6737	0.3117	2521.36	1	3640.0%	7	K.TLGISPFHEFADVVFTANDSGHR.H
UQ9CY4099.6%2010824.6%122131848.8(Q9CY40) Hemoglobin, beta adult major chain
	TK010303_lung_E18_mito_3_step10.3321.3321.2	3.9529	0.4776	2995.23	1	2930.0%	7	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK010303_lung_E18_mito_3_step02.3528.3528.2	1.5048	0.1496	2867.0	9	1610.0%	5	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UFKBX_MOUSE99.6%7492.8%581646695.6(Q61576) 65 kDa FK506-binding protein precursor (EC 5.2.1.8) (FKBP65) (FKBPRP) (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (Immunophilin FKBP65)
*	TK010303_lung_E18_mito_3_step08.2105.2105.2	2.4002	0.4573	1712.04	1	5670.0%	7	R.QLIVPPHLAHGENGAR.G
UHEM6_MOUSE99.6%226.8%354406487.5(P36552) Coproporphyrinogen III oxidase, mitochondrial precursor (EC 1.3.3.3) (Coproporphyrinogenase) (Coprogen oxidase) (COX)
*	TK010303_lung_E18_mito_3_step11.2660.2660.2	4.0084	0.5514	1686.1	1	8180.0%	1	K.KWCDDYFFIVHR.G
*	TK010303_lung_E18_mito_3_step03.2133.2133.1	1.7627	0.2772	1511.82	1	5000.0%	1	K.NPYAPTMHFNYR.Y
UIDHP_MOUSE99.6%3013618.7%523587498.7(P54071) Isocitrate dehydrogenase [NADP], mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) (ICD-M)
	TK010303_lung_E18_mito_3_step01.2539.2539.1	2.3392	0.3059	1247.87	1	5500.0%	1	R.LIDDMVAQVLK.S
	TK010303_lung_E18_mito_3_step01.2836.2836.1	2.6775	0.3142	1156.99	1	7500.0%	2	K.DIFQEIFDK.H
*	TK010303_lung_E18_mito_3_step02.2326.2326.1	1.5376	0.0836	1138.44	4	5620.0%	4	K.KWPLYLSTK.N
	TK010303_lung_E18_mito_3_step05.2488.2488.1	1.5737	0.1362	1439.83	1	5420.0%	9	R.LVPGWTKPITIGR.H
*	TK010303_lung_E18_mito_3_step01.4311.4311.1	2.2371	0.2036	1276.87	2	6000.0%	4	K.LILPHVDVQLK.Y
	TK010303_lung_E18_mito_3_step01.1527.1527.1	2.953	0.3177	1385.71	1	5420.0%	2	K.DLAGCIHGLSNVK.L
	TK010303_lung_E18_mito_3_step01.1795.1795.1	1.3316	0.1116	1096.71	1	6880.0%	2	K.YFDLGLPNR.D
*	TK010303_lung_E18_mito_3_step02.1888.1888.2	4.3098	0.6351	1976.4	1	7500.0%	1	R.IKVEKPVVEMDGDEMTR.I
*	TK010303_lung_E18_mito_3_step01.0171.0171.1	1.3458	0.1816	706.57	12	7000.0%	2	K.LVFTPK.N
UCA16_MOUSE99.6%143619.1%10251084895.4(Q04857) Collagen alpha 1(VI) chain precursor
	TK010303_lung_E18_mito_3_step04.3557.3557.3	2.4658	0.231	3962.58	7	1360.0%	1	K.KCPDYTCPITFSSPADITILLDSSASVGSHNFETTK.V
	TK010303_lung_E18_mito_3_step06.3503.3503.2	1.2089	0.0196	2682.43	36	1590.0%	1	K.ENYAELLDDGFLKNITAQICIDK.K
*	TK010303_lung_E18_mito_3_step10.3382.3382.3	1.5898	0.0506	3271.33	35	1420.0%	1	K.GYRGPEGPQGPPGHVGPPGPDECEILDIIMK.M
*	TK010303_lung_E18_mito_3_step05.2868.2868.1	2.6811	0.3514	1495.82	1	5380.0%	2	K.KGLEELLIGGSHLK.E
*	TK010303_lung_E18_mito_3_step04.3011.3011.2	2.6657	0.362	2203.07	1	4170.0%	5	R.NLVWNAGALHYSDEVEIIR.G
	TK010303_lung_E18_mito_3_step03.2741.2741.2	1.5133	0.1333	3175.3	17	1610.0%	1	K.YLIVVTDGHPLEGYKEPCGGLEDAVNEAK.H
*	TK010303_lung_E18_mito_3_step07.3900.3900.2	2.6329	0.491	2022.16	1	3530.0%	1	R.DAEEVISQTIDTIVDMIK.N
*	TK010303_lung_E18_mito_3_step01.4008.4008.2	1.1726	0.0198	2936.37	43	1200.0%	1	-.MRLAHALLPLLLQACWVATQDIQGSK.A
UDYJ2_HUMAN99.6%3312.6%492540996.4(O43237) Dynein light intermediate chain 2, cytosolic (LIC53/55) (LIC-2)
	TK010303_lung_E18_mito_3_step08.3186.3186.3	3.8402	0.549	3144.25	1	2980.0%	1	K.IAILHENFTTVKPEDAYEDFIVKPPVR.K
	TK010303_lung_E18_mito_3_step07.2012.2012.2	1.3148	0.1454	1723.84	5	4230.0%	1	K.CDAVSVLEKEHDYR.D
	TK010303_lung_E18_mito_3_step05.2857.2857.3	1.8294	0.0010	2549.71	25	2000.0%	1	K.FVKDFQDYMEPEEGCQGSPQR.R
UQ9D84699.6%3529.8%121143229.4(Q9D846) 2010300P09Rik protein
	TK010303_lung_E18_mito_3_step03.3509.3509.2	1.6849	0.0303	2577.82	2	2380.0%	1	R.AGLHRQLLFVTSFVFAGYFYLK.R
	TK010303_lung_E18_mito_3_step06.2751.2751.2	4.0659	0.4023	1700.72	1	6540.0%	2	K.KTYAEILEPFHPVR.-
UETFA_MOUSE99.6%157335.4%333350398.4(Q99LC5) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor (Alpha-ETF)
	TK010303_lung_E18_mito_3_step01.1508.1508.1	1.2558	0.0357	1290.67	19	3750.0%	2	R.LGGEVSCLVAGTK.C
*	TK010303_lung_E18_mito_3_step01.0904.0904.1	1.5818	0.2388	1143.57	1	7220.0%	1	K.VLVAQHDAYK.G
	TK010303_lung_E18_mito_3_step12.3361.3361.2	2.0608	0.0379	2211.13	2	2890.0%	8	K.DPEAPIFQVADYGIVADLFK.V
	TK010303_lung_E18_mito_3_step01.1112.1112.1	1.2807	0.014	1311.52	1	6360.0%	1	R.TIYAGNALCTVK.C
*	TK010303_lung_E18_mito_3_step01.2966.2966.2	3.502	0.6055	1795.21	1	6330.0%	1	K.GLLPEELTPLILETQK.Q
*	TK010303_lung_E18_mito_3_step01.2188.2188.1	2.4235	0.3625	1413.7	1	4580.0%	1	K.LNVAPVSDIIEIK.S
*	TK010303_lung_E18_mito_3_step07.2590.2590.3	1.5336	0.0073	3316.08	23	1290.0%	1	R.GTSFEAAATSGGSASSEKAPSSSSVGISEWLDQK.L
UNLTP_MOUSE99.6%7913.3%547591587.4(P32020) Nonspecific lipid-transfer protein, mitochondrial precursor (NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol carrier protein X) (SCP-X) (SCPX)
	TK010303_lung_E18_mito_3_step08.2837.2837.2	3.5891	0.4994	2240.35	1	6050.0%	1	K.GHPLGATGLAQCAELCWQLR.G
	TK010303_lung_E18_mito_3_step02.1854.1854.1	1.4123	0.1786	967.59	1	7140.0%	1	K.HIEVLIDK.Y
	TK010303_lung_E18_mito_3_step08.2529.2529.3	1.8623	0.1076	3493.59	49	1290.0%	1	K.WVINPSGGLISKGHPLGATGLAQCAELCWQLR.G
	TK010303_lung_E18_mito_3_step01.0416.0416.3	1.9458	0.14	2682.63	7	2080.0%	1	K.GHPLGATGLAQCAELCWQLRGEAGK.R
	TK010303_lung_E18_mito_3_step01.1959.1959.1	1.4275	0.0385	852.71	4	7140.0%	1	K.IGGIFAFK.V
	TK010303_lung_E18_mito_3_step07.3490.3490.2	2.7336	0.3858	2156.09	1	3950.0%	2	K.KADCTITMADSDLLALMTGK.M
UCALU_MOUSE99.6%3163327.9%315370644.7(O35887) Calumenin precursor
	TK010303_lung_E18_mito_3_step04.3401.3401.2	2.244	0.4113	2705.88	1	3700.0%	25	K.EEIVDKYDLFVGSQATDFGEALVR.H
*	TK010303_lung_E18_mito_3_step06.1753.1753.1	1.8065	0.2324	1241.68	1	5620.0%	2	K.RWIHEDVER.Q
	TK010303_lung_E18_mito_3_step01.0903.0903.1	2.3163	0.3268	1232.56	1	7780.0%	1	R.HLVYESDQNK.D
*	TK010303_lung_E18_mito_3_step04.3762.3762.3	2.1992	0.2917	3329.02	1	2140.0%	1	K.NADGFIDLEEYIGDMYSHDGNADEPEWVK.T
	TK010303_lung_E18_mito_3_step02.2269.2269.2	1.3595	0.1594	1894.22	1	4000.0%	1	K.GHDLNEDGLVSWEEYK.N
UNPS1_MOUSE99.6%1914126.4%284333639.4(O55125) NipSnap1 protein
*	TK010303_lung_E18_mito_3_step05.2996.2996.2	2.339	0.3667	2790.86	1	2830.0%	11	K.IQFHNVKPECLDAYNSLTEAVLPK.L
	TK010303_lung_E18_mito_3_step08.2761.2761.2	2.9993	0.2805	1774.34	1	5710.0%	4	K.LKPGTMIEWGNNWAR.A
	TK010303_lung_E18_mito_3_step01.1324.1324.1	1.7689	0.0591	714.34	5	8000.0%	1	R.IMIPLK.I
	TK010303_lung_E18_mito_3_step06.3513.3513.2	2.8058	0.4805	2020.31	1	4670.0%	1	R.NQLLLEFSFWNEPQPR.A
	TK010303_lung_E18_mito_3_step01.3964.3964.1	1.292	0.1201	1591.94	1	4230.0%	1	R.FSGGYPALMDCMNK.L
UO8831299.6%2213.1%175199209.0(O88312) GOB-4 protein (Anterior GRADIENT 2) (XENEPUS LAEVIS) (XENOPUS LAEVIS)
*	TK010303_lung_E18_mito_3_step12.3187.3187.2	1.2365	0.0701	2715.68	81	1590.0%	1	K.TSNRPLMVIHHLDECPHSQALKK.V
*	TK010303_lung_E18_mito_3_step12.1811.1811.2	3.214	0.5424	2584.64	1	3810.0%	1	K.TSNRPLMVIHHLDECPHSQALK.K
UQ9D7G799.6%1611025.1%327352178.1(Q9D7G7) 0710008K08Rik protein
	TK010303_lung_E18_mito_3_step10.3331.3331.2	2.3504	0.3905	2902.37	1	2000.0%	10	R.DIPVVIDADGLWLVAQQPALIHSYHK.A
	TK010303_lung_E18_mito_3_step09.2338.2338.2	3.4919	0.3311	1189.21	1	7730.0%	2	R.LHALVVGPGLGR.D
	TK010303_lung_E18_mito_3_step01.2155.2155.2	1.6011	0.2119	2542.59	58	2270.0%	1	K.SYSPELIVHPVLDSSNAVEEVEK.W
	TK010303_lung_E18_mito_3_step11.2085.2085.3	1.6107	0.0279	2278.75	32	2120.0%	1	R.STTTTDMITEVGTAFSRLFTT.-
UT9S2_MOUSE99.6%112119.0%662753307.4(P58021) Transmembrane 9 superfamily protein member 2 precursor
*	TK010303_lung_E18_mito_3_step08.1734.1734.2	4.0752	0.4835	2125.47	1	6110.0%	3	K.HTHIDKPDCSGPAMDISNK.A
	TK010303_lung_E18_mito_3_step06.4422.4422.3	1.8233	0.1238	4527.52	37	1080.0%	1	R.WDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLR.T
*	TK010303_lung_E18_mito_3_step07.2680.2680.2	1.3586	0.0609	2488.04	4	2380.0%	2	K.SFKHTHIDKPDCSGPAMDISNK.A
	TK010303_lung_E18_mito_3_step11.1707.1707.1	1.814	0.3441	1307.77	10	4000.0%	1	K.LVHGDIFRPPR.K
*	TK010303_lung_E18_mito_3_step12.4277.4277.3	1.5281	0.0621	4443.37	2	1250.0%	1	R.LLLLSLLLLGTVPGPRPGSAFYLPGLAPVNFCAEEKSNECK.A
	TK010303_lung_E18_mito_3_step03.2768.2768.2	4.1415	0.5076	1602.21	1	7310.0%	2	K.RPSENLGQVLFGER.I
UCATD_MOUSE99.6%2313345.6%410449547.1(P18242) Cathepsin D precursor (EC 3.4.23.5)
*	TK010303_lung_E18_mito_3_step02.4094.4094.3	1.7006	0.0813	4526.48	1	1280.0%	1	K.TICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNR.V
*	TK010303_lung_E18_mito_3_step12.1757.1757.3	2.1852	0.1817	2945.23	2	1920.0%	1	K.NIFSFYLNRDPEGQPGGELMLGGTDSK.Y
*	TK010303_lung_E18_mito_3_step09.2907.2907.1	2.1267	0.3614	1394.58	2	5500.0%	4	K.ILDIACWVHHK.Y
*	TK010303_lung_E18_mito_3_step08.2145.2145.2	1.1602	0.1267	2231.69	19	2140.0%	1	K.GGCEAIVDTGTSLLVGPVEEVK.E
*	TK010303_lung_E18_mito_3_step06.2635.2635.2	1.5282	0.092	2978.96	2	1850.0%	1	K.NGTSFDIHYGSGSLSGYLSQDTVSVPCK.S
*	TK010303_lung_E18_mito_3_step10.4321.4321.3	2.3038	0.2329	4424.62	4	1320.0%	2	K.NYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCK.I
*	TK010303_lung_E18_mito_3_step03.3380.3380.2	1.6289	0.1331	2438.65	1	3160.0%	10	K.AYWQVHMDQLEVGNELTLCK.G
UQ922L099.6%242.6%541607796.8(Q922L0) Yolk sac gene 2
*	TK010303_lung_E18_mito_3_step07.2224.2224.2	3.2254	0.517	1650.35	1	6540.0%	2	R.WHQTADFGHVPNLK.M
UMTE1_MOUSE99.6%1610812.6%453496527.4(Q9QYR9) Acyl coenzyme A thioester hydrolase, mitochondrial precursor (EC 3.1.2.2) (Very-long-chain acyl-CoA thioesterase) (MTE-I)
*	TK010303_lung_E18_mito_3_step08.1806.1806.3	1.5275	0.0921	2170.21	4	2890.0%	1	K.MTKDGLLDVVEALQSPLVDK.K
*	TK010303_lung_E18_mito_3_step11.3999.3999.2	1.5754	0.2227	2228.63	1	3330.0%	9	R.AHAVAQVDAWQQLQTFFHK.Q
*	TK010303_lung_E18_mito_3_step08.3438.3438.2	5.159	0.651	2265.22	1	6470.0%	5	K.SIETMHMEYFEEAVNYLR.S
UQ9CWK599.6%112712.0%742840875.4(Q9CWK5) 2410024C15Rik protein
	TK010303_lung_E18_mito_3_step07.3170.3170.2	2.0245	0.1824	2426.82	1	3250.0%	3	R.CLGPPSAHLLSEELDLEFNKR.S
	TK010303_lung_E18_mito_3_step06.2581.2581.2	5.2911	0.672	2117.66	1	6390.0%	2	K.AVAAAHTFFVGNPEHMEMR.Q
	TK010303_lung_E18_mito_3_step02.4573.4573.3	1.0041	0.0563	4178.56	8	1110.0%	1	R.DYSAILYLNGDFDGGNFYFTELDAKTVTAEVQPQCGR.A
	TK010303_lung_E18_mito_3_step07.1798.1798.1	2.1341	0.2995	1511.51	1	5000.0%	3	R.DLEAKPHMHEFR.L
URL7_MOUSE99.6%396.7%2703142010.9(P14148) 60S ribosomal protein L7
	TK010303_lung_E18_mito_3_step07.3804.3804.2	5.0168	0.5844	2140.11	1	6470.0%	3	K.FGIICMEDLIHEIYTVGK.R
UGLSK_HUMAN99.6%81412.4%669734617.8(O94925) Glutaminase, kidney isoform, mitochondrial precursor (EC 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase)
*	TK010303_lung_E18_mito_3_step10.2651.2651.2	1.7634	0.3755	2299.24	2	3060.0%	1	R.WNNTPMDEALHFGHHDVFK.I
*	TK010303_lung_E18_mito_3_step11.1108.1108.1	1.3713	0.067	856.52	8	6670.0%	1	K.ENQTVHK.N
*	TK010303_lung_E18_mito_3_step12.2452.2452.2	4.1865	0.4624	2631.72	1	4750.0%	1	K.GIHFCHDLVSLCNFHNYDNLR.H
*	TK010303_lung_E18_mito_3_step08.3618.3618.2	1.7804	0.1144	2837.45	1	2200.0%	3	K.LFLNEDDKPHNPMVNAGAIVVTSLIK.Q
*	TK010303_lung_E18_mito_3_step01.1376.1376.1	1.5259	0.1648	1118.84	1	5560.0%	1	K.VADYIPQLAK.F
UHBB1_MOUSE99.6%178941.8%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major)
	TK010303_lung_E18_mito_3_step01.1362.1362.1	2.3507	0.2864	1464.64	1	4580.0%	1	K.GTFASLSELHCDK.L
	TK010303_lung_E18_mito_3_step01.1160.1160.1	2.1044	0.3136	1296.56	1	5450.0%	2	K.DFTPAAQAAFQK.V
	TK010303_lung_E18_mito_3_step05.4409.4409.2	2.0483	0.4474	2576.69	1	3570.0%	8	K.GTFASLSELHCDKLHVDPENFR.L
	TK010303_lung_E18_mito_3_step01.2224.2224.1	1.1533	0.0276	1277.99	22	4440.0%	2	R.LLVVYPWTQR.Y
	TK010303_lung_E18_mito_3_step04.2697.2697.2	4.6524	0.5801	1886.09	1	6880.0%	4	K.KVITAFNDGLNHLDSLK.G
UMYHA_HUMAN99.6%10187.3%19762289375.5(P35580) Myosin heavy chain, nonmuscle type B (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B)
*	TK010303_lung_E18_mito_3_step01.3778.3778.2	3.966	0.554	3063.07	1	4040.0%	1	R.DLSEELEALKTELEDTLDTTAAQQELR.T
*	TK010303_lung_E18_mito_3_step08.2325.2325.2	1.5372	0.2238	1902.21	1	4330.0%	3	R.HEMPPHIYAISESAYR.C
*	TK010303_lung_E18_mito_3_step11.3963.3963.3	1.884	0.021	3441.94	9	1610.0%	1	K.HQQLLEEKNILAEQLQAETELFAEAEEMR.A
*	TK010303_lung_E18_mito_3_step02.4372.4372.3	1.946	0.2244	4629.5	1	1410.0%	1	R.FLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLK.V
*	TK010303_lung_E18_mito_3_step02.3072.3072.2	4.1049	0.5761	1738.92	1	6540.0%	1	K.KQELEEILHDLESR.V
*	TK010303_lung_E18_mito_3_step06.3754.3754.2	2.5544	0.0818	2438.12	1	3250.0%	2	K.NILAEQLQAETELFAEAEEMR.A
*	TK010303_lung_E18_mito_3_step05.2860.2860.3	1.9583	0.0335	2240.64	13	2500.0%	1	K.MQAHIQDLEEQLDEEEGAR.Q
UQ8VDJ399.6%221188.9%12681417426.9(Q8VDJ3) Similar to lipoprotein-binding protein (Expressed sequence AA960365)
*	TK010303_lung_E18_mito_3_step12.3869.3869.2	1.222	0.0167	2586.79	5	2140.0%	3	K.RIQEIIEDLEAQVTVECAIPQK.F
	TK010303_lung_E18_mito_3_step01.1279.1279.1	1.3331	0.0374	1195.81	5	4500.0%	1	K.LGQALTEVYAK.A
	TK010303_lung_E18_mito_3_step12.2309.2309.2	1.3817	0.1202	2404.2	84	1900.0%	1	K.ITLEGPTEDVNVAQEQIEGMVK.D
	TK010303_lung_E18_mito_3_step03.3021.3021.2	2.328	0.2688	2814.67	2	2600.0%	4	R.SIMEECGGVHIHFPVEGSGSDTVVIR.G
	TK010303_lung_E18_mito_3_step08.2057.2057.1	1.2984	0.0715	1204.65	1	6110.0%	3	R.RCDIIIISGR.K
*	TK010303_lung_E18_mito_3_step05.4266.4266.2	1.6639	0.0234	2578.41	1	3100.0%	9	K.ELEALIQNLENVVEDYMLVDPK.H
UQ922Q199.6%41010.7%338381948.7(Q922Q1) Unknown (Protein for MGC:6272)
*	TK010303_lung_E18_mito_3_step05.3525.3525.3	2.202	0.2565	4047.07	17	1320.0%	1	K.LYPSESYLQNYEVAYPDCSPVHLISEASLVDLNTR.L
*	TK010303_lung_E18_mito_3_step07.3444.3444.3	8.6701	0.742	4174.5	1	3500.0%	3	K.KLYPSESYLQNYEVAYPDCSPVHLISEASLVDLNTR.L
UO5477499.6%6810.8%11991350817.4(O54774) MBLVR
*	TK010303_lung_E18_mito_3_step12.2399.2399.2	1.1449	0.013	2374.54	228	1750.0%	1	K.CSDATLLSSLLEEMKTTLAQC.-
*	TK010303_lung_E18_mito_3_step06.2399.2399.3	1.6247	0.1001	4669.9	37	1130.0%	1	K.MTRPEGSSVHDGVPVPFQLPPGVSNEAQFVFTIQSIVMAQKLK.G
*	TK010303_lung_E18_mito_3_step07.3068.3068.2	1.8321	0.304	2577.84	1	2500.0%	1	K.RYQDAPGVEHIPVVQIDLSVPLK.V
*	TK010303_lung_E18_mito_3_step08.2390.2390.3	1.5605	0.0902	3344.85	5	1810.0%	1	K.VTYDIQASLQKDSQVTVSIILENQSSSFLK.N
	TK010303_lung_E18_mito_3_step11.1693.1693.1	2.7311	0.4472	1393.62	1	5450.0%	2	R.SIQGHHVCLLVK.K
USELB_MOUSE99.6%71123.7%583634178.3(Q9JHW4) Selenocysteine-specific elongation factor (Elongation factor sec) (mSelB)
*	TK010303_lung_E18_mito_3_step04.2533.2533.3	2.1183	0.1046	3295.75	6	1480.0%	2	R.GAPIIPVAAKPGGPEAPETEAPQGISELIELLK.S
	TK010303_lung_E18_mito_3_step10.2899.2899.2	1.9222	0.2452	2019.74	96	2370.0%	1	R.VNVNVGVLGHIDSGKTALAR.A
*	TK010303_lung_E18_mito_3_step06.3639.3639.2	1.3126	0.0284	2644.4	1	1920.0%	1	K.GQGTVMTGTILSGTISLGDSVEIPALK.V
	TK010303_lung_E18_mito_3_step05.2837.2837.2	2.7567	0.4612	2232.25	1	3000.0%	2	R.GLVCAPESLHTVHAALISVEK.I
*	TK010303_lung_E18_mito_3_step06.3334.3334.3	1.6287	0.0251	4181.29	73	1040.0%	1	K.FHITVGHETVMGRTLFFSPAPDSFDLEPVLDSFDLSR.E
UCA26_MOUSE99.6%2213615.8%10291098126.3(Q02788) Collagen alpha 2(VI) chain precursor
*	TK010303_lung_E18_mito_3_step04.4278.4278.2	1.355	0.0066	2723.5	5	1960.0%	1	K.NLEWIAGGTWTPSALKFAYNQLIK.E
	TK010303_lung_E18_mito_3_step11.1095.1095.1	1.3188	0.0040	1012.42	27	4500.0%	1	R.GPQGALGEPGK.Q
*	TK010303_lung_E18_mito_3_step05.2110.2110.3	1.227	0.0037	2528.36	320	1670.0%	1	K.HEAYGECYKVSCLEIPGPHGPK.G
*	TK010303_lung_E18_mito_3_step11.3879.3879.2	1.1246	4.0E-4	2286.6	1	2730.0%	1	R.GDSGQPGPKGDPGRPGFSYPGPR.G
*	TK010303_lung_E18_mito_3_step10.3182.3182.2	5.1368	0.5551	2473.61	1	5680.0%	9	R.ATYLNSFSHVGTGIVHAINNVVR.G
*	TK010303_lung_E18_mito_3_step04.3069.3069.2	2.0543	0.3512	2287.38	1	2730.0%	7	K.GVVNFAVVITDGHVTGSPCGGIK.M
*	TK010303_lung_E18_mito_3_step01.3966.3966.2	1.0912	0.0546	2755.92	2	2000.0%	1	R.ATYLNSFSHVGTGIVHAINNVVRGAR.G
*	TK010303_lung_E18_mito_3_step05.3196.3196.3	3.5488	0.2879	3862.87	1	1740.0%	1	R.DVTVTAIGIGDMFHETHESENLYSIACDKPQQVR.N
UQ91VA799.6%259131.2%384421958.6(Q91VA7) Tumor-related protein (Unknown) (Protein for MGC:6572)
*	TK010303_lung_E18_mito_3_step12.3428.3428.2	1.2785	0.0534	2796.61	26	1600.0%	1	R.HPFAQAVGRNIANPTAMLLSATNMLR.H
	TK010303_lung_E18_mito_3_step05.2533.2533.1	1.8051	0.1767	1207.61	2	5560.0%	1	R.HNNLDLVIIR.E
	TK010303_lung_E18_mito_3_step08.2845.2845.1	2.1415	0.4179	1384.68	1	5000.0%	1	R.KLDLFANVVHVK.S
*	TK010303_lung_E18_mito_3_step12.1263.1263.1	2.0154	0.4918	1114.2	1	6000.0%	5	K.SVIGHLHPHGG.-
	TK010303_lung_E18_mito_3_step08.3054.3054.2	1.9888	0.1935	2244.32	5	3060.0%	1	K.LGDGLFLQCCEEVAELYPK.I
	TK010303_lung_E18_mito_3_step05.2520.2520.2	4.3307	0.6398	1829.02	1	7330.0%	5	R.HLNLEYHSSMIADAVK.K
*	TK010303_lung_E18_mito_3_step12.1881.1881.2	3.1497	0.4531	1464.93	1	7270.0%	1	K.TRHNNLDLVIIR.E
*	TK010303_lung_E18_mito_3_step06.3103.3103.2	3.0399	0.4601	2788.01	1	3480.0%	5	K.EHHLSEVQNMASEEKLEQVLSSMK.E
UQ9D5G999.6%2218.2%1591787710.6(Q9D5G9) 4930442D21Rik protein
*	TK010303_lung_E18_mito_3_step12.1903.1903.2	2.9593	0.5607	2379.91	1	3950.0%	1	R.KPFHTDNPSIQGQWHPFTNK.R
*	TK010303_lung_E18_mito_3_step11.1201.1201.1	1.1458	0.0348	1022.45	30	5620.0%	1	R.TALHGLRPR.E
UQ9EQ2099.6%2011024.1%535579168.1(Q9EQ20) Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27)
*	TK010303_lung_E18_mito_3_step03.3773.3773.2	1.6082	0.2348	3119.47	2	1790.0%	3	K.YAHMVDVGQVGVNVPIPVPLPMFSFTGSR.S
*	TK010303_lung_E18_mito_3_step05.3384.3384.2	1.5362	0.0367	2691.68	9	1880.0%	4	R.GLQVVEHACSVTSLMLGETMPSITK.D
	TK010303_lung_E18_mito_3_step01.1460.1460.2	1.6772	0.2361	1962.11	47	2630.0%	1	R.VNAGDQPGADLGPLITPQAK.E
*	TK010303_lung_E18_mito_3_step02.2328.2328.1	1.4271	0.0472	1156.61	4	5620.0%	1	K.KWLPELVDR.A
*	TK010303_lung_E18_mito_3_step01.2964.2964.1	1.4755	0.0854	1465.91	4	3850.0%	1	R.CMALSTAILVGEAK.K
*	TK010303_lung_E18_mito_3_step02.4277.4277.2	2.3098	0.3704	2345.75	1	3250.0%	9	K.EEIFGPVLVVLETETLDEAIK.I
	TK010303_lung_E18_mito_3_step01.0906.0906.1	1.7492	0.1786	1181.62	1	6000.0%	1	K.NHGVVMPDANK.E
UQ8TB5399.6%797.5%16201832417.3(Q8TB53) Similar to KIAA1007 protein (Fragment)
*	TK010303_lung_E18_mito_3_step02.4498.4498.2	1.2023	0.0179	2782.2	2	2500.0%	1	R.IYNHPPHPTMSVDEVLEMLQRFK.D
*	TK010303_lung_E18_mito_3_step01.0403.0403.1	0.9919	0.0028	914.82	1	6250.0%	1	R.LKVGGVDPK.Q
*	TK010303_lung_E18_mito_3_step05.4005.4005.2	1.5112	0.0667	3062.38	7	1850.0%	1	K.ELHITACLFGGIIEKGLVTYMALGLALR.Y
*	TK010303_lung_E18_mito_3_step12.3096.3096.3	2.2882	0.1999	4080.22	12	1320.0%	1	R.NVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQIYDK.C
*	TK010303_lung_E18_mito_3_step05.2518.2518.3	1.5296	0.0662	2642.59	36	1850.0%	1	K.KDVPPSINTTNIDTLLVATDQTER.I
*	TK010303_lung_E18_mito_3_step12.2940.2940.2	3.7412	0.5374	2510.85	1	4500.0%	2	R.IYNHPPHPTMSVDEVLEMLQR.F
UAMPL_MOUSE99.6%4417.9%487526197.0(Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase)
	TK010303_lung_E18_mito_3_step12.0995.0995.1	1.4769	0.0018	1198.01	1	5450.0%	1	K.GITFDSGGISIK.A
	TK010303_lung_E18_mito_3_step05.3280.3280.2	3.5852	0.2338	2343.15	1	5530.0%	1	K.WAHLDIAGVMTNKDEIPYLR.K
	TK010303_lung_E18_mito_3_step07.4137.4137.3	1.5816	0.0663	3878.42	8	1290.0%	1	R.QVQDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLK.Q
	TK010303_lung_E18_mito_3_step03.3080.3080.2	4.506	0.628	2063.85	1	5560.0%	1	R.TFYGLHQDFPSVVVVGLGK.R
UILK_MOUSE99.6%6129.1%452513478.1(O55222) Integrin-linked protein kinase (EC 2.7.1.-)
	TK010303_lung_E18_mito_3_step09.2428.2428.2	1.7696	0.1301	1946.79	28	2810.0%	1	R.HALNSRSVMIDEDMTAR.I
	TK010303_lung_E18_mito_3_step08.1840.1840.2	4.1009	0.5551	1587.48	1	6430.0%	3	R.GDDTPLHLAASHGHR.D
	TK010303_lung_E18_mito_3_step01.1670.1670.1	1.4022	0.1334	1111.58	38	5000.0%	1	K.DTFWKGTTR.T
UITB1_MOUSE99.6%357.5%798882315.9(P09055) Integrin beta-1 precursor (Fibronectin receptor beta subunit) (CD29 antigen) (Integrin VLA-4 beta subunit)
*	TK010303_lung_E18_mito_3_step10.2997.2997.3	5.6654	0.5948	4150.09	1	2290.0%	2	K.LGGIVLPNDGQCHLENNVYTMSHYYDYPSIAHLVQK.L
*	TK010303_lung_E18_mito_3_step04.2607.2607.3	1.603	0.0798	2723.29	4	2170.0%	1	-.MNLQLVSWIGLISLICSVFGQTDK.N
UCPSM_HUMAN99.6%19599.9%15001649396.7(P31327) Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSASE I)
*	TK010303_lung_E18_mito_3_step04.3074.3074.3	2.4791	0.2468	3609.8	2	1900.0%	1	K.TVVVNCNPETVSTDFDECDKLYFEELSLER.I
*	TK010303_lung_E18_mito_3_step01.2426.2426.1	1.8583	0.273	1164.82	1	6000.0%	1	K.IALGIPLPEIK.N
*	TK010303_lung_E18_mito_3_step11.2501.2501.2	1.6648	0.0383	1485.69	20	4580.0%	2	K.GILIGIQQSFRPR.F
*	TK010303_lung_E18_mito_3_step05.1874.1874.1	1.4086	0.0153	895.44	5	5830.0%	3	K.NIHPWVK.Q
*	TK010303_lung_E18_mito_3_step04.2987.2987.3	3.6102	0.3575	3746.47	1	1860.0%	6	R.VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEK.V
*	TK010303_lung_E18_mito_3_step03.2372.2372.2	2.6837	0.0637	1590.65	4	4290.0%	2	K.IAPSFAVESIEDALK.A
*	TK010303_lung_E18_mito_3_step01.0936.0936.1	1.7369	0.281	1239.39	3	5000.0%	1	R.VSQEHPVVLTK.F
*	TK010303_lung_E18_mito_3_step01.1522.1522.1	1.2898	0.12	1306.9	12	3640.0%	1	K.AADTIGYPVMIR.S
*	TK010303_lung_E18_mito_3_step11.1335.1335.1	1.3383	0.0239	1021.47	1	7140.0%	1	K.KNIHPWVK.Q
*	TK010303_lung_E18_mito_3_step01.2262.2262.1	1.6918	0.0821	1281.7	1	5450.0%	1	K.TLGVDFIDVATK.V
UQ9D7V499.6%114.8%312353075.2(Q9D7V4) 2210401K11Rik protein
*	TK010303_lung_E18_mito_3_step12.2628.2628.2	4.722	0.6441	1821.28	1	7500.0%	1	R.HRPDFEVFVFDVGQK.T
UO8830699.6%52513.3%173183526.3(O88306) DJ-1
	TK010303_lung_E18_mito_3_step05.3594.3594.2	4.8664	0.656	2330.29	1	5000.0%	5	K.GLIAAICAGPTALLAHEVGFGCK.V
UG25B_HUMAN99.6%8345.8%191213116.0(P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog)
	TK010303_lung_E18_mito_3_step07.1958.1958.1	1.9389	0.2926	1406.67	2	4500.0%	5	K.WVPEITHHCPK.T
UQ9D2F699.6%52510.3%185201606.0(Q9D2F6) 4930552N12Rik protein
*	TK010303_lung_E18_mito_3_step11.1681.1681.2	2.1301	0.4432	2162.27	1	3890.0%	5	K.SGVTDHYALDDHHALHLTR.K
UQ0764699.6%6366.3%335389079.7(Q07646) PEG1/MEST protein (Mesoderm specific transcript)
	TK010303_lung_E18_mito_3_step12.2435.2435.2	2.5286	0.4126	2383.09	1	3500.0%	6	K.SLCLSNGGIFPETHRPLLLQK.L
UO8829999.6%4418.5%438478096.5(O88299) 50 kDa glycoprotein (RH50) (Erythrocyte membrane protein RH50)
	TK010303_lung_E18_mito_3_step08.3077.3077.3	1.6889	0.0367	3761.4	30	1330.0%	1	R.FKFPLMAISLEVAMIVLFGLFVEYETPQNASQK.N
	TK010303_lung_E18_mito_3_step09.2176.2176.3	1.5926	0.1246	2372.52	4	2220.0%	1	R.ELDNRFFQHANHNHVEHEV.-
	TK010303_lung_E18_mito_3_step08.2777.2777.3	2.3386	0.1133	3166.33	2	1880.0%	1	K.EFHFGIYNMINADFSTATVLISFGAVLGK.T
	TK010303_lung_E18_mito_3_step12.1155.1155.2	3.5131	0.4991	1746.62	1	6540.0%	1	R.FFQHANHNHVEHEV.-
URL9_MOUSE99.6%128625.0%1922188110.0(P51410) 60S ribosomal protein L9
	TK010303_lung_E18_mito_3_step08.2849.2849.2	3.873	0.4194	1755.75	1	6790.0%	2	R.RDFNHINVELSLLGK.K
	TK010303_lung_E18_mito_3_step11.3920.3920.2	1.4643	0.0087	2488.68	1	2860.0%	9	R.SVYAHFPINVVIQENGSLVEIR.N
	TK010303_lung_E18_mito_3_step02.1834.1834.1	1.9054	0.2515	1333.91	1	5000.0%	1	R.TICSHVQNMIK.G
UQ9CY5999.6%51314.9%302336329.1(Q9CY59) 2500002N19Rik protein
	TK010303_lung_E18_mito_3_step12.4269.4269.2	1.8851	0.1015	2561.01	2	2270.0%	3	R.FALPSPQHILGLPIGQHIYLSTR.I
	TK010303_lung_E18_mito_3_step11.2225.2225.2	1.5384	0.0981	2566.65	8	2380.0%	2	R.AVLKDPNDHTVCYLLFANQSEK.D
UHMG2_MOUSE99.6%117.2%209240317.3(P30681) High mobility group protein 2 (HMG-2)
*	TK010303_lung_E18_mito_3_step05.2072.2072.1	2.8368	0.371	1578.77	1	6070.0%	1	K.IKIEHPGLSIGDTAK.K
UPLMN_MOUSE99.6%91720.2%812908476.5(P20918) Plasminogen precursor (EC 3.4.21.7) [Contains: Angiostatin]
*	TK010303_lung_E18_mito_3_step12.3787.3787.2	1.5447	0.0639	2944.88	1	2600.0%	3	R.FTGQHFCGGTLIAPEWVLTAAHCLEK.S
*	TK010303_lung_E18_mito_3_step06.2309.2309.2	1.2378	0.0029	3116.34	137	1300.0%	1	R.YDYCNIPECEEECMYCSGEKYEGK.I
*	TK010303_lung_E18_mito_3_step09.3470.3470.3	1.9972	0.0504	3860.29	53	1180.0%	1	K.VIPACLPSPNYMVADRTICYITGWGETQGTFGAGR.L
*	TK010303_lung_E18_mito_3_step08.3104.3104.2	2.1479	0.3593	2164.55	5	2780.0%	2	R.VVGGCVANPHSWPWQISLR.T
*	TK010303_lung_E18_mito_3_step11.3553.3553.3	1.7204	0.0566	4151.53	15	1080.0%	1	-.MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTK.K
*	TK010303_lung_E18_mito_3_step05.1910.1910.2	1.1104	0.075	2440.52	24	2140.0%	1	K.VILGAHEEYIRGLDVQEISVAK.L
UQ9CZB799.6%3515.0%313343578.3(Q9CZB7) Protein kinase, interferon inducible double stranded RNA dependent activator
	TK010303_lung_E18_mito_3_step03.4416.4416.2	1.37	0.2552	3167.07	1	2220.0%	1	K.FSNISPENHISLTNVVGHSLGCTWHSLR.N
	TK010303_lung_E18_mito_3_step12.2887.2887.2	3.9375	0.5541	2184.43	1	4720.0%	2	K.NQLNPIGSLQELAIHHGWR.L
UPLSL_MOUSE99.6%3313.2%627702025.4(Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65)
	TK010303_lung_E18_mito_3_step05.3450.3450.3	1.7625	0.0491	3524.22	37	1410.0%	1	K.LTPFTIQENLNLALNSASAIGCHVVNIGAEDLK.E
*	TK010303_lung_E18_mito_3_step11.4265.4265.3	2.1006	0.0108	3102.34	3	1940.0%	1	K.FSLVGIGGQDLNEGNRTLTLALVWQLMR.R
	TK010303_lung_E18_mito_3_step03.2561.2561.2	3.8654	0.5861	2541.7	1	4520.0%	1	K.YPALHKPENQDIDWGALEGETR.E
UQ8QZT199.6%218127.1%424448168.5(Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial
*	TK010303_lung_E18_mito_3_step12.2289.2289.2	1.909	0.1745	2884.94	1	2780.0%	1	K.MLEIDPQKVNIHGGAVSLGHPIGMSGAR.I
*	TK010303_lung_E18_mito_3_step02.1258.1258.1	1.1673	0.1459	1347.59	4	3640.0%	2	K.IHMGNCAENTAK.K
*	TK010303_lung_E18_mito_3_step12.2632.2632.3	2.0258	0.1623	3338.19	158	1290.0%	1	R.LNVKPLARIAAFADAAVDPIDFPLAPAYAVPK.V
*	TK010303_lung_E18_mito_3_step05.3398.3398.2	2.0543	0.3917	2950.15	1	2410.0%	3	K.ENGTITAANASTLNDGAAALVLMTAEAAQR.L
*	TK010303_lung_E18_mito_3_step01.2104.2104.1	1.4779	0.0884	1409.63	2	4580.0%	5	K.FASEITPITISVK.G
*	TK010303_lung_E18_mito_3_step01.3336.3336.2	2.3158	0.2428	2446.58	3	2830.0%	4	R.IAAFADAAVDPIDFPLAPAYAVPK.V
*	TK010303_lung_E18_mito_3_step12.1727.1727.2	5.0456	0.6892	1932.49	1	6840.0%	5	K.VNIHGGAVSLGHPIGMSGAR.I
UT9S3_MOUSE99.6%1110110.9%587675457.2(Q9ET30) Transmembrane 9 superfamily protein member 3 precursor
	TK010303_lung_E18_mito_3_step09.3844.3844.2	4.7558	0.6467	2876.7	1	3800.0%	10	K.SISHYHETLGEALQGVELEFSGLDIK.F
	TK010303_lung_E18_mito_3_step12.4013.4013.3	2.2698	0.2777	4218.87	3	1280.0%	1	K.MYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVR.K
UA4_MOUSE99.6%5712.3%770867524.8(P12023) Alzheimer's disease amyloid A4 protein homolog precursor (Amyloidogenic glycoprotein) (AG)
	TK010303_lung_E18_mito_3_step09.2316.2316.2	3.1621	0.5503	1864.31	1	6070.0%	1	R.MDVCETHLHWHTVAK.E
	TK010303_lung_E18_mito_3_step12.2968.2968.2	1.2924	0.0415	2612.41	14	1800.0%	1	K.GAIIGLMVGGVVIATVIVITLVMLKK.K
	TK010303_lung_E18_mito_3_step09.4135.4135.3	1.6202	0.0126	3773.05	10	1470.0%	1	R.ALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGK.W
	TK010303_lung_E18_mito_3_step04.3663.3663.2	1.4598	0.0235	2400.62	7	2500.0%	2	K.MQQNGYENPTYKFFEQMQN.-
UQ99MI199.6%112.1%11201283305.9(Q99MI1) Rab6-interacting protein 2 isoform B
*	TK010303_lung_E18_mito_3_step05.3081.3081.2	3.2576	0.5811	2785.47	1	2830.0%	1	R.SNQTNHKPSPDQIIQPLLELDQNR.S
UIF32_MOUSE99.6%3516.3%325364615.6(Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1)
	TK010303_lung_E18_mito_3_step09.2426.2426.2	3.9791	0.4816	1680.11	1	7000.0%	2	K.GHFGPINSVAFHPDGK.S
	TK010303_lung_E18_mito_3_step08.2914.2914.3	2.0188	0.0909	3980.54	13	1390.0%	1	K.TFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTR.I
UQ9JJB299.6%5911.5%227251727.7(Q9JJB2) Brain cDNA, clone MNCb-4134
*	TK010303_lung_E18_mito_3_step08.2776.2776.1	2.8675	0.4485	1559.57	1	5380.0%	2	R.NLHHEVELGVLLGK.R
*	TK010303_lung_E18_mito_3_step01.2531.2531.1	1.1049	0.0195	1462.62	2	4550.0%	1	K.IPDPHALRLWLK.V
UEFTS_MOUSE99.6%103632.1%324353347.1(Q9CZR8) Elongation factor Ts, mitochondrial precursor (EF-Ts) (EF-TsMt)
*	TK010303_lung_E18_mito_3_step08.3181.3181.2	3.0823	0.5095	2837.91	1	3080.0%	5	K.VPSGFYVGSYVHGVTQSPSLQNLVLGK.Y
	TK010303_lung_E18_mito_3_step08.3802.3802.2	1.6944	0.1446	2967.06	2	1920.0%	3	K.EGLIGLLQEGNTAVLVEVNCETDFVSR.N
	TK010303_lung_E18_mito_3_step03.2667.2667.2	3.6616	0.6151	2558.92	1	4520.0%	1	K.FQQLVQQVALGTMAHCQNLTDR.L
*	TK010303_lung_E18_mito_3_step10.2251.2251.2	3.0416	0.382	2907.45	2	2410.0%	1	R.RLGQHVVGMAPLSVGSLDDEPGGETETR.M
UQ91YM499.6%61212.2%630715138.3(Q91YM4) Hypothetical 71.5 kDa protein
*	TK010303_lung_E18_mito_3_step05.2638.2638.2	3.9543	0.4805	1878.07	1	6330.0%	1	K.LVHINTTALLEHPEYK.G
	TK010303_lung_E18_mito_3_step01.0684.0684.1	1.3254	0.0994	605.52	1	8750.0%	3	R.FVLAR.R
*	TK010303_lung_E18_mito_3_step11.1877.1877.2	3.4306	0.5159	2155.62	1	4250.0%	1	R.NFVAPHLAQPVGNQPLPPGAK.R
*	TK010303_lung_E18_mito_3_step05.4264.4264.3	1.4428	0.0613	4069.77	68	1100.0%	1	K.WLNLPLFEAFTQHLLSRVQDVSLSHVCSVLLAFAR.L
UQ9D91099.6%1110.0%210224516.5(Q9D910) 1810013B01Rik protein
*	TK010303_lung_E18_mito_3_step04.2471.2471.2	3.8957	0.5282	2483.65	1	3500.0%	1	R.VLVMEGAGHPCYLDKPDEWHK.G
UQ9DCT999.6%81424.0%616680087.6(Q9DCT9) 0610010I20Rik protein
	TK010303_lung_E18_mito_3_step07.3360.3360.3	1.6637	0.0246	3862.15	157	1090.0%	2	K.ELHAVRNIRPSCHGILGVYGGMIYTGIFYWILR.G
	TK010303_lung_E18_mito_3_step12.2695.2695.2	3.1373	0.4719	2216.53	1	4740.0%	1	R.IPVPILPGLPMNNHGNYIVR.L
	TK010303_lung_E18_mito_3_step02.3309.3309.3	2.182	0.0608	4717.02	1	1440.0%	1	R.HTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYLSPFREFQR.C
	TK010303_lung_E18_mito_3_step06.3421.3421.3	3.4192	0.5398	4433.28	1	1730.0%	2	K.DCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLK.D
	TK010303_lung_E18_mito_3_step05.1873.1873.2	2.0213	0.3738	1529.41	1	5770.0%	2	K.VTVFAEGCHGHLAK.Q
UQ91W9099.6%114124.5%323361155.3(Q91W90) Similar to hypothetical protein MGC3178
	TK010303_lung_E18_mito_3_step01.2807.2807.2	3.7672	0.6126	2194.72	1	5260.0%	1	K.ALAPTWEQLALGLEHSETVK.I
	TK010303_lung_E18_mito_3_step07.2970.2970.2	2.7114	0.4941	2649.25	1	3180.0%	6	K.QGLYELSANNFELHVSQGNHFIK.F
	TK010303_lung_E18_mito_3_step01.1607.1607.1	1.3505	0.2051	1289.64	1	4500.0%	1	K.NLAPTWEELSK.K
	TK010303_lung_E18_mito_3_step01.1994.1994.1	1.6271	0.0915	1301.71	1	6000.0%	1	R.DLDSLHSFVLR.Q
	TK010303_lung_E18_mito_3_step11.1716.1716.2	2.2804	0.1611	1556.78	18	3460.0%	1	K.SFEDTIAQGITFVK.F
UQ9CTF999.6%4105.7%212246326.9(Q9CTF9) 1300003F06Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step06.2523.2523.1	2.367	0.3767	1504.69	1	5450.0%	3	K.NHPWLELSDVHR.E
UQ922L599.6%205621.0%9101020887.4(Q922L5) Unknown (Protein for MGC:5677)
*	TK010303_lung_E18_mito_3_step04.2455.2455.1	2.245	0.2014	1384.19	1	4500.0%	1	K.VHVFYIDYGNR.E
*	TK010303_lung_E18_mito_3_step12.4084.4084.2	2.9802	0.4604	1902.16	1	5000.0%	2	R.ALLLPGHHLVTVMLSGIK.C
	TK010303_lung_E18_mito_3_step09.4160.4160.3	1.7578	0.0577	3849.49	22	1330.0%	1	K.ERSASYKPVFVTEITDDLHFYVQDVETGTQLEK.L
	TK010303_lung_E18_mito_3_step11.1677.1677.1	1.159	0.0642	1278.62	8	5000.0%	1	K.TIHLSSIRPPR.L
	TK010303_lung_E18_mito_3_step10.1995.1995.2	0.8388	0.0926	1885.12	14	2670.0%	1	R.YGDFRADDADEFGYSR.-
*	TK010303_lung_E18_mito_3_step08.4408.4408.3	1.6554	0.0322	4025.44	19	1250.0%	2	R.LLQRDVQIILESCHNQNLLGTILHPNGNITELLLK.E
	TK010303_lung_E18_mito_3_step06.2522.2522.2	1.5341	0.2474	2751.59	1	3120.0%	5	K.KVNVTVDYIRPASPATETVPAFSER.T
	TK010303_lung_E18_mito_3_step12.1765.1765.2	5.2827	0.6439	2267.06	1	6110.0%	4	R.HFVDSHHQKPVNAIIEHVR.D
*	TK010303_lung_E18_mito_3_step03.3315.3315.2	2.6935	0.3816	2580.19	1	3410.0%	1	R.VLPAQATEYAFAFIQVPQDEDAR.T
UHS47_MOUSE99.6%3932535.3%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6)
	TK010303_lung_E18_mito_3_step12.2608.2608.2	3.6338	0.3777	1985.48	1	6250.0%	11	K.LSSLIILMPHHVEPLER.L
	TK010303_lung_E18_mito_3_step01.4323.4323.2	2.9373	0.3559	1638.93	1	6250.0%	1	K.LFYADHPFIFLVR.D
*	TK010303_lung_E18_mito_3_step11.2741.2741.3	1.9697	0.1513	3907.92	60	1330.0%	1	K.DLYLASVFHATAFEWDTEGNPFDQDIYGREELR.S
*	TK010303_lung_E18_mito_3_step05.4276.4276.2	2.8116	0.4748	2583.67	1	2800.0%	6	K.DQAVENILLSPLVVASSLGLVSLGGK.A
	TK010303_lung_E18_mito_3_step01.4270.4270.1	2.5419	0.3311	1339.83	1	5830.0%	12	K.HLAGLGLTEAIDK.N
*	TK010303_lung_E18_mito_3_step02.2072.2072.1	1.8519	0.0206	1296.66	7	5000.0%	1	K.LQMVEMPLAHK.L
*	TK010303_lung_E18_mito_3_step09.3454.3454.3	1.633	0.0225	3337.52	132	1210.0%	1	K.DQAVENILLSPLVVASSLGLVSLGGKATTASQAK.A
	TK010303_lung_E18_mito_3_step01.0328.0328.1	2.0206	0.0598	1226.68	2	5500.0%	4	K.GVVEVTHDLQK.H
*	TK010303_lung_E18_mito_3_step03.2640.2640.2	3.7425	0.4123	1737.52	1	7140.0%	2	K.LRDEEVHTGLGELLR.S
UQ9D5Y799.6%245.0%358398849.6(Q9D5Y7) 4921504I16Rik protein
*	TK010303_lung_E18_mito_3_step08.3416.3416.2	2.8078	0.5445	2252.13	1	4410.0%	2	K.TSEPVWEENFTFFIHNPR.R
UHBAZ_MOUSE99.6%1111.3%141161047.6(P06467) Hemoglobin zeta chain
*	TK010303_lung_E18_mito_3_step12.2079.2079.2	3.2227	0.5166	1983.96	1	5000.0%	1	K.TYFPHFDLHHGSQQLR.A
UADDA_MOUSE99.6%226.1%735806475.9(Q9QYC0) Alpha adducin (Erythrocyte adducin alpha subunit)
*	TK010303_lung_E18_mito_3_step11.1873.1873.2	3.6533	0.4858	1763.38	1	6560.0%	1	K.CIVHIHTPAGAAVSAMK.C
*	TK010303_lung_E18_mito_3_step01.4231.4231.2	1.2996	0.0377	2943.95	51	1300.0%	1	R.SPGTPAGEGSGSPPKWQIGEQEFEALMR.M
UM2A1_MOUSE99.6%7714.2%11501315898.0(P27046) Alpha-mannosidase II (EC 3.2.1.114) (Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (MAN II) (Golgi alpha-mannosidase II) (Mannosidase alpha class 2A member 1) (AMAN II)
*	TK010303_lung_E18_mito_3_step10.2281.2281.2	1.4622	0.1152	2613.19	8	1670.0%	1	R.LTLLSAQSLGASSMASGQIEVFMDR.R
	TK010303_lung_E18_mito_3_step12.1752.1752.2	2.3367	0.2967	1879.61	1	4690.0%	1	R.RNLGLFQHHDAITGTAK.D
*	TK010303_lung_E18_mito_3_step09.3891.3891.3	1.7698	0.1105	4747.05	9	990.0%	1	K.TLEFFWRQNWDLGSATDILCHMMPFYSYDIPHTCGPDPK.I
*	TK010303_lung_E18_mito_3_step02.3469.3469.3	1.9231	0.1194	4137.2	105	1090.0%	1	R.DSVINLSESVEDGPRGSPGNASQGSIHLHSPQLALQADPR.D
*	TK010303_lung_E18_mito_3_step04.3737.3737.2	2.0342	0.1778	2258.77	5	2750.0%	1	R.TISQAAYEVSFLAHIPPLGLK.V
	TK010303_lung_E18_mito_3_step07.2404.2404.2	2.8714	0.5708	1722.95	1	4330.0%	1	R.NLGLFQHHDAITGTAK.D
*	TK010303_lung_E18_mito_3_step05.4338.4338.3	1.8672	0.1762	4554.19	4	1160.0%	1	K.VLSDSGKPVEVQVSAVWNDMRTISQAAYEVSFLAHIPPLGLK.V
UDCOL_MOUSE99.6%3519.4%103117406.8(Q9CZL5) DcoH-like protein 2700061N24Rik
	TK010303_lung_E18_mito_3_step11.2048.2048.2	3.4408	0.4265	1716.45	1	7080.0%	2	K.MNHHPEWFNVYNK.V
	TK010303_lung_E18_mito_3_step12.2157.2157.2	1.2927	0.0315	2456.05	162	1320.0%	1	R.VALQAEKMNHHPEWFNVYNK.V
UOPA1_MOUSE99.6%351.5%9601113397.5(P58281) Dynamin-like 120 kDa protein, mitochondrial precursor (Large GTP binding protein) (LargeG)
	TK010303_lung_E18_mito_3_step08.2374.2374.2	3.6797	0.5132	1536.08	1	6540.0%	2	K.VTLSEGPHHVALFK.D
URM27_MOUSE99.6%71728.4%1481594510.2(Q99N92) Mitochondrial 60S ribosomal protein L27 (L27mt)
*	TK010303_lung_E18_mito_3_step06.2037.2037.2	4.2684	0.6243	1784.17	1	7000.0%	2	K.MEGHYVHAGNILGTQR.Q
*	TK010303_lung_E18_mito_3_step12.1472.1472.1	1.6341	0.2791	1188.72	1	6000.0%	2	R.WHPGAHVGLGR.N
	TK010303_lung_E18_mito_3_step09.2272.2272.2	3.0922	0.5224	1658.46	1	5710.0%	3	K.TFVHVVPAKPEGTFK.L
UG3P_MOUSE99.6%2213846.4%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH)
*	TK010303_lung_E18_mito_3_step04.3321.3321.2	1.719	0.0781	2293.89	7	2250.0%	3	K.WGEAGAEYVVESTGVFTTMEK.A
*	TK010303_lung_E18_mito_3_step01.0127.0127.1	1.9819	0.2644	1369.36	1	5000.0%	1	R.GAAQNIIPASTGAAK.A
	TK010303_lung_E18_mito_3_step01.1595.1595.1	1.3885	0.101	1558.67	18	2690.0%	1	R.VPTPNVSVVDLTCR.L
	TK010303_lung_E18_mito_3_step09.2906.2906.2	4.3631	0.5584	2372.34	1	4760.0%	5	K.RVIISAPSADAPMFVMGVNHEK.Y
	TK010303_lung_E18_mito_3_step11.3743.3743.2	3.9667	0.4854	2599.7	1	4350.0%	10	K.VIHDNFGIVEGLMTTVHAITATQK.T
*	TK010303_lung_E18_mito_3_step02.3798.3798.3	3.4902	0.3983	4055.05	1	1760.0%	1	K.GILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVK.L
*	TK010303_lung_E18_mito_3_step05.2784.2784.2	2.3116	0.4705	2295.87	1	3160.0%	1	K.LVINGKPITIFQERDPTNIK.W
UCOPB_MOUSE99.6%155714.4%9531070666.0(Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP)
	TK010303_lung_E18_mito_3_step03.4572.4572.2	0.6887	0.0024	2700.8	199	1140.0%	1	K.NEMNCKEDQFQLSLLAAMGNTQR.K
*	TK010303_lung_E18_mito_3_step08.3613.3613.2	1.2146	0.013	3198.21	3	1540.0%	1	R.NCVVLSDIHIDIMDYIQPATCTDAEFR.Q
	TK010303_lung_E18_mito_3_step06.2705.2705.2	3.4588	0.4488	2092.58	1	4170.0%	4	K.LVEKPSPLTLAPHDFANIK.A
	TK010303_lung_E18_mito_3_step07.0212.0212.3	0.9956	0.0687	3011.69	2	1630.0%	1	-.MTAAENVCYTLINVPMDSEPPSEISLK.N
*	TK010303_lung_E18_mito_3_step07.2849.2849.2	2.7775	0.4317	3132.76	1	2070.0%	6	R.SIFGEDALANVSIEKPVHQGPDAAVTGHIR.I
	TK010303_lung_E18_mito_3_step01.3335.3335.1	1.7099	0.2324	1316.1	1	5000.0%	1	R.VLQDLVMDILR.V
UPGK1_HUMAN99.6%114.6%417445978.1(P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2)
*	TK010303_lung_E18_mito_3_step07.2490.2490.2	3.5485	0.569	2037.06	1	5830.0%	1	K.SVVLMSHLGRPDGVPMPDK.Y
UTRFE_MOUSE99.6%184612.5%697767247.2(Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin)
*	TK010303_lung_E18_mito_3_step03.2311.2311.1	1.8036	0.1298	1421.84	2	4090.0%	3	R.LYLGHNYVTAIR.N
*	TK010303_lung_E18_mito_3_step01.2228.2228.1	1.9649	0.2832	1239.91	2	5000.0%	1	K.DFQLFSSPLGK.D
*	TK010303_lung_E18_mito_3_step04.1867.1867.2	3.9659	0.5036	2008.91	1	5880.0%	3	K.DFASCHLAQAPNHVVVSR.K
*	TK010303_lung_E18_mito_3_step01.4275.4275.1	1.7657	0.1402	1561.69	2	4230.0%	2	R.SAGWVIPIGLLFCK.L
*	TK010303_lung_E18_mito_3_step02.2364.2364.1	1.6251	0.0238	1316.69	3	6000.0%	2	K.HTTIFEVLPEK.A
*	TK010303_lung_E18_mito_3_step07.1753.1753.1	1.4796	0.2679	1258.6	1	5000.0%	4	R.LLEACTFHKH.-
*	TK010303_lung_E18_mito_3_step01.0056.0056.1	1.2897	0.1434	1241.89	1	4500.0%	1	K.HQTVLDNTEGK.N
UO7030499.6%4104.2%10121123856.1(O70304) Integrin alpha8 (Fragment)
*	TK010303_lung_E18_mito_3_step12.2304.2304.2	4.1725	0.6175	2180.44	1	6110.0%	3	R.GVSHPPQIVLPIHNWEPEK.K
*	TK010303_lung_E18_mito_3_step11.3149.3149.2	1.3548	0.0161	2645.13	1	2730.0%	1	K.DPVGTCYVAIQNFSAYAEHSPCR.N
UMDHM_MOUSE99.6%2913341.7%338355968.6(P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37)
*	TK010303_lung_E18_mito_3_step07.3085.3085.2	2.0029	0.4079	2397.63	2	2620.0%	6	R.LTLYDIAHTPGVAADLSHIETR.A
	TK010303_lung_E18_mito_3_step01.0640.0640.1	1.9612	0.3416	1148.77	1	5910.0%	8	R.VNVPVIGGHAGK.T
	TK010303_lung_E18_mito_3_step01.1764.1764.1	2.238	0.2865	1373.64	1	4550.0%	1	K.TIIPLISQCTPK.V
*	TK010303_lung_E18_mito_3_step01.1591.1591.1	2.1665	0.23	1116.7	1	6110.0%	2	K.MIAEAIPELK.A
*	TK010303_lung_E18_mito_3_step01.2042.2042.1	1.6491	0.2053	1562.59	1	3080.0%	2	K.VDFPQDQLATLTGR.I
	TK010303_lung_E18_mito_3_step01.0060.0060.1	1.123	0.1063	772.62	4	5830.0%	1	K.NSPLVSR.L
	TK010303_lung_E18_mito_3_step01.2515.2515.1	2.3005	0.2765	1235.97	5	5500.0%	4	K.IFGVTTLDIVR.A
	TK010303_lung_E18_mito_3_step01.3035.3035.2	4.5159	0.6336	1794.78	1	6110.0%	1	K.VAVLGASGGIGQPLSLLLK.N
	TK010303_lung_E18_mito_3_step02.1196.1196.1	1.8535	0.2071	928.63	6	6430.0%	2	K.HGVYNPNK.I
	TK010303_lung_E18_mito_3_step01.1398.1398.1	2.3141	0.2484	1340.68	3	4170.0%	1	K.GCDVVVIPAGVPR.K
	TK010303_lung_E18_mito_3_step01.1610.1610.1	1.8916	0.2022	1491.58	1	5830.0%	1	K.GYLGPEQLPDCLK.G
UQ9D19799.6%95139.4%170185674.7(Q9D197) 5730591C18Rik protein
	TK010303_lung_E18_mito_3_step01.1596.1596.1	1.8147	0.166	1271.65	8	5000.0%	1	K.SCYEDGWLIK.M
	TK010303_lung_E18_mito_3_step10.3879.3879.3	2.3088	0.1217	4011.64	1	1600.0%	7	K.HEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTK.L
	TK010303_lung_E18_mito_3_step04.3118.3118.3	2.2955	0.1055	3590.41	36	1380.0%	1	K.SCYEDGWLIKMTLSDPSEMDELMSEEAYEK.Y
UCCHL_MOUSE99.6%246.2%272310086.9(P53702) Cytochrome c-type heme lyase (EC 4.4.1.17) (CCHL) (Holocytochrome c-type synthase)
*	TK010303_lung_E18_mito_3_step08.2258.2258.2	3.0832	0.5261	2020.19	1	5000.0%	2	K.WEALHAHECPCGPSLVR.F
UO3512999.6%4109.0%299332969.8(O35129) BAP
	TK010303_lung_E18_mito_3_step01.2327.2327.1	2.2088	0.2553	1212.53	4	5500.0%	1	R.VLPSIVNEVLK.S
	TK010303_lung_E18_mito_3_step04.1978.1978.2	3.209	0.2295	1891.46	1	5000.0%	3	R.VLSRPNAQELPSMYQR.L
UKPY2_MOUSE99.6%71914.7%530577567.5(P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40)
	TK010303_lung_E18_mito_3_step08.2048.2048.2	3.4537	0.4652	1887.78	1	5330.0%	4	R.LNFSHGTHEYHAETIK.N
	TK010303_lung_E18_mito_3_step01.1835.1835.1	1.2342	0.0454	934.66	16	5000.0%	1	R.GIFPVLCK.D
*	TK010303_lung_E18_mito_3_step04.3122.3122.3	1.5866	0.0253	3527.07	3	1580.0%	1	-.PKPHSEAGTAFIQTQQLHAAMADTFLEHMCR.L
*	TK010303_lung_E18_mito_3_step05.2984.2984.2	1.359	0.1489	2305.57	2	2500.0%	1	R.RLAPITSDPTEAAAVGAVEASFK.C
UETFA_HUMAN99.6%141966.9%333350808.4(P13804) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor (Alpha-ETF)
*	TK010303_lung_E18_mito_3_step07.3868.3868.2	1.3063	0.1619	2355.27	1	2730.0%	14	K.IVAPELYIAVGISGAIQHLAGMK.D
URM49_MOUSE99.6%117.2%166191339.5(Q9CQ40) Mitochondrial 60s ribosomal protein L49 (L49mt) (MRP-L49)
*	TK010303_lung_E18_mito_3_step01.2903.2903.1	2.2359	0.4757	1347.52	1	5910.0%	1	K.DVEEFLSPLLGK.T
UGRN_MOUSE99.6%112.7%589634586.8(P28798) Granulins precursor (Acrogranin) [Contains: Granulin 1; Granulin 2; Granulin 3; Granulin 4; Granulin 5; Granulin 6; Granulin 7]
*	TK010303_lung_E18_mito_3_step11.1091.1091.2	4.3671	0.6797	1906.38	1	7000.0%	1	R.VHCCPHGASCDLVHTR.C
UQ8QZU399.6%118324.9%313346086.3(Q8QZU3) Similar to hexose-6-phosphate dehydrogenase (Glucose 1-dehydrogenase) (Fragment)
*	TK010303_lung_E18_mito_3_step06.2950.2950.2	4.2657	0.6189	2634.99	1	5000.0%	9	R.CVPLSDPDSNFQGLQAHLLQHVR.V
*	TK010303_lung_E18_mito_3_step11.2127.2127.3	1.6933	0.0655	2033.37	68	2190.0%	1	R.YRQSPLITAWPEELISK.L
*	TK010303_lung_E18_mito_3_step08.2726.2726.3	2.1904	0.1899	4290.67	4	1280.0%	1	K.FHLALSGGSSPIALFQQLATGHYSFPWAHTHLWLVDER.C
UQ8QZU499.6%113531.1%405439138.2(Q8QZU4) Similar to hydroxyacyl-coenzyme A dehydrogenase/3-ketoacyl-coenzyme A thiolase/enoyl-coenzyme A hydratase (Trifunctional protein), alpha subunit (Fragment)
	TK010303_lung_E18_mito_3_step02.2156.2156.1	2.3846	0.3382	1392.64	1	5910.0%	1	K.VIGMHYFSPVDK.M
*	TK010303_lung_E18_mito_3_step01.2267.2267.2	2.8693	0.4107	3114.03	1	2680.0%	1	K.EVESVTPEHCIFASNTSALPINQIAAVSK.R
*	TK010303_lung_E18_mito_3_step05.3897.3897.3	3.5492	0.472	3611.81	1	1860.0%	1	K.KLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGK.A
*	TK010303_lung_E18_mito_3_step03.3724.3724.2	4.2727	0.6309	2356.21	1	4780.0%	4	K.NVQQLAILGAGLMGAGIAQVSVDK.G
*	TK010303_lung_E18_mito_3_step03.2729.2729.2	3.323	0.493	2875.62	1	3540.0%	4	R.KYESAYGTQFTPCQLLLDHANNSSK.K
UQ9QYB199.6%249.5%253287295.6(Q9QYB1) Intracellular chloride channel protein
	TK010303_lung_E18_mito_3_step12.2515.2515.2	1.3643	0.0672	2623.63	13	1740.0%	2	R.KPADLQNLAPGTHPPFITFNSEVK.T
UQ8VCW899.6%165819.0%615679518.2(Q8VCW8) Similar to hypothetical protein FLJ20920
*	TK010303_lung_E18_mito_3_step02.4302.4302.2	1.8944	0.2803	2879.06	2	1960.0%	5	R.LPDLTTVISVDAPLPGTLLLDDIVAAGGK.E
*	TK010303_lung_E18_mito_3_step10.3210.3210.2	1.6129	0.1829	2064.65	19	2500.0%	5	K.GATLSHHNIVNNSMLIGQR.L
*	TK010303_lung_E18_mito_3_step01.1462.1462.1	1.8212	0.2468	1435.07	8	3570.0%	1	R.GGVIAGSPAPPELIR.A
*	TK010303_lung_E18_mito_3_step01.0679.0679.1	1.0963	0.0346	660.51	5	6000.0%	1	K.GIVFPK.Q
*	TK010303_lung_E18_mito_3_step08.3409.3409.3	2.2758	0.1708	3826.5	82	1110.0%	1	R.LPDLTTVISVDAPLPGTLLLDDIVAAGGKEQNLAQLR.Y
*	TK010303_lung_E18_mito_3_step02.2185.2185.1	1.7701	0.1038	1308.54	5	4500.0%	2	R.EALVILHENIR.L
*	TK010303_lung_E18_mito_3_step04.3235.3235.3	3.0218	0.484	3254.68	1	2500.0%	1	R.IMPHTEAQIVNVETGELTNLNVPGELYIR.G
UKBL_MOUSE99.6%82822.4%416449317.3(O88986) 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursor (EC 2.3.1.29) (AKB ligase) (Glycine acetyltransferase)
	TK010303_lung_E18_mito_3_step04.2665.2665.2	1.8044	0.2925	2719.86	34	1600.0%	1	R.SKMEAAGFTVSGADHPICPVMLGDAR.L
*	TK010303_lung_E18_mito_3_step02.3857.3857.3	2.582	0.3203	4578.45	1	1590.0%	1	R.EDAILYPSCFDANAGLFEALLTPEDAVLSDELNHASIIDGIR.L
*	TK010303_lung_E18_mito_3_step08.3330.3330.2	2.1628	0.2692	2653.9	1	2710.0%	5	R.LAAQYGALVFVDECHATGFLGPTGR.G
UCA24_MOUSE99.6%10228.8%17071673918.6(P08122) Collagen alpha 2(IV) chain precursor
*	TK010303_lung_E18_mito_3_step10.3763.3763.2	1.3307	0.0060	3189.57	11	1210.0%	1	K.GTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLK.G
*	TK010303_lung_E18_mito_3_step04.2170.2170.2	1.4888	0.0465	3063.97	36	1450.0%	1	R.GEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPK.G
*	TK010303_lung_E18_mito_3_step12.1028.1028.1	1.7357	0.1591	1372.72	1	3850.0%	1	R.GPPGPPPLILPGMK.D
*	TK010303_lung_E18_mito_3_step04.2594.2594.2	2.4617	0.5227	3079.25	1	2780.0%	4	R.CSVCEAPAVAIAVHSQDTSIPHCPAGWR.S
*	TK010303_lung_E18_mito_3_step03.3684.3684.2	1.3957	0.0731	2319.01	1	2890.0%	1	K.LDVPCGGRDCSGGCQCYPEK.G
*	TK010303_lung_E18_mito_3_step02.2396.2396.2	1.3141	0.1124	2148.09	57	2140.0%	1	R.RGLPGALGEIGPQGPPGDPGFR.G
URM12_MOUSE99.6%1829017.4%201217089.3(Q9DB15) 60S ribosomal protein L12, mitochondrial precursor (L12mt)
	TK010303_lung_E18_mito_3_step02.1853.1853.1	1.65	0.1143	1285.61	1	4500.0%	1	K.KLVESLPQEIK.A
	TK010303_lung_E18_mito_3_step04.4322.4322.2	1.9354	0.3669	2713.4	1	2610.0%	17	K.IQQLVQDIASLTLLEISDLNELLK.K
UANPC_MOUSE99.6%225.4%536598427.1(P70180) Atrial natriuretic peptide clearance receptor precursor (ANP-C) (ANPRC) (NPR-C) (Atrial natriuretic peptide C-type receptor) (EF-2)
*	TK010303_lung_E18_mito_3_step01.0058.0058.1	1.0837	0.0536	841.49	10	5830.0%	1	R.IMLAVHR.H
	TK010303_lung_E18_mito_3_step11.3191.3191.2	3.8834	0.502	2321.42	1	5240.0%	1	R.LASHWDLPMLSAGALAAGFQHK.D
UATA2_MOUSE99.6%8148.3%10441148585.3(O55143) Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (EC 3.6.3.8) (Calcium pump 2) (SERCA2) (SR Ca(2+)-ATPase 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase)
	TK010303_lung_E18_mito_3_step02.2812.2812.2	1.6837	0.1862	2475.79	7	2050.0%	2	K.TVEEVLGHFGVNESTGLSLEQVK.K
	TK010303_lung_E18_mito_3_step04.3655.3655.2	1.4481	0.018	2427.94	4	2500.0%	1	K.TASEMVLADDNFSTIVAAVEEGR.A
	TK010303_lung_E18_mito_3_step05.2021.2021.2	3.7511	0.5225	1509.67	1	7920.0%	2	R.CLALATHDNPLKR.E
	TK010303_lung_E18_mito_3_step05.3466.3466.3	2.0005	0.111	3243.67	4	1670.0%	1	K.CHQYDGLVELATICALCNDSALDYNEAK.G
UHCDH_MOUSE99.6%3945545.2%314344648.6(Q61425) Short chain 3-hydroxyacyl-CoA dehydrogenase, mitochondrial precursor (EC 1.1.1.35) (HCDH) (Medium and short chain L-3-hydroxyacyl-coenzyme A dehydrogenase)
	TK010303_lung_E18_mito_3_step10.3105.3105.3	1.997	0.0028	3615.91	16	1530.0%	1	K.HVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAK.S
	TK010303_lung_E18_mito_3_step01.1132.1132.1	1.2852	0.0811	1020.64	3	5620.0%	1	K.DTPGFIVNR.L
	TK010303_lung_E18_mito_3_step01.4154.4154.2	1.4491	0.1435	2359.36	4	2620.0%	1	K.LGAGYPMGPFELLDYVGLDTTK.F
*	TK010303_lung_E18_mito_3_step05.4138.4138.2	1.8004	0.2006	2783.99	1	2600.0%	13	K.FAAEHTIFASNTSSLQITNIANATTR.Q
*	TK010303_lung_E18_mito_3_step04.3867.3867.2	3.0237	0.507	3163.59	1	3100.0%	16	K.TLSCLSTSTDAASVVHSTDLVVEAIVENLK.L
*	TK010303_lung_E18_mito_3_step01.2024.2024.1	1.5158	0.2313	1247.61	1	5560.0%	1	K.TFESLVDFCK.T
*	TK010303_lung_E18_mito_3_step02.1810.1810.1	1.9484	0.1523	1047.53	1	7860.0%	1	K.LKNELFQR.L
UQ9UFU899.6%7911.9%917994396.9(Q9UFU8) Hypothetical protein (Fragment)
*	TK010303_lung_E18_mito_3_step04.4214.4214.2	1.4735	0.3023	2258.78	5	2140.0%	2	K.LVGEEGFVVTEAGFGADIGMEK.F
*	TK010303_lung_E18_mito_3_step11.1259.1259.1	2.0527	0.2629	1537.7	1	4330.0%	1	K.MHGGGPSVTAGVPLKK.E
*	TK010303_lung_E18_mito_3_step11.2220.2220.2	1.4077	0.0374	2160.68	11	2370.0%	1	K.LQPLSPVPSDIEISRGQTPK.A
*	TK010303_lung_E18_mito_3_step03.2283.2283.1	1.223	0.2256	1189.66	3	5000.0%	1	R.KITIGQGNTEK.G
*	TK010303_lung_E18_mito_3_step04.3547.3547.3	1.7555	0.0171	4183.13	7	1220.0%	1	K.YVLVAGITPTPLGEGKSTVTIGLVQALTAHLNVNSFACLR.Q
UQ921P599.6%2622224.2%661723267.4(Q921P5) Unknown (Protein for IMAGE:3981915) (Fragment)
	TK010303_lung_E18_mito_3_step11.2125.2125.1	1.7784	0.3286	1357.8	1	6360.0%	2	R.TGHSLLHTLYGR.S
	TK010303_lung_E18_mito_3_step02.2108.2108.1	1.8677	0.2276	1096.45	1	6430.0%	1	R.WHFYDTVK.G
*	TK010303_lung_E18_mito_3_step01.3815.3815.2	1.6098	0.245	2931.75	234	1250.0%	1	K.VSDAISTQYPVVDHEFDAVVVGAGGAGLR.A
	TK010303_lung_E18_mito_3_step12.1925.1925.2	3.1138	0.4551	2171.42	1	3820.0%	14	K.DHVYLQLHHLPPEQLATR.L
	TK010303_lung_E18_mito_3_step02.2170.2170.2	1.8996	0.3316	2952.91	1	2590.0%	4	K.HVNGQDQIVPGLYACGEAACASVHGANR.L
	TK010303_lung_E18_mito_3_step11.4036.4036.2	1.5129	0.1064	2737.06	1	2140.0%	1	R.YDTSYFVEYFALDLLMENGECR.G
	TK010303_lung_E18_mito_3_step02.3789.3789.3	1.6786	0.0158	4677.28	13	1130.0%	1	R.AGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGER.F
UPDX5_MOUSE99.6%102232.4%210218978.9(P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV)
	TK010303_lung_E18_mito_3_step01.1436.1436.1	0.9234	0.1079	1090.5	1	5500.0%	1	R.LLADPTGAFGK.A
	TK010303_lung_E18_mito_3_step04.2817.2817.1	2.1618	0.2645	1063.56	1	6880.0%	3	K.KVNLAELFK.G
	TK010303_lung_E18_mito_3_step01.2186.2186.1	2.2487	0.4016	1594.59	1	4000.0%	1	K.GVLFGVPGAFTPGCSK.T
	TK010303_lung_E18_mito_3_step02.2186.2186.1	2.9153	0.4628	1469.91	1	5000.0%	3	K.THLPGFVEQAGALK.A
	TK010303_lung_E18_mito_3_step11.2769.2769.2	1.578	0.1034	2007.39	66	2350.0%	1	K.ATDLLLDDSLVSLFGNRR.L
	TK010303_lung_E18_mito_3_step01.2256.2256.1	1.1889	0.1114	935.71	2	6430.0%	1	K.VNLAELFK.G
USUCA_MOUSE99.6%134733.0%333349949.4(Q9WUM5) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, alpha chain) (SCS-alpha)
*	TK010303_lung_E18_mito_3_step04.2737.2737.1	2.0327	0.4569	1225.74	1	6000.0%	2	K.HLGLPVFNTVK.E
*	TK010303_lung_E18_mito_3_step01.4298.4298.3	2.0284	0.0272	4611.26	3	1160.0%	1	K.TGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVR.V
	TK010303_lung_E18_mito_3_step01.1275.1275.2	1.5197	0.1706	1725.49	57	3330.0%	1	R.LIGPNCPGVINPGECK.I
	TK010303_lung_E18_mito_3_step12.1492.1492.2	1.6124	0.0623	1103.05	2	7780.0%	1	K.IGIMPGHIHK.K
	TK010303_lung_E18_mito_3_step01.0999.0999.1	2.2355	0.3586	1084.4	1	7270.0%	2	R.MGHAGAIIAGGK.G
*	TK010303_lung_E18_mito_3_step10.2562.2562.2	3.9023	0.5584	1682.24	1	6250.0%	6	K.AKPVVSFIAGITAPPGR.R
UPDA4_MOUSE99.6%2815412.9%638719735.3(P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72)
	TK010303_lung_E18_mito_3_step02.1933.1933.1	1.7115	0.3434	1283.72	3	5500.0%	1	K.RFDVSGYPTLK.I
	TK010303_lung_E18_mito_3_step01.1055.1055.1	1.4139	0.1471	716.66	1	8000.0%	1	K.EILTLK.Q
	TK010303_lung_E18_mito_3_step01.0059.0059.1	1.2376	0.0416	472.27	3	8330.0%	1	K.NPIK.F
*	TK010303_lung_E18_mito_3_step09.2052.2052.1	2.7845	0.5037	1316.49	1	6500.0%	11	K.FHHTFSPEIAK.F
*	TK010303_lung_E18_mito_3_step11.1443.1443.1	1.7895	0.3114	1001.65	1	7500.0%	2	K.HALPLVGHR.K
	TK010303_lung_E18_mito_3_step07.1653.1653.2	2.3695	0.2969	979.79	1	7500.0%	2	K.RSPPIPLAK.V
*	TK010303_lung_E18_mito_3_step01.0766.0766.1	1.3596	0.1459	960.51	1	6430.0%	1	K.FIDEHATK.R
	TK010303_lung_E18_mito_3_step01.0200.0200.1	0.913	0.0353	821.59	223	3570.0%	1	R.SPPIPLAK.V
	TK010303_lung_E18_mito_3_step01.1378.1378.1	1.4072	0.0185	1126.61	1	6670.0%	1	R.FDVSGYPTLK.I
	TK010303_lung_E18_mito_3_step01.1378.1378.1	1.4072	0.0185	1126.61	1	6670.0%	1	K.FDVSGYPTIK.I
*	TK010303_lung_E18_mito_3_step01.0184.0184.1	1.4742	0.204	1599.56	3	3460.0%	1	K.MDATANDITNDQYK.V
UPOR2_MOUSE99.6%61227.8%295317337.5(Q60930) Voltage-dependent anion-selective channel protein 2 (VDAC-2) (mVDAC2) (mVDAC6) (Outer mitochondrial membrane protein porin 2)
	TK010303_lung_E18_mito_3_step04.2269.2269.2	3.2907	0.4274	2104.55	1	4470.0%	3	K.VNNSSLIGVGYTQTLRPGVK.L
*	TK010303_lung_E18_mito_3_step12.4047.4047.2	1.6457	0.2853	3021.02	1	2120.0%	1	K.VCEDFDTSVNLAWTSGTNCTRFGIAAK.Y
	TK010303_lung_E18_mito_3_step01.2542.2542.1	1.2284	0.0427	1435.79	3	4500.0%	1	K.WCEYGLTFTEK.W
*	TK010303_lung_E18_mito_3_step06.3198.3198.2	1.4602	0.2141	2820.79	57	1520.0%	1	-.MAECCVPVCPRPMCIPPPYADLGK.A
UMCCA_MOUSE99.6%71117.0%717793447.8(Q99MR8) Methylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursor (EC 6.4.1.4) (3-Methylcrotonyl-CoA carboxylase 1) (MCCase alpha subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase alpha subunit)
*	TK010303_lung_E18_mito_3_step03.3048.3048.2	2.1028	0.3834	2759.08	1	3540.0%	1	K.SSAAQAIHPGYGFLSENMEFAELCK.Q
*	TK010303_lung_E18_mito_3_step10.2690.2690.2	1.2644	0.0346	3071.78	9	1850.0%	1	R.NSMHVDMADEAYSIGPAPSQQSYLAMEK.I
*	TK010303_lung_E18_mito_3_step08.3228.3228.2	1.439	0.0957	2688.48	35	1880.0%	1	K.SIMAAAGVPVVEGYHGKDQSDQCLR.E
	TK010303_lung_E18_mito_3_step08.3322.3322.2	2.2543	0.337	2596.55	1	2860.0%	2	R.LQVEHPVTEMITGTDLVEWQLR.I
*	TK010303_lung_E18_mito_3_step11.1869.1869.2	3.3657	0.5076	2498.74	1	5000.0%	2	R.LSGHPEFEAGNVHTDFIPQHHK.D
UPOR1_MOUSE99.6%2624033.4%296323518.4(Q60932) Voltage-dependent anion-selective channel protein 1 (VDAC-1) (mVDAC1) (mVDAC5) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin)
	TK010303_lung_E18_mito_3_step01.1662.1662.1	1.3418	0.0973	854.7	8	6430.0%	1	K.GYGFGLIK.L
	TK010303_lung_E18_mito_3_step04.2442.2442.2	3.1174	0.5547	1947.74	1	5590.0%	1	K.KLETAVNLAWTAGNSNTR.F
*	TK010303_lung_E18_mito_3_step06.4034.4034.2	1.3847	0.0502	2286.85	40	2110.0%	5	K.REHINLGCDVDFDIAGPSIR.G
*	TK010303_lung_E18_mito_3_step04.4039.4039.2	1.8312	0.231	2438.61	1	2860.0%	14	R.GALVLGYEGWLAGYQMNFETSK.S
	TK010303_lung_E18_mito_3_step01.0147.0147.1	1.5644	0.2103	1213.5	1	6000.0%	1	R.VTQSNFAVGYK.T
	TK010303_lung_E18_mito_3_step03.2532.2532.2	2.8731	0.4301	2104.44	1	3950.0%	4	K.VNNSSLIGLGYTQTLKPGIK.L
UQ9EP5699.6%72723.8%248278125.0(Q9EP56) Lysosomal thiol reductase precursor
	TK010303_lung_E18_mito_3_step04.3101.3101.2	4.7109	0.6343	2768.27	1	4380.0%	5	K.KLGPCLQVYAPEVSPESIMECATGK.R
	TK010303_lung_E18_mito_3_step12.2753.2753.3	5.6588	0.6521	3805.66	1	2890.0%	1	R.GTQLMHENAQLTDALHPPHEYVPWVLVNEKPLK.D
	TK010303_lung_E18_mito_3_step03.3784.3784.3	2.2724	0.055	3965.29	49	1360.0%	1	K.RGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLK.D
UMY1C_MOUSE99.6%10304.3%10281181569.4(Q9WTI7) Myosin Ic (Myosin I beta) (MMIb)
*	TK010303_lung_E18_mito_3_step05.3484.3484.2	3.9283	0.3323	2181.62	1	5880.0%	4	R.NFHVFYQLLEGGEEETLR.R
*	TK010303_lung_E18_mito_3_step12.1395.1395.2	3.33	0.5403	1800.19	1	6070.0%	1	K.LEDTVKPHPHFLTHK.L
	TK010303_lung_E18_mito_3_step07.1606.1606.1	2.4366	0.3269	1306.66	1	6000.0%	3	K.KRPETVATQFK.M
UTRAL_MOUSE99.6%142616.1%706802096.7(Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1)
	TK010303_lung_E18_mito_3_step05.1893.1893.1	3.1603	0.4234	1578.53	1	5830.0%	3	R.HLAEHSPYYEAMK.Q
	TK010303_lung_E18_mito_3_step04.3646.3646.2	1.1466	0.1608	2723.06	270	1200.0%	2	K.GTITIQDTGIGMTQEELVSNLGTIAR.S
*	TK010303_lung_E18_mito_3_step10.3609.3609.3	2.471	0.1781	3986.52	58	1220.0%	1	K.VEVYSRSAAPESPGYQWLSDGSGVFEIAEASGVRPGTK.I
*	TK010303_lung_E18_mito_3_step02.3156.3156.3	2.581	0.3573	3255.04	2	1850.0%	1	R.SAAPESPGYQWLSDGSGVFEIAEASGVRPGTK.I
	TK010303_lung_E18_mito_3_step01.1728.1728.1	1.5993	0.0118	1513.67	6	3460.0%	1	R.GVVDSEDIPLNLSR.E
*	TK010303_lung_E18_mito_3_step01.3328.3328.1	1.3398	0.1577	1329.69	4	4550.0%	1	R.AMVGRLNDLLVK.V
*	TK010303_lung_E18_mito_3_step06.3182.3182.2	2.075	0.3226	2851.03	1	2310.0%	2	K.KGTITIQDTGIGMTQEELVSNLGTIAR.S
	TK010303_lung_E18_mito_3_step02.3686.3686.2	1.4258	0.0473	2840.33	4	2050.0%	1	R.NIYYLCAPNRHLAEHSPYYEAMK.Q
UQ9CR8899.6%92915.6%1281492011.4(Q9CR88) 1810032L21Rik protein
*	TK010303_lung_E18_mito_3_step07.2109.2109.1	2.24	0.4933	1406.11	1	5420.0%	4	R.HLADHGLLSGVQR.A
	TK010303_lung_E18_mito_3_step01.0664.0664.1	1.1418	0.0136	816.45	9	5830.0%	3	R.KNTILPK.D
UQ99LE699.6%339.2%628717827.0(Q99LE6) Similar to ATP-binding cassette, sub-family F (GCN20), member 2
	TK010303_lung_E18_mito_3_step07.3574.3574.2	3.6414	0.4794	2633.21	1	5000.0%	1	R.YHQHLQEQLDLDLSPLEYMMK.C
	TK010303_lung_E18_mito_3_step02.2289.2289.2	1.3299	0.0136	2888.33	35	1670.0%	1	R.ILVLVSHSQDFLNGVCTNIIHMHNK.K
	TK010303_lung_E18_mito_3_step01.3931.3931.1	1.4618	0.0961	1263.68	6	4550.0%	1	R.RYGLIGLNGIGK.S
UQ9QXG599.6%51715.7%381434317.0(Q9QXG5) Lysophosphatidic acid phosphatase
*	TK010303_lung_E18_mito_3_step05.3229.3229.3	2.1774	0.031	4254.65	7	1250.0%	1	R.CLLAGLFQHQKGSAVIHTDEASSEVLYPNYQSCWVLK.E
*	TK010303_lung_E18_mito_3_step09.2435.2435.2	3.3083	0.5352	2671.05	1	3640.0%	4	R.FDYTVTNLAGGPKPHSHYDTEYR.K
UGBLP_HUMAN99.6%2015236.9%317350777.7(P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase)
	TK010303_lung_E18_mito_3_step07.2033.2033.3	1.8876	0.0511	3875.75	109	1250.0%	1	K.YTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDK.L
	TK010303_lung_E18_mito_3_step08.2177.2177.2	4.2851	0.6568	2747.88	1	3850.0%	10	K.TNHIGHTGYLNTVTVSPDGSLCASGGK.D
	TK010303_lung_E18_mito_3_step10.2778.2778.3	2.3512	0.1938	3737.04	1	1720.0%	1	K.DGQAMLWDLNEGKHLYTLDGGDIINALCFSPNR.Y
	TK010303_lung_E18_mito_3_step02.3124.3124.2	3.7435	0.5627	2629.22	1	4350.0%	7	K.GHNGWVTQIATTPQFPDMILSASR.D
UOAT_MOUSE99.6%6279234.4%439483556.6(P29758) Ornithine aminotransferase, mitochondrial precursor (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase)
*	TK010303_lung_E18_mito_3_step12.2484.2484.2	1.7388	0.0845	2984.82	6	1800.0%	1	R.QYFDFLSAYGAVSQGHCHPKIIDAMK.S
*	TK010303_lung_E18_mito_3_step03.2904.2904.2	4.1142	0.5637	2093.97	1	5290.0%	2	R.WLAVDHENVRPDMVLLGK.A
*	TK010303_lung_E18_mito_3_step09.3182.3182.2	2.5065	0.3911	2316.39	1	2890.0%	17	R.QYFDFLSAYGAVSQGHCHPK.I
*	TK010303_lung_E18_mito_3_step01.1339.1339.1	1.2299	0.1255	850.67	1	6430.0%	1	R.LAPPLVIK.E
	TK010303_lung_E18_mito_3_step01.1780.1780.1	1.1089	0.4271	580.41	1	6250.0%	1	K.TILSF.-
	TK010303_lung_E18_mito_3_step09.2274.2274.2	2.6162	0.4938	1891.36	1	5310.0%	5	R.LRDNGLLAKPTHGDIIR.L
*	TK010303_lung_E18_mito_3_step05.1786.1786.1	1.0677	0.0579	910.45	37	6670.0%	1	R.RWGYTVK.G
	TK010303_lung_E18_mito_3_step04.3002.3002.2	4.4867	0.6522	1813.31	1	6670.0%	11	R.HQVLFIADEIQTGLAR.T
*	TK010303_lung_E18_mito_3_step08.4388.4388.3	2.6089	0.3552	4110.27	1	1510.0%	18	K.ALSGGLYPVSAVLCDDEIMLTIKPGEHGSTYGGNPLGCR.I
	TK010303_lung_E18_mito_3_step04.2298.2298.2	2.1999	0.2679	1738.32	3	3570.0%	5	K.YGAHNYHPLPVALER.G
UQ9D2L899.6%4422.8%451491847.8(Q9D2L8) 2310016C19Rik protein
	TK010303_lung_E18_mito_3_step12.1389.1389.1	1.1899	0.0936	1449.62	2	4090.0%	1	R.EMAPNMAEWDQK.E
*	TK010303_lung_E18_mito_3_step12.2555.2555.3	2.0611	0.0063	4100.4	58	1140.0%	1	R.EDAVALCSMAKLFATEECFAICNQALQMHGGYGYLK.D
*	TK010303_lung_E18_mito_3_step01.0504.0504.3	1.6517	0.0098	3518.69	18	1290.0%	1	K.LESLAWSLCAAGISLDAPMGCSVQVNHEVDQR.A
*	TK010303_lung_E18_mito_3_step05.2741.2741.2	5.665	0.721	2420.49	1	5000.0%	1	R.INVASCSLGAAHASVILTQEHLK.V
UQ91YX499.6%3510.1%356384759.6(Q91YX4) Similar to thioredoxin reductase 2
	TK010303_lung_E18_mito_3_step09.2386.2386.2	4.616	0.6754	2204.71	1	5880.0%	2	R.DAHHYGWEVAQPVQHNWK.T
	TK010303_lung_E18_mito_3_step04.2289.2289.2	3.4231	0.5577	2052.74	1	5590.0%	1	K.KLPTNQLQVTWEDHASGK.E
USZ15_MOUSE99.6%2412.6%167190917.3(Q9WVL7) Small inducible cytokine B15 precursor (CXCL15) (Lungkine)
*	TK010303_lung_E18_mito_3_step10.2610.2610.2	3.3402	0.5257	2522.45	1	4250.0%	2	K.LLYSVEHEKPLYLSFGRPENK.R
URS20_HUMAN99.6%82216.8%119133739.9(P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20
	TK010303_lung_E18_mito_3_step06.2358.2358.1	2.6814	0.3571	1508.83	1	6250.0%	4	K.RLIDLHSPSEIVK.Q
	TK010303_lung_E18_mito_3_step01.1562.1562.1	1.9096	0.2961	1350.67	1	5910.0%	1	R.LIDLHSPSEIVK.Q
	TK010303_lung_E18_mito_3_step01.0124.0124.1	1.2832	0.0068	818.59	2	6670.0%	1	R.NVKSLEK.V
UHMGL_MOUSE99.6%4424.3%325341618.3(P38060) Hydroxymethylglutaryl-CoA lyase, mitochondrial precursor (EC 4.1.3.4) (HMG-CoA lyase) (HL) (3-hydroxy-3-methylglutarate-CoA lyase)
	TK010303_lung_E18_mito_3_step02.3820.3820.2	3.5215	0.3737	2887.84	1	3330.0%	1	K.GASGNLATEDLVYMLNGLGIHTGVNLQK.L
	TK010303_lung_E18_mito_3_step12.2569.2569.3	1.9366	0.1259	4488.47	4	1220.0%	1	K.GASGNLATEDLVYMLNGLGIHTGVNLQKLLEAGDFICQALNR.K
*	TK010303_lung_E18_mito_3_step05.4200.4200.3	1.6499	0.1082	4081.91	21	1250.0%	1	K.IRLIDMLSEAGLPVIEATSFVSPNWVPQMADHSDVLK.G
*	TK010303_lung_E18_mito_3_step11.3327.3327.3	2.3375	0.0155	3812.68	22	1400.0%	1	R.LIDMLSEAGLPVIEATSFVSPNWVPQMADHSDVLK.G
UCY1_MOUSE99.6%2220.0%325353289.2(Q9D0M3) Cytochrome c1, heme protein, mitochondrial precursor (Cytochrome c-1)
	TK010303_lung_E18_mito_3_step09.2955.2955.3	1.5835	0.0997	4143.52	161	810.0%	1	K.VMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHR.G
	TK010303_lung_E18_mito_3_step06.3431.3431.2	3.4063	0.6192	2656.34	1	3480.0%	1	R.HGGEDYVFSLLTGYCEPPTGVSLR.E
UCYTB_MOUSE99.6%41621.4%98110467.4(Q62426) Cystatin B (Stefin B)
*	TK010303_lung_E18_mito_3_step07.2365.2365.2	2.6085	0.4581	2444.53	1	3750.0%	4	R.VFQPLPHENKPLTLSSYQTNK.E
UQ99LF099.6%4614.3%470541466.3(Q99LF0) Similar to plexin B1 (Unknown) (Protein for MGC:7576)
	TK010303_lung_E18_mito_3_step03.2201.2201.2	3.6667	0.48	1781.43	1	6790.0%	1	R.VWHLVRPTDEVDEGK.S
	TK010303_lung_E18_mito_3_step12.1613.1613.3	2.0645	0.0949	3310.71	11	1670.0%	1	R.LLSVKGTLQQFVDNFFQSVLAPGHAVPPAVK.Y
	TK010303_lung_E18_mito_3_step10.2803.2803.2	2.2001	0.4595	2447.51	1	2750.0%	2	R.AHTDSLNTLVALHQLYQYTQK.Y
UQ8VC7599.6%51129.7%222244417.1(Q8VC75) Hypothetical 24.4 kDa protein
*	TK010303_lung_E18_mito_3_step11.3827.3827.2	1.306	0.0234	2651.84	328	1200.0%	1	-.MALSNPLTEARVPGSVGTPLPGVEVR.I
*	TK010303_lung_E18_mito_3_step10.4226.4226.2	1.7315	0.2125	2615.57	11	1960.0%	3	R.HLLAHPSITDVAVIGVPDMTWGQR.V
*	TK010303_lung_E18_mito_3_step08.3149.3149.2	1.5384	0.1549	1967.23	3	3330.0%	1	R.GPSVFREYWDKPEETK.S
UQ9JIG799.6%6814.2%627708446.0(Q9JIG7) DXImx40e protein (DNA segment, Chr X, Immunex 40, expressed) (Similar to JM1 protein)
*	TK010303_lung_E18_mito_3_step04.1887.1887.1	1.877	0.2084	1433.67	1	5000.0%	1	R.LAEIQELHHSVR.A
	TK010303_lung_E18_mito_3_step05.3446.3446.2	1.8796	0.2152	2778.7	1	2610.0%	2	K.YLAALHENCSQLIQTIEDTGTIMR.E
	TK010303_lung_E18_mito_3_step04.3250.3250.3	1.7551	0.0196	3677.28	9	1370.0%	1	R.LAMSLAQACMDLGYPLELGYQNFLYPSEPDLR.D
	TK010303_lung_E18_mito_3_step06.3847.3847.3	1.5634	0.1083	3143.37	6	1920.0%	1	K.AYKYLAALHENCSQLIQTIEDTGTIMR.E
*	TK010303_lung_E18_mito_3_step11.1563.1563.2	4.2929	0.598	2071.35	1	6180.0%	1	R.AASLLEHHASQLCQHVNR.D
UP4H2_MOUSE99.6%5713.2%537610025.8(Q60716) Prolyl 4-hydroxylase alpha-2 subunit precursor (EC 1.14.11.2) (4-PH alpha-2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase alpha-2 subunit)
*	TK010303_lung_E18_mito_3_step02.3330.3330.3	1.4761	0.0775	3643.6	2	1470.0%	1	R.LGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPK.K
	TK010303_lung_E18_mito_3_step08.3550.3550.2	2.3557	0.1877	2446.5	1	3680.0%	2	R.SAYNEGDYYHTVLWMEQVLK.Q
	TK010303_lung_E18_mito_3_step09.2256.2256.2	0.9805	0.1329	1824.82	40	2670.0%	1	R.HAACPVLVGCKWVSNK.W
	TK010303_lung_E18_mito_3_step01.0995.0995.1	1.4427	0.2533	1211.5	1	5500.0%	1	R.HAACPVLVGCK.W
UVP36_MOUSE99.6%5728.2%358404167.0(Q9DBH5) Vesicular integral-membrane protein VIP36 precursor
	TK010303_lung_E18_mito_3_step03.2883.2883.3	1.8883	0.1396	3886.72	1	2050.0%	1	K.REHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVR.L
	TK010303_lung_E18_mito_3_step03.3135.3135.2	4.2273	0.6252	2471.85	1	5500.0%	2	K.DNFHGLAIFLDTYPNDETTER.V
	TK010303_lung_E18_mito_3_step01.4103.4103.3	2.2503	0.0061	4446.13	5	1120.0%	1	R.EHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDER.S
*	TK010303_lung_E18_mito_3_step09.2251.2251.3	1.6331	0.0648	4114.87	10	1220.0%	1	R.CPGRPGLPGPGPSPTTFLHLLLLLGPVAADITDGNSEHLK.R
UACDL_MOUSE99.6%122224.4%430480828.2(P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD)
*	TK010303_lung_E18_mito_3_step08.1522.1522.3	1.5401	0.0195	2726.61	78	1880.0%	1	K.HGGIGGDLLSTAVTWEEQAYSNCTR.A
*	TK010303_lung_E18_mito_3_step08.2582.2582.2	3.9641	0.5146	2085.76	1	5330.0%	2	R.KFFQEEVIPHHTEWEK.A
*	TK010303_lung_E18_mito_3_step02.2310.2310.2	3.379	0.6042	1958.84	1	6430.0%	1	K.FFQEEVIPHHTEWEK.A
	TK010303_lung_E18_mito_3_step01.1194.1194.1	1.698	0.1064	1451.67	1	5000.0%	2	R.VQPIYGGTNEIMK.E
*	TK010303_lung_E18_mito_3_step01.1623.1623.1	1.906	0.2959	1250.62	1	6110.0%	1	R.IFSSEHDIFR.E
*	TK010303_lung_E18_mito_3_step01.0638.0638.1	1.3538	0.0044	995.44	2	5620.0%	3	K.FIPQMTAGK.C
*	TK010303_lung_E18_mito_3_step01.1274.1274.1	1.9861	0.2472	1268.55	1	6360.0%	1	R.LPANALLGEENK.G
*	TK010303_lung_E18_mito_3_step01.1608.1608.2	1.6812	0.3056	2006.32	1	3950.0%	1	K.CIGAIAMTEPGAGSDLQGVR.T
UQ9CZE299.6%2213.4%478541147.1(Q9CZE2) 2810011D23Rik protein
	TK010303_lung_E18_mito_3_step06.2741.2741.3	1.4285	0.0934	3888.75	16	1210.0%	1	K.ICDPGLTAFEPEALGNLVEGMDFHRFYFENALSK.S
	TK010303_lung_E18_mito_3_step10.3194.3194.3	4.1864	0.4736	3581.7	1	2500.0%	1	R.EYYSEADASHCIQQILESVNHCHLNGIVHR.D
UO8881299.6%115.0%281289698.3(O88812) Mac25
	TK010303_lung_E18_mito_3_step03.2833.2833.2	3.9755	0.629	1554.47	1	7310.0%	1	K.HEVTGWVLVSPLSK.E
UENOA_MOUSE99.6%3314.8%433470106.8(P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1)
*	TK010303_lung_E18_mito_3_step10.3125.3125.2	3.8457	0.0472	3022.96	1	3280.0%	1	R.HIADLAGNPEVILPVPAFNVINGGSHAGNK.L
*	TK010303_lung_E18_mito_3_step03.4445.4445.3	1.6473	0.0164	3706.44	60	1140.0%	1	K.GVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNK.L
	TK010303_lung_E18_mito_3_step06.3619.3619.2	1.2653	0.0102	2996.55	35	1480.0%	1	R.SGETEDTFIADLVVGLCTGQIKTGAPCR.S
UACTA_HUMAN99.6%122229.2%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2)
	TK010303_lung_E18_mito_3_step01.1102.1102.1	1.817	0.2524	1163.47	1	6500.0%	3	K.EITALAPSTMK.I
	TK010303_lung_E18_mito_3_step01.1094.1094.1	0.9108	0.0447	644.62	1	7000.0%	1	R.GILTLK.Y
	TK010303_lung_E18_mito_3_step04.3561.3561.3	1.6965	0.0805	3494.36	28	1550.0%	1	R.FRCPETLFQPSFIGMESAGIHETTYNSIMK.C
	TK010303_lung_E18_mito_3_step05.2242.2242.1	1.0679	0.0959	1198.74	10	5000.0%	1	R.AVFPSIVGRPR.H
	TK010303_lung_E18_mito_3_step02.3504.3504.2	1.3767	0.0356	2540.62	1	2730.0%	2	K.LCYVALDFENEMATAASSSSLEK.S
	TK010303_lung_E18_mito_3_step11.1955.1955.1	2.1602	0.1375	1502.84	2	5000.0%	1	K.IWHHSFYNELR.V
	TK010303_lung_E18_mito_3_step01.1004.1004.1	2.5049	0.431	1173.46	1	7000.0%	2	R.HQGVMVGMGQK.D
	TK010303_lung_E18_mito_3_step01.0931.0931.1	1.436	0.169	796.49	8	6670.0%	1	K.IIAPPER.K
UQ9CQX899.6%102850.0%1021110110.0(Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene)
*	TK010303_lung_E18_mito_3_step09.2260.2260.2	2.8339	0.4191	1810.86	1	6540.0%	2	R.RKPMSQEEMEFIQR.G
*	TK010303_lung_E18_mito_3_step11.1649.1649.1	2.2039	0.2951	1431.74	3	4580.0%	4	R.VVQVVKPHAPLIK.F
*	TK010303_lung_E18_mito_3_step04.2069.2069.2	3.5815	0.5236	2337.61	1	3480.0%	2	K.LSASEALGSAALPSHSSAISQHSK.G
UQ8VDC099.6%5113.3%9021014808.2(Q8VDC0) Leucyl-tRNA synthetase
*	TK010303_lung_E18_mito_3_step10.3830.3830.2	1.1356	0.0078	2379.37	119	1580.0%	1	K.FYLLSMFPYPSGKLHMGHVR.V
*	TK010303_lung_E18_mito_3_step08.1882.1882.1	2.8167	0.3458	1320.37	1	6670.0%	3	R.FLSHFCHDQK.M
URHOG_HUMAN99.6%1110.5%191213088.1(P35238) Rho-related GTP-binding protein RhoG (Sid10750) (P35238) Rho-related GTP-binding protein RhoG (Sid10750)
	TK010303_lung_E18_mito_3_step12.2271.2271.2	3.9745	0.5661	2394.63	1	4740.0%	1	K.WHPEVCHHCPDVPILLVGTK.K
UQ9DBL199.6%91716.9%432478747.9(Q9DBL1) 1300003O09Rik protein
*	TK010303_lung_E18_mito_3_step02.3674.3674.2	1.9782	0.1996	2503.4	1	2860.0%	2	R.IFDFQGLQHQVAQVATQLEATR.L
*	TK010303_lung_E18_mito_3_step03.1953.1953.1	1.6524	0.0597	1130.6	16	5560.0%	2	R.LVEAGRPFIK.E
*	TK010303_lung_E18_mito_3_step03.4259.4259.2	3.7697	0.4756	2391.89	1	5250.0%	1	K.VDASVALLCDIQNTIINNLFR.K
*	TK010303_lung_E18_mito_3_step12.3280.3280.2	3.1632	0.4864	2659.6	1	3640.0%	2	K.RIFDFQGLQHQVAQVATQLEATR.L
*	TK010303_lung_E18_mito_3_step03.2167.2167.2	3.6097	0.4308	2118.25	1	5280.0%	2	K.KFAQEHVAPLVSSMDENSK.M
UPSPB_MOUSE99.6%124626.3%377417286.2(P50405) Pulmonary surfactant-associated protein B precursor (SP-B) (Pulmonary surfactant-associated proteolipid SPL(Phe))
*	TK010303_lung_E18_mito_3_step11.3759.3759.2	4.4301	0.6069	2991.56	1	3890.0%	2	K.GVLAVAVSQVCHVVPLVVGGICQCLAER.Y
*	TK010303_lung_E18_mito_3_step12.2412.2412.3	1.5401	0.0456	3730.71	7	1400.0%	1	R.VQAVIPKGVLAVAVSQVCHVVPLVVGGICQCLAER.Y
*	TK010303_lung_E18_mito_3_step06.4330.4330.2	2.1078	0.1349	2494.26	1	2750.0%	6	R.QVLDVYLPLVIDYFQSQINPK.A
*	TK010303_lung_E18_mito_3_step10.3429.3429.3	7.3455	0.6725	3576.59	1	3170.0%	2	R.ALGHCLQEVWGHAGANDLCQECEDIVHLLTK.M
*	TK010303_lung_E18_mito_3_step01.2078.2078.1	2.7462	0.2087	1507.73	1	6820.0%	1	K.FLEQECDILPLK.L
UQ922W599.6%117.4%309323736.9(Q922W5) Similar to pyrroline-5-carboxylate reductase 1
*	TK010303_lung_E18_mito_3_step04.3190.3190.2	4.5665	0.5424	2395.57	1	5450.0%	1	K.DNVCSPGGATIHALHVLESGGFR.S
UETFB_MOUSE99.6%112924.6%252273108.4(Q9DCW4) Electron transfer flavoprotein beta-subunit (Beta-ETF)
*	TK010303_lung_E18_mito_3_step02.2592.2592.1	2.1651	0.2186	1163.66	1	6110.0%	2	K.EKVDLLFLGK.Q
*	TK010303_lung_E18_mito_3_step03.2713.2713.2	5.0025	0.6175	2146.06	1	6250.0%	4	R.GIHVEIPGAQAESLGPLQVAR.V
*	TK010303_lung_E18_mito_3_step01.1120.1120.1	1.3284	0.0444	1340.25	1	4090.0%	1	K.VSVISVEEPPQR.S
*	TK010303_lung_E18_mito_3_step02.1918.1918.1	1.1507	0.1655	948.56	56	5000.0%	2	K.RVIDFAVK.I
*	TK010303_lung_E18_mito_3_step12.1329.1329.2	1.6518	0.1222	2400.28	2	2950.0%	2	K.AGDLGVDLTSKVSVISVEEPPQR.S
UAF32_HUMAN99.6%336.8%797884848.7(Q9Y4W6) AFG3-like protein 2 (EC 3.4.24.-) (Paraplegin-like protein)
*	TK010303_lung_E18_mito_3_step12.2017.2017.1	1.0244	0.0731	1476.68	11	3330.0%	1	R.NSLLTDIIAAYQR.F
*	TK010303_lung_E18_mito_3_step11.2499.2499.2	1.5938	0.1701	1962.27	2	3120.0%	1	R.MCMTLGGRASEEIFFGR.I
*	TK010303_lung_E18_mito_3_step09.3223.3223.2	3.5929	0.5256	2648.98	1	4130.0%	1	K.TVAYHEAGHAVAGWYLEHADPLLK.V
UMYO6_MOUSE99.6%9912.9%12651464098.8(Q64331) Myosin VI
*	TK010303_lung_E18_mito_3_step08.1809.1809.2	3.5378	0.56	1847.59	1	6000.0%	1	R.LPQPSDQHFTSVVHQK.H
*	TK010303_lung_E18_mito_3_step12.1001.1001.1	1.0228	0.0727	678.51	1	7500.0%	1	R.RHNPR.I
*	TK010303_lung_E18_mito_3_step03.4368.4368.3	2.4527	0.1976	2924.61	2	1900.0%	1	K.SAPSLEYCAELLGLDQDDLRVSLTTR.V
*	TK010303_lung_E18_mito_3_step08.3902.3902.2	1.3591	0.1107	2611.83	18	1800.0%	1	R.VVAGVLHLGNIDLEEAGSTSGGCNLK.N
*	TK010303_lung_E18_mito_3_step01.1039.1039.1	1.304	0.0035	1286.77	12	4500.0%	1	K.DGKPEVNRQIK.N
*	TK010303_lung_E18_mito_3_step03.2541.2541.2	1.337	0.0971	2609.97	1	2620.0%	1	K.KDVEDNCSLMYLNEATLLHNVK.V
*	TK010303_lung_E18_mito_3_step11.1539.1539.3	1.8019	0.0693	3162.48	34	1520.0%	1	R.APKSVTDYDFAPFLNNSPQQNPAAQLPAR.Q
	TK010303_lung_E18_mito_3_step08.2050.2050.2	1.3664	0.1373	1875.42	127	2500.0%	1	R.GAEILPRQFEEIWER.C
	TK010303_lung_E18_mito_3_step05.2626.2626.2	3.7533	0.5671	1587.3	1	6250.0%	1	K.TVYSHLFDHVVNR.V
UODBA_MOUSE99.6%114910.6%442503718.1(P50136) 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component alpha chain (E1)) (BCKDH E1-alpha)
	TK010303_lung_E18_mito_3_step02.2797.2797.2	4.5005	0.6218	2443.21	1	4780.0%	3	R.HFVTISSPLATQIPQAVGAAYAAK.R
*	TK010303_lung_E18_mito_3_step05.4461.4461.2	1.8574	0.1656	2450.64	13	2000.0%	6	K.LKPNPSLLFSDVYQEMPAQLR.R
	TK010303_lung_E18_mito_3_step11.2561.2561.2	2.8537	0.2716	2728.91	1	3000.0%	2	K.ERHFVTISSPLATQIPQAVGAAYAAK.R
UQ8R0T899.6%8644.7%451509176.5(Q8R0T8) Hypothetical 50.9 kDa protein (Fragment)
*	TK010303_lung_E18_mito_3_step05.3008.3008.2	3.9843	0.5664	2342.49	1	4500.0%	8	R.DITDTLVAINIHDGAHHLDLR.A
UQ9D17299.6%1911532.3%266280908.8(Q9D172) DNA segment, Chr 10, Johns Hopkins University 81 expressed (Hypothetical 28.1 kDa protein)
*	TK010303_lung_E18_mito_3_step12.2872.2872.2	3.0124	0.5307	2740.08	1	3120.0%	9	K.VVTTPAFMCETALHHIHDGIGAMVK.N
*	TK010303_lung_E18_mito_3_step03.2677.2677.2	1.5603	0.2178	3046.35	1	2220.0%	2	R.GGAEVQIFAPDVPQMHVIDHTKGEPSER.E
*	TK010303_lung_E18_mito_3_step02.2709.2709.2	4.2585	0.485	2458.91	1	4170.0%	5	K.ITSLAQLNAANHDAAIFPGGFGAAK.N
	TK010303_lung_E18_mito_3_step03.2672.2672.2	3.3485	0.5383	2391.51	1	3100.0%	2	R.GGAEVQIFAPDVPQMHVIDHTK.G
*	TK010303_lung_E18_mito_3_step01.1091.1091.1	1.5576	0.22	873.62	1	7140.0%	1	K.NVLELTGK.-
UQ9CT0599.6%14788.4%654753955.3(Q9CT05) 2610027H02Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step05.2636.2636.2	2.8333	0.5439	2242.74	1	4120.0%	3	R.QEFAQHANAFHQWIQETR.T
	TK010303_lung_E18_mito_3_step06.3434.3434.2	4.4057	0.6163	2928.48	1	4350.0%	8	R.LEESLEYQQFVANVEEEEAWINEK.M
	TK010303_lung_E18_mito_3_step06.2057.2057.1	2.7944	0.4267	1589.63	1	5000.0%	2	K.KHEAFETDFTVHK.D
UQ9Z12699.6%2411.4%105112439.3(Q9Z126) Platelet factor 4
*	TK010303_lung_E18_mito_3_step03.2543.2543.1	1.5504	0.0516	1351.67	1	4090.0%	2	R.HCAVPQLIATLK.N
UCATC_MOUSE99.6%82813.9%462523766.9(P97821) Dipeptidyl-peptidase I precursor (EC 3.4.14.1) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase)
*	TK010303_lung_E18_mito_3_step09.1855.1855.1	1.9148	0.3152	1272.39	1	6670.0%	1	R.LYTHNHNFVK.A
*	TK010303_lung_E18_mito_3_step01.2795.2795.1	2.438	0.1091	1433.77	1	5450.0%	1	R.DPVTGIEYWIIK.N
*	TK010303_lung_E18_mito_3_step12.2764.2764.2	4.9566	0.6366	2529.92	1	5000.0%	1	R.GHTAISYCHETMTGWVHDVLGR.N
*	TK010303_lung_E18_mito_3_step09.3159.3159.2	3.4987	0.4806	2113.51	1	5000.0%	5	R.RGTDECAIESIAVAAIPIPK.L
UDEST_MOUSE99.6%41610.3%165185228.0(Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF)
*	TK010303_lung_E18_mito_3_step08.3666.3666.2	4.6818	0.6123	2081.03	1	5620.0%	4	R.KEELMFFLWAPEQAPLK.S
UQ9ERI699.6%115.4%334363668.2(Q9ERI6) Alcohol dehydrogenase PAN2 (RIKEN cDNA 3110030G19 gene)
	TK010303_lung_E18_mito_3_step10.2183.2183.2	3.0685	0.5877	1974.41	1	4710.0%	1	R.RLEGTNVTVNVLHPGIVR.T
ULMB1_MOUSE99.6%14329.9%17861969044.9(P02469) Laminin beta-1 chain precursor (Laminin B1 chain)
*	TK010303_lung_E18_mito_3_step05.3294.3294.2	1.326	0.0471	3111.16	8	1670.0%	1	R.VCAQEPEFSYGCAEGSCYPATGDLLIGR.A
	TK010303_lung_E18_mito_3_step01.1303.1303.1	1.5422	0.1366	1353.75	1	5000.0%	1	K.DILAQSPAAEPLK.N
	TK010303_lung_E18_mito_3_step05.3334.3334.3	1.6563	0.0296	3877.61	27	1450.0%	1	K.IWWQSENGVENVTIQLDLEAEFHFTHLIMTFK.T
*	TK010303_lung_E18_mito_3_step01.3178.3178.1	1.2967	0.1163	1502.93	1	4230.0%	2	R.DVLSALAEVEQLSK.M
*	TK010303_lung_E18_mito_3_step08.3708.3708.3	4.7686	0.4534	4052.28	1	2130.0%	1	R.QCNEVESGYYFTTLDHYIYEAEEANLGPGVVVVER.Q
*	TK010303_lung_E18_mito_3_step05.2392.2392.2	1.4085	0.0616	1982.56	4	3240.0%	2	-.MGLLQVFAFGVLALWGTR.V
*	TK010303_lung_E18_mito_3_step05.3593.3593.2	3.563	0.5359	2458.63	1	4050.0%	2	R.ERVETLSQVEVILQQSAADIAR.A
*	TK010303_lung_E18_mito_3_step04.2042.2042.2	3.6263	0.5739	2043.63	1	6430.0%	4	R.NCEQCKPFYFQHPER.D
UQ99K2399.6%3315.2%461525156.8(Q99K23) Similar to hypothetical protein FLJ11200
	TK010303_lung_E18_mito_3_step09.3090.3090.2	2.9283	0.5912	2041.67	1	5670.0%	1	K.ELHDLFNLPHDRPYFK.R
*	TK010303_lung_E18_mito_3_step01.3786.3786.2	1.4562	0.0935	3180.59	19	1480.0%	1	R.ENEEHHYINMSLPIDAVVSVAPEESWGK.V
*	TK010303_lung_E18_mito_3_step11.2612.2612.2	1.2582	0.148	3111.15	1	2200.0%	1	K.FLILDPHYTGAEDLQVMLEKGWCGWK.S
USYR_MOUSE99.6%242.7%660756747.6(Q9D0I9) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA ligase) (ArgRS)
*	TK010303_lung_E18_mito_3_step10.2655.2655.2	3.0138	0.4281	2042.16	1	5000.0%	2	K.YIDKVEIAGPGFINVHLR.K
UATPB_MOUSE99.6%179660147.8%529563015.3(P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14)
	TK010303_lung_E18_mito_3_step07.4229.4229.2	4.8208	0.6372	1924.24	1	6670.0%	11	R.DQEGQDVLLFIDNIFR.F
	TK010303_lung_E18_mito_3_step05.3762.3762.1	2.7327	0.406	1461.75	1	5830.0%	7	K.TVLIMELINNVAK.A
	TK010303_lung_E18_mito_3_step03.2627.2627.2	3.8535	0.5385	1651.36	1	6790.0%	2	R.LVLEVAQHLGESTVR.T
	TK010303_lung_E18_mito_3_step01.2671.2671.1	1.4474	0.0183	1443.61	4	4170.0%	1	R.VALTGLTVAEYFR.D
	TK010303_lung_E18_mito_3_step09.3428.3428.3	1.9363	0.0045	3718.29	1	1570.0%	3	K.GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.A
	TK010303_lung_E18_mito_3_step01.1922.1922.1	1.5738	0.2483	1435.57	2	4230.0%	1	R.FTQAGSEVSALLGR.I
	TK010303_lung_E18_mito_3_step01.1688.1688.1	2.1128	0.2261	1090.63	3	5000.0%	1	K.VVDLLAPYAK.G
	TK010303_lung_E18_mito_3_step02.3244.3244.2	3.6497	0.5818	2023.76	1	5590.0%	6	R.FLSQPFQVAEVFTGHMGK.L
	TK010303_lung_E18_mito_3_step01.2490.2490.1	1.2923	0.0847	1215.85	309	2690.0%	1	K.GGKIGLFGGAGVGK.T
	TK010303_lung_E18_mito_3_step01.0096.0096.1	1.2945	0.1789	902.47	3	5000.0%	1	K.VLDSGAPIK.I
	TK010303_lung_E18_mito_3_step09.4071.4071.2	3.1346	0.501	3035.92	1	2680.0%	11	R.IVAVIGAVVDVQFDEGLPPILNALEVQGR.D
	TK010303_lung_E18_mito_3_step03.2145.2145.1	2.4676	0.3978	1409.67	1	5380.0%	13	K.AHGGYSVFAGVGER.T
	TK010303_lung_E18_mito_3_step04.4001.4001.2	2.5541	0.4199	2679.95	1	3040.0%	60	K.SLQDIIAILGMDELSEEDKLTVSR.A
	TK010303_lung_E18_mito_3_step10.3715.3715.3	4.2334	0.4317	3848.21	1	1880.0%	49	K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.A
	TK010303_lung_E18_mito_3_step12.4024.4024.2	1.5822	0.145	3030.32	1	1920.0%	2	K.QFAPIHAEAPEFIEMSVEQEILVTGIK.V
UQ9D7N699.6%3911.9%1601834210.2(Q9D7N6) 2310001L22Rik protein
*	TK010303_lung_E18_mito_3_step06.2619.2619.2	1.7696	0.2975	2182.35	19	2500.0%	3	K.STGELVVQWHLKPVEQEAK.S
UCU80_MOUSE99.6%3512.8%429494296.5(Q8VHI3) Protein C21orf80 homolog
*	TK010303_lung_E18_mito_3_step07.4130.4130.3	1.8111	0.109	4307.25	56	910.0%	1	-.MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASR.R
	TK010303_lung_E18_mito_3_step09.2332.2332.2	3.4602	0.4316	1679.74	1	7080.0%	2	R.LYHWQSPDIHQVR.I
URALA_MOUSE99.6%62622.3%206235537.1(P05810) Ras-related protein RAL-A
	TK010303_lung_E18_mito_3_step06.3705.3705.2	3.3577	0.5156	2429.21	1	4210.0%	5	K.SALTLQFMYDEFVEDYEPTK.A
	TK010303_lung_E18_mito_3_step07.3057.3057.2	3.0121	0.5592	2863.38	1	3200.0%	1	K.KVVLDGEEVQIDILDTAGQEDYAAIR.D
UQ9CZN799.6%1810228.4%504557598.5(Q9CZN7) Serine hydroxymethyltransferase (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT)
	TK010303_lung_E18_mito_3_step08.3130.3130.2	4.4686	0.5374	1721.0	1	6250.0%	7	R.AHLLADMAHISGLVAAK.V
*	TK010303_lung_E18_mito_3_step01.3388.3388.3	1.7985	0.023	4001.83	1	1460.0%	1	R.AQHSKVAQTQAGEAAGGWTGQESLSDSDPEMWELLQR.E
	TK010303_lung_E18_mito_3_step01.1408.1408.1	2.0429	0.2706	1361.66	1	5000.0%	1	R.AALEALGSCLNNK.Y
*	TK010303_lung_E18_mito_3_step03.2867.2867.2	4.1852	0.6205	2231.06	1	5500.0%	7	R.GYSLVSGGTDTHLVLVDLRPK.G
	TK010303_lung_E18_mito_3_step07.3238.3238.2	1.7745	0.156	2016.16	1	4060.0%	1	R.YYGGAEVVDEIELLCQR.R
*	TK010303_lung_E18_mito_3_step03.4187.4187.3	2.5613	0.1775	4098.16	2	1490.0%	1	R.ALEAFDLDPAQWGVNVQPYSGSPANLAAYTALLQPHDR.I
UHYES_MOUSE99.6%468.1%554625156.2(P34914) Soluble epoxide hydrolase (SEH) (EC 3.3.2.3) (Epoxide hydratase) (Cytosolic epoxide hydrolase) (CEH)
*	TK010303_lung_E18_mito_3_step04.2914.2914.2	3.7495	0.5141	2218.57	1	4470.0%	2	K.AKPNEVVFLDDFGSNLKPAR.D
*	TK010303_lung_E18_mito_3_step12.2023.2023.2	3.0259	0.388	3002.58	1	3330.0%	1	K.RGHIEDCGHWTQIEKPTEVNQILIK.W
*	TK010303_lung_E18_mito_3_step06.2651.2651.2	1.6626	0.1397	2846.77	1	2170.0%	1	R.GHIEDCGHWTQIEKPTEVNQILIK.W
UNCB1_MOUSE99.6%161188.9%459534095.1(Q02819) Nucleobindin 1 precursor (CALNUC)
	TK010303_lung_E18_mito_3_step02.4378.4378.2	1.4788	0.0775	2897.53	14	1880.0%	6	K.TFFILHDINSDGVLDEQELEALFTK.E
*	TK010303_lung_E18_mito_3_step05.3502.3502.2	1.4755	0.1292	1936.44	1	3330.0%	9	R.YLQEVINVLETDGHFR.E
UQ9UG1699.6%111.5%13251520875.5(Q9UG16) Hypothetical protein (Fragment)
*	TK010303_lung_E18_mito_3_step07.4224.4224.2	3.954	0.5391	2335.29	1	5530.0%	1	K.DFDFWLSEVEALLASEDYGK.D
UQ99KQ299.6%204644.3%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment)
	TK010303_lung_E18_mito_3_step04.2650.2650.2	5.1202	0.6353	2202.01	1	5260.0%	5	R.LVSNHSLHETSSVFVDSLTK.V
	TK010303_lung_E18_mito_3_step03.2100.2100.1	1.6588	0.0507	1301.4	4	5450.0%	1	K.FNGTHIPGSPFK.I
	TK010303_lung_E18_mito_3_step03.2203.2203.2	1.8436	0.1819	2279.29	2	3160.0%	1	K.VHSPSGALEECYVTEIDQDK.Y
*	TK010303_lung_E18_mito_3_step06.3123.3123.2	1.3416	0.1265	1652.77	4	3460.0%	1	K.HMGSRLYSVSYLLK.D
	TK010303_lung_E18_mito_3_step07.2045.2045.2	3.1014	0.5221	1825.54	1	5620.0%	2	R.RAPSVANIGSHCDLSLK.I
	TK010303_lung_E18_mito_3_step12.2267.2267.2	4.4153	0.4864	2306.76	1	5230.0%	2	K.GQHVPGSPFQFTVGPLGEGGAHK.V
	TK010303_lung_E18_mito_3_step04.2198.2198.2	1.4089	0.0343	1437.92	3	4620.0%	1	K.AGNNMLLVGVHGPR.T
	TK010303_lung_E18_mito_3_step01.1940.1940.1	1.1058	0.0199	1380.54	14	3750.0%	1	K.YGGPYHIGGSPFK.A
*	TK010303_lung_E18_mito_3_step11.3163.3163.2	1.745	0.3219	2913.45	1	1900.0%	1	R.AEAGVPAEFGIWTREAGAGGLAIAVEGPSK.A
	TK010303_lung_E18_mito_3_step06.2546.2546.2	0.9987	0.0228	2061.59	32	2500.0%	1	K.THEAEIVEGENHTYCIR.F
	TK010303_lung_E18_mito_3_step04.3031.3031.2	1.2696	0.096	2624.04	25	1520.0%	1	K.FNEEHIPDSPFVVPVASPSGDARR.L
*	TK010303_lung_E18_mito_3_step09.1922.1922.3	1.5757	0.1012	2218.24	53	1820.0%	1	K.VATVPQHATSGPGPADVSKVVAK.G
UILK1_HUMAN99.6%114.4%452514198.1(Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK)
	TK010303_lung_E18_mito_3_step12.2115.2115.2	4.1326	0.5633	2142.82	1	4740.0%	1	K.VALEGLRPTIPPGISPHVCK.L
UQ9EPZ299.6%5118.4%831926317.4(Q9EPZ2) ELAC2
	TK010303_lung_E18_mito_3_step03.2771.2771.2	1.4451	0.1284	3166.76	14	1480.0%	1	R.VLCSLTAVFVSHLHADHHTGLLNILLQR.E
*	TK010303_lung_E18_mito_3_step05.2113.2113.2	1.2938	0.0042	2001.62	64	2250.0%	1	K.AKELGLPVGTAAIAPIIAAVK.D
*	TK010303_lung_E18_mito_3_step06.2441.2441.2	3.8668	0.4108	2462.83	1	4000.0%	3	R.FGPDTQHLILNENCPSVHNLR.S
UPYC_MOUSE99.6%4029421.6%11781296856.7(Q05920) Pyruvate carboxylase, mitochondrial precursor (EC 6.4.1.1) (Pyruvic carboxylase) (PCB)
	TK010303_lung_E18_mito_3_step01.2166.2166.2	3.3781	0.5103	2347.07	1	4050.0%	1	R.LDNASAFQGAVISPHYDSLLVK.V
*	TK010303_lung_E18_mito_3_step02.2641.2641.1	2.6084	0.3782	1547.69	1	5830.0%	2	R.NHQGLLLMDTTFR.D
	TK010303_lung_E18_mito_3_step10.3378.3378.2	2.8203	0.3922	2414.37	1	3680.0%	15	R.HIEVQILGDQYGNILHLYER.D
	TK010303_lung_E18_mito_3_step07.1669.1669.1	1.4531	0.195	1046.64	30	6430.0%	1	R.RLEYKPIK.K
*	TK010303_lung_E18_mito_3_step07.3218.3218.2	2.938	0.4698	3057.46	1	2690.0%	6	R.LQVEHTVTEEITDVDLVHAQIHVSEGR.S
	TK010303_lung_E18_mito_3_step07.1510.1510.1	1.4963	0.0784	927.4	1	6670.0%	2	K.EMHFHPK.A
*	TK010303_lung_E18_mito_3_step08.4170.4170.3	2.2542	0.2533	2626.77	1	2610.0%	1	R.ACTELGIRTVAVYSEQDTGQMHR.Q
	TK010303_lung_E18_mito_3_step12.3737.3737.2	1.8918	0.1658	2953.05	1	2220.0%	3	R.LDNASAFQGAVISPHYDSLLVKVIAHGK.D
*	TK010303_lung_E18_mito_3_step07.4369.4369.2	1.442	0.047	2449.04	8	2140.0%	2	R.SVVEFLQGYIGIPHGGFPEPFR.S
*	TK010303_lung_E18_mito_3_step01.3351.3351.2	4.6752	0.67	2683.38	1	4780.0%	1	R.HGEEVTPEDVLSAAMYPDVFAQFK.D
	TK010303_lung_E18_mito_3_step11.3516.3516.3	2.0406	0.1128	4062.94	23	1220.0%	1	R.VFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSR.T
*	TK010303_lung_E18_mito_3_step04.2235.2235.2	1.1689	0.0297	1977.63	16	2190.0%	1	R.TVAVYSEQDTGQMHRQK.A
*	TK010303_lung_E18_mito_3_step10.3701.3701.3	4.0875	0.4922	4646.94	1	1920.0%	2	K.TNIPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNR.A
UCTE1_MOUSE99.6%5911.7%419461366.6(O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I)
	TK010303_lung_E18_mito_3_step11.3369.3369.2	1.6117	0.0969	2287.69	18	1960.0%	2	K.GPGIGLLGISKGGELGLAMASFLK.G
	TK010303_lung_E18_mito_3_step03.3099.3099.2	3.3238	0.4361	2023.6	1	5000.0%	1	R.SDTTFLFLVGQDDHNWK.S
	TK010303_lung_E18_mito_3_step05.1854.1854.1	1.7064	0.2044	897.6	1	7140.0%	2	R.HFLAPGVR.R
UB3AT_MOUSE99.6%155711.5%9291031355.4(P04919) Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (MEB3)
*	TK010303_lung_E18_mito_3_step09.4183.4183.3	2.0531	0.1503	3835.02	15	1290.0%	1	K.GTFLLGLAETSLAGVANHLLDCFIYEDQIRPQDR.E
*	TK010303_lung_E18_mito_3_step01.1864.1864.1	1.8647	0.323	1094.71	1	6670.0%	1	K.ALLNLVPVQK.E
*	TK010303_lung_E18_mito_3_step03.2228.2228.2	1.6528	0.0859	2005.73	1	3610.0%	1	R.SHAEDLGNLEGVKPAVLTR.S
*	TK010303_lung_E18_mito_3_step09.2475.2475.3	2.1866	0.3453	2164.2	2	2890.0%	1	K.RSHAEDLGNLEGVKPAVLTR.S
*	TK010303_lung_E18_mito_3_step09.3503.3503.2	3.2288	0.6079	2438.49	1	4210.0%	6	R.NQELQWVEAAHWIGLEENLR.E
*	TK010303_lung_E18_mito_3_step10.2186.2186.2	3.0774	0.5643	2544.01	1	2950.0%	1	R.RYLPSPAKPDPNLYNTLDLNGGK.G
UQ99L2399.6%91912.8%470533326.9(Q99L23) Similar to NADH dehydrogenase (Ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Q reductase) (Fragment)
	TK010303_lung_E18_mito_3_step05.2598.2598.1	1.7204	0.1052	1330.67	1	4500.0%	3	K.TSMESLIHHFK.L
	TK010303_lung_E18_mito_3_step11.3877.3877.3	2.0047	0.0801	3462.12	1	1690.0%	1	K.AVTNMTLNFGPQHPAAHGVLRLVLELSGEMVR.K
	TK010303_lung_E18_mito_3_step12.2059.2059.2	3.9263	0.5918	2231.55	1	5000.0%	1	K.AVTNMTLNFGPQHPAAHGVLR.L
	TK010303_lung_E18_mito_3_step03.2916.2916.2	2.5286	0.4265	2047.04	1	4380.0%	2	K.ETAHWKPPPWNDVDILK.E
UQ922K299.6%6815.0%641749236.8(Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment)
*	TK010303_lung_E18_mito_3_step12.2224.2224.2	1.1623	0.0513	2819.97	15	1600.0%	1	-.KDRPQEADGIDSVIVVDNVPQVGPDR.L
*	TK010303_lung_E18_mito_3_step07.1638.1638.2	1.4011	0.0319	1143.54	123	4380.0%	1	R.KMAQELYMK.Q
	TK010303_lung_E18_mito_3_step10.2375.2375.2	3.7255	0.6076	1705.35	1	6540.0%	2	R.GFHCESSAHWPIFK.W
*	TK010303_lung_E18_mito_3_step06.3969.3969.2	1.1018	0.0057	2870.2	73	1590.0%	1	R.FCQLLWRPRPPTLLSQDQIKQIK.K
	TK010303_lung_E18_mito_3_step06.2859.2859.2	0.793	0.099	2717.24	17	1740.0%	1	K.DFSWSPGGNIIAFWVPEDKDIPAR.V
ULMB2_MOUSE99.6%668.7%17991963526.7(Q61292) Laminin beta-2 chain precursor (S-laminin) (S-LAM)
*	TK010303_lung_E18_mito_3_step09.4119.4119.3	1.8287	0.1388	3968.75	10	1250.0%	1	R.LGLLLSVLAATLAQAPSLDVPGCSRGSCYPATGDLLVGR.A
*	TK010303_lung_E18_mito_3_step09.4123.4123.2	1.1849	0.0295	2535.15	5	2050.0%	1	R.VLDISIPASPEQIQRLASEIAER.V
*	TK010303_lung_E18_mito_3_step11.3731.3731.2	3.9459	0.6089	3196.6	1	2960.0%	1	R.RLEQWAQELQQTGVLGAFESSFLNMQGK.L
*	TK010303_lung_E18_mito_3_step05.2784.2784.3	2.3757	0.1929	3443.3	2	1670.0%	1	R.GLNCEQCQDFYQDLPWHPAEDGHTHACR.K
*	TK010303_lung_E18_mito_3_step10.2505.2505.2	2.61	0.4073	2480.5	1	3750.0%	1	R.GFSGVFPACHPCHACFGDWDR.V
*	TK010303_lung_E18_mito_3_step12.1761.1761.2	1.2938	0.0559	1913.52	1	3440.0%	1	R.CDSHDDPVLGLVSGQCR.C
UQ99K3599.6%399.2%315362694.8(Q99K35) Similar to hypothetical protein LOC57333 (Fragment)
*	TK010303_lung_E18_mito_3_step12.1925.1925.3	1.9798	0.0687	3256.62	3	1960.0%	3	R.VHHGTPLSEAPHDDAHGNFQYDHEAFLGR.D
UQ9Z24799.6%2521318.8%570629965.2(Q9Z247) FK506 binding protein 9 precursor (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS)
*	TK010303_lung_E18_mito_3_step04.3777.3777.2	3.3666	0.5616	2510.66	1	3180.0%	11	R.DGNGEVLLEEFSEYIHAQVATGK.G
*	TK010303_lung_E18_mito_3_step03.1989.1989.1	1.8561	0.3835	1309.7	1	6360.0%	1	R.IVVPPHLGYGEK.G
	TK010303_lung_E18_mito_3_step04.3710.3710.2	2.2501	0.3043	2266.19	1	3500.0%	9	K.DIPGQASLVFDVALLDLHNPK.D
*	TK010303_lung_E18_mito_3_step12.4187.4187.3	1.8349	0.1218	4304.94	111	860.0%	1	R.RSLLLLLLWVTGQAAPVLGLAVSSELQIQQSFVPDECPR.T
*	TK010303_lung_E18_mito_3_step02.2050.2050.1	3.0112	0.4947	1431.04	1	6360.0%	3	R.YHYVGTFLDGQK.F
UFINC_MOUSE99.6%281947.7%24772732155.3(P11276) Fibronectin precursor (FN) (Fragments)
*	TK010303_lung_E18_mito_3_step03.3831.3831.2	1.6547	0.1521	2974.17	2	1670.0%	2	R.EVTSDSGSIVVSGLTPGVEYTYTIQVLR.D
	TK010303_lung_E18_mito_3_step04.3821.3821.3	1.2815	0.0366	4374.26	50	990.0%	1	K.TPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFR.R
	TK010303_lung_E18_mito_3_step12.2291.2291.2	1.0588	0.0372	2853.25	388	1250.0%	1	R.SYTITGLQPGTDYKIHLYTLNDNAR.S
	TK010303_lung_E18_mito_3_step03.3192.3192.2	2.1496	0.2371	3044.85	2	2410.0%	4	R.VVTPLSPPTNLHLEANPDTGVLTVSWER.S
	TK010303_lung_E18_mito_3_step06.2807.2807.3	1.6283	0.0777	3055.19	5	1670.0%	1	R.YNQRTNTNVNCPIECFMPLDVQADR.D
*	TK010303_lung_E18_mito_3_step06.3286.3286.2	3.3204	0.3595	2547.52	1	4570.0%	11	R.NSITLTNLNPGTEYVVSIIAVNGR.E
*	TK010303_lung_E18_mito_3_step08.2822.2822.2	2.5933	0.4444	2333.42	1	4250.0%	7	K.GLTPGVIYEGQLISIQQYGHR.E
UACDV_MOUSE99.6%5713.6%656708768.7(P50544) Acyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor (EC 1.3.99.-) (VLCAD) (MVLCAD)
*	TK010303_lung_E18_mito_3_step04.2746.2746.3	1.8102	0.0793	2597.8	1	2290.0%	1	K.VPSENVLGEVGDGFKVAVNILNNGR.F
*	TK010303_lung_E18_mito_3_step01.3163.3163.2	1.9702	0.4304	2738.55	1	2170.0%	1	K.GQLTIDQVFPYPSVLSEEQAQFLK.E
*	TK010303_lung_E18_mito_3_step01.2363.2363.1	2.5327	0.431	1505.71	1	4640.0%	2	K.NPFGNVGLLMGEAGK.Q
*	TK010303_lung_E18_mito_3_step01.2943.2943.2	2.1952	0.3168	2580.74	5	2080.0%	1	K.ELGAFGLQVPSELGGLGLSNTQYAR.L
UQ9CR6899.6%115132.8%274293688.7(Q9CR68) 4430402G14Rik protein (RIKEN cDNA 4430402G14 gene)
*	TK010303_lung_E18_mito_3_step08.3138.3138.2	1.8889	0.2268	2520.42	32	1960.0%	5	R.KGPAPLNLEVPAYEFTSDDVVVVG.-
*	TK010303_lung_E18_mito_3_step05.2777.2777.3	1.7291	0.0696	4063.9	35	1280.0%	1	K.GFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSK.I
*	TK010303_lung_E18_mito_3_step05.4476.4476.2	2.0097	0.2652	2529.53	1	2600.0%	5	R.GVAGALRPLLQGAVPAASEPPVLDVK.R
UCOPE_MOUSE99.6%61261.1%144162805.6(O89079) Coatomer epsilon subunit (Epsilon-coat protein) (Epsilon-COP) (Fragment)
	TK010303_lung_E18_mito_3_step12.2975.2975.2	1.3901	0.0553	2967.12	4	1730.0%	3	K.DSGHPETLINLIVLSQHLGKPPEVTNR.Y
	TK010303_lung_E18_mito_3_step02.3840.3840.2	3.3648	0.4399	2932.83	1	3270.0%	1	K.KMQDQDEDATLTQLATAWVNLAVGGEK.L
	TK010303_lung_E18_mito_3_step10.3414.3414.3	2.2198	0.1224	3726.58	54	1210.0%	1	K.CSPTLLLLNGQAACHSAQGRWETAEGVLQEALDK.D
UQ91YT099.6%176121.8%464508348.2(Q91YT0) Similar to NADH dehydrogenase (Ubiquinone) flavoprotein 1 (51kD)
	TK010303_lung_E18_mito_3_step02.4333.4333.2	1.3245	0.0592	2618.28	1	1920.0%	4	K.HAGGVTGGWDNLLAVIPGGSSTPLIPK.S
	TK010303_lung_E18_mito_3_step07.2800.2800.2	3.3471	0.5108	2640.46	1	3180.0%	6	K.LFNISGHVNHPCTVEEEMSVPLK.E
	TK010303_lung_E18_mito_3_step10.2961.2961.3	1.9133	0.1437	3228.63	57	1370.0%	1	K.ELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPK.S
	TK010303_lung_E18_mito_3_step10.2878.2878.3	4.5794	0.5133	3401.56	1	2580.0%	1	R.LKPPFPADVGVFGCPTTVANVETVAVSPTICR.R
*	TK010303_lung_E18_mito_3_step07.1744.1744.1	1.1426	0.1186	1200.46	5	5000.0%	2	R.HFRPELEDR.M
	TK010303_lung_E18_mito_3_step11.3389.3389.3	1.7385	0.0044	3966.82	4	1460.0%	1	K.QGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICR.R
ULCFB_MOUSE99.6%357.0%699779237.1(P41216) Long-chain-fatty-acid--CoA ligase 2 (EC 6.2.1.3) (Long-chain acyl-CoA synthetase 2) (LACS 2)
*	TK010303_lung_E18_mito_3_step12.2236.2236.2	3.7603	0.5369	2698.05	1	3960.0%	2	R.VKPKPPEPEDLAIICFTSGTTGNPK.G
*	TK010303_lung_E18_mito_3_step07.2846.2846.2	1.0554	0.0819	2614.71	13	1960.0%	1	K.ALKPPCDLSMQSVEIAGTTDGIRR.S
UGL6S_HUMAN99.6%3313.6%552620828.3(P15586) N-acetylglucosamine-6-sulfatase precursor (EC 3.1.6.14) (G6S) (Glucosamine-6-sulfatase)
*	TK010303_lung_E18_mito_3_step12.3657.3657.3	2.0488	0.0786	4383.24	35	1110.0%	1	R.TMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAK.T
*	TK010303_lung_E18_mito_3_step08.1913.1913.3	1.2695	0.0361	2780.26	280	1410.0%	1	K.IQEPNTFPAILRSMCGYQTFFAGK.Y
*	TK010303_lung_E18_mito_3_step03.3040.3040.2	3.3822	0.347	1702.06	1	6150.0%	1	K.RWQTLLSVDDLVEK.L
UMDHC_MOUSE99.6%2211.7%333363466.6(P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)
*	TK010303_lung_E18_mito_3_step07.3865.3865.2	1.3592	0.0597	2088.13	21	2500.0%	1	K.EEIAFKDLDVAVLVGSMPR.R
	TK010303_lung_E18_mito_3_step05.2238.2238.2	3.7939	0.5165	2281.32	1	5260.0%	1	K.NVIIWGNHSSTQYPDVNHAK.V
UTCPD_MOUSE99.6%5720.4%539580668.0(P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45)
	TK010303_lung_E18_mito_3_step02.2062.2062.1	2.7105	0.4681	1456.63	1	6670.0%	2	K.GIHPTIISESFQK.A
	TK010303_lung_E18_mito_3_step01.3527.3527.2	2.4074	0.3354	3032.87	1	2500.0%	1	R.AFADAMEVIPSTLAENAGLNPISTVTELR.N
*	TK010303_lung_E18_mito_3_step06.3598.3598.3	2.5687	0.1872	3490.53	1	1890.0%	1	K.TIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGK.L
*	TK010303_lung_E18_mito_3_step09.4312.4312.3	1.7032	0.0677	3582.47	6	1360.0%	1	K.GGISNILEEMVVQPLLVSVSALTLATETVRSILK.I
UPDP1_HUMAN99.6%7258.0%538612206.8(Q9P0J1) [Pyruvate dehydrogenase [Lipoamide]]-phosphatase 1, mitochondrial precursor (EC 3.1.3.43) (PDP 1) (Pyruvate dehydrogenase phosphatase, catalytic subunit 1) (PDPC 1)
*	TK010303_lung_E18_mito_3_step09.2594.2594.2	4.7933	0.6565	2300.91	1	5250.0%	4	R.IVGEYLTGMHHQQPIAVGGYK.V
*	TK010303_lung_E18_mito_3_step09.2634.2634.2	2.716	0.5351	2644.54	1	4290.0%	3	K.FIPPNYHTPPYLTAEPEVTYHR.L
UQ9QXT099.6%145228.0%182207675.1(Q9QXT0) Putative secreted protein ZSIG9 (5330432A10RIK protein) (Transmembrane protein 4)
*	TK010303_lung_E18_mito_3_step01.3018.3018.1	1.3165	0.0798	1444.71	20	3640.0%	1	R.ALVDELEWEIAR.V
*	TK010303_lung_E18_mito_3_step08.1529.1529.2	2.6251	0.4446	1396.4	1	7000.0%	2	K.RTDLCDHALHR.S
	TK010303_lung_E18_mito_3_step01.0864.0864.1	1.085	0.0349	921.43	3	5710.0%	1	R.EADNVKDK.L
	TK010303_lung_E18_mito_3_step10.4293.4293.2	2.0337	0.2139	2516.23	18	2110.0%	6	K.FACESIVEEYEDELIEFFSR.E
UQ9D2Y199.6%1814020.5%288316078.4(Q9D2Y1) 9130022B02Rik protein
	TK010303_lung_E18_mito_3_step09.2358.2358.2	3.4783	0.6231	2773.6	1	3330.0%	6	K.CLHSVGQPLTGHGDPVGQWPCNPEK.T
	TK010303_lung_E18_mito_3_step07.3492.3492.3	3.8993	0.5417	3761.79	1	1890.0%	10	R.SAHLCQPEGIHICDGTEAENTAILALLEEQGLIR.K
UQ91Z1099.6%7157.0%640704947.2(Q91Z10) Similar to phosphoenolpyruvate carboxykinase 2 (Mitochondrial)
*	TK010303_lung_E18_mito_3_step04.1855.1855.1	1.1018	0.059	1061.47	1	6110.0%	2	R.HGVFVGSAMR.S
*	TK010303_lung_E18_mito_3_step06.3967.3967.2	1.6123	0.1571	2509.55	3	2500.0%	1	R.LARDEGWLAEHMLILGITNPAGK.K
*	TK010303_lung_E18_mito_3_step03.3547.3547.2	2.0227	0.2424	2169.45	3	2630.0%	3	R.DEGWLAEHMLILGITNPAGK.K
*	TK010303_lung_E18_mito_3_step01.1043.1043.1	1.9704	0.3628	1241.59	1	5450.0%	1	R.YVAAAFPSACGK.T
UQ8VDG899.6%1110.5%200228196.5(Q8VDG8) Similar to paraoxonase 2
	TK010303_lung_E18_mito_3_step12.2869.2869.2	2.8132	0.5412	2273.26	1	4250.0%	1	K.FPGLHSFAPDKPGGILMMDLK.D
UMAAI_MOUSE99.6%41021.3%216242757.9(Q9WVL0) Maleylacetoacetate isomerase (EC 5.2.1.2) (MAAI) (Glutathione S-transferase zeta 1) (EC 2.5.1.18) (GSTZ1-1)
*	TK010303_lung_E18_mito_3_step02.4153.4153.3	1.2665	0.0292	3676.41	23	1290.0%	1	K.IDGITIVQSLAIMEYLEETRPIPRLLPQDPQK.R
*	TK010303_lung_E18_mito_3_step09.3426.3426.2	3.9233	0.6216	1638.71	1	7690.0%	3	K.ELLALEVFQVSHPR.R
UQ925I199.6%393.2%591667429.3(Q925I1) TOB3
*	TK010303_lung_E18_mito_3_step09.2595.2595.2	1.4012	0.0251	2165.52	3	2780.0%	3	K.VERPDSQTNKPPHPSLLSC.-
UP2G4_MOUSE99.6%4164.8%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4)
	TK010303_lung_E18_mito_3_step10.2485.2485.2	4.6742	0.5768	2172.52	1	5830.0%	4	K.VAHSFNCTPIEGMLSHQLK.Q
UPRTP_MOUSE99.6%7919.8%474538445.9(P16675) Lysosomal protective protein precursor (EC 3.4.16.5) (Cathepsin A) (Carboxypeptidase C) (MO54)
*	TK010303_lung_E18_mito_3_step02.2022.2022.1	2.1708	0.3058	1134.77	4	5000.0%	1	K.ALHIPESLPR.W
*	TK010303_lung_E18_mito_3_step10.2143.2143.3	2.1379	0.0222	2573.46	13	1930.0%	1	R.NEAAPDQDEIDCLPGLAKQPSFR.Q
*	TK010303_lung_E18_mito_3_step12.2513.2513.2	1.5226	0.0023	1834.74	10	3080.0%	2	K.HFHYWFVESQNDPK.N
*	TK010303_lung_E18_mito_3_step06.4289.4289.2	1.9859	0.2049	2782.81	1	3040.0%	1	K.MEVQRRPWLVDYGESGEQVAGFVK.E
*	TK010303_lung_E18_mito_3_step04.3459.3459.2	1.8774	0.2663	2599.22	9	2050.0%	1	K.ECSHITFLTIKGAGHMVPTDKPR.A
*	TK010303_lung_E18_mito_3_step02.2370.2370.1	1.6524	0.1863	1350.63	1	5500.0%	1	K.ECSHITFLTIK.G
UEFTU_HUMAN99.6%71318.8%452495427.6(P49411) Elongation factor Tu, mitochondrial precursor (P43)
*	TK010303_lung_E18_mito_3_step02.2094.2094.1	2.0556	0.2126	1263.55	2	5500.0%	1	R.TVVTGIEMFHK.S
*	TK010303_lung_E18_mito_3_step11.1149.1149.2	3.7877	0.6619	1812.44	1	7190.0%	1	R.DKPHVNVGTIGHVDHGK.T
*	TK010303_lung_E18_mito_3_step02.2926.2926.2	2.2417	0.3532	2813.43	1	3270.0%	1	K.NMITGTAPLDGCILVVAANDGPMPQTR.E
*	TK010303_lung_E18_mito_3_step07.1556.1556.2	2.8197	0.4366	1773.74	1	5360.0%	3	R.HYAHTDCPGHADYVK.N
*	TK010303_lung_E18_mito_3_step11.1613.1613.2	2.866	0.4351	1619.91	1	5710.0%	1	R.GLVMVKPGSIKPHQK.V
UCD36_MOUSE99.6%2214.6%471525678.3(Q08857) Platelet glycoprotein IV (GPIV) (GPIIIB) (CD36 antigen) (PAS IV) (PAS-4 protein)
*	TK010303_lung_E18_mito_3_step05.2106.2106.3	1.8816	0.0302	3586.92	5	1400.0%	1	-.GCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEK.T
*	TK010303_lung_E18_mito_3_step12.2591.2591.3	7.0617	0.6917	3847.96	1	3180.0%	1	K.EGKPVYISLPHFLHASPDVSEPIEGLHPNEDEHR.T
UQ9CXR899.6%71114.2%639723956.3(Q9CXR8) 3110021P21Rik protein
	TK010303_lung_E18_mito_3_step03.3263.3263.2	3.54	0.6105	1887.32	1	6560.0%	2	R.LIDLHTNVATAVLEHIK.A
*	TK010303_lung_E18_mito_3_step09.3192.3192.2	1.7231	0.0893	2041.22	51	3120.0%	2	K.HILYGCSEIFNATQFIK.Q
*	TK010303_lung_E18_mito_3_step10.4257.4257.2	1.3069	0.0452	2927.83	15	1460.0%	1	K.HILYGCSEIFNATQFIKQLSQLGQK.-
*	TK010303_lung_E18_mito_3_step07.2301.2301.3	1.4083	0.0626	3026.52	52	1500.0%	1	K.ESPFPEVAESVQQELESYRAQEDEVK.R
	TK010303_lung_E18_mito_3_step10.4206.4206.2	1.4843	0.2534	2869.5	2	2500.0%	1	K.VFDQYLNFITLEDDMFVLCNQNK.E
UADHA_MOUSE99.6%134927.5%374396408.1(P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2)
*	TK010303_lung_E18_mito_3_step10.4346.4346.2	1.6361	0.0229	1895.14	5	3670.0%	4	K.KFPLDPLITHVLPFEK.I
*	TK010303_lung_E18_mito_3_step05.3316.3316.2	2.9532	0.4597	2504.06	1	2860.0%	4	K.AAVLWELHKPFTIEDIEVAPPK.A
*	TK010303_lung_E18_mito_3_step08.3441.3441.3	2.0096	1.0E-4	4084.32	10	1190.0%	1	R.SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK.V
*	TK010303_lung_E18_mito_3_step04.3082.3082.2	2.0614	0.2019	2688.12	1	2390.0%	4	K.QIHNFISTSTFSQYTVVDDIAVAK.I
UQ9JJE799.6%3318.7%449514977.6(Q9JJE7) Brain cDNA, clone MNCb-0629, similar to Homo sapiens delta-6 fatty acid desaturase (CYB5RP) mRNA
	TK010303_lung_E18_mito_3_step03.3648.3648.2	1.3408	0.1758	2349.59	1	3100.0%	1	K.DPDVTVAPVFLLGESSVEYGKK.K
*	TK010303_lung_E18_mito_3_step07.3353.3353.3	1.9483	0.0711	3432.34	40	1420.0%	1	R.HPGGSRLIGHHGAEDATDAFHAFHQDLHFVR.K
*	TK010303_lung_E18_mito_3_step09.3475.3475.3	4.0995	0.4397	3468.46	1	2080.0%	1	R.KFLKPLLIGELAPEEPSQDGAQNAQLIEDFR.A
UQ99K4899.6%6206.8%473545418.9(Q99K48) Non-POU-domain-containing, octamer-binding protein
	TK010303_lung_E18_mito_3_step08.1940.1940.1	1.335	0.0814	1181.53	2	5000.0%	2	R.HEHQVMLMR.Q
	TK010303_lung_E18_mito_3_step10.3755.3755.2	1.8404	0.2075	2672.09	1	2730.0%	4	R.NLPQYVSNELLEEAFSVFGQVER.A
UACDS_MOUSE99.6%95114.8%412449478.8(Q07417) Acyl-CoA dehydrogenase, short-chain specific, mitochondrial precursor (EC 1.3.99.2) (SCAD) (Butyryl-CoA dehydrogenase)
*	TK010303_lung_E18_mito_3_step08.2541.2541.2	4.9337	0.6632	2185.48	1	6180.0%	7	R.LHTVYQSVELPETHQMLR.Q
*	TK010303_lung_E18_mito_3_step01.1710.1710.1	1.0081	0.0351	1224.84	1	5500.0%	1	K.ELVPIAAQLDR.E
*	TK010303_lung_E18_mito_3_step03.4249.4249.3	1.9829	0.1591	3347.79	7	1610.0%	1	R.KLAASEAATAISHQAIQILGSMGYVTEMPAER.Y
UNPS2_MOUSE99.6%82026.0%281329339.3(O55126) NipSnap2 protein (Glioblastoma amplified sequence)
*	TK010303_lung_E18_mito_3_step07.2098.2098.2	2.1363	0.3094	1977.78	1	4000.0%	4	K.LQFHNVKPECLDAYNK.I
	TK010303_lung_E18_mito_3_step01.2688.2688.1	1.854	0.1126	1243.92	3	5500.0%	1	R.IMIPLKTSPLQ.-
	TK010303_lung_E18_mito_3_step09.3547.3547.2	1.2248	0.0549	2566.95	6	2250.0%	1	R.SYQLRPGTMIEWGNYWARAIR.F
*	TK010303_lung_E18_mito_3_step06.3513.3513.3	2.168	0.053	3029.96	9	1770.0%	1	K.NQLLLEFSFWNEPVPRPGPNIYELR.S
	TK010303_lung_E18_mito_3_step10.2889.2889.2	1.9676	0.32	2229.07	1	3240.0%	1	R.SYQLRPGTMIEWGNYWAR.A
USDFL_MOUSE99.6%138545.2%221236487.4(Q9ESP1) Stromal cell-derived factor 2-like protein 1 precursor (SDF2 like protein 1)
	TK010303_lung_E18_mito_3_step12.2671.2671.3	6.727	0.6655	3934.93	1	3090.0%	1	K.NLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVR.C
*	TK010303_lung_E18_mito_3_step07.2882.2882.2	3.5719	0.6289	2439.97	1	3810.0%	9	R.FQHVGTSVFLSVTGEQYGNPIR.G
*	TK010303_lung_E18_mito_3_step01.3463.3463.3	1.926	0.0832	4086.02	1	1420.0%	1	R.GQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL.-
*	TK010303_lung_E18_mito_3_step11.3147.3147.2	1.5584	0.0443	2978.88	19	1730.0%	1	R.EASVRFQHVGTSVFLSVTGEQYGNPIR.G
UGBAS_MOUSE99.6%244.3%394456646.0(P04894) Guanine nucleotide-binding protein G(S), alpha subunit (Adenylate cyclase-stimulating G alpha protein)
	TK010303_lung_E18_mito_3_step05.2310.2310.2	4.1287	0.4975	2186.28	1	6880.0%	2	R.HYCYPHFTCAVDTENIR.R
UQ9NRP299.6%2427.8%7994607.9(Q9NRP2) DC13
*	TK010303_lung_E18_mito_3_step12.2744.2744.2	3.4662	0.5328	2614.94	1	4050.0%	2	-.MHPDLSPHLHTEECNVLINLLK.E
UQ9CZU699.6%1815615.7%464517378.6(Q9CZU6) 2610511A05Rik protein (Citrate synthase)
	TK010303_lung_E18_mito_3_step11.1340.1340.1	1.4934	0.0267	1106.67	11	4440.0%	1	K.EVGKDVSDEK.L
*	TK010303_lung_E18_mito_3_step09.4440.4440.2	3.0573	0.4528	1966.06	1	4640.0%	3	K.YWELIYEDCMDLIAK.L
*	TK010303_lung_E18_mito_3_step05.3180.3180.2	1.6624	0.0981	2162.08	23	2810.0%	1	R.AKYWELIYEDCMDLIAK.L
	TK010303_lung_E18_mito_3_step01.0350.0350.1	1.2262	0.0705	834.62	6	7500.0%	1	K.LVAQLYK.I
*	TK010303_lung_E18_mito_3_step11.4341.4341.3	3.331	0.3061	4169.63	1	1640.0%	12	R.AALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFAR.A
UQ9CQV599.6%2411.4%167189019.8(Q9CQV5) 3110030K20Rik protein
*	TK010303_lung_E18_mito_3_step11.1292.1292.2	1.3758	0.0566	2178.65	4	3060.0%	2	K.GNKPVSYEEAHAPHYIAHR.K
UAGT2_HUMAN99.6%3311.1%514571567.9(Q9BYV1) Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) (Beta-ALAAT II)
*	TK010303_lung_E18_mito_3_step08.1533.1533.2	1.3856	0.1246	2874.99	25	1600.0%	1	R.YLDFFSGIVTVSVGHCHPKVNAVAQK.Q
*	TK010303_lung_E18_mito_3_step10.3178.3178.2	3.4868	0.3505	2501.19	1	4050.0%	1	R.LGSHFWGFQTHDVLPDIVTMAK.G
*	TK010303_lung_E18_mito_3_step01.0426.0426.1	1.1389	0.1873	1045.52	1	5620.0%	1	R.GSIFSQTFR.I
USDF2_MOUSE99.6%5931.8%211231597.3(Q9DCT5) Stromal cell-derived factor 2 precursor (SDF-2)
*	TK010303_lung_E18_mito_3_step05.2461.2461.2	3.5027	0.3855	2459.61	1	4090.0%	2	K.HSSTDVLLSVTGEQYGRPISGQK.E
*	TK010303_lung_E18_mito_3_step01.0780.0780.1	1.1912	0.2544	911.52	6	5000.0%	1	R.LTHINTGR.N
*	TK010303_lung_E18_mito_3_step03.2428.2428.3	1.7075	0.2115	3701.6	2	1500.0%	2	-.MAVLSLLLLGGLWSAVGASNMAVVTCGSVVKLLNTR.H
UQ99LX799.6%197733.0%288312578.5(Q99LX7) Hypothetical 31.3 kDa protein (Fragment)
*	TK010303_lung_E18_mito_3_step09.2072.2072.1	1.3865	0.2297	1167.11	1	5000.0%	1	R.REGMTAFVEK.R
*	TK010303_lung_E18_mito_3_step05.3614.3614.2	1.9345	0.2799	3176.22	1	2070.0%	5	K.KPVIAAVNGYALGGGCELAMMCDIIYAGEK.A
*	TK010303_lung_E18_mito_3_step10.1946.1946.1	1.6372	0.2146	1313.57	1	5560.0%	6	K.FLSHWDHITR.V
*	TK010303_lung_E18_mito_3_step03.2037.2037.2	2.5317	0.4149	1425.95	1	5420.0%	3	K.NSSVGLIQLNRPK.A
*	TK010303_lung_E18_mito_3_step01.2220.2220.2	1.9596	0.1373	2112.64	1	3750.0%	1	K.AQFGQPEILLGTIPGAGGTQR.L
*	TK010303_lung_E18_mito_3_step01.1311.1311.1	1.8719	0.279	1291.67	1	5500.0%	2	K.LVEEAIQCAEK.I
UQ99KS199.6%126638.9%144165117.8(Q99KS1) Hypothetical 16.5 kDa protein (Fragment)
	TK010303_lung_E18_mito_3_step05.3418.3418.2	2.7283	0.4996	2081.82	1	4690.0%	4	K.EKDNIDITLQWLIQHSK.S
	TK010303_lung_E18_mito_3_step10.3021.3021.2	3.9571	0.5303	2556.65	1	4090.0%	7	K.NELHNLLDKPQLQGIPVLVLGNK.R
	TK010303_lung_E18_mito_3_step06.2382.2382.2	1.0845	0.0255	1699.3	323	2330.0%	1	R.GVSAIVYMVDAADQEK.I
UHS7C_MOUSE99.6%64138629.4%646708715.5(P08109) Heat shock cognate 71 kDa protein
	TK010303_lung_E18_mito_3_step08.4026.4026.2	2.2169	0.4191	2915.63	1	2690.0%	6	R.NVLIFDLGGGTFDVSILTIEDGIFEVK.S
	TK010303_lung_E18_mito_3_step01.1600.1600.1	1.5458	0.1382	1303.53	3	4500.0%	1	K.NSLESYAFNMK.A
	TK010303_lung_E18_mito_3_step02.1921.1921.1	2.4227	0.3799	1483.79	1	6150.0%	4	K.SQIHDIVLVGGSTR.I
	TK010303_lung_E18_mito_3_step02.3834.3834.2	1.347	9.0E-4	2840.87	132	1300.0%	1	K.DAGTIAGLNVLRIINEPTAAAIAYGLDK.K
	TK010303_lung_E18_mito_3_step02.2350.2350.1	2.0289	0.2919	1237.5	1	6110.0%	2	R.MVNHFIAEFK.R
	TK010303_lung_E18_mito_3_step01.2026.2026.1	1.3878	0.0084	1253.74	11	3890.0%	1	R.FEELNADLFR.G
	TK010303_lung_E18_mito_3_step10.2573.2573.2	2.7032	0.5656	1654.19	1	7690.0%	1	K.HWPFMVVNDAGRPK.V
	TK010303_lung_E18_mito_3_step08.2614.2614.2	1.1398	0.0023	2612.06	100	1670.0%	1	-.MSKGPAVGIDLGTTYSCVGVFQHGK.V
	TK010303_lung_E18_mito_3_step05.4205.4205.2	1.3382	0.2076	3001.71	20	1540.0%	13	R.TLSSSTQASIEIDSLYEGIDFYTSITR.A
	TK010303_lung_E18_mito_3_step09.4084.4084.2	3.8055	0.4521	2518.82	1	3910.0%	34	R.GVPQIEVTFDIDANGILNVSAVDK.S
UPDX3_MOUSE99.6%2213635.0%257281277.6(P20108) Thioredoxin-dependent peroxide reductase, mitochondrial precursor (EC 1.11.1.-) (Perioredoxin 3) (Antioxidant protein 1) (AOP-1) (MER5 protein) (PRX III)
	TK010303_lung_E18_mito_3_step01.1026.1026.1	0.6544	0.0613	504.61	5	6670.0%	1	K.QISR.D
	TK010303_lung_E18_mito_3_step02.1870.1870.1	1.799	0.3037	1208.56	1	5000.0%	1	K.HLSVNDLPVGR.S
*	TK010303_lung_E18_mito_3_step01.2338.2338.1	2.2249	0.2586	1272.77	1	5450.0%	2	R.GLFIIDPNGVVK.H
*	TK010303_lung_E18_mito_3_step05.2658.2658.3	5.1344	0.5557	3416.37	1	2830.0%	5	K.AFQFVETHGEVCPANWTPESPTIKPSPTASK.E
*	TK010303_lung_E18_mito_3_step03.3031.3031.2	3.8684	0.5893	1784.33	1	6250.0%	1	K.NGGLGHMNITLLSDITK.Q
*	TK010303_lung_E18_mito_3_step04.3054.3054.2	2.2435	0.2256	1915.95	6	3240.0%	10	R.KNGGLGHMNITLLSDITK.Q
*	TK010303_lung_E18_mito_3_step01.3582.3582.1	2.1651	0.3093	1479.41	1	4620.0%	2	R.DYGVLLESAGIALR.G
UQ9JJL899.6%5177.9%518583027.9(Q9JJL8) Seryl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.11)
*	TK010303_lung_E18_mito_3_step11.3151.3151.2	2.1974	0.4073	2295.6	8	2370.0%	4	R.KGELRPADLPAIISTWQELR.Q
*	TK010303_lung_E18_mito_3_step12.1792.1792.2	3.4567	0.4975	2356.18	1	4750.0%	1	R.ITAPTHVPLQYIGPNQPQKPR.L
UCH60_MOUSE99.6%3401766453.9%573609566.2(P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65)
*	TK010303_lung_E18_mito_3_step10.2751.2751.2	3.1167	0.5579	2200.26	1	4120.0%	78	K.RIQEITEQLDITTSEYEK.E
	TK010303_lung_E18_mito_3_step01.0730.0730.1	1.2326	0.1256	904.69	1	5620.0%	5	K.LSDGVAVLK.V
	TK010303_lung_E18_mito_3_step01.0091.0091.1	1.3562	0.2448	846.52	1	6430.0%	2	K.VGEVIVTK.D
	TK010303_lung_E18_mito_3_step03.3336.3336.2	1.3676	0.1885	2330.41	8	2270.0%	1	R.ALMLQGVDLLADAVAVTMGPKGR.T
	TK010303_lung_E18_mito_3_step01.1319.1319.2	4.1425	0.6223	2563.92	1	3540.0%	2	K.LVQDVANNTNEEAGDGTTTATVLAR.S
*	TK010303_lung_E18_mito_3_step03.3895.3895.2	5.6815	0.6393	2458.35	1	5420.0%	12	R.TALLDAAGVASLLTTAEAVVTEIPK.E
*	TK010303_lung_E18_mito_3_step04.4239.4239.2	2.7675	0.4626	3089.18	1	2590.0%	44	K.DMAIATGGAVFGEEGLNLNLEDVQAHDLGK.V
*	TK010303_lung_E18_mito_3_step02.3484.3484.2	3.0991	0.5039	2536.43	1	3410.0%	15	K.ILQSSSEVGYDAMLGDFVNMVEK.G
	TK010303_lung_E18_mito_3_step01.0100.0100.1	1.216	0.2623	743.61	4	5000.0%	1	K.GIIDPTK.V
*	TK010303_lung_E18_mito_3_step01.2115.2115.2	2.6843	0.5095	1906.28	1	4120.0%	2	K.ISSVQSIVPALEIANAHR.K
	TK010303_lung_E18_mito_3_step07.4378.4378.2	2.2258	0.4664	2369.37	1	2860.0%	87	R.KPLVIIAEDVDGEALSTLVLNR.L
*	TK010303_lung_E18_mito_3_step06.2807.2807.2	4.5485	0.6196	2037.13	1	6390.0%	16	K.KISSVQSIVPALEIANAHR.K
	TK010303_lung_E18_mito_3_step01.2595.2595.1	2.4305	0.4585	1507.65	1	5420.0%	4	K.TLNDELEIIEGMK.F
	TK010303_lung_E18_mito_3_step01.2096.2096.1	1.7487	0.0331	1217.84	9	5000.0%	2	K.NAGVEGSLIVEK.I
	TK010303_lung_E18_mito_3_step01.1358.1358.1	1.2782	0.1182	912.74	16	5000.0%	2	K.VGLQVVAVK.A
*	TK010303_lung_E18_mito_3_step01.2259.2259.1	2.6035	0.3814	1178.74	1	7000.0%	2	K.DIGNIISDAMK.K
*	TK010303_lung_E18_mito_3_step09.2478.2478.2	2.8621	0.4339	2298.34	1	4170.0%	1	R.IQEITEQLDITTSEYEKEK.L
	TK010303_lung_E18_mito_3_step03.3872.3872.2	6.0128	0.5856	2117.02	1	6250.0%	8	R.ALMLQGVDLLADAVAVTMGPK.G
	TK010303_lung_E18_mito_3_step05.3845.3845.1	2.0694	0.1623	1430.64	1	5380.0%	3	R.GVMLAVDAVIAELK.K
*	TK010303_lung_E18_mito_3_step04.3870.3870.2	3.384	0.6408	2844.91	1	3330.0%	35	R.TALLDAAGVASLLTTAEAVVTEIPKEEK.D
	TK010303_lung_E18_mito_3_step02.1880.1880.1	1.7935	0.2599	1347.65	1	4550.0%	4	R.TVIIEQSWGSPK.V
	TK010303_lung_E18_mito_3_step03.2356.2356.2	3.6336	0.5973	2514.83	1	3700.0%	4	K.KQSKPVTTPEEIAQVATISANGDK.D
UQ8VDM699.6%579.7%859960026.6(Q8VDM6) Similar to E1B-55 kDa-associated protein 5
	TK010303_lung_E18_mito_3_step01.2452.2452.1	1.5493	0.0901	1355.95	22	3640.0%	1	K.YNILGTNAIMDK.M
*	TK010303_lung_E18_mito_3_step03.2073.2073.2	2.6908	0.3651	2111.87	1	3440.0%	2	R.RPLDMEPQQQVYHPELK.T
	TK010303_lung_E18_mito_3_step04.2587.2587.2	1.5221	0.1039	2918.24	25	1600.0%	1	K.EALGGQALYPHVLVKNCAVEFNFGQR.A
	TK010303_lung_E18_mito_3_step11.2673.2673.2	1.2251	0.1429	3184.67	7	1670.0%	1	K.FAENDVIGCFADFECGNDVELSFTKNGK.W
UIMB1_MOUSE99.6%225.0%876971524.8(P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG)
	TK010303_lung_E18_mito_3_step05.2688.2688.2	3.326	0.5049	2095.06	1	5620.0%	1	R.HFIMQVVCEATQCPDTR.V
	TK010303_lung_E18_mito_3_step08.2769.2769.2	1.1239	0.042	2868.96	1	2120.0%	1	R.AAVENLPTFLVELSRVLANPGNSQVAR.V
UQ9CWJ199.6%116.0%283297695.0(Q9CWJ1) 2410043M02Rik protein
	TK010303_lung_E18_mito_3_step07.2501.2501.2	3.2889	0.5044	1781.77	1	5620.0%	1	K.KISLPGQMTGTPITPLK.D
UUCR1_MOUSE99.6%93114.8%480527696.1(Q9CZ13) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor (EC 1.10.2.2)
*	TK010303_lung_E18_mito_3_step04.2365.2365.2	3.1005	0.5023	2318.95	1	4760.0%	1	R.VASEQSSHATCTVGVWIDAGSR.Y
	TK010303_lung_E18_mito_3_step05.2313.2313.1	1.8554	0.3893	1258.36	1	5000.0%	5	R.RIPLAEWESR.I
*	TK010303_lung_E18_mito_3_step04.2909.2909.3	1.6183	0.1978	4299.08	69	1050.0%	2	R.EMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVR.R
UECHB_HUMAN99.6%114.2%474512949.4(P55084) Trifunctional enzyme beta subunit, mitochondrial precursor (TP-beta) [Includes: 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase)]
	TK010303_lung_E18_mito_3_step05.3256.3256.2	4.3802	0.622	2138.61	1	4470.0%	1	K.FNNWGGSLSLGHPFGATGCR.L
UG3BP_MOUSE99.6%484.7%465518295.6(P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1)
	TK010303_lung_E18_mito_3_step11.2015.2015.2	3.1817	0.5302	2083.98	1	5590.0%	2	R.HPDSHQLFIGNLPHEVDK.S
	TK010303_lung_E18_mito_3_step12.1979.1979.2	3.7671	0.5353	2541.68	1	4290.0%	2	R.HPDSHQLFIGNLPHEVDKSELK.D
UQ91YQ599.6%143421.4%608685286.5(Q91YQ5) Similar to ribophorin I
*	TK010303_lung_E18_mito_3_step12.2139.2139.2	1.5788	0.0486	2537.62	4	2140.0%	1	R.SEDVLDYGPFKDIPAYSQDTFK.V
	TK010303_lung_E18_mito_3_step08.3340.3340.2	3.2714	0.4952	2200.98	1	5290.0%	3	K.NLVEQHIQDIVVHYTFNK.V
	TK010303_lung_E18_mito_3_step07.2829.2829.2	1.3705	0.1801	2224.16	1	2940.0%	2	K.QFVVFEGNHYFYSPYPTK.T
*	TK010303_lung_E18_mito_3_step02.1845.1845.1	2.0789	0.3701	980.59	1	7500.0%	3	R.LAHLGVQIK.G
	TK010303_lung_E18_mito_3_step09.2334.2334.3	1.704	0.1603	3073.67	1	2100.0%	1	K.VLMLQEPLLVVAAFYILFFTVIIYVR.L
*	TK010303_lung_E18_mito_3_step10.3051.3051.2	1.8354	0.3573	2871.59	1	2500.0%	3	K.ISVVVETVYTHVLHPYPTQITQSEK.Q
*	TK010303_lung_E18_mito_3_step01.3275.3275.1	1.482	0.1651	1276.9	1	5000.0%	1	K.AVTSEIAVLQSR.L
UQ96T1299.6%3516.3%362431599.1(Q96T12) Hypothetical protein FLJ14515
*	TK010303_lung_E18_mito_3_step08.3536.3536.2	3.741	0.0332	2651.9	1	4520.0%	2	K.GDNVYEFHLKFLDLVKPEPVYK.L
*	TK010303_lung_E18_mito_3_step11.2613.2613.3	1.7403	0.0864	4290.92	1	1530.0%	1	K.VLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGR.F
UCTN2_MOUSE99.6%112.0%9531052985.9(Q61301) Alpha-2 catenin (Alpha-catenin related protein) (Alpha N-catenin)
	TK010303_lung_E18_mito_3_step07.3114.3114.2	4.7636	0.0283	2086.1	1	6670.0%	1	K.KAHVLAASVEQATQNFLEK.G
UQ9D9S099.6%2211.2%268296586.0(Q9D9S0) 1700030F05Rik protein
*	TK010303_lung_E18_mito_3_step12.2156.2156.2	3.9447	0.5338	1724.19	1	6430.0%	1	R.SRPVLQVFVHGESLR.S
*	TK010303_lung_E18_mito_3_step05.3380.3380.2	1.2907	0.0525	1863.66	2	3210.0%	1	K.FFQTQIKSLYESIEE.-
UQ9DAB499.6%6277428.9%391428906.7(Q9DAB4) 1700015E05Rik protein
	TK010303_lung_E18_mito_3_step11.3492.3492.2	2.2235	0.3837	2641.4	1	3040.0%	3	R.ALDLFSDNAPPPELLEIINEDIAK.K
	TK010303_lung_E18_mito_3_step04.2299.2299.2	4.6319	0.6719	1819.09	1	6880.0%	6	K.HQSLGGQYGVQGFPTIK.I
	TK010303_lung_E18_mito_3_step02.3761.3761.2	2.7	0.3889	2766.2	1	2500.0%	1	R.ALDLFSDNAPPPELLEIINEDIAKK.T
	TK010303_lung_E18_mito_3_step01.2816.2816.1	1.8855	0.2307	1389.75	1	5000.0%	5	R.TGEAIVDAALSALR.Q
	TK010303_lung_E18_mito_3_step01.1652.1652.1	1.603	0.1884	1530.64	2	4230.0%	2	K.NLEPEWAAAATEVK.E
	TK010303_lung_E18_mito_3_step01.0138.0138.1	0.9456	0.1084	662.59	3	6000.0%	1	Q.GFPTIK.I
	TK010303_lung_E18_mito_3_step03.3167.3167.2	4.8837	0.6427	2650.77	1	5000.0%	19	K.TCEEHQLCVVAVLPHILDTGAAGR.N
	TK010303_lung_E18_mito_3_step12.2615.2615.2	3.6999	0.652	2451.78	1	3180.0%	1	K.HQSLGGQYGVQGFPTIKIFGANK.N
	TK010303_lung_E18_mito_3_step10.2979.2979.2	2.7269	0.4272	2778.61	1	3540.0%	18	K.KTCEEHQLCVVAVLPHILDTGAAGR.N
	TK010303_lung_E18_mito_3_step01.1995.1995.1	1.3161	0.1849	1485.8	21	3330.0%	2	K.GSFSEQGINEFLR.-
UCRTC_MOUSE99.6%109206960.8%416479954.5(P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60)
	TK010303_lung_E18_mito_3_step05.3197.3197.2	3.1564	0.5514	2860.94	1	3640.0%	33	R.CKDDEFTHLYTLIVRPDNTYEVK.I
*	TK010303_lung_E18_mito_3_step12.3808.3808.3	3.2781	0.2473	4141.53	1	1500.0%	25	K.GTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVK.S
	TK010303_lung_E18_mito_3_step01.0098.0098.1	1.3678	0.2027	737.54	14	5830.0%	1	K.FVLSSGK.F
	TK010303_lung_E18_mito_3_step01.1338.1338.2	2.7917	0.4136	2761.21	1	3260.0%	1	K.IDDPTDSKPEDWDKPEHIPDPDAK.K
*	TK010303_lung_E18_mito_3_step01.1151.1151.1	1.4496	0.1215	1004.58	7	6250.0%	1	K.LFPSGLDQK.D
	TK010303_lung_E18_mito_3_step02.2642.2642.2	2.0476	0.3512	2393.02	1	3500.0%	1	K.IDNSQVESGSLEDDWDFLPPK.K
	TK010303_lung_E18_mito_3_step11.1833.1833.1	2.1956	0.3048	1150.63	1	6880.0%	11	K.KVHVIFNYK.G
	TK010303_lung_E18_mito_3_step02.3737.3737.3	3.3519	0.4082	3273.03	1	2230.0%	2	K.SGTIFDNFLITNDEAYAEEFGNETWGVTK.A
*	TK010303_lung_E18_mito_3_step03.2759.2759.2	1.5876	0.1238	2569.86	22	2050.0%	1	K.DMHGDSEYNIMFGPDICGPGTKK.V
	TK010303_lung_E18_mito_3_step04.2667.2667.1	1.6636	0.1799	1222.23	1	5500.0%	11	K.GQTLVVQFTVK.H
	TK010303_lung_E18_mito_3_step01.0911.0911.1	1.7551	0.1087	701.55	3	8000.0%	2	K.NVLINK.D
*	TK010303_lung_E18_mito_3_step11.4421.4421.3	1.9368	0.1815	3936.46	75	1140.0%	1	-.MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNR.W
	TK010303_lung_E18_mito_3_step01.0967.0967.1	2.3173	0.3902	1477.57	1	5830.0%	1	K.HEQNIDCGGGYVK.L
*	TK010303_lung_E18_mito_3_step01.0180.0180.1	1.1461	0.1066	801.59	1	6670.0%	4	R.FYALSAK.F
	TK010303_lung_E18_mito_3_step04.2119.2119.1	2.6565	0.3472	1021.47	1	7140.0%	8	K.VHVIFNYK.G
UOM70_MOUSE99.6%51111.9%611675217.3(Q9CZW5) Mitochondrial precursor proteins import receptor (Translocase of outer membrane TOM70)
*	TK010303_lung_E18_mito_3_step05.2466.2466.3	1.5925	0.0931	4439.72	60	1010.0%	1	R.GTMCMQQQQPMLSTQDFNMAAEIDPMNSDVYHHRGQLK.I
	TK010303_lung_E18_mito_3_step08.3396.3396.2	1.3882	0.0659	2563.43	1	2620.0%	1	K.AGKYEQAIQCYTEAISLCPTEK.N
	TK010303_lung_E18_mito_3_step04.2431.2431.2	3.4826	0.4866	1557.8	1	6250.0%	3	K.NREPLMPSPQFIK.S
UMDHM_HUMAN99.6%95110.7%338355318.7(P40926) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37)
*	TK010303_lung_E18_mito_3_step04.4245.4245.2	1.4539	0.0588	2615.31	1	2610.0%	1	K.VDFPQDQLTALTGRIQEAGTEVVK.A
*	TK010303_lung_E18_mito_3_step01.1971.1971.1	1.8011	0.065	1563.68	1	4230.0%	1	K.VDFPQDQLTALTGR.I
*	TK010303_lung_E18_mito_3_step01.2732.2732.1	2.2607	0.4979	1330.79	1	6360.0%	7	R.FVFSLVDAMNGK.E
UPDI_MOUSE99.6%3051902136.9%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59)
	TK010303_lung_E18_mito_3_step03.3801.3801.3	2.1223	0.2365	3757.15	70	1210.0%	2	K.KFLESGGQDGAGDDEDLDLEEALEPDMEEDDDQK.A
	TK010303_lung_E18_mito_3_step01.2611.2611.1	1.3703	0.0436	968.58	19	5000.0%	2	R.ILEFFGLK.K
	TK010303_lung_E18_mito_3_step01.0659.0659.1	1.8977	0.2549	1218.52	1	6000.0%	3	K.SNFEEALAAHK.Y
	TK010303_lung_E18_mito_3_step11.3813.3813.2	1.3316	0.0612	3145.38	1	1830.0%	15	K.RTGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK010303_lung_E18_mito_3_step03.4387.4387.2	2.2752	0.3078	2990.27	1	2240.0%	103	R.TGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK010303_lung_E18_mito_3_step06.3030.3030.2	3.4185	0.6017	1969.2	1	5940.0%	26	K.HNQLPLVIEFTEQTAPK.I
	TK010303_lung_E18_mito_3_step01.1266.1266.1	1.2708	0.0428	777.7	1	7500.0%	1	K.DGVVLFK.K
	TK010303_lung_E18_mito_3_step01.1908.1908.1	1.8221	0.0407	750.55	20	8000.0%	2	K.LLDFIK.H
	TK010303_lung_E18_mito_3_step06.2933.2933.1	2.2366	0.1899	1084.65	1	6880.0%	17	K.THILLFLPK.S
	TK010303_lung_E18_mito_3_step04.1866.1866.1	1.3114	0.091	930.45	1	5710.0%	5	K.VHSFPTLK.F
	TK010303_lung_E18_mito_3_step10.2857.2857.2	3.996	0.4371	1837.95	1	6430.0%	81	K.ILFIFIDSDHTDNQR.I
	TK010303_lung_E18_mito_3_step03.1917.1917.1	2.2733	0.3555	1346.44	1	6360.0%	3	K.KSNFEEALAAHK.Y
	TK010303_lung_E18_mito_3_step06.2285.2285.2	2.303	0.38	1956.19	1	5330.0%	15	K.IKPHLMSQEVPEDWDK.Q
	TK010303_lung_E18_mito_3_step02.3724.3724.2	3.8381	0.5518	2644.79	1	2920.0%	17	K.QFLLAAEAIDDIPFGITSNSGVFSK.Y
UQ6159599.6%1915310.1%13271525925.9(Q61595) Kinectin
*	TK010303_lung_E18_mito_3_step03.3248.3248.2	5.5849	0.6359	2065.74	1	7350.0%	2	K.AHQLSVTSQVQELQNLLR.G
*	TK010303_lung_E18_mito_3_step09.2770.2770.2	1.1147	0.0403	2401.71	22	2250.0%	1	K.VEMLMAPSKEQDVLLSHQDTK.Q
*	TK010303_lung_E18_mito_3_step12.1072.1072.1	1.489	0.0424	948.69	1	6430.0%	1	K.ERLLSAMK.E
*	TK010303_lung_E18_mito_3_step09.4292.4292.3	2.457	0.2173	3703.37	1	1720.0%	1	K.SENVAVLVDEPLIHATTYMPLDNANSNLMMDKR.E
*	TK010303_lung_E18_mito_3_step04.2542.2542.2	1.8358	0.1861	2022.17	3	3440.0%	1	K.REIIDMIKPDHVEGIQK.S
*	TK010303_lung_E18_mito_3_step01.0866.0866.1	1.2718	0.1116	887.62	15	4290.0%	12	K.VEPVLVTK.Q
*	TK010303_lung_E18_mito_3_step02.2682.2682.3	2.0044	0.0229	3206.47	1	1810.0%	1	R.DFKLSDASPAEDEQFVPAPLNVAETSSSVR.E
UQ9CV7199.6%41010.7%233271849.9(Q9CV71) Ribosomal protein, mitochondrial, S7 (Fragment)
*	TK010303_lung_E18_mito_3_step01.2402.2402.1	1.925	0.1804	1452.79	1	5420.0%	1	K.NCEPVIGLVPILK.G
*	TK010303_lung_E18_mito_3_step05.2561.2561.1	2.4724	0.4381	1467.28	1	5450.0%	3	K.LSHELLEAFHNR.G
UQ9JM6599.6%3515.9%308345675.1(Q9JM65) Nonclathrin coat protein epsilon-COP (Coatomer protein complex, subunit epsilon)
*	TK010303_lung_E18_mito_3_step05.2590.2590.2	3.2159	0.2967	2303.13	1	4500.0%	2	R.KYGVVLDEIKPSSAPELQAVR.M
*	TK010303_lung_E18_mito_3_step10.2199.2199.3	1.6543	0.0378	3110.38	95	1670.0%	1	R.SVDVTNTTFLLMAASIYFHDQNPDAALR.T
UQ922D899.6%102411.4%9351012567.1(Q922D8) Similar to C1-tetrahydrofolate synthase
	TK010303_lung_E18_mito_3_step08.2202.2202.2	3.8221	0.5829	1532.79	1	7670.0%	1	K.MHGGGPTVTAGLPLPK.A
*	TK010303_lung_E18_mito_3_step03.3132.3132.2	2.7702	0.4569	1638.11	1	4670.0%	1	K.STTTIGLVQALGAHLR.Q
	TK010303_lung_E18_mito_3_step09.3168.3168.2	3.4804	0.5001	2582.78	1	3640.0%	4	K.IVGAPMHDLLLWNNATVTTCHSK.T
*	TK010303_lung_E18_mito_3_step02.4109.4109.3	1.9138	0.2085	4510.62	9	1100.0%	2	K.GDILVVATGQPEMVKGEWIKPGAVVIDCGINYVPDDTKPNGR.K
*	TK010303_lung_E18_mito_3_step02.2581.2581.2	1.7899	0.1795	2974.21	2	2120.0%	1	K.GEWIKPGAVVIDCGINYVPDDTKPNGR.K
*	TK010303_lung_E18_mito_3_step01.0335.0335.1	1.3802	0.0601	1048.64	6	5000.0%	1	R.LGRMVVASSK.K
URNT1_MOUSE99.6%465.2%11131226576.7(Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog)
	TK010303_lung_E18_mito_3_step07.2706.2706.2	1.3365	0.2134	2819.32	48	1460.0%	1	K.ENPSATLEDLEKPGVDEEPQHVLLR.Y
	TK010303_lung_E18_mito_3_step09.2508.2508.2	2.8724	0.6045	2146.95	1	3610.0%	2	K.RFTAQGLPDLNHSQVYAVK.T
	TK010303_lung_E18_mito_3_step06.1799.1799.2	3.4353	0.5527	1490.94	1	8080.0%	1	R.GNTSGSHIVNHLVR.A
UQ9CQU099.6%1611836.5%170190495.3(Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene)
	TK010303_lung_E18_mito_3_step03.2725.2725.2	2.6187	0.2397	1651.79	1	6150.0%	1	K.YFYVSAEQVVQGMK.E
*	TK010303_lung_E18_mito_3_step04.4147.4147.3	2.841	0.4469	4505.53	1	1580.0%	10	K.FAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPR.I
	TK010303_lung_E18_mito_3_step11.1847.1847.1	1.3353	0.2145	1126.58	1	5620.0%	4	K.GFGDHIHWR.T
UANK1_MOUSE99.6%224815.8%18622042426.6(Q02357) Ankyrin 1 (Erythrocyte ankyrin)
	TK010303_lung_E18_mito_3_step07.1764.1764.2	1.0558	0.0971	1846.86	220	2330.0%	1	K.DELTPLHCAARNGHVR.I
	TK010303_lung_E18_mito_3_step04.2405.2405.2	1.3811	0.1654	2527.91	7	2080.0%	2	K.LLLENGASPNLATTAGHTPLHTAAR.E
	TK010303_lung_E18_mito_3_step09.3136.3136.2	1.441	0.011	2095.32	211	2220.0%	5	K.NGLTPLHVAVHHNNLDIVK.L
	TK010303_lung_E18_mito_3_step03.2332.2332.2	1.2472	0.0837	1798.01	85	2500.0%	1	R.TAAVLLQNDPNPDVLSK.T
	TK010303_lung_E18_mito_3_step11.2967.2967.2	3.8628	0.6159	2503.92	1	4550.0%	2	K.LGYSPLHQAAQQGHTDIVTLLLK.N
	TK010303_lung_E18_mito_3_step08.2308.2308.2	2.9947	0.5704	1788.7	1	6000.0%	1	R.MGYTPLHVASHYGNIK.L
	TK010303_lung_E18_mito_3_step11.2691.2691.3	1.5209	0.0115	4770.03	53	930.0%	1	K.TGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASR.R
	TK010303_lung_E18_mito_3_step10.3213.3213.3	1.9922	0.0629	3576.42	79	1060.0%	1	K.TGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR.G
	TK010303_lung_E18_mito_3_step06.2578.2578.2	1.1975	0.0311	2499.51	92	1430.0%	1	K.VVRQVDSSGAIDTQQHEEVELR.G
	TK010303_lung_E18_mito_3_step11.3619.3619.2	1.6417	0.1935	2656.14	10	2050.0%	2	R.IRVENPNSLLDQSTALLTLWVDR.E
	TK010303_lung_E18_mito_3_step06.4015.4015.3	2.4066	0.1214	3776.25	2	1710.0%	1	R.VMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVK.N
	TK010303_lung_E18_mito_3_step07.2436.2436.3	1.6161	0.0215	2393.62	357	1790.0%	1	R.LLCSVIGGTDQAQWEDITGTTK.L
	TK010303_lung_E18_mito_3_step04.3058.3058.3	1.9774	0.058	3364.77	1	1750.0%	1	R.QVDSSGAIDTQQHEEVELRGSGLQPDLIEGR.K
	TK010303_lung_E18_mito_3_step04.2294.2294.1	1.6032	0.228	1057.47	4	5000.0%	1	R.SFHFQSFR.E
	TK010303_lung_E18_mito_3_step01.2783.2783.1	0.6089	0.0781	681.31	5	6000.0%	1	R.VVIPPR.T
UBCAM_MOUSE99.6%72717.8%275307938.4(O35855) Branched-chain amino acid aminotransferase, mitochondrial precursor (EC 2.6.1.42) (BCAT(m)) (Fragment)
	TK010303_lung_E18_mito_3_step12.4048.4048.2	1.3052	0.0414	3113.92	17	1540.0%	1	R.IQPFQNLTLHPACSGLHYSLQLFEGLK.A
	TK010303_lung_E18_mito_3_step04.2162.2162.1	2.1164	0.5151	1259.39	1	5450.0%	5	K.KPAPSQALLFGK.T
	TK010303_lung_E18_mito_3_step07.2826.2826.2	1.747	0.1452	1347.5	2	6110.0%	1	R.LFRPWLNMDR.M
UTCPY_MOUSE99.6%244.0%531581847.7(Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2)
*	TK010303_lung_E18_mito_3_step02.2598.2598.2	3.3237	0.4782	2315.56	1	4250.0%	2	K.DGNVLLHEMQIQHPTASIIAK.V
UQ99KI099.6%6771933.7%780854647.9(Q99KI0) Similar to mitochondrial aconitase (Nuclear aco2 gene)
	TK010303_lung_E18_mito_3_step02.1968.1968.2	3.9759	0.6414	2264.27	1	5000.0%	6	K.VAVPSTIHCDHLIEAQVGGEK.D
	TK010303_lung_E18_mito_3_step12.1408.1408.3	1.4054	0.0712	2813.9	2	1880.0%	1	K.EGWPLDIRVGLIGSCTNSSYEDMGR.S
*	TK010303_lung_E18_mito_3_step11.2607.2607.3	1.7596	0.1166	4582.15	28	1010.0%	1	R.VAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEK.D
	TK010303_lung_E18_mito_3_step01.1666.1666.1	1.3908	0.0756	1270.69	3	4500.0%	1	K.FNPETDFLTGK.D
*	TK010303_lung_E18_mito_3_step11.3312.3312.2	2.5388	0.3377	2342.58	1	2620.0%	4	R.VAMQDATAQMAMLQFISSGLPK.V
	TK010303_lung_E18_mito_3_step09.3560.3560.3	3.1065	0.3351	4561.37	1	1450.0%	6	K.GGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHR.M
	TK010303_lung_E18_mito_3_step03.3424.3424.2	1.4568	0.0871	2222.66	1	3000.0%	14	R.GHLDNISNNLLIGAINIENGK.A
	TK010303_lung_E18_mito_3_step11.1393.1393.1	1.2338	0.1727	1328.75	29	4000.0%	1	K.RLNRPLTLSEK.I
	TK010303_lung_E18_mito_3_step01.3428.3428.2	3.8026	0.6402	2784.57	1	3080.0%	19	R.NDANPETHAFVTSPEIVTALAIAGTLK.F
*	TK010303_lung_E18_mito_3_step02.2172.2172.1	2.0053	0.2201	1568.84	1	3750.0%	1	K.VAMSHFEPSEYIR.Y
	TK010303_lung_E18_mito_3_step01.2707.2707.1	1.7025	0.0093	1199.78	3	6110.0%	1	K.DLEDLQILIK.V
	TK010303_lung_E18_mito_3_step01.2483.2483.1	1.9393	0.1177	1589.73	1	5000.0%	1	R.LQLLEPFDKWDGK.D
	TK010303_lung_E18_mito_3_step10.4366.4366.2	1.4135	0.0612	2930.04	78	1520.0%	8	K.HPNGTQETILLNHTFNETQIEWFR.A
	TK010303_lung_E18_mito_3_step01.1066.1066.1	1.0356	0.0143	800.68	12	5710.0%	1	K.VAGILTVK.G
	TK010303_lung_E18_mito_3_step01.1640.1640.2	2.1582	0.2543	1503.68	1	6250.0%	1	K.FKLEAPDADELPR.S
UQ99KP699.6%51118.3%504552396.6(Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV)
	TK010303_lung_E18_mito_3_step04.3577.3577.2	1.3466	0.0424	2717.36	1	2170.0%	1	K.YIAENGTDPINNQPLSEEQLIDIK.V
	TK010303_lung_E18_mito_3_step10.2887.2887.2	3.0861	0.5069	2902.31	1	3330.0%	3	R.QVASHVGLHSASIPGILALDLCPSDTNK.I
	TK010303_lung_E18_mito_3_step07.3644.3644.3	2.2742	0.1669	4339.76	17	1030.0%	1	R.AHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK.V
UTBA1_HUMAN99.6%3125739.2%451501525.1(P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1)
	TK010303_lung_E18_mito_3_step03.2591.2591.2	1.6063	0.2255	2417.58	2	2000.0%	1	R.QLFHPEQLITGKEDAANNYAR.G
	TK010303_lung_E18_mito_3_step03.2708.2708.2	4.8937	0.6039	2754.03	1	4570.0%	2	K.AYHEQLSVAEITNACFEPANQMVK.C
	TK010303_lung_E18_mito_3_step01.2786.2786.2	1.4727	0.0871	2500.56	3	2170.0%	1	K.TIGGGDDSFNTFFSETGAGKHVPR.A
	TK010303_lung_E18_mito_3_step03.2913.2913.2	3.9219	0.591	1757.31	1	7330.0%	3	R.IHFPLATYAPVISAEK.A
	TK010303_lung_E18_mito_3_step01.2352.2352.1	1.8348	0.2384	1585.58	1	3750.0%	1	R.SIQFVDWCPTGFK.V
	TK010303_lung_E18_mito_3_step04.3307.3307.2	2.6609	0.3092	2411.71	1	3250.0%	3	R.FDGALNVDLTEFQTNLVPYPR.I
	TK010303_lung_E18_mito_3_step07.3472.3472.3	2.2889	0.2583	4302.21	5	1280.0%	14	R.ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDK.T
	TK010303_lung_E18_mito_3_step05.3169.3169.2	1.754	0.0785	2333.04	2	2630.0%	6	R.AFVHWYVGEGMEEGEFSEAR.E
ULMG2_MOUSE99.6%81213.4%11921302886.2(Q61092) Laminin gamma-2 chain precursor (Kalinin/nicein/epiligrin 100 kDa subunit) (Laminin B2t chain)
*	TK010303_lung_E18_mito_3_step11.2704.2704.3	2.2444	0.1696	3024.68	58	1400.0%	1	R.CDQCQPGFHMLTDAGCTRDQGQLDSK.C
*	TK010303_lung_E18_mito_3_step10.3754.3754.3	1.9203	0.1349	4447.52	7	1150.0%	1	R.ATYGEYSTGYIDNVTLVSARPVLGAPAPWVERCVCLLGYK.G
*	TK010303_lung_E18_mito_3_step11.1805.1805.3	1.7457	0.2229	2451.5	47	1770.0%	1	K.LLSGGGGSGSWDSSVVQGLMGKLEK.T
*	TK010303_lung_E18_mito_3_step03.2661.2661.3	1.6812	0.1844	3552.78	4	1610.0%	2	R.GDGSCVCKPGFGAFNCDHAALTSCPACYNQVK.I
*	TK010303_lung_E18_mito_3_step06.3779.3779.2	2.7208	0.4811	1989.12	1	4710.0%	2	R.NHLHLLETSIDGILADVK.N
	TK010303_lung_E18_mito_3_step09.2846.2846.2	3.4851	0.5424	2378.68	1	5000.0%	1	R.LNEHPSSHWSPQLSYFEYR.R
UQ91X7699.6%9659.5%390460348.3(Q91X76) Similar to hypothetical protein FLJ12442
	TK010303_lung_E18_mito_3_step02.4322.4322.2	1.7582	0.1987	2143.78	1	3820.0%	1	R.VLYFGDHLYSDLADLMLR.H
*	TK010303_lung_E18_mito_3_step03.3267.3267.2	3.7634	0.5452	2255.86	1	4720.0%	8	R.QLFDVVIVQADKPNFFTDR.R
UQ8VHY099.6%14306.7%23272524755.5(Q8VHY0) AN2/NG2 proteoglycan
*	TK010303_lung_E18_mito_3_step08.2506.2506.2	3.0766	0.4952	2526.24	1	3540.0%	3	R.AHLQGPTGTSVAGPQTSEAFVITVR.D
*	TK010303_lung_E18_mito_3_step11.2853.2853.2	1.5364	0.3685	2559.31	220	1520.0%	1	R.GALEGGFHFDLSDGAHTSPGHFFR.V
	TK010303_lung_E18_mito_3_step12.1921.1921.2	1.1295	0.056	2426.71	18	2140.0%	1	K.HDVQVLTAKPRNGLAGDTETFR.K
*	TK010303_lung_E18_mito_3_step09.2827.2827.2	4.0511	0.6126	2251.19	1	4470.0%	3	R.SGNEVHYHVTAGPQWGQLLR.D
*	TK010303_lung_E18_mito_3_step02.3830.3830.2	1.1502	0.0267	2908.07	18	1670.0%	1	R.DQPGEPATEFSCRELEVGDIVYVHR.G
*	TK010303_lung_E18_mito_3_step07.3873.3873.2	1.1473	0.0468	2472.16	8	1900.0%	1	R.ELEVGDIVYVHRGGPAQDLTFR.V
*	TK010303_lung_E18_mito_3_step01.0548.0548.1	1.5739	0.0042	1217.72	28	4500.0%	2	K.QALLSLEGTRK.L
*	TK010303_lung_E18_mito_3_step06.2730.2730.2	2.9593	0.4556	2190.91	1	4170.0%	2	K.SLNSASYLYEVMEQPHHGK.L
UQ8R06599.6%144039.3%239263427.9(Q8R065) Hypothetical 26.3 kDa protein
*	TK010303_lung_E18_mito_3_step09.2232.2232.2	1.4886	0.0045	1595.21	128	2920.0%	1	K.HVLNQDLTFQHIK.I
*	TK010303_lung_E18_mito_3_step04.1949.1949.2	1.6498	0.0963	1704.86	6	3570.0%	1	K.ITYPTAPSRPYTPLK.G
*	TK010303_lung_E18_mito_3_step12.1813.1813.2	4.0184	0.5396	1978.17	1	5830.0%	1	R.HSASLIFLHGSGHSGQGQR.E
*	TK010303_lung_E18_mito_3_step06.2615.2615.2	3.7102	0.5824	2208.52	1	4470.0%	4	K.SLGVSTTFHSLPNLNHELNK.T
*	TK010303_lung_E18_mito_3_step10.2442.2442.2	1.8664	0.2994	2811.98	1	2290.0%	1	K.SLGVSTTFHSLPNLNHELNKTELEK.L
*	TK010303_lung_E18_mito_3_step07.3334.3334.2	3.2358	0.5895	2526.78	1	3810.0%	4	R.MLPELFQCHGSADNLVLHAWGK.E
UTPP2_MOUSE99.6%578.0%12621398786.6(Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase)
*	TK010303_lung_E18_mito_3_step11.2656.2656.2	1.3416	0.0602	2525.82	4	1880.0%	1	K.GCALADHLLHTQPHDGAAAGDAEAK.E
*	TK010303_lung_E18_mito_3_step01.4344.4344.2	0.9472	0.0118	1805.91	13	3210.0%	1	K.IWDPIHRVALAEACR.K
*	TK010303_lung_E18_mito_3_step12.2987.2987.3	1.646	5.0E-4	4023.55	4	1380.0%	1	R.GTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVR.R
	TK010303_lung_E18_mito_3_step08.2694.2694.2	4.5332	0.7035	2562.54	1	5480.0%	2	K.VNESSHYDLAFTDVHFKPGQIR.R
UQ9CZN199.6%247.2%265292619.3(Q9CZN1) 9430083G14Rik protein (RIKEN cDNA 9430083G14 gene)
*	TK010303_lung_E18_mito_3_step11.2271.2271.2	2.858	0.539	2175.03	1	4440.0%	2	K.QLVRPDQLPIYTAPPLHSK.Y
UQ9DCU699.6%4109.9%294330739.8(Q9DCU6) 1110017G11Rik protein (Mitochondrial ribosomal protein L4) (L4mt)
	TK010303_lung_E18_mito_3_step07.3206.3206.2	4.5875	0.6041	2079.81	1	6470.0%	3	R.HWGSSVLLVDLTHEEMPK.N
	TK010303_lung_E18_mito_3_step06.2541.2541.1	1.2981	0.0372	1342.61	2	4500.0%	1	R.RPVQAWVESLR.G
UHMG1_MOUSE99.6%72713.6%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30)
	TK010303_lung_E18_mito_3_step05.1981.1981.1	2.7927	0.4518	1523.72	1	5000.0%	5	K.IKGEHPGLSIGDVAK.K
	TK010303_lung_E18_mito_3_step05.2053.2053.1	2.835	0.2073	1592.68	1	6150.0%	1	K.KHPDASVNFSEFSK.K
UQ9DCJ599.6%4625.6%172199928.5(Q9DCJ5) 0610033L03Rik protein (RIKEN cDNA 0610033L03 gene)
*	TK010303_lung_E18_mito_3_step05.1838.1838.2	4.0022	0.6007	1831.84	1	5620.0%	2	R.ARPEPNPVIEGDLKPAK.H
*	TK010303_lung_E18_mito_3_step08.3160.3160.2	1.2609	0.0526	2283.51	2	3000.0%	1	R.ARPEPNPVIEGDLKPAKHGTR.F
*	TK010303_lung_E18_mito_3_step02.2001.2001.3	1.7442	0.0605	2954.51	33	1590.0%	1	K.SHCAEPFTEYWTCLDYSNMQLFR.H
USPRC_MOUSE99.6%82219.2%302344504.9(P07214) SPARC precursor (Secreted protein acidic and rich in cysteine) (Osteonectin) (ON) (Basement membrane protein BM-40)
	TK010303_lung_E18_mito_3_step11.4036.4036.3	1.9838	0.0687	4105.09	13	1210.0%	4	K.NYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLR.A
	TK010303_lung_E18_mito_3_step04.2229.2229.2	2.8399	0.3481	1575.86	1	6150.0%	1	K.RLEAGDHPVELLAR.D
	TK010303_lung_E18_mito_3_step02.1949.1949.1	2.241	0.3939	1216.6	1	7220.0%	1	K.LHLDYIGPCK.Y
UFRDA_MOUSE99.6%73726.6%207229248.0(O35943) Frataxin, mitochondrial precursor (Fxn)
*	TK010303_lung_E18_mito_3_step10.3930.3930.3	2.4036	0.2751	4274.38	2	1350.0%	1	R.LAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIK.L
*	TK010303_lung_E18_mito_3_step07.2973.2973.2	4.6328	0.6079	1999.72	1	6250.0%	6	K.NWVYSHDGVSLHELLAR.E
UQ9DA6199.6%115.9%357407298.8(Q9DA61) 2300004O14Rik protein
*	TK010303_lung_E18_mito_3_step09.2618.2618.2	4.3867	0.6089	2630.82	1	4750.0%	1	R.AAPIHEQTLYKEEPCYIFHQR.C
UQ9D00999.6%116.5%231249258.6(Q9D009) 2610209A20Rik protein
	TK010303_lung_E18_mito_3_step11.2900.2900.2	4.1829	0.5615	1897.13	1	6790.0%	1	R.VHYSELLALQEHWLR.R
UHCD2_MOUSE99.6%5731.8%261274198.4(O08756) 3-hydroxyacyl-CoA dehydrogenase type II (EC 1.1.1.35) (Type II HADH) (Endoplasmic reticulum-associated amyloid beta-peptide binding protein)
	TK010303_lung_E18_mito_3_step03.4215.4215.2	1.3246	0.2674	2441.73	74	1670.0%	2	R.GVIINTASVAAFEGQVGQAAYSASK.G
*	TK010303_lung_E18_mito_3_step01.4266.4266.2	2.5205	0.4102	2910.28	1	3000.0%	1	R.LGDPAEYAHLVQTIIENPFLNGEVIR.L
*	TK010303_lung_E18_mito_3_step01.3122.3122.2	3.1631	0.553	2081.91	1	5530.0%	1	R.VVTIAPGLFATPLLTTLPEK.V
*	TK010303_lung_E18_mito_3_step01.1863.1863.1	1.3713	0.0309	1364.75	2	5000.0%	1	R.NFLASQVPFPSR.L
USODM_MOUSE99.6%5721.6%222246038.6(P09671) Superoxide dismutase [Mn], mitochondrial precursor (EC 1.15.1.1)
*	TK010303_lung_E18_mito_3_step01.1260.1260.1	1.699	0.1364	1440.89	3	3850.0%	1	K.GDVTTQVALQPALK.F
*	TK010303_lung_E18_mito_3_step07.1560.1560.2	4.1275	0.5445	1711.16	1	8210.0%	1	K.HHAAYVNNLNATEEK.Y
*	TK010303_lung_E18_mito_3_step10.2565.2565.2	3.9492	0.3623	2141.77	1	4720.0%	2	K.FNGGGHINHTIFWTNLSPK.G
*	TK010303_lung_E18_mito_3_step09.2282.2282.3	1.6437	0.159	3565.56	1	1880.0%	1	K.GDVTTQVALQPALKFNGGGHINHTIFWTNLSPK.G
UDYSF_MOUSE99.6%668.1%20832371275.8(Q9ESD7) Dysferlin (Dystrophy associated fer-1 like protein) (Fer-1 like protein 1)
*	TK010303_lung_E18_mito_3_step11.3608.3608.3	2.391	0.2044	4277.81	14	1320.0%	1	K.GNSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLR.T
	TK010303_lung_E18_mito_3_step12.2505.2505.3	3.5091	0.3624	3721.09	1	1880.0%	1	R.LALHVLQQQGLVPEHVESRPLYSPLQPDIEQGK.L
*	TK010303_lung_E18_mito_3_step03.4169.4169.2	1.1984	0.0739	3038.53	74	1250.0%	1	K.EPLIPVQEEEFIDWWSKFFASVGER.E
	TK010303_lung_E18_mito_3_step09.4548.4548.3	1.1849	0.0739	3861.02	54	1210.0%	1	R.AVFDGCHYYYLPWGNVKPVVVLSSYWEDISHR.I
*	TK010303_lung_E18_mito_3_step12.2687.2687.2	1.2698	0.0335	2142.1	1	2780.0%	1	R.TQEETDDPSVIGEFKGLFK.I
*	TK010303_lung_E18_mito_3_step04.3823.3823.2	1.5211	0.0473	2426.69	58	1900.0%	1	K.DPSEDKEDIEGNLLRPTGVALR.G
UPCD8_MOUSE99.6%6813.6%612667669.2(Q9Z0X1) Programmed cell death protein 8, mitochondrial precursor (EC 1.-.-.-) (Apoptosis-inducing factor)
	TK010303_lung_E18_mito_3_step12.0963.0963.2	1.103	0.1247	1499.98	2	4580.0%	1	R.RVEHHDHAVVSGR.L
*	TK010303_lung_E18_mito_3_step03.2793.2793.2	2.3361	0.3429	1776.41	1	5000.0%	1	R.KSQASGIEVIQLFPEK.G
*	TK010303_lung_E18_mito_3_step03.2504.2504.2	3.9302	0.5172	2263.68	1	4500.0%	2	R.KVETDHIVTAVGLEPNVELAK.T
*	TK010303_lung_E18_mito_3_step07.3078.3078.3	1.7789	0.0234	3428.66	34	1410.0%	1	R.SESETESEASEITIPPSAPAVPQVPVEGEDYGK.G
UATPA_MOUSE99.6%74142237.8%553597539.2(Q03265) ATP synthase alpha chain, mitochondrial precursor (EC 3.6.3.14)
*	TK010303_lung_E18_mito_3_step11.3036.3036.2	5.2439	0.6497	2414.57	1	6000.0%	33	K.FENAFLSHVISQHQSLLGNIR.S
	TK010303_lung_E18_mito_3_step04.2223.2223.2	2.0242	0.392	1442.48	1	5380.0%	3	K.GIRPAINVGLSVSR.V
*	TK010303_lung_E18_mito_3_step01.3571.3571.1	1.9127	0.1527	1338.74	2	5000.0%	1	K.EIVTNFLAGFEP.-
	TK010303_lung_E18_mito_3_step05.2357.2357.3	1.5398	0.0378	2888.53	43	1500.0%	1	K.QGQYSPMAIEEQVAVIYAGVRGYLDK.L
	TK010303_lung_E18_mito_3_step01.0342.0342.1	1.3883	0.0409	716.54	2	8000.0%	1	R.LTELLK.Q
	TK010303_lung_E18_mito_3_step02.3754.3754.2	5.9255	0.6953	2341.87	1	6430.0%	4	R.EVAAFAQFGSDLDAATQQLLSR.G
	TK010303_lung_E18_mito_3_step04.2557.2557.2	2.3907	0.4526	1330.34	1	6000.0%	1	K.LYCIYVAIGQK.R
	TK010303_lung_E18_mito_3_step10.3939.3939.3	1.7862	0.0513	3805.97	3	1400.0%	1	K.YTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGK.H
	TK010303_lung_E18_mito_3_step01.2699.2699.1	1.7109	0.1252	1320.26	5	5000.0%	5	K.TSIAIDTIINQK.R
	TK010303_lung_E18_mito_3_step01.1188.1188.1	1.4285	0.0188	1173.54	1	5000.0%	1	R.VVDALGNAIDGK.G
*	TK010303_lung_E18_mito_3_step06.1903.1903.2	1.4607	0.0848	1631.94	2	4060.0%	1	R.AGLVSKNALGSSFVGAR.N
	TK010303_lung_E18_mito_3_step06.3439.3439.2	3.4826	0.5456	2313.0	1	4750.0%	16	K.QGQYSPMAIEEQVAVIYAGVR.G
	TK010303_lung_E18_mito_3_step01.1392.1392.1	1.5466	0.1839	1028.68	10	5000.0%	2	K.AVDSLVPIGR.G
	TK010303_lung_E18_mito_3_step02.2212.2212.1	2.9788	0.4152	1289.66	1	7000.0%	4	K.HALIIYDDLSK.Q
UIF2A_HUMAN99.6%396.4%314359815.1(P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A)
*	TK010303_lung_E18_mito_3_step07.3006.3006.2	2.0151	0.1128	2438.58	1	3420.0%	3	R.HVAEVLEYTKDEQLESLFQR.T
UQ99JY099.6%82220.6%475513869.4(Q99JY0) Similar to hydroxyacyl-coenzyme A dehydrogenase/3-ketoacyl-coenzyme A thiolase/enoyl-coenzyme A hydratase (Trifunctional protein), beta subunit
*	TK010303_lung_E18_mito_3_step06.3393.3393.3	1.6147	0.0249	4563.27	16	1090.0%	1	K.AGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGR.K
*	TK010303_lung_E18_mito_3_step04.3241.3241.2	4.3989	0.2162	2136.41	1	4740.0%	4	K.FNIWGGSLSLGHPFGATGCR.L
*	TK010303_lung_E18_mito_3_step12.2831.2831.2	1.3049	0.0674	2782.12	7	1880.0%	1	K.WALRSSIRPLSCSSQLHSAPAVQTK.S
	TK010303_lung_E18_mito_3_step01.1410.1410.1	2.0396	0.2565	1418.64	1	4580.0%	2	K.DQLLLGPTYATPK.V
UMUTA_MOUSE99.6%92113.2%748829657.1(P16332) Methylmalonyl-CoA mutase, mitochondrial precursor (EC 5.4.99.2) (MCM)
*	TK010303_lung_E18_mito_3_step02.2932.2932.2	3.7563	0.5994	2466.58	1	4500.0%	1	K.NPEDLIWHTPEGISIKPLYSR.A
	TK010303_lung_E18_mito_3_step04.4225.4225.2	3.2546	0.3428	2453.49	1	3860.0%	4	K.VIATGFADLGFDVDIGPLFQTPR.E
*	TK010303_lung_E18_mito_3_step02.2417.2417.3	1.7926	0.0843	3476.75	6	1740.0%	1	R.TAIEAMAAVFGGTQSLHSNSFDEALGLPTVKSAR.I
	TK010303_lung_E18_mito_3_step12.1996.1996.1	1.6319	0.0387	1166.64	38	5000.0%	1	R.RLWAHLIEK.M
	TK010303_lung_E18_mito_3_step01.2163.2163.1	1.4401	0.086	1145.78	21	5000.0%	1	K.ILFDGIPLEK.M
*	TK010303_lung_E18_mito_3_step11.2725.2725.2	2.9803	0.3831	2650.95	1	2500.0%	1	K.GKNPEDLIWHTPEGISIKPLYSR.A
UCAO1_MOUSE99.6%5176.2%661746608.6(Q9R0H0) Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (Palmitoyl-CoA oxidase) (AOX)
	TK010303_lung_E18_mito_3_step07.2378.2378.2	2.8348	0.3264	1930.8	1	4170.0%	4	R.EIGTHKPLPGITVGDIGPK.F
*	TK010303_lung_E18_mito_3_step02.4224.4224.2	0.9606	0.1168	2352.85	25	1900.0%	1	R.AAATFNPELITHVLDGSPENTR.R
UO8865399.6%82644.4%124135537.3(O88653) MEK binding partner 1 (Mitogen-activated protein kinase kinase 1 interacting protein 1)
*	TK010303_lung_E18_mito_3_step05.3069.3069.2	2.6536	0.5074	2902.02	1	2960.0%	3	K.VANDSAPEHALRPGFLSTFALATDQGSK.L
	TK010303_lung_E18_mito_3_step11.2224.2224.2	2.269	0.3352	1721.03	1	4000.0%	4	K.KLPSVEGLHAIVVSDR.D
*	TK010303_lung_E18_mito_3_step01.3052.3052.1	2.0919	0.1446	1302.73	1	6000.0%	1	K.ELAPLFEELIK.V
UFUMH_MOUSE99.6%3834236.3%507543719.0(P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3)
	TK010303_lung_E18_mito_3_step11.4328.4328.2	1.9377	0.2546	2471.07	1	2750.0%	17	K.ETAIELGYLTAEQFDEWVKPK.D
*	TK010303_lung_E18_mito_3_step04.2729.2729.2	2.8937	0.5529	2342.56	1	4050.0%	5	K.SQSSNDTFPTAMHIAAAVEVHK.V
*	TK010303_lung_E18_mito_3_step01.1406.1406.1	1.4536	0.2611	867.74	1	6430.0%	1	K.VLLPGLQK.L
	TK010303_lung_E18_mito_3_step08.2889.2889.2	1.6526	0.1309	2613.77	45	1820.0%	1	R.INKLMNESLMLVTALNPHIGYDK.A
	TK010303_lung_E18_mito_3_step02.3214.3214.2	3.2594	0.6408	2259.29	1	4210.0%	1	K.LMNESLMLVTALNPHIGYDK.A
	TK010303_lung_E18_mito_3_step07.3005.3005.3	1.9516	0.0166	4456.8	7	1190.0%	1	K.LNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSK.K
	TK010303_lung_E18_mito_3_step01.1534.1534.1	2.2468	0.3634	1204.65	1	5450.0%	1	R.AIEMLGGELGSK.K
	TK010303_lung_E18_mito_3_step01.2060.2060.1	1.7613	0.2249	1499.77	1	3570.0%	1	K.VAALTGLPFVTAPNK.F
*	TK010303_lung_E18_mito_3_step01.0770.0770.1	2.0343	0.3415	854.62	1	7860.0%	1	K.LHDALSAK.S
	TK010303_lung_E18_mito_3_step03.2947.2947.2	1.2369	0.0325	2842.88	108	1480.0%	1	R.FLGSGPRSGLGELILPENEPGSSIMPGK.V
	TK010303_lung_E18_mito_3_step04.3106.3106.3	4.3443	0.5495	3272.99	1	2770.0%	3	K.LNDHFPLVVWQTGSGTQTNMNVNEVISNR.A
*	TK010303_lung_E18_mito_3_step01.0282.0282.1	1.3249	0.0418	834.49	11	7500.0%	1	K.EFAQVIK.I
*	TK010303_lung_E18_mito_3_step11.0997.0997.1	2.67	0.3391	1286.73	1	6500.0%	3	K.KPVHPNDHVNK.S
UTCPZ_MOUSE99.6%71713.2%531580047.1(P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1)
*	TK010303_lung_E18_mito_3_step07.3877.3877.2	4.1767	0.3921	2237.01	1	5500.0%	3	K.VHAELADVLTEAVVDSILAIR.K
*	TK010303_lung_E18_mito_3_step03.3656.3656.2	1.486	0.1257	2751.54	24	1670.0%	2	R.AVKNAIDDGCVVPGAGAVEVALAEALIK.Y
	TK010303_lung_E18_mito_3_step02.2598.2598.2	3.3237	0.4782	2315.56	1	4250.0%	2	K.DGNVLLHEMQIQHPTASLIAK.V
UTBBX_HUMAN99.6%147815.5%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain
	TK010303_lung_E18_mito_3_step02.3349.3349.2	5.7553	0.6488	1959.91	1	7350.0%	5	K.GHYTEGAELVDSVLDVVR.K
	TK010303_lung_E18_mito_3_step02.3224.3224.2	2.5397	0.4474	2803.0	1	3000.0%	7	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK010303_lung_E18_mito_3_step03.3503.3503.2	2.058	0.3545	2712.25	1	2290.0%	2	K.LTTPTYGDLNHLVSATMSGVTTCLR.F
UQ99K8699.6%92322.5%650708586.5(Q99K86) Lutheran blood group (Auberger b antigen included)
	TK010303_lung_E18_mito_3_step09.3563.3563.2	2.944	0.4613	2256.81	1	4720.0%	2	R.EHPEHYVLEWFLVDGTGAR.H
	TK010303_lung_E18_mito_3_step09.3991.3991.3	1.9085	0.0488	4530.89	4	1310.0%	1	K.LHVAYLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTVR.W
	TK010303_lung_E18_mito_3_step10.4182.4182.2	1.4903	0.0099	2930.42	28	1880.0%	4	R.LTLHYPTEHVEFWVGSPSTTEGWVR.E
	TK010303_lung_E18_mito_3_step12.2787.2787.3	1.5073	0.1484	4405.82	17	1220.0%	1	K.GHVFHFGSVAPQTAQAGVAVMAVAVSVGLLLLVVAAFYCMRR.K
	TK010303_lung_E18_mito_3_step06.1727.1727.2	4.4798	0.5446	2155.75	1	6110.0%	1	R.DANFHCAAHYDLPSGQHGR.L
UQ91Y3799.6%115.5%623695665.6(Q91Y37) Cytosolic aminopeptidase P
	TK010303_lung_E18_mito_3_step11.3119.3119.3	6.1325	0.5974	3633.38	1	2580.0%	1	R.SALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYK.T
UGTFI_MOUSE99.6%5510.1%9981123806.4(Q9ESZ8) General transcription factor II-I (GTFII-I) (TFII-I) (Bruton tyrosine kinase-associated protein-135) (BTK-associated protein-135) (BAP-135)
	TK010303_lung_E18_mito_3_step06.1773.1773.1	1.4255	0.0672	1086.51	7	5710.0%	1	K.YCVEEEEK.A
	TK010303_lung_E18_mito_3_step03.3129.3129.3	1.4533	0.0189	3473.61	33	1250.0%	1	K.AKGPVTIPYPLFQSHVEDLYVEGLPEGIPFR.R
	TK010303_lung_E18_mito_3_step06.3158.3158.3	1.5233	0.1384	3895.86	1	1470.0%	1	-.MAQVVMSALPAEDEESSESRMVVTFLMSALESMCK.E
	TK010303_lung_E18_mito_3_step07.1845.1845.2	3.3542	0.472	1865.49	1	4670.0%	1	K.RPELLTHSTTEVTQPR.T
	TK010303_lung_E18_mito_3_step05.1925.1925.1	1.6682	0.2146	1324.06	2	5000.0%	1	K.HPEHYDLATLK.W
UQ9JKR699.6%5647625.0%9991111815.2(Q9JKR6) 170 kDa glucose regulated protein GRP170 precursor
*	TK010303_lung_E18_mito_3_step04.2210.2210.2	1.8155	0.0701	1725.16	4	4230.0%	4	R.SRFPEHELIVDPQR.Q
*	TK010303_lung_E18_mito_3_step12.3696.3696.3	2.4456	0.2028	4763.45	1	1250.0%	2	R.VEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGATR.V
*	TK010303_lung_E18_mito_3_step01.1476.1476.1	1.3404	0.0277	1180.66	1	5910.0%	1	R.FLGDSAAGMAIK.N
*	TK010303_lung_E18_mito_3_step01.3362.3362.2	3.4219	0.5206	3008.58	1	2690.0%	1	R.SLAEDFAEQPIKDAVITVPAFFNQAER.R
*	TK010303_lung_E18_mito_3_step03.3948.3948.2	2.3005	0.3086	2670.02	2	2390.0%	17	K.MVEEIGVELAVLDLPDLPEDELAR.S
*	TK010303_lung_E18_mito_3_step01.3260.3260.1	1.5392	0.1891	1539.22	1	4580.0%	4	R.DAVIYPILVEFTR.E
	TK010303_lung_E18_mito_3_step02.3308.3308.2	3.9859	0.5673	2728.49	1	4550.0%	5	R.YSHDFNFHINYGDLGFLGPEDLR.V
	TK010303_lung_E18_mito_3_step04.2745.2745.2	3.4748	0.3116	1707.21	1	6330.0%	3	K.VAIVKPGVPMEIVLNK.E
	TK010303_lung_E18_mito_3_step01.2872.2872.2	3.5361	0.475	2522.69	1	4320.0%	2	K.TVLSANADHMAQIEGLMDDVDFK.A
*	TK010303_lung_E18_mito_3_step07.3808.3808.3	6.7761	0.685	4024.84	1	3000.0%	2	K.AHFNLDESGVLSLDRVESVFETLVEDSPEEESTLTK.L
*	TK010303_lung_E18_mito_3_step02.3637.3637.2	4.1796	0.5809	2256.32	1	6670.0%	9	R.LIPEMDQVFTEVEMTTLEK.V
*	TK010303_lung_E18_mito_3_step12.3655.3655.2	3.7105	0.0238	3137.21	2	3280.0%	5	R.VPGPVQQALQSAEMSLDQIEQVILVGGATR.V
URS23_HUMAN99.6%102034.3%1431580810.5(P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23
	TK010303_lung_E18_mito_3_step09.1848.1848.1	2.4037	0.3476	1207.41	1	6360.0%	3	R.KGHAVGDIPGVR.F
	TK010303_lung_E18_mito_3_step09.4015.4015.2	1.3873	0.133	3127.79	18	1480.0%	1	K.KITAFVPNDGCLNFIEENDEVLVAGFGR.K
	TK010303_lung_E18_mito_3_step01.0840.0840.1	1.6813	0.1401	812.55	3	5710.0%	2	K.AHLGTALK.A
	TK010303_lung_E18_mito_3_step11.1103.1103.1	2.0823	0.3631	938.62	1	6880.0%	1	K.KAHLGTALK.A
	TK010303_lung_E18_mito_3_step07.3621.3621.2	1.8266	0.2108	3001.11	6	1730.0%	2	K.ITAFVPNDGCLNFIEENDEVLVAGFGR.K
UCACP_MOUSE99.6%352.2%627708358.2(P47934) Carnitine O-acetyltransferase (EC 2.3.1.7) (Carnitine acetylase) (CAT)
*	TK010303_lung_E18_mito_3_step08.1493.1493.1	2.7217	0.4401	1393.78	1	5000.0%	2	R.NHVAGQMLHGGGSK.F
UQ922R899.6%4617.5%440481005.1(Q922R8) Similar to protein disulfide isomerase-related protein
*	TK010303_lung_E18_mito_3_step05.3689.3689.3	2.2128	0.2082	4081.0	1	1600.0%	1	-.MARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNR.E
	TK010303_lung_E18_mito_3_step01.2002.2002.1	2.1165	0.4419	1529.76	1	4640.0%	2	K.LAAVDATVNQVLASR.Y
*	TK010303_lung_E18_mito_3_step02.3234.3234.2	3.3374	0.5153	2831.89	1	3960.0%	1	K.DGELPVEDDIDLSDVELDDLEKDEL.-
UADRO_MOUSE99.6%51114.8%494542028.7(Q61578) NADPH:adrenodoxin oxidoreductase, mitochondrial precursor (EC 1.18.1.2) (Adrenodoxin reductase) (AR) (Ferredoxin-NADP(+) reductase)
	TK010303_lung_E18_mito_3_step04.2845.2845.2	2.4018	0.2842	2345.94	1	2860.0%	3	K.TPQICVVGSGPAGFYTAQHLLK.H
*	TK010303_lung_E18_mito_3_step05.4302.4302.2	1.193	0.0716	2852.03	35	1670.0%	1	R.EMIQLPGTRPILDPSDFLGLQDRIK.D
*	TK010303_lung_E18_mito_3_step10.3670.3670.2	3.06	0.4854	2797.28	1	3000.0%	1	K.RGPTGVITTTMTDSFLTSQALLEDLK.A
URL6_MOUSE99.6%61810.5%2873261210.8(P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107)
*	TK010303_lung_E18_mito_3_step08.3570.3570.2	3.748	0.4073	1529.19	1	6790.0%	4	R.SSITPGTVLIILTGR.H
*	TK010303_lung_E18_mito_3_step01.1572.1572.1	1.2716	0.0383	998.77	2	5620.0%	1	K.AVDLQILPK.I
	TK010303_lung_E18_mito_3_step01.0891.0891.1	1.3847	0.1098	697.56	4	6000.0%	1	R.NPVLVR.G
UAATM_MOUSE99.6%4023843.3%430474119.0(P05202) Aspartate aminotransferase, mitochondrial precursor (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-2)
*	TK010303_lung_E18_mito_3_step11.2584.2584.2	2.0641	0.1852	2013.01	1	3750.0%	1	R.DVFLPKPSWGNHTPIFR.D
	TK010303_lung_E18_mito_3_step12.2215.2215.2	1.8942	0.3075	3093.45	1	2120.0%	1	K.IPEQSVLLLHACAHNPTGVDPRPEQWK.E
*	TK010303_lung_E18_mito_3_step01.1044.1044.1	1.3845	0.1438	981.52	1	6880.0%	2	R.VGAFTVVCK.D
*	TK010303_lung_E18_mito_3_step09.3326.3326.3	5.0868	0.6386	3436.27	1	2590.0%	8	K.EGSSHNWQHITDQIGMFCFTGLKPEQVER.L
*	TK010303_lung_E18_mito_3_step10.2793.2793.2	4.9986	0.6235	2326.2	1	5450.0%	8	R.ISVAGVTSGNVGYLAHAIHQVTK.-
	TK010303_lung_E18_mito_3_step09.4415.4415.2	2.5496	0.3218	2203.46	1	4210.0%	2	K.NLFAFFDMAYQGFASGDGDK.D
	TK010303_lung_E18_mito_3_step05.2661.2661.2	1.6961	0.295	2070.11	1	3440.0%	9	R.HFIEQGINVCLCQSYAK.N
	TK010303_lung_E18_mito_3_step01.2383.2383.1	1.1703	0.1321	1499.47	16	3330.0%	3	K.EYLPIGGLAEFCK.A
*	TK010303_lung_E18_mito_3_step11.3876.3876.3	2.6497	0.0698	4723.05	2	1280.0%	2	K.TCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWK.E
*	TK010303_lung_E18_mito_3_step10.2263.2263.2	3.2007	0.3877	1794.42	1	5000.0%	2	K.ILIRPLYSNPPLNGAR.I
UACDS_HUMAN99.6%3516.0%412442978.0(P16219) Acyl-CoA dehydrogenase, short-chain specific, mitochondrial precursor (EC 1.3.99.2) (SCAD) (Butyryl-CoA dehydrogenase)
*	TK010303_lung_E18_mito_3_step07.2737.2737.3	1.6421	0.0653	3655.08	5	1400.0%	1	K.KMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISR.G
*	TK010303_lung_E18_mito_3_step04.3817.3817.2	4.5591	0.6185	3189.22	1	3330.0%	2	K.LAASEAATAISHQAIQILGGMGYVTEMPAER.H
UQ1470099.6%468.1%9051019517.5(Q14700) Hypothetical protein KIAA0090 (Fragment)
	TK010303_lung_E18_mito_3_step12.1831.1831.2	2.2642	0.3048	1848.14	1	4330.0%	1	R.TTAHFPHPPQCTLLVK.D
*	TK010303_lung_E18_mito_3_step05.3608.3608.2	4.0282	0.5071	2100.92	1	6180.0%	2	K.RPILQSLLLPVMDQDYAK.V
	TK010303_lung_E18_mito_3_step05.2428.2428.3	1.9215	0.1458	4266.49	1	1580.0%	1	R.SWETNIGGLNWEITLDSGSFQALGLVGLQESVRYIAVLK.K
U2AAA_HUMAN99.6%6266.8%588650925.1(P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein)
	TK010303_lung_E18_mito_3_step10.2318.2318.2	3.5367	0.5702	2217.03	1	4210.0%	5	R.AISHEHSPSDLEAHFVPLVK.R
	TK010303_lung_E18_mito_3_step10.2079.2079.3	1.573	0.1111	2195.86	36	2240.0%	1	K.IGPILDNSTLQSEVKPILEK.L
UQ9DC6999.6%122820.4%377425099.7(Q9DC69) 1010001N11Rik protein
	TK010303_lung_E18_mito_3_step09.2407.2407.2	1.344	0.064	1164.66	224	3890.0%	1	R.MGSQVIIPYR.C
*	TK010303_lung_E18_mito_3_step11.1761.1761.1	3.3785	0.5363	1386.5	1	6360.0%	2	R.FIHVSHLNASMK.S
*	TK010303_lung_E18_mito_3_step12.1572.1572.2	1.1572	0.0444	2222.23	211	1670.0%	1	K.AVQHSNVVINLIGREWETR.N
*	TK010303_lung_E18_mito_3_step05.2130.2130.1	2.0006	0.2261	1183.4	1	6250.0%	4	R.FLNHFANYR.W
*	TK010303_lung_E18_mito_3_step11.2904.2904.2	1.1894	0.0145	2751.07	13	1730.0%	1	R.SSVSGVVATVFGATGFLGRYVVNHLGR.M
*	TK010303_lung_E18_mito_3_step03.2505.2505.2	2.8571	0.3796	1523.02	1	6150.0%	1	K.AVQHSNVVINLIGR.E
UQ91WK299.6%6824.7%352398326.7(Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD)
	TK010303_lung_E18_mito_3_step07.2420.2420.2	3.1742	0.4388	2077.39	1	4210.0%	2	K.SAVADKHELLSLASSNHLGK.S
*	TK010303_lung_E18_mito_3_step05.2034.2034.2	1.0535	0.0615	2466.32	143	1900.0%	1	K.HELLSLASSNHLGKSLQLLMDR.V
*	TK010303_lung_E18_mito_3_step07.3240.3240.3	1.7792	0.0904	3227.63	1	2040.0%	1	K.LFKPHQAPARMDSLLIAGQINTYCQNIK.E
	TK010303_lung_E18_mito_3_step04.2230.2230.1	1.9126	0.1883	1505.77	1	3850.0%	1	K.HELLSLASSNHLGK.S
*	TK010303_lung_E18_mito_3_step10.3635.3635.3	2.5457	0.2603	3701.63	54	1330.0%	1	K.ASITFEHMFEEVPIVIKNSHLINVLMWELEK.K
UENPL_MOUSE99.6%136213044.6%802924764.8(P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96)
	TK010303_lung_E18_mito_3_step01.2924.2924.1	1.6994	0.1026	1547.44	79	2860.0%	1	R.GNTLGRGTTITLVLK.E
	TK010303_lung_E18_mito_3_step02.2382.2382.2	1.7995	0.2436	2358.54	67	2250.0%	1	R.LTESPCALVASQYGWSGNMER.I
	TK010303_lung_E18_mito_3_step01.1576.1576.1	2.5074	0.3333	1516.65	1	5770.0%	4	K.NLLHVTDTGVGMTR.E
	TK010303_lung_E18_mito_3_step01.4140.4140.2	1.8522	0.3157	2953.2	1	2920.0%	2	K.GYEVIYLTEPVDEYCIQALPEFDGK.R
	TK010303_lung_E18_mito_3_step01.2331.2331.1	1.7548	0.2799	1599.65	4	3750.0%	2	R.VFITDDFHDMMPK.Y
*	TK010303_lung_E18_mito_3_step09.3896.3896.2	1.8382	0.1896	2510.63	2	2620.0%	1	K.EDEDDKTVMDLAVVLFETATLR.S
	TK010303_lung_E18_mito_3_step04.4254.4254.2	3.233	0.5214	2291.36	1	3420.0%	27	K.ESDDPMAYIHFTAEGEVTFK.S
	TK010303_lung_E18_mito_3_step03.2776.2776.2	3.1149	0.4047	1754.13	1	5770.0%	2	R.RVFITDDFHDMMPK.Y
	TK010303_lung_E18_mito_3_step01.0003.0003.1	1.2452	0.1886	646.4	1	8000.0%	1	K.VIVTSK.H
*	TK010303_lung_E18_mito_3_step02.2080.2080.2	4.6864	0.6236	2254.21	1	5830.0%	18	R.FQSSHHSTDITSLDQYVER.M
	TK010303_lung_E18_mito_3_step12.3023.3023.2	3.519	0.5079	2007.57	1	6670.0%	1	R.KYSQFINFPIYVWSSK.T
	TK010303_lung_E18_mito_3_step01.1142.1142.1	1.321	0.0637	783.6	2	8000.0%	1	K.YLNFVK.G
	TK010303_lung_E18_mito_3_step08.4070.4070.2	4.5141	0.6016	2456.07	1	5240.0%	16	R.GTTITLVLKEEASDYLELDTIK.N
*	TK010303_lung_E18_mito_3_step10.4090.4090.2	3.4892	0.4943	1780.44	1	6670.0%	6	K.TVMDLAVVLFETATLR.S
	TK010303_lung_E18_mito_3_step01.1690.1690.1	1.5627	0.0502	1187.71	4	5000.0%	1	K.SILFVPTSAPR.G
	TK010303_lung_E18_mito_3_step04.2611.2611.2	2.7055	0.3675	2115.7	1	3890.0%	1	K.NLLHVTDTGVGMTREELVK.N
	TK010303_lung_E18_mito_3_step04.3238.3238.2	3.6749	0.6175	3081.11	1	3600.0%	17	K.KGYEVIYLTEPVDEYCIQALPEFDGK.R
	TK010303_lung_E18_mito_3_step04.4306.4306.3	1.7006	0.1151	3328.71	22	1580.0%	1	K.MTEAQEDGQSTSELIGQFGVGFYSAFLVADK.V
	TK010303_lung_E18_mito_3_step01.0203.0203.1	1.5213	0.2485	878.61	1	8330.0%	2	K.TFEINPR.H
*	TK010303_lung_E18_mito_3_step03.4093.4093.2	2.3552	0.3496	2031.54	1	3330.0%	2	R.LISLTDENALAGNEELTVK.I
	TK010303_lung_E18_mito_3_step10.3857.3857.2	1.758	0.0178	2731.13	7	2170.0%	1	R.TDDEVVQREEEAIQLDGLNASQIR.E
	TK010303_lung_E18_mito_3_step01.1551.1551.1	1.8176	0.3464	1487.78	2	4230.0%	2	K.GVVDSDDLPLNVSR.E
	TK010303_lung_E18_mito_3_step07.3568.3568.2	2.7443	0.4831	2546.46	1	3160.0%	21	K.TVWDWELMNDIKPIWQRPSK.E
	TK010303_lung_E18_mito_3_step01.1072.1072.1	1.5458	0.0253	993.42	3	6250.0%	1	R.SGYLLPDTK.A
	TK010303_lung_E18_mito_3_step01.1215.1215.1	1.4604	0.221	973.59	4	6670.0%	1	K.YNDTFWK.E
	TK010303_lung_E18_mito_3_step01.2820.2820.1	1.7258	0.0714	1309.65	1	5560.0%	1	K.EFEPLLNWMK.D
	TK010303_lung_E18_mito_3_step02.3041.3041.3	1.4781	0.0035	4293.43	56	1030.0%	1	K.SGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADK.V
UCLP1_MOUSE99.6%2218.5%297333569.0(Q08091) Calponin H1, smooth muscle (Basic calponin) (Calponin 1)
	TK010303_lung_E18_mito_3_step02.4140.4140.3	1.7754	0.0945	3904.43	3	1320.0%	1	K.YGVKPHDIFEANDLFENTNHTQVQSTLLALASMAK.T
*	TK010303_lung_E18_mito_3_step05.2936.2936.2	3.5237	0.539	2400.04	1	4470.0%	1	K.KVNESTQNWHQLENIGNFIK.A
UQ8R1V499.6%248.8%227260228.2(Q8R1V4) Similar to RIKEN cDNA 2400003B06 gene
*	TK010303_lung_E18_mito_3_step03.2347.2347.2	4.8249	0.4352	2219.78	1	5530.0%	2	R.VHLDIQVGEHANNYPEIAAK.D
UCAZ2_MOUSE99.6%3327.3%286329675.8(P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2)
	TK010303_lung_E18_mito_3_step07.2889.2889.3	1.6154	0.0121	3762.25	2	1560.0%	1	K.IQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAK.E
	TK010303_lung_E18_mito_3_step04.2878.2878.2	1.3971	0.0995	2787.66	9	2080.0%	1	K.IEGYEDQVLITEHGDLGNGKFLDPK.N
*	TK010303_lung_E18_mito_3_step05.2732.2732.2	4.1879	0.5598	2302.05	1	5530.0%	1	K.KVDGQQTIIACIESHQFQAK.N
UEF11_MOUSE99.6%3137325.8%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu)
	TK010303_lung_E18_mito_3_step09.4304.4304.2	3.1451	0.3865	2913.6	1	2860.0%	18	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK010303_lung_E18_mito_3_step08.3552.3552.3	1.596	0.0254	3524.61	6	1470.0%	1	K.IGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVK.S
*	TK010303_lung_E18_mito_3_step02.3568.3568.3	2.0725	0.1263	3044.2	4	1670.0%	1	K.DGHASGTTLLEALDCILPPTRPTDKPLR.L
	TK010303_lung_E18_mito_3_step01.2559.2559.2	1.5654	0.182	2518.24	1	2610.0%	6	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK010303_lung_E18_mito_3_step03.2161.2161.2	3.1637	0.4893	1405.18	1	6360.0%	3	K.YYVTIIDAPGHR.D
	TK010303_lung_E18_mito_3_step09.2691.2691.1	2.4174	0.4098	1590.86	1	4640.0%	1	K.THINIVVIGHVDSGK.S
UQ9DCS799.6%119.3%227257158.0(Q9DCS7) 0610011D08Rik protein
*	TK010303_lung_E18_mito_3_step05.3377.3377.2	4.3724	0.0366	2529.15	1	4250.0%	1	K.RIQTYLESTKPIIDLYEEMGK.V
UFABE_MOUSE99.6%41028.9%135151376.5(Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein)
*	TK010303_lung_E18_mito_3_step06.4011.4011.2	1.4813	0.1618	1900.24	149	2190.0%	1	K.TESTVKTTVFSCNLGEK.F
*	TK010303_lung_E18_mito_3_step03.2155.2155.2	1.8354	0.2188	2578.35	46	2140.0%	3	R.KTETVCTFQDGALVQHQQWDGK.E
UEPPL_HUMAN99.6%11134.4%50655531025.6(P58107) Epiplakin (450 kDa epidermal antigen)
	TK010303_lung_E18_mito_3_step11.2459.2459.3	2.005	0.1945	3049.74	3	1610.0%	2	K.GVLRPGTALVLLEAQAATGFVIDPVRNLR.L
*	TK010303_lung_E18_mito_3_step06.4282.4282.2	0.979	0.0463	3194.53	1	1900.0%	1	R.DGLLPTGLGQRLLEAQVASGFLVDPLNNQR.L
*	TK010303_lung_E18_mito_3_step12.3888.3888.2	1.5038	0.0077	3002.45	2	2040.0%	1	R.LLEAQVATGGIIDPTSHHHLPMPVAIQR.G
*	TK010303_lung_E18_mito_3_step08.3757.3757.3	1.7583	0.0667	4128.61	2	1550.0%	1	K.GLIPWEQAARLLEAQVATGGIIDPTSHHHLPMPVAIQR.G
*	TK010303_lung_E18_mito_3_step03.3200.3200.2	1.4631	0.0731	3135.32	4	1850.0%	1	R.SLQAVPGAKDGTSLWDLLSSCHFTEEQR.R
	TK010303_lung_E18_mito_3_step10.2447.2447.2	1.2684	0.0902	2632.2	2	2270.0%	1	R.GQFQGRPVSVWDVLFSSYLSEAR.R
*	TK010303_lung_E18_mito_3_step06.1735.1735.3	2.1239	0.1966	2299.38	97	1970.0%	1	K.AEIIDQDLYERLEHGQATAK.D
*	TK010303_lung_E18_mito_3_step06.2987.2987.3	1.5525	0.0082	3682.83	9	1400.0%	1	R.DETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAK.D
*	TK010303_lung_E18_mito_3_step05.2573.2573.2	3.7582	0.5706	2028.18	1	5280.0%	1	R.LLEAQIATGGIIDPVHSHR.V
*	TK010303_lung_E18_mito_3_step03.1925.1925.1	1.5093	0.0895	1048.69	8	5560.0%	1	K.RAEGAIAGFR.D
UQ8VCC999.6%355.1%807908216.0(Q8VCC9) Similar to spondin 1a
	TK010303_lung_E18_mito_3_step09.2247.2247.1	2.8778	0.3716	1464.95	1	6540.0%	1	R.ANHWSAIIGGSHSK.N
	TK010303_lung_E18_mito_3_step08.2737.2737.2	1.6553	0.2966	2984.23	1	1920.0%	2	K.IRPLTSLDHPQSPFYDPEGGSITQVAR.V
USPCB_MOUSE99.6%15256.7%21282452485.3(P15508) Spectrin beta chain, erythrocyte (Beta-I spectrin)
	TK010303_lung_E18_mito_3_step05.1844.1844.2	4.56	0.5764	1932.59	1	6560.0%	2	R.VHLENMGSHDIVDGNHR.L
*	TK010303_lung_E18_mito_3_step03.2240.2240.1	1.5158	0.0969	1406.64	4	4090.0%	1	R.LEGLDTDWDALR.R
	TK010303_lung_E18_mito_3_step05.2226.2226.1	1.9989	0.1747	1258.74	16	5000.0%	3	K.HRPDLIDFDK.L
*	TK010303_lung_E18_mito_3_step03.2039.2039.1	2.4203	0.056	1437.8	1	5450.0%	1	R.HNLEHAFDVAER.Q
*	TK010303_lung_E18_mito_3_step11.1160.1160.1	1.0297	0.0506	1405.86	1	4170.0%	1	K.AEQLSAARSSDLR.L
	TK010303_lung_E18_mito_3_step06.2006.2006.2	1.0387	0.1319	1647.94	9	3080.0%	1	R.HEAFEKSTASWAER.F
*	TK010303_lung_E18_mito_3_step04.2823.2823.2	4.219	0.5466	2142.04	1	5590.0%	2	R.GVMEHLEHQAQGFPEEFR.D
*	TK010303_lung_E18_mito_3_step04.2447.2447.2	1.1497	0.0051	2849.94	8	1960.0%	1	K.LQEALDLYTVFGESDACELWMTEK.G
	TK010303_lung_E18_mito_3_step10.2217.2217.2	3.3141	0.3824	1497.56	1	7730.0%	1	K.HRPDLIDFDKLK.D
*	TK010303_lung_E18_mito_3_step03.2072.2072.3	1.3773	0.0435	2260.75	83	1970.0%	1	R.GLDAHLKQIFQEADDMVAQK.Q
UCLH1_HUMAN99.6%228014.7%16751916135.7(Q00610) Clathrin heavy chain 1 (CLH-17)
*	TK010303_lung_E18_mito_3_step11.2852.2852.3	1.9403	0.0044	4070.0	114	1070.0%	1	-.MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDK.F
*	TK010303_lung_E18_mito_3_step02.3384.3384.2	2.7824	0.4513	2884.0	1	3200.0%	3	R.RPLIDQVVQTALSETQDPEEVSVTVK.A
*	TK010303_lung_E18_mito_3_step07.4046.4046.3	1.8655	0.0040	3464.16	2	1610.0%	1	R.DPHLACVAYERGQCDLELINVCNENSLFK.S
*	TK010303_lung_E18_mito_3_step09.3820.3820.2	4.8577	0.602	2371.3	1	5750.0%	6	R.KFDVNTSAVQVLIEHIGNLDR.A
*	TK010303_lung_E18_mito_3_step03.2371.2371.1	1.5004	0.1409	1072.31	5	5620.0%	2	K.HDVVFLITK.Y
*	TK010303_lung_E18_mito_3_step03.2444.2444.2	2.786	0.0185	1946.31	7	2940.0%	5	K.LHIIEVGTPPTGNQPFPK.K
*	TK010303_lung_E18_mito_3_step09.2482.2482.3	1.5615	0.0745	2454.01	258	1670.0%	1	R.EKVGEQAQVVIIDMNDPSNPIR.R
*	TK010303_lung_E18_mito_3_step05.3169.3169.3	2.3553	0.1229	3499.06	1	1720.0%	1	R.AVVHTHLLNPEWLVNYFGSLSVEDSLECLR.A
*	TK010303_lung_E18_mito_3_step07.4288.4288.2	1.176	4.0E-4	3074.59	29	1540.0%	1	R.LDNYDAPDIANIAISNELFEEAFAIFR.K
*	TK010303_lung_E18_mito_3_step10.3678.3678.3	1.6425	0.0122	3563.23	1	1880.0%	1	K.EFRLAQMCGLHIVVHADELEELINYYQDR.G
UQ9Z2W599.6%8820.4%834918619.0(Q9Z2W5) Glucosidase I
*	TK010303_lung_E18_mito_3_step12.2497.2497.2	4.2023	0.5413	2378.31	1	3410.0%	1	R.SPKPLLTGLMWAQQGATPGTPPK.L
*	TK010303_lung_E18_mito_3_step01.0828.0828.1	1.0921	0.0407	956.46	20	5620.0%	1	R.ASHPSTAER.H
*	TK010303_lung_E18_mito_3_step09.4060.4060.2	1.7901	0.1148	3163.98	3	1790.0%	1	R.AAHANPPTLLLPVVHMLEGHDPDDLAFLR.K
*	TK010303_lung_E18_mito_3_step06.4479.4479.3	1.9803	0.0576	4055.47	3	1350.0%	1	R.GPSGQGQFLIQQVTLKAPFSVEFVFESGSAATGGNQASGR.L
*	TK010303_lung_E18_mito_3_step12.3431.3431.2	1.3929	0.0743	2900.5	5	1600.0%	1	R.SAVWLNINYLALGALHHYGHVEGPHK.V
*	TK010303_lung_E18_mito_3_step12.3185.3185.3	2.5092	0.123	4227.48	2	1420.0%	1	R.VPPEFLVQRAAHANPPTLLLPVVHMLEGHDPDDLAFLR.K
*	TK010303_lung_E18_mito_3_step05.4036.4036.2	1.0568	0.0104	2560.98	3	2270.0%	1	K.MDPALFPPVPLFSGVPSRSFFPR.G
*	TK010303_lung_E18_mito_3_step01.2183.2183.1	1.7553	0.2296	1194.7	2	5000.0%	1	R.DLALPTLLNPK.T
UMVP_MOUSE99.6%225.9%861959525.6(Q9EQK5) Major vault protein (MVP)
	TK010303_lung_E18_mito_3_step11.2097.2097.2	3.8716	0.5378	2152.77	1	6180.0%	1	R.IPPYHYIHVLDQNSNVSR.V
*	TK010303_lung_E18_mito_3_step02.3306.3306.3	1.7242	0.0443	3689.28	3	1560.0%	1	K.VMAGDEWLFEGPGTYIPQKEVEVVEIIQATVIK.Q
UCATZ_MOUSE99.6%156930.4%306339966.6(Q9WUU7) Cathepsin Z precursor (EC 3.4.22.-)
*	TK010303_lung_E18_mito_3_step01.0227.0227.1	1.2492	0.1335	1294.54	15	3640.0%	1	R.NVNGVNYASVTR.N
*	TK010303_lung_E18_mito_3_step11.3587.3587.3	3.4979	0.3905	3918.3	1	1930.0%	3	K.GAWPSILLSVQNVIDCGNAGSCEGGNDLPVWEYAHK.H
*	TK010303_lung_E18_mito_3_step07.1970.1970.2	3.2268	0.6074	2638.58	1	4550.0%	7	R.NQHIPQYCGSCWAHGSTSAMADR.I
*	TK010303_lung_E18_mito_3_step04.2721.2721.2	1.9539	0.0548	2245.24	6	2860.0%	3	K.GGTGDSYNLAIESACTFGDPIV.-
UARSA_MOUSE99.6%5254.7%506537765.9(P50428) Arylsulfatase A precursor (EC 3.1.6.8) (ASA) (Cerebroside-sulfatase)
	TK010303_lung_E18_mito_3_step08.2364.2364.2	1.3747	0.2182	2589.2	5	2170.0%	5	K.AHFFTQGSAHSDTTSDPACHAANR.L
UMOES_MOUSE99.6%339.2%576676366.6(P26041) Moesin (Membrane-organizing extension spike protein)
	TK010303_lung_E18_mito_3_step02.1890.1890.1	1.2114	0.0025	1451.35	6	4090.0%	1	K.AQMVQEDLEKTR.A
	TK010303_lung_E18_mito_3_step04.2902.2902.2	1.6746	0.0109	2285.36	3	3060.0%	1	R.AKFYPEDVSEELIQDITQR.L
	TK010303_lung_E18_mito_3_step08.3422.3422.2	3.7001	0.5754	2494.03	1	3570.0%	1	K.KGSELWLGVDALGLNIYEQNDR.L
UCOPP_MOUSE99.6%9927.3%9051024495.3(O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102)
	TK010303_lung_E18_mito_3_step02.2489.2489.3	1.8876	0.1504	3983.39	26	1360.0%	1	K.WSCSQVFEGHTHYVMQIVINPKDNNQFASASLDR.T
	TK010303_lung_E18_mito_3_step07.3497.3497.2	1.6708	0.1512	2161.11	3	3420.0%	1	K.SFKPDFGAESIYGGFLLGVR.S
	TK010303_lung_E18_mito_3_step07.3249.3249.3	1.6847	0.048	3826.88	15	1250.0%	1	K.TCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVR.I
	TK010303_lung_E18_mito_3_step12.3457.3457.2	1.4031	0.071	2837.39	19	1670.0%	1	R.LPLAVKDMGSCEIYPQTIQHNPNGR.F
	TK010303_lung_E18_mito_3_step09.4507.4507.2	1.1833	0.0419	2708.59	117	1460.0%	1	R.VWCVASLRGSNNVALGYDEGSIIVK.L
*	TK010303_lung_E18_mito_3_step11.2195.2195.3	1.6814	0.0438	4431.05	11	1190.0%	1	K.CQFSLAQECLHHAQDYGGLLLLATASGNASMVNKLAEGAER.D
	TK010303_lung_E18_mito_3_step12.4191.4191.2	1.2	0.0401	2423.51	5	2250.0%	1	R.FVVVCGDGEYIIYTAMALRNK.S
	TK010303_lung_E18_mito_3_step05.2136.2136.1	2.3429	0.3759	1504.6	1	5450.0%	1	R.VHMFEAHSDYIR.C
*	TK010303_lung_E18_mito_3_step11.1440.1440.3	4.2695	0.6021	3665.6	1	2270.0%	1	K.GFQPSRPTAQQEPDGKPASSPVIMASQTTHKEEK.S
UQ9D8S999.6%41616.1%137143798.8(Q9D8S9) 1810037G04Rik protein
*	TK010303_lung_E18_mito_3_step07.2962.2962.2	5.593	0.6656	2298.52	1	5950.0%	4	R.LVHEALSEELAGPVHALAIQAK.T
UPDX1_MOUSE99.6%3515.1%199221768.1(P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein)
	TK010303_lung_E18_mito_3_step01.1926.1926.1	2.2101	0.1296	921.53	7	7140.0%	1	R.GLFIIDDK.G
*	TK010303_lung_E18_mito_3_step05.1914.1914.2	4.449	0.6208	2393.15	1	5240.0%	2	K.HGEVCPAGWKPGSDTIKPDVNK.S
UQ9D6R299.6%165619.4%366396396.7(Q9D6R2) 1500012E04Rik protein
	TK010303_lung_E18_mito_3_step09.2696.2696.2	2.4905	0.1202	1591.98	2	5710.0%	2	K.TPIAAGHPSMNLLLR.K
	TK010303_lung_E18_mito_3_step07.1816.1816.1	1.1281	0.0026	1219.92	21	3890.0%	1	R.IAEFAFEYAR.N
	TK010303_lung_E18_mito_3_step02.3285.3285.2	1.212	0.0222	2954.26	86	1350.0%	1	K.DMANPTALLLSAVMMLRHMGLFDHAAK.I
	TK010303_lung_E18_mito_3_step06.2089.2089.1	2.7987	0.4727	1128.5	1	6110.0%	6	R.HMGLFDHAAK.I
	TK010303_lung_E18_mito_3_step04.2686.2686.2	2.5899	0.1528	2263.84	2	3610.0%	1	R.KTFDLYANVRPCVSIEGYK.T
UMPPB_MOUSE99.6%143822.5%489546157.0(Q9CXT8) Mitochondrial processing peptidase beta subunit, mitochondrial precursor (EC 3.4.24.64) (Beta-MPP) (P-52)
	TK010303_lung_E18_mito_3_step04.2310.2310.1	1.6827	0.133	1194.57	1	5560.0%	2	R.RIPIPELEAR.I
*	TK010303_lung_E18_mito_3_step05.2098.2098.1	2.1922	0.3864	1336.54	1	6500.0%	5	K.FHFGDSLCSHK.G
	TK010303_lung_E18_mito_3_step04.2087.2087.2	1.0411	0.0254	2284.28	2	2780.0%	1	R.YENEKNNGTAHFLEHMAFK.G
*	TK010303_lung_E18_mito_3_step05.1882.1882.1	1.2419	0.1046	938.43	20	5000.0%	1	R.RLWGFTR.R
	TK010303_lung_E18_mito_3_step03.3629.3629.2	2.103	0.4139	2507.05	2	2140.0%	2	R.SQLDLELEIENMGAHLNAYTSR.E
*	TK010303_lung_E18_mito_3_step01.1490.1490.1	1.7664	0.3343	1194.83	1	5450.0%	1	K.SPAIAALGPIER.L
	TK010303_lung_E18_mito_3_step07.3772.3772.3	3.936	0.5702	3371.33	1	2680.0%	1	R.EMQEVETNLQEVVFDYLHATAYQNTALGR.T
UQ9ERD399.6%1126.4%159175434.2(Q9ERD3) Telokin
*	TK010303_lung_E18_mito_3_step08.3300.3300.3	5.0827	0.541	4552.32	1	2070.0%	1	K.SSTGSPTSPINAEKLESEDDVSQAFLEAVAEEKPHVKPYFSK.T
UEF2_MOUSE99.6%142821.4%857951836.8(P58252) Elongation factor 2 (EF-2)
	TK010303_lung_E18_mito_3_step04.1939.1939.2	3.4254	0.5809	1616.41	1	6150.0%	1	K.TGTITTFEHAHNMR.V
*	TK010303_lung_E18_mito_3_step10.2374.2374.3	1.404	0.0844	1834.58	29	2190.0%	1	R.FYAFGRVFSGVVSTGLK.V
	TK010303_lung_E18_mito_3_step10.2334.2334.2	3.8812	0.5743	2121.78	1	5000.0%	4	K.RGHVFEESQVAGTPMFVVK.A
	TK010303_lung_E18_mito_3_step07.3201.3201.3	1.8649	0.0189	3742.57	34	1290.0%	1	R.GHVFEESQVAGTPMFVVKAYLPVNESFGFTADLR.S
	TK010303_lung_E18_mito_3_step06.4043.4043.2	1.3517	0.1224	2622.39	3	2250.0%	1	K.MDRALLELQLEPEELYQTFQR.I
	TK010303_lung_E18_mito_3_step03.3500.3500.3	2.0381	0.1902	4247.6	1	1420.0%	2	R.SNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETR.K
	TK010303_lung_E18_mito_3_step01.3204.3204.1	1.2221	0.0206	1541.98	1	4580.0%	1	K.LWGDRYFDPANGK.F
	TK010303_lung_E18_mito_3_step01.3072.3072.1	1.8098	0.1028	1497.68	3	4550.0%	1	R.TFCQLILDPIFK.V
	TK010303_lung_E18_mito_3_step03.1960.1960.1	1.9977	0.3244	1402.43	1	5500.0%	1	K.KEDLYLKPIQR.T
	TK010303_lung_E18_mito_3_step11.3620.3620.2	1.5506	0.0814	2551.2	7	2140.0%	1	K.STAISLFYELSENDLNFIKQSK.D
UQ9CYY999.6%153731.0%741849626.3(Q9CYY9) Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
	TK010303_lung_E18_mito_3_step06.3443.3443.3	1.4168	0.0168	3796.53	8	1530.0%	1	R.DMAMDSCRQNPECEFYFSLDADAVLTNPETLR.V
*	TK010303_lung_E18_mito_3_step10.4317.4317.3	1.4471	0.0385	3430.98	2	1690.0%	1	-.MAAAGPEHRLLLLLLLLLPPLPPVTSASDRPR.G
	TK010303_lung_E18_mito_3_step06.3271.3271.3	1.7915	0.016	3631.79	4	1500.0%	1	R.ISLFLHNSEVYHEPHIADAWPQLQDHFSAVK.L
	TK010303_lung_E18_mito_3_step10.4229.4229.2	1.2257	0.0071	2533.12	6	2140.0%	1	R.TELPQKEVFSSSDTDPDMAFCK.S
	TK010303_lung_E18_mito_3_step07.1634.1634.1	1.9006	0.2958	1426.79	2	4090.0%	5	R.LTHYHEGLPTTR.G
	TK010303_lung_E18_mito_3_step05.3017.3017.2	1.2805	0.0217	2366.67	23	2500.0%	1	R.HEDSRLAGGYENVPTVDIHMK.Q
	TK010303_lung_E18_mito_3_step11.2453.2453.2	3.6221	0.4905	1655.08	1	6920.0%	1	K.GIFLHLSNQHEFGR.L
	TK010303_lung_E18_mito_3_step11.3735.3735.3	2.4471	0.3073	3209.61	4	1670.0%	2	K.YADQKDMIIMFVDSYDVILASSPTELLK.K
	TK010303_lung_E18_mito_3_step06.2594.2594.3	2.1105	0.2999	4232.86	1	1550.0%	1	K.LQLNYLGNYVPNGWTPQGGCGFCNQTLRTLPGGQPPPR.V
UQ9D05199.6%3237831.5%359389376.9(Q9D051) 2610103L06Rik protein (Pyruvate dehydrogenase (Lipoamide) beta)
	TK010303_lung_E18_mito_3_step01.0207.0207.1	1.4434	0.1149	1232.49	6	4000.0%	1	K.VVSPWNSEDAK.G
*	TK010303_lung_E18_mito_3_step02.4208.4208.2	2.04	0.2802	3013.35	7	1730.0%	9	R.DNNPVVMLENELMYGVAFELPAEAQSK.D
*	TK010303_lung_E18_mito_3_step02.2970.2970.2	3.9569	0.5191	1804.43	1	6000.0%	1	R.TIRPMDIEAIEASVMK.T
	TK010303_lung_E18_mito_3_step10.2182.2182.3	3.0562	0.465	2902.18	1	2220.0%	1	R.GPNGASAGVAAQHSQCFAAWYGHCPGLK.V
	TK010303_lung_E18_mito_3_step06.3114.3114.2	2.4679	0.2472	2502.52	1	2950.0%	17	K.TNHLVTVEGGWPQFGVGAEICAR.I
	TK010303_lung_E18_mito_3_step01.1918.1918.1	1.9613	0.2227	903.71	1	7860.0%	1	K.DFLIPIGK.A
UU2AF_MOUSE99.6%3313.1%475535179.1(P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit)
	TK010303_lung_E18_mito_3_step11.4119.4119.2	1.2376	0.0025	3066.09	1	2040.0%	1	K.GYAFCEYVDINVTDQAIAGLNGMQLGDK.K
	TK010303_lung_E18_mito_3_step12.2399.2399.3	5.0472	0.6165	3561.31	1	3120.0%	1	R.RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK.L
	TK010303_lung_E18_mito_3_step09.4334.4334.3	1.3736	0.0996	3190.77	13	1610.0%	1	K.GYAFCEYVDINVTDQAIAGLNGMQLGDKK.L
UQ9UEV999.6%12148.4%26022781905.7(Q9UEV9) Actin-binding protein homolog ABP-278
	TK010303_lung_E18_mito_3_step11.2383.2383.2	3.3598	0.5174	2310.96	1	4090.0%	2	R.GQHVTGSPFQFTVGPLGEGGAHK.V
	TK010303_lung_E18_mito_3_step05.2521.2521.2	3.1616	0.0233	2197.79	1	4520.0%	1	K.AHGPGLEGGLVGKPAEFTIDTK.G
	TK010303_lung_E18_mito_3_step01.0418.0418.1	1.1452	0.0878	834.43	2	6430.0%	1	R.AYGPGLEK.S
	TK010303_lung_E18_mito_3_step10.4318.4318.2	1.2246	0.0094	2613.78	15	1740.0%	1	R.IGNLQTDLSDGLRLIALLEVLSQK.R
*	TK010303_lung_E18_mito_3_step07.4348.4348.3	2.118	0.1575	3981.7	4	1340.0%	1	K.VVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTK.A
	TK010303_lung_E18_mito_3_step04.3274.3274.2	1.4288	0.1128	2522.93	9	1960.0%	1	K.KNGNHVANSPVSIMVVQSEIGDAR.R
	TK010303_lung_E18_mito_3_step03.2336.2336.2	1.2212	0.0716	1735.81	1	3930.0%	1	K.TYSVEYLPKVTGLHK.V
	TK010303_lung_E18_mito_3_step07.2278.2278.2	1.1455	0.0019	1970.51	96	2220.0%	1	R.DAGEGLLAVQITDQEGKPK.R
	TK010303_lung_E18_mito_3_step02.2506.2506.2	1.3077	0.0080	3036.7	3	1850.0%	1	K.ANEPTHFTVDCTEAGEGDVSVGIKCDAR.V
	TK010303_lung_E18_mito_3_step06.2131.2131.1	1.5742	0.2167	1278.45	3	4170.0%	1	R.AWGPGLHGGIVGR.S
UO0883299.6%2210.0%578665557.4(O08832) Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase) (UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase) (GalNAc-T4)
*	TK010303_lung_E18_mito_3_step12.2216.2216.2	3.3532	0.4849	2302.5	1	3950.0%	1	K.NVFSNLHVPEDRPGWHGAIR.S
*	TK010303_lung_E18_mito_3_step03.4359.4359.3	1.5991	0.1499	4512.67	3	1280.0%	1	R.ISRDETAIVCPVIDTIDWNTFEFYMQTGEPMIGGFDWR.L
UQ9D11199.6%85017.7%147161858.4(Q9D111) 3110050F08Rik protein
	TK010303_lung_E18_mito_3_step09.2883.2883.2	3.0564	0.5271	3042.34	1	2800.0%	7	R.DLGPHHFNVLAFPCNQFGQQEPDTNR.E
UDHB4_MOUSE99.6%392.6%735795248.6(P51660) Estradiol 17 beta-dehydrogenase 4 (EC 1.1.1.62) (17-beta-HSD 4) (17-beta-hydroxysteroid dehydrogenase 4)
*	TK010303_lung_E18_mito_3_step06.1783.1783.2	3.1007	0.4651	1767.02	1	5560.0%	3	R.TSHAAPAATSGFVGAVGHK.L
UT9S1_MOUSE99.6%4612.9%606689147.1(Q9DBU0) Transmembrane 9 superfamily protein member 1 precursor
	TK010303_lung_E18_mito_3_step08.4325.4325.3	2.3381	0.0386	4072.8	2	1420.0%	1	R.FPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHR.H
	TK010303_lung_E18_mito_3_step07.2369.2369.2	3.2924	0.5698	2880.46	1	4090.0%	2	K.VGPYHNPQETYHYYQLPVCCPEK.I
	TK010303_lung_E18_mito_3_step06.2970.2970.2	2.507	0.5104	1921.73	1	4060.0%	1	R.GFVGYMEESGFLPHSHK.I
URAGE_MOUSE99.6%2214.1%403426696.1(Q62151) Advanced glycosylation end product-specific receptor precursor (Receptor for advanced glycosylation end products)
*	TK010303_lung_E18_mito_3_step12.2717.2717.3	3.4239	0.6203	4752.5	1	1670.0%	1	K.DGAPLPLAPSPVLLLPEVGHADEGTYSCVATHPSHGPQESPPVSIR.V
*	TK010303_lung_E18_mito_3_step08.1942.1942.1	1.3087	0.1712	1279.9	1	5500.0%	1	R.RPLNTAPIQLR.V
URL3_MOUSE99.6%92912.9%4024599310.2(P27659) 60S ribosomal protein L3 (J1 protein)
	TK010303_lung_E18_mito_3_step04.2245.2245.1	1.2653	0.0436	983.57	1	6250.0%	2	R.HGSLGFLPR.K
	TK010303_lung_E18_mito_3_step06.2077.2077.2	4.609	0.4939	1826.45	1	6880.0%	3	K.KAHLMEIQVNGGTVAEK.L
	TK010303_lung_E18_mito_3_step02.2900.2900.2	2.1354	0.4092	2974.05	1	2600.0%	4	R.ERLEQQVPVNQVFGQDEMIDVIGVTK.G
UQ8VDD599.6%8124.9%19602263555.7(Q8VDD5) Nonmuscle heavy chain myosin II-A
	TK010303_lung_E18_mito_3_step05.2330.2330.2	2.2701	0.3838	1915.67	1	4000.0%	2	R.HEMPPHIYAITDTAYR.S
	TK010303_lung_E18_mito_3_step03.4083.4083.2	2.747	0.4331	2504.23	1	3250.0%	2	K.LQLQEQLQAETELCAEAEELR.A
	TK010303_lung_E18_mito_3_step09.4299.4299.2	1.3129	0.1307	2619.68	377	1090.0%	1	R.KLEGDSTDLSDQIAELQAQIAELK.M
*	TK010303_lung_E18_mito_3_step03.2104.2104.1	1.0716	0.0016	1043.4	1	6250.0%	1	K.KLVWVPSSK.N
	TK010303_lung_E18_mito_3_step04.2039.2039.2	4.0588	0.5421	1586.36	1	8330.0%	1	K.NKHEAMITDLEER.L
*	TK010303_lung_E18_mito_3_step01.2687.2687.1	2.0903	0.342	1461.73	1	4620.0%	1	R.VISGVLQLGNIAFK.K
USTRN_MOUSE99.6%91722.4%780860145.3(O55106) Striatin
*	TK010303_lung_E18_mito_3_step07.3913.3913.3	2.1697	0.1041	4015.28	13	1250.0%	1	K.SFIMGADEALESELGLGELAGLTVANEADSLAYDIANNK.D
*	TK010303_lung_E18_mito_3_step06.4175.4175.3	1.3588	0.0032	3237.88	4	1790.0%	1	R.SAGDGTDWEKEDQCLTPEAWNVDQGVISK.L
	TK010303_lung_E18_mito_3_step05.2109.2109.2	3.3988	0.5186	1771.37	1	6070.0%	1	K.KFEESIHDVAFHPSK.C
*	TK010303_lung_E18_mito_3_step11.3173.3173.3	1.5801	0.0379	3754.03	50	1250.0%	2	K.GYTSIFNMETQQRVLTLESNVDSTSSSSCQINR.V
*	TK010303_lung_E18_mito_3_step06.2407.2407.2	2.9396	0.4094	1886.68	1	5000.0%	3	R.VISHPTLPISITAHEDR.H
*	TK010303_lung_E18_mito_3_step11.3399.3399.3	2.2775	0.0898	4474.6	3	1280.0%	1	R.LWNTTEVAPALSVFNDNQELGIPASVDLVSSDPSHMVASFSK.G
UA2HS_MOUSE99.6%126614.8%345373266.5(P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin)
*	TK010303_lung_E18_mito_3_step03.2675.2675.3	1.6672	0.0534	3243.76	79	1380.0%	1	K.LVEISRAQNVPLPVSTLVEFVIAATDCTAK.E
*	TK010303_lung_E18_mito_3_step07.3840.3840.2	4.97	0.6205	2546.48	1	4780.0%	7	R.AQNVPLPVSTLVEFVIAATDCTAK.E
*	TK010303_lung_E18_mito_3_step04.2322.2322.2	5.4028	0.6493	2139.77	1	6000.0%	4	R.HAFSPVASVESASGETLHSPK.V
UCYPB_MOUSE99.6%2314745.2%208227139.5(P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1)
	TK010303_lung_E18_mito_3_step01.0210.0210.1	1.6203	0.1294	896.68	1	6670.0%	1	R.FPDENFK.L
	TK010303_lung_E18_mito_3_step03.2113.2113.1	3.3728	0.4613	1478.47	1	5770.0%	11	K.HYGPGWVSMANAGK.D
*	TK010303_lung_E18_mito_3_step01.2156.2156.1	1.4972	0.0978	866.68	2	6430.0%	1	R.VVFGLFGK.T
	TK010303_lung_E18_mito_3_step01.1396.1396.1	1.3221	0.0305	1246.62	5	4500.0%	1	K.IEVEKPFAIAK.E
	TK010303_lung_E18_mito_3_step01.1698.1698.1	1.7535	0.2976	1459.48	1	4170.0%	1	K.DTNGSQFFITTVK.T
	TK010303_lung_E18_mito_3_step01.1426.1426.1	1.6865	0.1205	1374.53	5	4550.0%	1	K.IEVEKPFAIAKE.-
*	TK010303_lung_E18_mito_3_step03.1971.1971.2	1.0899	0.0221	2742.04	8	1730.0%	1	K.VLFAAALIVGSVVFLLLPGPSVANDKK.K
	TK010303_lung_E18_mito_3_step01.1888.1888.1	1.6401	0.2864	1366.61	2	4170.0%	2	K.TVDNFVALATGEK.G
UQ8R3F599.6%3322.6%221248758.8(Q8R3F5) Hypothetical 24.9 kDa protein (Fragment)
*	TK010303_lung_E18_mito_3_step08.1564.1564.2	3.8735	0.6253	1464.13	1	7310.0%	1	K.KPLVAVHSNVSGQK.Y
*	TK010303_lung_E18_mito_3_step08.4401.4401.3	1.5217	0.0788	4305.32	5	1140.0%	1	R.QSNFSFACLEAQEHCKSLGIENPVCQVSNYLFPDCR.V
UQ922Q499.6%5257.2%320336597.8(Q922Q4) Similar to pyrroline 5-carboxylate reductase isoform
	TK010303_lung_E18_mito_3_step04.3349.3349.2	3.9736	0.5944	2444.55	1	4320.0%	5	K.DNVCSPGGATIHALHFLESGGFR.S
UCPT2_MOUSE99.6%14549.3%658739278.2(P52825) Carnitine O-palmitoyltransferase II, mitochondrial precursor (EC 2.3.1.21) (CPT II)
*	TK010303_lung_E18_mito_3_step12.2963.2963.2	3.2889	0.5613	3085.45	1	3270.0%	1	R.KGHFYVFDVLDQDGNIVNPSEIQAHLK.Y
*	TK010303_lung_E18_mito_3_step04.1825.1825.1	2.0239	0.2729	1274.63	1	6500.0%	2	K.ELHAHLLAQDK.Q
*	TK010303_lung_E18_mito_3_step09.2555.2555.2	4.4156	0.6104	1904.42	1	5620.0%	3	K.DLVHLSHTMLHGDGTNR.W
*	TK010303_lung_E18_mito_3_step10.4334.4334.2	1.1363	0.0072	2959.26	4	1600.0%	6	K.GHFYVFDVLDQDGNIVNPSEIQAHLK.Y
	TK010303_lung_E18_mito_3_step04.2191.2191.1	1.4628	0.1741	751.59	1	8000.0%	2	R.HLLVLR.K
UQ9D0Q799.6%4814.1%306354119.2(Q9D0Q7) 2600005P05Rik protein
	TK010303_lung_E18_mito_3_step05.3298.3298.2	3.8944	0.4587	2243.08	1	5880.0%	2	R.LHTLVTEHCFPDMVWDLK.Y
	TK010303_lung_E18_mito_3_step05.2904.2904.2	1.2743	0.0898	2794.75	6	2080.0%	2	R.LERPIHLACTAGIFDPYVPPEGDAR.M
UQ9D8T799.6%8408.9%112126459.8(Q9D8T7) 1810035L17Rik protein
	TK010303_lung_E18_mito_3_step08.1949.1949.1	2.8735	0.3324	1230.64	1	7220.0%	6	R.EHFAQFGHVR.R
UQ8VCH099.6%128420.3%424439958.5(Q8VCH0) Similar to acetyl-CoA acyltransferase, 3-oxo acyl-CoA thiolase A, peroxisomal
	TK010303_lung_E18_mito_3_step03.4336.4336.3	1.6555	0.1401	3944.95	4	1320.0%	1	K.AEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQK.A
	TK010303_lung_E18_mito_3_step06.2527.2527.3	2.0123	0.02	2641.51	1	2500.0%	1	K.LGIPAEKVNPLGGAIALGHPLGCTGAR.Q
*	TK010303_lung_E18_mito_3_step12.1809.1809.2	1.1013	0.0655	2176.01	14	2370.0%	1	R.NGSYDIGMACGVESMTLSQR.G
	TK010303_lung_E18_mito_3_step10.2381.2381.2	2.7903	0.3936	1934.6	1	3950.0%	9	K.VNPLGGAIALGHPLGCTGAR.Q
UQ9D73999.6%72749.1%116133467.4(Q9D739) 2900002J19Rik protein
	TK010303_lung_E18_mito_3_step04.2217.2217.2	3.6991	0.0861	1855.49	1	5940.0%	1	K.KTTGLVGLAVCDTPHER.L
	TK010303_lung_E18_mito_3_step05.3349.3349.2	3.9903	0.5696	2197.02	1	5000.0%	5	K.KLEALLQGGEVEEVILQAEK.E
*	TK010303_lung_E18_mito_3_step04.2962.2962.2	1.3792	0.0046	2519.59	1	2370.0%	1	K.WKPWEPLVEEPPANQWNWPI.-
USEP2_MOUSE99.6%12869.7%361415266.5(P42208) Septin 2 (NEDD5 protein)
*	TK010303_lung_E18_mito_3_step02.2340.2340.1	1.792	0.1453	1481.68	1	5910.0%	1	K.RILDEIEEHSIK.I
	TK010303_lung_E18_mito_3_step06.3318.3318.2	3.0355	0.5245	2866.93	1	2950.0%	9	R.TMLITHMQDLQEVTQDLHYENFR.S
UQ91ZP199.6%3323.3%236270548.1(Q91ZP1) Fibrinogen B-beta-chain (Fragment)
	TK010303_lung_E18_mito_3_step11.3687.3687.2	1.463	0.132	2392.22	109	1580.0%	1	K.ISQLTRMGPTELLIEMEDWK.G
*	TK010303_lung_E18_mito_3_step02.1973.1973.1	1.3067	0.0861	1511.71	5	3460.0%	1	K.AHYGGFTVQNEASK.Y
*	TK010303_lung_E18_mito_3_step02.2270.2270.2	4.3953	0.542	2414.05	1	4500.0%	1	R.KGGETSEMYLIQPDTSIKPYR.V
UACTB_HUMAN99.6%1411045929.9%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin)
	TK010303_lung_E18_mito_3_step08.3430.3430.3	3.9821	0.3553	3233.63	1	2590.0%	1	R.CPEALFQPSFLGMESCGIHETTFNSIMK.C
	TK010303_lung_E18_mito_3_step05.3464.3464.2	2.8626	0.381	2811.47	1	3540.0%	1	K.EKLCYVALDFEQEMATAASSSSLEK.S
	TK010303_lung_E18_mito_3_step11.1975.1975.2	2.4316	0.4079	1519.69	1	7000.0%	17	K.IWHHTFYNELR.V
	TK010303_lung_E18_mito_3_step01.1540.1540.2	3.9498	0.535	1956.28	1	5880.0%	1	R.VAPEEHPVLLTEAPLNPK.A
	TK010303_lung_E18_mito_3_step04.3878.3878.2	4.3961	0.6299	2554.56	1	4550.0%	99	K.LCYVALDFEQEMATAASSSSLEK.S
	TK010303_lung_E18_mito_3_step05.3076.3076.2	1.8687	0.2785	3187.21	1	2590.0%	2	R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L
UQ9P03599.6%115.9%373444239.1(Q9P035) HSPC121
*	TK010303_lung_E18_mito_3_step06.3570.3570.2	3.3645	0.0014	2654.56	1	4290.0%	1	K.GDNVYEFHLEFLDLVKPEPVYK.L
UQ9Z0I999.6%8206.5%17031857825.6(Q9Z0I9) Collagen alpha3(VI) precursor (Fragment)
*	TK010303_lung_E18_mito_3_step11.2056.2056.2	0.9659	0.041	3126.05	8	1790.0%	1	K.DITAQDSADIIFLIDGSQNTGNANFDVIR.D
	TK010303_lung_E18_mito_3_step12.0984.0984.1	1.2576	0.0012	888.42	40	5000.0%	1	K.RDAVTAVR.K
*	TK010303_lung_E18_mito_3_step07.2586.2586.2	3.2059	0.515	2534.38	1	3200.0%	4	K.GGSGLNAGSALSYIHANHFTEAGGSR.T
*	TK010303_lung_E18_mito_3_step12.2797.2797.2	2.2705	0.3559	2175.9	1	4440.0%	1	R.HIVLQPPAIVTQVMEVNKR.D
	TK010303_lung_E18_mito_3_step02.2112.2112.2	0.9701	0.1602	2958.24	4	1850.0%	1	R.ALNGSALYTGSSLDFVRNNLFTSSAGHR.A
UOST4_MOUSE99.6%4422.2%441490145.8(O54734) Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit precursor (EC 2.4.1.119) (Oligosaccharyl transferase 48 kDa subunit) (DDOST 48 kDa subunit)
*	TK010303_lung_E18_mito_3_step09.4282.4282.2	1.3162	0.0513	2329.56	7	2250.0%	1	R.VIFSGSLDFFSDAFFNSAVQK.A
*	TK010303_lung_E18_mito_3_step11.3997.3997.3	1.8806	0.0637	4366.35	19	1120.0%	1	R.GVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGR.N
*	TK010303_lung_E18_mito_3_step03.3073.3073.3	5.3095	0.5806	3235.33	1	3300.0%	1	K.TAVIDHHNYDVSDLGQHTLIVADTENLLK.A
*	TK010303_lung_E18_mito_3_step02.4490.4490.2	1.2925	0.0169	3010.75	149	1300.0%	1	R.VIFSGSLDFFSDAFFNSAVQKATPGAQR.Y
UQ9CWU299.6%3512.6%446514888.6(Q9CWU2) 2410004E01Rik protein
*	TK010303_lung_E18_mito_3_step12.2668.2668.3	1.9294	0.2062	4255.93	14	1540.0%	1	R.WLHKCELFLLLILSMITLWAVGYILDFNSDSWLLK.G
*	TK010303_lung_E18_mito_3_step07.2466.2466.2	4.4102	0.7109	2217.65	1	5750.0%	2	K.THQNTPLHWAVAAGNVSAVDK.L
UH2AG_HUMAN99.6%82231.0%1291397610.9(P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3)
	TK010303_lung_E18_mito_3_step01.0066.0066.1	1.0228	0.1997	498.49	1	8330.0%	2	R.IIPR.H
	TK010303_lung_E18_mito_3_step02.3997.3997.2	4.1989	0.3348	2918.49	1	3570.0%	3	R.VGAGAPVYLAAVLEYLTAEILELAGNAAR.D
	TK010303_lung_E18_mito_3_step06.2002.2002.1	1.0873	0.0143	852.56	1	7500.0%	3	R.HLQLAIR.N
UQ91YE499.6%4163.2%564666476.4(Q91YE4) 67 kDa polymerase-associated factor PAF67
	TK010303_lung_E18_mito_3_step06.2379.2379.2	1.0356	0.0386	2142.87	49	2060.0%	4	K.FLSPVVPNYDNVHPNYHK.E
UO3567899.6%3517.2%303333887.2(O35678) MONOGLYCERIDE lipase (EC 3.1.1.23)
*	TK010303_lung_E18_mito_3_step06.2806.2806.2	3.6771	0.6222	2294.74	1	4500.0%	2	K.GLDMLVFAHDHVGHGQSEGER.M
*	TK010303_lung_E18_mito_3_step10.3873.3873.3	1.5291	0.0271	3693.62	75	1250.0%	1	K.MYEGAYHVLHRELPEVTNSVLHEVNSWVSHR.I
UACF7_MOUSE99.6%20228.0%53276079845.5(Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF)
*	TK010303_lung_E18_mito_3_step11.1328.1328.1	1.4023	0.0174	1011.27	2	6430.0%	1	K.AHFQHLMK.S
*	TK010303_lung_E18_mito_3_step09.4675.4675.1	0.6513	0.0051	1460.79	5	2270.0%	1	R.TWLDEKQSQQAK.N
	TK010303_lung_E18_mito_3_step07.4276.4276.2	1.4726	0.0393	2065.36	30	2350.0%	1	K.SLRPAVERLELLLQIANK.I
	TK010303_lung_E18_mito_3_step10.3103.3103.3	2.0351	0.0711	2785.04	5	1960.0%	1	K.LIDWLEDAESHLDSELEISNDPDK.I
*	TK010303_lung_E18_mito_3_step09.4055.4055.3	1.9862	0.0999	3773.23	36	1330.0%	1	K.FQDALEPLLSWLTDTEELIANQKPPSAEYKVVK.A
*	TK010303_lung_E18_mito_3_step09.2231.2231.3	1.9888	0.1445	2759.19	17	2050.0%	1	K.FLDVLELAEKFWYDMAVLLTTIK.D
*	TK010303_lung_E18_mito_3_step03.2559.2559.2	1.1373	0.2303	2592.41	4	1900.0%	1	R.VLSEQLSQQTELFAEIERNQTK.L
*	TK010303_lung_E18_mito_3_step09.3268.3268.3	6.0367	0.6646	3962.6	1	2730.0%	2	R.HQELLSQQQNFIVATQSAQSFLDQHSHNLTPEER.Q
*	TK010303_lung_E18_mito_3_step09.2894.2894.2	1.3088	0.1159	2165.72	22	2110.0%	1	K.GHFSSLELVPPSTLTTTHLK.A
*	TK010303_lung_E18_mito_3_step07.3872.3872.2	3.0267	0.5428	2775.92	1	3330.0%	1	R.SLLEILNSAADILINSSEIDEDEIR.D
*	TK010303_lung_E18_mito_3_step05.2704.2704.2	1.6784	0.1701	1761.36	6	3570.0%	1	K.TIVQLKPRNPDHVLK.S
*	TK010303_lung_E18_mito_3_step08.3300.3300.2	1.5481	0.0666	3035.21	7	1960.0%	1	K.FLQDHKEFENWLQQSENELDSMHK.G
	TK010303_lung_E18_mito_3_step10.2214.2214.3	1.8845	0.1607	2781.27	2	2290.0%	1	K.WKVISPTGNEAMVPSVCFLIPPPNK.G
*	TK010303_lung_E18_mito_3_step09.3174.3174.3	1.9296	0.0782	3947.27	115	1000.0%	1	K.LLSDTVASDPGVLQQQLATTKQLQEELAEHQVPVEK.L
	TK010303_lung_E18_mito_3_step04.2521.2521.3	1.4813	0.071	2581.52	55	1700.0%	1	K.VPEGGEGISATEVDSRWQEYQSR.V
	TK010303_lung_E18_mito_3_step01.2932.2932.1	1.3364	8.0E-4	1487.56	2	4090.0%	1	K.YQKAENMYAQIK.D
*	TK010303_lung_E18_mito_3_step12.3695.3695.3	1.7763	0.1281	3778.41	8	1410.0%	1	K.FWYDMAVLLTTIKDTQDIVHDLESPGIDPSIIK.Q
	TK010303_lung_E18_mito_3_step05.3408.3408.3	2.5798	0.2383	3878.14	142	980.0%	1	K.NTLQADAAHLESGQPVQCESDVIMYIQECEGLIR.Q
	TK010303_lung_E18_mito_3_step02.2777.2777.2	1.3329	0.032	2467.4	10	2370.0%	1	R.QIEITICKNDECVLEDNSQR.T
UQ922Q899.6%4613.0%307348779.5(Q922Q8) Similar to hypothetical protein PRO1855
*	TK010303_lung_E18_mito_3_step05.2940.2940.2	3.6784	0.3782	1863.1	1	6790.0%	2	R.HHEILQWVLQTDSQQ.-
	TK010303_lung_E18_mito_3_step01.2375.2375.1	2.0627	0.2693	1318.96	2	4550.0%	1	R.LVTLPVSFAQLK.N
*	TK010303_lung_E18_mito_3_step02.2609.2609.1	2.0341	0.1636	1561.83	1	4580.0%	1	R.LVNLQHLDLLNNR.L
USEP7_MOUSE99.6%1717315.4%436505508.6(O55131) Septin 7 (CDC10 protein homolog)
	TK010303_lung_E18_mito_3_step05.3528.3528.2	3.7232	0.4748	2611.26	1	4090.0%	13	K.STLINSLFLTDLYSPEYPGPSHR.I
	TK010303_lung_E18_mito_3_step12.3124.3124.3	1.948	0.0746	4263.05	9	1120.0%	1	R.GFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHR.I
	TK010303_lung_E18_mito_3_step01.1787.1787.1	1.2926	0.2119	980.62	1	6250.0%	1	K.VNIIPLIAK.A
	TK010303_lung_E18_mito_3_step03.2760.2760.2	2.0747	0.311	1997.78	12	2500.0%	1	K.DRLPLAVVGSNTIIEVNGK.R
UQ9D6U899.6%82016.1%155177259.9(Q9D6U8) 2310056P07Rik protein (RIKEN cDNA 2310056P07 gene)
*	TK010303_lung_E18_mito_3_step12.1213.1213.1	2.7451	0.5172	1506.8	1	5830.0%	3	R.HGVPLHKPTDFEK.K
*	TK010303_lung_E18_mito_3_step07.2089.2089.1	1.8759	0.264	1456.54	2	3640.0%	3	K.RHESLTSLNLER.K
UQ9DBF199.6%102225.7%510555146.4(Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1)
*	TK010303_lung_E18_mito_3_step11.3471.3471.3	4.9745	0.6015	4120.52	1	2500.0%	2	K.VMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFK.F
*	TK010303_lung_E18_mito_3_step04.2403.2403.2	4.2353	0.1408	1708.27	1	7690.0%	2	R.LFLHESIHNEVVDR.L
*	TK010303_lung_E18_mito_3_step12.3420.3420.3	1.847	0.0293	3731.93	12	1390.0%	1	K.SLLELGGNNAIIAFEDADLSLVVPSVLFAAVGTAGQR.C
*	TK010303_lung_E18_mito_3_step05.4164.4164.2	1.3942	0.0614	2658.02	104	1300.0%	3	K.ILVEGIGEVQEYVDVCDYAAGLSR.M
*	TK010303_lung_E18_mito_3_step12.2908.2908.2	3.9063	0.5925	2264.85	1	4720.0%	2	-.STLLIHHPQYAWLQDLGLR.E
UO0879499.6%6391527.2%9661094046.2(O08794) Alpha glucosidase II, alpha subunit
*	TK010303_lung_E18_mito_3_step09.3367.3367.3	2.8559	0.1872	3901.72	1	1570.0%	5	K.THSDSKPYGPTSVGLDFSLPGMEHVYGIPEHADSLR.L
	TK010303_lung_E18_mito_3_step10.2046.2046.3	1.2411	0.0205	1825.7	30	2830.0%	1	R.LDLLEDRSLLLSVNAR.G
	TK010303_lung_E18_mito_3_step06.1711.1711.1	1.1348	0.0022	1147.76	61	5000.0%	1	R.SIRPGLSPYR.A
*	TK010303_lung_E18_mito_3_step06.3399.3399.2	3.0335	0.4293	1626.22	1	6920.0%	4	R.FPQPLNMLEHLASK.R
	TK010303_lung_E18_mito_3_step06.2183.2183.1	1.8791	0.2544	1235.52	1	5500.0%	1	R.KLVAIVDPHIK.V
*	TK010303_lung_E18_mito_3_step08.4448.4448.2	2.9354	0.5633	2404.09	1	4000.0%	28	R.DIHNIYGLYVHMATADGLIQR.S
*	TK010303_lung_E18_mito_3_step08.3616.3616.3	5.3751	0.6002	4320.81	1	2430.0%	6	R.WNYRDEADVLEVDQGFDDHNMPCDVIWLDIEHADGK.R
*	TK010303_lung_E18_mito_3_step07.4402.4402.2	1.3217	0.1615	2899.76	5	2200.0%	1	R.SWLSLVLAYLGVCLGITLAVDRSNFK.T
*	TK010303_lung_E18_mito_3_step03.4308.4308.2	1.7403	0.3121	2501.05	5	2270.0%	5	R.ALLDTLQLGPDALTVHLIHEVTK.V
*	TK010303_lung_E18_mito_3_step02.3345.3345.3	1.8128	0.0359	3702.16	1	1800.0%	1	R.DIHNIYGLYVHMATADGLIQRSGGIERPFVLSR.A
*	TK010303_lung_E18_mito_3_step02.1509.1509.1	2.1803	0.4178	1327.02	1	4500.0%	1	K.DAVHYGGWEHR.D
	TK010303_lung_E18_mito_3_step08.4176.4176.2	1.624	0.0371	2512.22	3	2050.0%	2	R.DLGIFWLNAAETWVDISSNTAGK.T
	TK010303_lung_E18_mito_3_step04.3170.3170.2	2.4192	0.4303	2537.26	1	3180.0%	4	R.QYASLTGTQALPPLFSLGYHQSR.W
	TK010303_lung_E18_mito_3_step01.1464.1464.1	1.2017	0.058	1104.62	1	7220.0%	1	K.LVAIVDPHIK.V
*	TK010303_lung_E18_mito_3_step03.3480.3480.3	3.5509	0.4737	3700.27	1	2020.0%	1	R.DEADVLEVDQGFDDHNMPCDVIWLDIEHADGK.R
*	TK010303_lung_E18_mito_3_step05.3477.3477.3	4.4539	0.4686	3858.28	1	2270.0%	1	R.DEADVLEVDQGFDDHNMPCDVIWLDIEHADGKR.Y
UO0879599.6%2310727.3%521587934.5(O08795) Alpha glucosidase II, beta subunit
	TK010303_lung_E18_mito_3_step06.4370.4370.3	1.8149	0.1639	4755.66	16	1050.0%	2	R.SLEQEISFDFGPSGEFAYLYSQCYELTTNEYVYRLCPFK.L
	TK010303_lung_E18_mito_3_step01.0950.0950.1	1.3916	0.0261	871.65	1	6430.0%	1	K.LLELQAGK.K
	TK010303_lung_E18_mito_3_step02.2484.2484.3	1.6109	0.1118	4110.66	7	1520.0%	1	R.SLEQEISFDFGPSGEFAYLYSQCYELTTNEYVYR.L
	TK010303_lung_E18_mito_3_step02.4509.4509.3	1.8128	0.1135	4470.54	1	1420.0%	7	R.GVSLSNHHFYEESKPFTCLDGTATIPFDQVNDDYCDCK.D
	TK010303_lung_E18_mito_3_step04.3847.3847.2	1.3695	0.1186	2545.76	4	2250.0%	1	-.MLLLLLLLLPLCWAVEVKRPR.G
	TK010303_lung_E18_mito_3_step09.2496.2496.3	1.9627	0.0703	2933.12	9	1850.0%	1	K.LVSQKPKHGGSPTSLGTWGSWAGPDHDK.F
	TK010303_lung_E18_mito_3_step05.2508.2508.2	4.2899	0.661	2153.97	1	6000.0%	5	K.HGGSPTSLGTWGSWAGPDHDK.F
	TK010303_lung_E18_mito_3_step03.2364.2364.1	2.3774	0.2174	1060.67	1	7140.0%	5	K.KILIEEWK.T
UQ9D8V899.6%2412.1%198218505.8(Q9D8V8) 1810029F08Rik protein
*	TK010303_lung_E18_mito_3_step11.3228.3228.2	2.6195	0.5409	2652.78	1	3260.0%	2	K.TCSSLSVPQGEAAQLLQALHHFTR.L
UGCDH_MOUSE99.6%92721.2%438486478.6(Q60759) Glutaryl-CoA dehydrogenase, mitochondrial precursor (EC 1.3.99.7) (GCD)
*	TK010303_lung_E18_mito_3_step02.3256.3256.2	2.7755	0.4018	2717.7	1	3180.0%	3	K.SSRPVFDWKDPLILEEQLTADEK.L
*	TK010303_lung_E18_mito_3_step12.1941.1941.2	1.0524	0.0107	2918.88	272	1250.0%	1	R.SMMSVQSSLVMHPIYTYGSEEQRQK.Y
	TK010303_lung_E18_mito_3_step08.3998.3998.2	1.0914	0.0336	2353.73	23	2000.0%	1	K.KLADMLTEITLGLHACLQLGR.L
	TK010303_lung_E18_mito_3_step11.2724.2724.2	2.198	0.3955	2679.66	1	2610.0%	4	R.HAMNLEAVNTYEGTHDIHALILGR.A
UFBN1_MOUSE99.6%8107.6%28713122664.9(Q61554) Fibrillin 1 precursor
	TK010303_lung_E18_mito_3_step08.2574.2574.3	1.4083	9.0E-4	2817.54	18	1850.0%	1	K.TCVDVNECDLNPNICLSGTCENTK.G
*	TK010303_lung_E18_mito_3_step06.3958.3958.3	2.1946	0.2961	4364.65	8	1220.0%	1	K.GICQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHR.C
*	TK010303_lung_E18_mito_3_step08.3132.3132.3	1.5657	0.0188	4788.82	9	930.0%	1	R.RSTNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVSNK.V
	TK010303_lung_E18_mito_3_step03.4499.4499.3	1.7024	0.1519	3230.26	1	1850.0%	1	R.CVDVRPGYCYTALANGRCSNQLPQSITK.M
	TK010303_lung_E18_mito_3_step12.1639.1639.3	1.7611	0.0021	3045.43	19	1770.0%	1	R.HRMDACCCSVGAAWGTEECEECPLR.N
	TK010303_lung_E18_mito_3_step11.1312.1312.2	2.7461	0.5502	2092.21	1	5000.0%	1	R.AWGHPCEMCPAQPHPCR.R
*	TK010303_lung_E18_mito_3_step10.2054.2054.3	1.6106	0.0534	4761.16	41	880.0%	2	K.CEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSWSSSGR.R
UGS28_MOUSE99.6%4169.2%250284299.3(O88630) 28 kDa Golgi SNARE protein (Golgi SNAP receptor complex member 1) (28 kDa cis-Golgi SNARE p28) (GOS-28)
*	TK010303_lung_E18_mito_3_step07.2925.2925.2	4.1949	0.6341	2499.73	1	4550.0%	4	K.MAEYTHSAGVPSLNAALMHTLQR.H
UGR78_MOUSE99.6%2371587737.3%655724225.2(P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP)
	TK010303_lung_E18_mito_3_step01.0066.0066.1	1.0228	0.1997	498.49	1	8330.0%	2	K.LIPR.N
	TK010303_lung_E18_mito_3_step02.1808.1808.2	2.3557	0.1756	1607.57	7	4290.0%	1	K.TKPYIQVDIGGGQTK.T
	TK010303_lung_E18_mito_3_step07.2074.2074.2	2.6222	0.4488	1736.75	1	5330.0%	5	K.KTKPYIQVDIGGGQTK.T
	TK010303_lung_E18_mito_3_step01.1086.1086.1	1.7144	0.2177	1430.51	1	5450.0%	1	R.TWNDPSVQQDIK.F
	TK010303_lung_E18_mito_3_step09.2476.2476.2	3.8288	0.5508	2019.85	1	5590.0%	15	K.KVTHAVVTVPAYFNDAQR.Q
	TK010303_lung_E18_mito_3_step07.4153.4153.2	4.6627	0.5881	2002.64	1	6760.0%	29	R.GVPQIEVTFEIDVNGILR.V
	TK010303_lung_E18_mito_3_step05.3410.3410.2	2.5696	0.4556	2320.43	1	2860.0%	8	K.EDVGTVVGIDLGTTYSCVGVFK.N
	TK010303_lung_E18_mito_3_step01.1524.1524.1	1.9384	0.2065	1319.51	1	5000.0%	2	R.NELESYAYSLK.N
*	TK010303_lung_E18_mito_3_step10.3186.3186.2	3.0198	0.5141	2153.24	1	3820.0%	118	R.IEIESFFEGEDFSETLTR.A
	TK010303_lung_E18_mito_3_step01.2460.2460.1	2.4027	0.4834	1540.65	1	5000.0%	6	K.TFAPEEISAMVLTK.M
	TK010303_lung_E18_mito_3_step01.1860.1860.1	1.6901	0.1985	1399.77	1	6820.0%	1	K.ELEEIVQPIISK.L
	TK010303_lung_E18_mito_3_step01.1611.1611.2	2.1991	0.2854	1890.35	1	3750.0%	2	K.VTHAVVTVPAYFNDAQR.Q
	TK010303_lung_E18_mito_3_step04.2551.2551.2	2.1772	0.2884	1592.65	1	5360.0%	4	K.KSDIDEIVLVGGSTR.I
	TK010303_lung_E18_mito_3_step01.0895.0895.1	1.3939	0.1367	1193.54	213	3890.0%	1	K.VYEGERPLTK.D
	TK010303_lung_E18_mito_3_step01.0036.0036.1	1.615	0.0702	758.42	10	6670.0%	1	R.NTVVPTK.K
	TK010303_lung_E18_mito_3_step10.4350.4350.3	3.7143	0.4051	4572.91	1	1790.0%	24	K.NILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQR.V
	TK010303_lung_E18_mito_3_step02.2204.2204.1	1.1584	0.1304	1460.78	1	4230.0%	1	K.SDIDEIVLVGGSTR.I
	TK010303_lung_E18_mito_3_step01.0850.0850.1	1.3697	0.0954	728.57	2	8000.0%	2	K.IQQLVK.E
	TK010303_lung_E18_mito_3_step01.4255.4255.2	2.6868	0.1984	1936.52	2	4710.0%	2	K.DNHLLGTFDLTGIPPAPR.G
UNNTM_MOUSE99.6%10387.1%10861138987.6(Q61941) NAD(P) transhydrogenase, mitochondrial precursor (EC 1.6.1.2) (Pyridine nucleotide transhydrogenase) (Nicotinamide nucleotide transhydrogenase)
*	TK010303_lung_E18_mito_3_step07.4293.4293.3	1.9504	0.1608	3224.22	2	1750.0%	3	R.VTIAQGYDALSSMANISGYKAVVLAANHFGR.F
*	TK010303_lung_E18_mito_3_step05.4478.4478.3	3.5866	0.2024	3984.65	1	1740.0%	5	R.APMVNPTLGAHEADFLKPSGTLISFIYPAQNPDLLNK.L
	TK010303_lung_E18_mito_3_step06.1770.1770.1	1.4068	0.0884	954.58	1	6880.0%	2	R.FGIHPVAGR.M
UVDP_MOUSE99.6%5711.2%9411051534.9(Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment)
	TK010303_lung_E18_mito_3_step05.4338.4338.2	1.2903	0.0501	3036.46	2	1850.0%	1	K.QLGPPVQQIILVSPMGVSRLMDLLADSR.E
	TK010303_lung_E18_mito_3_step04.2541.2541.3	2.1272	0.1005	4121.73	5	1620.0%	1	R.QSEDLGSQFTEIFIKQPENVTLLLSLLEEFDFHVR.W
	TK010303_lung_E18_mito_3_step05.3101.3101.2	1.6628	0.2037	2739.26	2	2270.0%	2	R.ASQKPQPNFPSPEYMIFDHEFTK.L
	TK010303_lung_E18_mito_3_step11.3661.3661.2	3.8045	0.5706	2203.78	1	5830.0%	1	R.LEVGIQAMEHLIHVLQTDR.S
UCATA_MOUSE99.6%204829.8%526596347.9(P24270) Catalase (EC 1.11.1.6)
*	TK010303_lung_E18_mito_3_step01.2236.2236.1	2.2289	0.3487	1504.88	1	4170.0%	2	R.DAILFPSFIHSQK.R
	TK010303_lung_E18_mito_3_step02.3320.3320.2	5.0991	0.6493	2191.81	1	6940.0%	5	R.GPLLVQDVVFTDEMAHFDR.E
	TK010303_lung_E18_mito_3_step08.1889.1889.2	2.2946	0.1616	1311.12	1	6500.0%	1	K.RLCENIAGHLK.D
	TK010303_lung_E18_mito_3_step01.4136.4136.2	2.5454	0.4623	2519.73	1	3500.0%	1	K.FYTEDGNWDLVGNNTPIFFIR.D
*	TK010303_lung_E18_mito_3_step01.1278.1278.1	1.4895	0.1148	1546.68	22	3080.0%	2	R.SALEHSVQCAVDVK.R
	TK010303_lung_E18_mito_3_step10.2249.2249.2	2.7842	0.4944	1649.24	1	6540.0%	1	K.VWPHKDYPLIPVGK.L
	TK010303_lung_E18_mito_3_step09.1736.1736.1	2.0393	0.4064	1280.38	1	5500.0%	2	R.HMNGYGSHTFK.L
*	TK010303_lung_E18_mito_3_step01.0263.0263.1	1.893	0.3046	1393.32	1	4090.0%	1	K.NFTDVHPDYGAR.I
	TK010303_lung_E18_mito_3_step11.0963.0963.2	1.2745	0.0635	994.49	3	5710.0%	1	K.RNPQTHLK.D
*	TK010303_lung_E18_mito_3_step08.2930.2930.3	1.7915	0.0476	3788.96	22	1290.0%	2	K.LVLNKNPVNYFAEVEQMAFDPSNMPPGIEPSPDK.M
UM1A2_MOUSE99.6%112.2%641728718.3(P39098) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2)
	TK010303_lung_E18_mito_3_step06.2290.2290.2	3.7742	0.5632	1588.22	1	6920.0%	1	K.NPGVFLIHGPDEHR.H
UMYHB_MOUSE99.6%11257.0%19722270265.5(O08638) Myosin heavy chain, smooth muscle isoform (SMMHC)
	TK010303_lung_E18_mito_3_step11.2940.2940.2	1.5554	0.1226	2469.66	3	3060.0%	3	K.LQQLFNHTMFILEQEEYQR.E
	TK010303_lung_E18_mito_3_step09.2616.2616.2	1.118	0.0141	2790.26	45	1800.0%	2	K.DSSITGELEKQLLQANPILEAFGNAK.T
	TK010303_lung_E18_mito_3_step12.1567.1567.3	2.205	0.0995	3298.65	4	1550.0%	3	K.VDYNASAWLTKNMDPLNDNVTSLLNASSDK.F
	TK010303_lung_E18_mito_3_step12.3988.3988.2	1.462	0.08	2920.96	269	1250.0%	1	R.LEARIAQLEEELEEEQGNMEAMSDR.V
	TK010303_lung_E18_mito_3_step01.2059.2059.1	1.1881	0.0446	1025.73	4	5620.0%	1	K.ATDKSFVEK.L
	TK010303_lung_E18_mito_3_step05.3012.3012.3	1.9671	0.0958	3488.21	18	1610.0%	1	R.YFSGLIYTYSGLFCVVVNPYKYLPIYSEK.I
UQ9CPV399.6%1126.1%142164939.2(Q9CPV3) 2900055D03Rik protein (RIKEN cDNA 2900055D03 gene)
*	TK010303_lung_E18_mito_3_step12.2225.2225.3	3.671	0.6011	4409.85	1	2220.0%	1	R.TIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILK.A
UQ91VD999.6%91720.9%727797495.7(Q91VD9) Hypothetical 79.7 kDa protein (Unknown) (Protein for MGC:7850)
	TK010303_lung_E18_mito_3_step09.3752.3752.2	1.2079	0.0226	2934.51	9	1540.0%	1	K.VMNILHRIASQVAALDLGYKPGVEAIR.K
	TK010303_lung_E18_mito_3_step07.4068.4068.2	1.7681	0.3271	2762.91	1	2400.0%	1	R.SNYLLNTTIAGVEEADVVLLVGTNPR.F
*	TK010303_lung_E18_mito_3_step10.4279.4279.3	1.7471	0.0071	4514.96	50	990.0%	1	R.EGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSR.F
	TK010303_lung_E18_mito_3_step11.1603.1603.3	1.4373	0.0266	2125.15	11	2660.0%	1	R.ILPRMHEDINEEWISDK.T
*	TK010303_lung_E18_mito_3_step10.3771.3771.2	1.8001	0.2215	2915.21	11	1720.0%	2	R.VAGMLQNFEGNAVAAIAGGLVDAEALVALK.D
	TK010303_lung_E18_mito_3_step06.2055.2055.1	1.7298	0.3014	1385.78	1	4170.0%	3	K.KPMVVLGSSALQR.D
UPDA3_MOUSE99.6%2910720.6%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57)
	TK010303_lung_E18_mito_3_step01.0810.0810.1	1.6081	0.2223	789.53	1	6670.0%	2	K.FLDAGHK.L
*	TK010303_lung_E18_mito_3_step01.2320.2320.2	2.4133	0.3967	2152.58	1	4710.0%	1	K.FIQDSIFGLCPHMTEDNK.D
*	TK010303_lung_E18_mito_3_step03.2875.2875.2	5.2011	0.6858	2284.47	1	6390.0%	7	K.KFIQDSIFGLCPHMTEDNK.D
	TK010303_lung_E18_mito_3_step01.1896.1896.1	2.153	0.3869	1344.58	1	5910.0%	2	K.GFPTIYFSPANK.K
	TK010303_lung_E18_mito_3_step01.1088.1088.1	1.2497	0.2612	1040.63	2	5000.0%	2	R.TADGIVSHLK.K
	TK010303_lung_E18_mito_3_step07.1538.1538.1	1.5006	0.2399	916.46	1	7140.0%	1	K.KFLDAGHK.L
*	TK010303_lung_E18_mito_3_step02.2704.2704.2	3.1572	0.5623	2305.2	1	3160.0%	4	K.EYDDNGEGITIFRPLHLANK.F
*	TK010303_lung_E18_mito_3_step01.1846.1846.1	1.5219	0.2452	1397.64	25	3640.0%	2	R.DLFSDGHSEFLK.A
*	TK010303_lung_E18_mito_3_step03.3063.3063.2	2.2377	0.1633	2822.66	16	1960.0%	2	K.EYDDNGEGITIFRPLHLANKFEDK.T
	TK010303_lung_E18_mito_3_step01.0135.0135.1	1.2714	0.1879	871.61	1	6430.0%	2	K.DPNIVIAK.M
*	TK010303_lung_E18_mito_3_step03.2181.2181.1	1.8276	0.3092	1261.67	1	6000.0%	4	R.FAHTNIESLVK.E
UKAD4_MOUSE99.6%3523.8%223250627.5(Q9WUR9) Adenylate kinase isoenzyme 4, mitochondrial (EC 2.7.4.3) (ATP-AMP transphosphorylase)
*	TK010303_lung_E18_mito_3_step09.3558.3558.3	1.6684	0.0923	3984.38	243	930.0%	1	R.VYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAAR.L
*	TK010303_lung_E18_mito_3_step12.2203.2203.2	4.2089	0.5433	1892.4	1	5000.0%	2	R.IAQNFGLQHLSSGHLLR.E
UGBG5_HUMAN99.6%83439.7%6873189.9(P30670) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-5 subunit (P30670) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-5 subunit
	TK010303_lung_E18_mito_3_step08.2806.2806.2	1.3669	0.0436	3072.93	1	1920.0%	5	K.QFCLQNAQHDPLLTGVSSSTNPFRPQK.V
UQ8VC9399.6%2220.3%128145518.4(Q8VC93) Prion protein interacting protein
	TK010303_lung_E18_mito_3_step07.2584.2584.3	1.8304	0.0863	2880.09	158	1600.0%	1	K.NGLLDMNKGLSLQHIGRPHSGIDDCK.N
	TK010303_lung_E18_mito_3_step12.1528.1528.2	3.4384	0.5151	1991.18	1	5290.0%	1	K.GLSLQHIGRPHSGIDDCK.N
UQ9CWW199.6%3511.6%379421588.6(Q9CWW1) 2410003B16Rik protein
	TK010303_lung_E18_mito_3_step11.2337.2337.2	1.6643	0.1101	2714.76	5	2290.0%	2	K.VSGLPTPDLSWQLDGKPIRPDSAHK.M
	TK010303_lung_E18_mito_3_step12.2367.2367.2	4.5458	0.6276	2188.75	1	6940.0%	1	R.FFRPHFLQAPGDLTVQEGK.L
UGB11_MOUSE99.6%115.0%359420246.0(P21278) Guanine nucleotide-binding protein, alpha-11 subunit
*	TK010303_lung_E18_mito_3_step10.2837.2837.2	3.6993	0.5138	2169.95	1	5290.0%	1	K.ILHSHLVDYFPEFDGPQR.D
UQ9ESW499.6%3510.2%421469768.4(Q9ESW4) Putative lipid kinase (Similar to hypothetical protein FLJ10842)
*	TK010303_lung_E18_mito_3_step08.2030.2030.2	1.4297	0.1394	2166.25	2	2940.0%	2	R.ERPPIEPEETPPRPSLYR.R
*	TK010303_lung_E18_mito_3_step11.2613.2613.2	4.4299	0.6288	2860.95	1	4380.0%	1	K.AAHFFSTLQEWPQTHQASISYTGPR.E
UQ9Z2L699.6%3510.8%481545377.5(Q9Z2L6) Multiple inositol polyphosphate phosphatase
*	TK010303_lung_E18_mito_3_step11.2183.2183.2	3.5554	0.4489	2049.86	1	4710.0%	2	K.VLPLAHSQRPVGLYEELK.T
*	TK010303_lung_E18_mito_3_step03.3371.3371.3	1.8833	0.0596	3825.02	14	1360.0%	1	R.CVDSSAAFLQGLWQHYHPGLPPPDVSDMECGPPR.I
UQ9D1E399.6%51718.1%204232746.2(Q9D1E3) 1110013G13Rik protein
	TK010303_lung_E18_mito_3_step02.2368.2368.2	3.409	0.4557	2691.55	1	3640.0%	4	K.GAISCVNVHICDSPFHCTMEEAR.S
	TK010303_lung_E18_mito_3_step11.3200.3200.2	4.1104	0.5792	1742.82	1	7310.0%	1	K.FKPGYLEATLNWFR.L
UUBC7_HUMAN99.6%2414.3%154178628.5(P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC)
	TK010303_lung_E18_mito_3_step05.3654.3654.2	1.7526	0.3498	2485.62	1	2620.0%	2	K.TDQVIQSLIALVNDPQPEHPLR.A
UQ9D90099.6%2210.4%327373367.5(Q9D900) 1810014G04Rik protein
*	TK010303_lung_E18_mito_3_step12.2663.2663.2	3.7473	0.6048	2429.0	1	3860.0%	1	R.KMHPLPGTQLLDMAGGTGDIAFR.F
*	TK010303_lung_E18_mito_3_step02.1914.1914.1	1.2236	0.0391	1378.56	187	3500.0%	1	R.FLSYVQAQHQR.R
UQ91VM999.6%114.8%330381157.0(Q91VM9) Similar to pyrophosphatase (Inorganic)
*	TK010303_lung_E18_mito_3_step12.2179.2179.2	4.1351	0.5809	1832.29	1	5670.0%	1	K.HVAGHYISPFHDIPLK.A
UHGD_MOUSE99.6%3320.2%445499907.2(O09173) Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase)
*	TK010303_lung_E18_mito_3_step12.2125.2125.3	3.312	0.4756	3749.97	1	1880.0%	1	R.ILPSVSHKPFESIDQGHVTHNWDEVGPDPNQLR.W
*	TK010303_lung_E18_mito_3_step06.3365.3365.3	1.8401	0.0482	4193.64	30	1220.0%	1	R.FSVDVFEETRGYILEVYGVHFELPDLGPIGANGLANPR.D
*	TK010303_lung_E18_mito_3_step07.4472.4472.2	1.2084	0.0083	2164.73	23	2220.0%	1	K.SNNGLAVHIFLCNSSMENR.C
UPAHX_MOUSE99.6%114.7%338386077.5(O35386) Phytanoyl-CoA dioxygenase, peroxisomal precursor (EC 1.14.11.18) (Phytanoyl-CoA alpha-hydroxylase) (PhyH) (Phytanic acid oxidase) (Lupus nephritis-associated peptide 1)
*	TK010303_lung_E18_mito_3_step10.2633.2633.2	3.4707	0.5519	1753.25	1	6000.0%	1	K.GDTVFFHPLLIHGSGR.N
UCOF1_MOUSE99.6%2244222.3%166185608.1(P18760) Cofilin, non-muscle isoform
*	TK010303_lung_E18_mito_3_step09.3666.3666.2	4.8268	0.653	2021.22	1	6250.0%	21	K.KEDLVFIFWAPENAPLK.S
*	TK010303_lung_E18_mito_3_step01.2364.2364.2	1.6431	0.2892	2198.11	5	2630.0%	1	K.EILVGDVGQTVDDPYTTFVK.M
UQ9CX8199.6%225.2%462518156.4(Q9CX81) 3100002P13Rik protein
	TK010303_lung_E18_mito_3_step12.1109.1109.1	1.3058	0.0518	1133.86	13	5560.0%	1	R.TVDADVLSRR.C
	TK010303_lung_E18_mito_3_step12.2083.2083.2	3.4651	0.3956	1664.09	1	6150.0%	1	R.RLPAFTLSHLESHR.A
UAMAC_MOUSE99.6%4620.3%380415877.4(O09174) Alpha-methylacyl-CoA racemase (EC 5.1.99.4) (2-methylacyl-CoA racemase)
*	TK010303_lung_E18_mito_3_step03.2876.2876.2	1.3204	0.0462	2541.23	13	2050.0%	1	R.ERASFITDGEQLPSPRPAPLLSR.T
*	TK010303_lung_E18_mito_3_step10.3319.3319.3	4.2955	0.577	3584.42	1	2840.0%	2	K.AEWCQIFDGTDACVTPVLTFEEALHHQHNR.E
*	TK010303_lung_E18_mito_3_step03.4569.4569.2	0.7474	0.1224	2635.77	126	1090.0%	1	R.SGRGQIIDSSMVEGTAYLSSFLWK.T
UMTX2_MOUSE99.6%248.4%263297585.6(O88441) Metaxin 2
	TK010303_lung_E18_mito_3_step09.3747.3747.2	3.8284	0.5329	2407.34	1	4520.0%	2	K.VPFIHVGNQVVSELGPIVQFVK.A
UGSHR_MOUSE99.6%102420.8%500536758.1(P47791) Glutathione reductase, mitochondrial precursor (EC 1.6.4.2) (GR) (GRase)
*	TK010303_lung_E18_mito_3_step05.3525.3525.2	1.5441	0.1023	2698.38	10	1960.0%	2	R.KPTTTVIPDVDCLLWAIGRDPNSK.G
*	TK010303_lung_E18_mito_3_step05.1897.1897.2	1.1286	0.068	1631.84	11	3330.0%	1	K.TSSGLELQVVTSVPGR.K
*	TK010303_lung_E18_mito_3_step08.3678.3678.2	1.6694	0.0901	2157.03	4	2500.0%	4	R.KPTTTVIPDVDCLLWAIGR.D
*	TK010303_lung_E18_mito_3_step06.4353.4353.3	2.4102	0.3936	3894.03	2	1510.0%	1	R.ALTCTMASPGEPQPPAPDTSSFDYLVIGGGSGGLASARR.A
*	TK010303_lung_E18_mito_3_step09.2710.2710.3	2.113	0.2793	2711.31	3	2290.0%	1	K.SHIEIIHGYATFADGPRPTVEVNGK.K
UQ6129199.6%337110.3%45455047695.4(Q61291) AM2 receptor
	TK010303_lung_E18_mito_3_step01.1052.1052.1	1.1485	0.0239	677.82	4	7500.0%	1	R.QMEIR.G
	TK010303_lung_E18_mito_3_step04.1835.1835.3	1.4836	0.1652	2747.02	94	1590.0%	1	K.SEPVHPFGLAVYGEHIFWTDWVR.R
*	TK010303_lung_E18_mito_3_step03.3437.3437.3	1.8622	0.0522	3799.66	3	1410.0%	1	R.AVNSSCRAQDEFECANGECISFSLTCDGVSHCK.D
*	TK010303_lung_E18_mito_3_step09.2312.2312.3	1.9079	0.0034	4701.31	1	1410.0%	1	K.DFDECSVYGTCSQLCTNTDGSFTCGCVEGYLLQPDNRSCK.A
*	TK010303_lung_E18_mito_3_step05.3882.3882.3	1.9926	0.1002	4328.1	29	1180.0%	1	K.DFDECSVYGTCSQLCTNTDGSFTCGCVEGYLLQPDNR.S
	TK010303_lung_E18_mito_3_step09.2662.2662.1	3.0554	0.5169	1462.46	1	5450.0%	3	K.KPEHELFLVYGK.G
	TK010303_lung_E18_mito_3_step06.4335.4335.2	1.3307	0.029	3151.63	85	1210.0%	1	K.RAFINGTGVETVVSADLPNAHGLAVDWVSR.N
*	TK010303_lung_E18_mito_3_step10.2433.2433.3	1.6758	0.0938	3220.75	297	1200.0%	1	R.CDGDTDCMDSSDEKSCEGVTHVCDPNVK.F
*	TK010303_lung_E18_mito_3_step08.2413.2413.2	3.5736	0.5877	2491.59	1	4520.0%	5	R.SLFPGHPHSAYEQTFQGDESVR.I
	TK010303_lung_E18_mito_3_step11.1235.1235.1	2.0113	0.2403	1153.76	2	5560.0%	2	K.GGALHIYHQR.R
	TK010303_lung_E18_mito_3_step04.2363.2363.3	1.7267	0.105	3639.02	2	1770.0%	1	K.TLISGMIDEPHAIVVDPLRGTMYWSDWGNHPK.I
	TK010303_lung_E18_mito_3_step09.3024.3024.3	1.5905	0.0411	3650.62	213	1210.0%	1	R.QTTAMDFSYANETVCWVHVGDSAAQTQLKCAR.M
	TK010303_lung_E18_mito_3_step05.3173.3173.2	2.619	0.3433	2394.29	1	3570.0%	1	R.SGQQACEGVGSFLLYSVHEGIR.G
	TK010303_lung_E18_mito_3_step09.2231.2231.2	1.3972	0.0936	1839.79	123	2500.0%	1	R.ACACAHGMLAEDGASCR.E
	TK010303_lung_E18_mito_3_step11.3551.3551.3	2.4961	0.3023	3939.57	1	1390.0%	1	K.NEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTR.Q
	TK010303_lung_E18_mito_3_step11.2132.2132.2	5.7974	0.6945	2067.19	1	6670.0%	3	K.NAVVQGLEQPHGLVVHPLR.G
	TK010303_lung_E18_mito_3_step04.2033.2033.2	3.8904	0.5608	2920.72	1	3800.0%	2	R.SHACENDQYGKPGGCSDICLLANSHK.A
	TK010303_lung_E18_mito_3_step05.3852.3852.3	2.5948	0.0843	3710.62	4	1480.0%	1	R.VEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFR.Y
*	TK010303_lung_E18_mito_3_step11.2721.2721.2	1.1769	0.094	3070.91	2	2000.0%	1	R.NTIALDFHLSQSALYWTDAVEDKIYR.G
	TK010303_lung_E18_mito_3_step11.3935.3935.2	1.4423	0.0698	3175.27	5	1670.0%	1	R.VRSHACENDQYGKPGGCSDICLLANSHK.A
	TK010303_lung_E18_mito_3_step02.1857.1857.2	1.1209	0.0057	2061.89	5	2780.0%	1	R.TTLLAGDIEHPRAIALDPR.D
UQ924V899.6%4253227.4%565618106.8(Q924V8) Carboxylesterase MH1 (EC 3.1.1.1)
	TK010303_lung_E18_mito_3_step01.4192.4192.2	3.3517	0.581	2138.52	1	5260.0%	2	K.AVIGDHGDEIFSVFGSPFLK.D
	TK010303_lung_E18_mito_3_step01.3002.3002.2	3.196	0.0931	1875.66	1	6560.0%	1	K.ESYPFLPTVIDGVVLPK.A
	TK010303_lung_E18_mito_3_step04.4258.4258.2	3.5789	0.5514	2861.92	1	3700.0%	15	K.ENIPLQFSEDCLYLNIYTPADLTK.N
	TK010303_lung_E18_mito_3_step02.4257.4257.2	2.0929	0.2043	3148.34	1	2420.0%	17	R.AISESGVSLTAALITTDVKPIAGLVATLSGCK.T
	TK010303_lung_E18_mito_3_step11.4336.4336.2	1.4796	0.062	2874.06	58	1600.0%	1	K.NTTSYPPMCSQDAVGGQVLSELFTNR.K
	TK010303_lung_E18_mito_3_step05.3496.3496.2	1.3358	0.1811	3004.93	1	1920.0%	1	K.NTTSYPPMCSQDAVGGQVLSELFTNRK.E
	TK010303_lung_E18_mito_3_step01.3963.3963.2	2.4411	0.2141	2309.3	1	3750.0%	3	K.DLFQDLMADVVFGVPSVIVSR.S
	TK010303_lung_E18_mito_3_step05.2669.2669.2	0.9344	0.0134	2434.5	9	1900.0%	1	K.KDLFQDLMADVVFGVPSVIVSR.S
	TK010303_lung_E18_mito_3_step02.2201.2201.1	2.1221	0.2692	1438.8	1	4170.0%	1	R.GNWGHLDQVAALR.W
UQ9DBG499.6%229.9%594663196.8(Q9DBG4) 1300012G16Rik protein
	TK010303_lung_E18_mito_3_step12.2635.2635.2	3.592	0.5642	2649.79	1	4550.0%	1	K.LLPGGHDLLVAHNTWNSYQNMLR.I
	TK010303_lung_E18_mito_3_step05.2120.2120.3	2.1542	0.1599	4203.12	4	1360.0%	1	K.TTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTK.N
UQ9D1G199.6%3526.9%201221875.7(Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene)
*	TK010303_lung_E18_mito_3_step09.2772.2772.3	1.4051	0.0097	3564.69	60	1410.0%	1	K.EFADSLGVPFLETSAKNATNVEQAFMTMAAEIK.K
	TK010303_lung_E18_mito_3_step08.2670.2670.2	3.4179	0.4889	2282.05	1	4250.0%	2	R.GAHGIIVVYDVTDQESYANVK.Q
UDYNA_MOUSE99.6%91312.9%12811417276.0(O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued)
*	TK010303_lung_E18_mito_3_step08.4214.4214.2	1.2332	0.0703	1803.02	35	2500.0%	1	R.TPSGSRMSTEASARPLR.V
*	TK010303_lung_E18_mito_3_step07.3689.3689.2	1.2137	0.0034	2763.43	53	1350.0%	1	R.MPGTDAPGIPAALAFGSQVSDTLLDCR.K
*	TK010303_lung_E18_mito_3_step12.2293.2293.3	1.9711	0.0358	3830.94	32	1290.0%	2	R.IHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGR.L
	TK010303_lung_E18_mito_3_step06.2658.2658.2	1.2533	0.177	2785.08	4	1880.0%	1	K.LATAMQEGEYDAERPPSKPPPVELR.A
*	TK010303_lung_E18_mito_3_step12.3121.3121.3	2.2393	0.1997	3285.95	61	1330.0%	1	K.ASLAALPPLHVAKLSLPPHEGPGGNLVAGALYR.K
*	TK010303_lung_E18_mito_3_step10.1979.1979.2	1.4857	0.0027	1690.32	8	5000.0%	2	R.LHISQLQHENSILR.G
*	TK010303_lung_E18_mito_3_step05.1956.1956.2	3.6212	0.5297	1734.52	1	5710.0%	1	K.LNQLSTHTHVVDITR.S
UHS9B_MOUSE99.6%8165.7%723831945.0(P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA)
	TK010303_lung_E18_mito_3_step03.2451.2451.2	3.9013	0.4456	1783.9	1	6790.0%	2	K.HLEINPDHPIVETLR.Q
	TK010303_lung_E18_mito_3_step10.1977.1977.2	3.7501	0.4797	1911.61	1	6000.0%	2	K.KHLEINPDHPIVETLR.Q
	TK010303_lung_E18_mito_3_step01.1244.1244.1	1.5815	0.1167	1277.66	16	4090.0%	2	R.ELISNASDALDK.I
	TK010303_lung_E18_mito_3_step01.1871.1871.1	1.5326	0.0974	1351.89	1	4170.0%	2	R.TLTLVDTGIGMTK.A
UKAD2_MOUSE99.6%104423.4%231256947.3(Q9WTP6) Adenylate kinase isoenzyme 2, mitochondrial (EC 2.7.4.3) (ATP-AMP transphosphorylase)
	TK010303_lung_E18_mito_3_step01.0556.0556.1	1.811	0.0539	982.28	1	6500.0%	6	R.AVLLGPPGAGK.G
*	TK010303_lung_E18_mito_3_step12.3625.3625.2	3.4384	0.5116	2633.01	1	3750.0%	2	R.GIHCAIDASQTPDIVFASILAAFSK.A
*	TK010303_lung_E18_mito_3_step09.4212.4212.2	1.6579	0.035	2108.96	4	2650.0%	2	K.EELDSVIEFSIQDSLLIR.R
UQ9Z2I099.6%9416.5%738829896.5(Q9Z2I0) Leucine zipper-EF-hand containing transmembrane protein 1
*	TK010303_lung_E18_mito_3_step03.3580.3580.2	4.54	0.599	2702.37	1	4570.0%	5	K.RVQQMIGQIDGLITQLETTQQDGK.L
*	TK010303_lung_E18_mito_3_step05.3733.3733.2	4.3329	0.6481	2447.52	1	4130.0%	4	K.LGPSQSTPTGESVISITELISAMK.Q
UQ9UJR599.6%1188.6%3534926.6(Q9UJR5) LST-1/M protein
*	TK010303_lung_E18_mito_3_step10.3413.3413.3	3.5383	0.3515	3063.67	1	2170.0%	1	R.NDAPSVLVPGPGLLRAGTPLCISAEAASAQQ.-
UDLDH_MOUSE99.6%6986141.1%509542127.9(O08749) Dihydrolipoamide dehydrogenase, mitochondrial precursor (EC 1.8.1.4)
	TK010303_lung_E18_mito_3_step02.3316.3316.3	2.2591	0.1032	3814.73	119	1110.0%	1	K.STDRVLGAHILGPGAGEMVNEAALALEYGASCEDIAR.V
	TK010303_lung_E18_mito_3_step09.2223.2223.2	2.616	0.5309	1527.71	1	7080.0%	2	R.VCHAHPTLSEAFR.E
*	TK010303_lung_E18_mito_3_step04.3169.3169.2	2.8864	0.4677	2173.25	1	4720.0%	10	R.RPFTQNLGLEELGIELDPK.G
	TK010303_lung_E18_mito_3_step05.2696.2696.1	1.7851	0.3382	1129.66	1	5500.0%	3	K.ALTGGIAHLFK.Q
	TK010303_lung_E18_mito_3_step03.3348.3348.2	4.1204	0.6806	1983.3	1	5560.0%	2	K.IPNIYAIGDVVAGPMLAHK.A
*	TK010303_lung_E18_mito_3_step01.2292.2292.1	2.9428	0.6198	1465.6	1	6540.0%	2	R.EANLAAAFGKPINF.-
	TK010303_lung_E18_mito_3_step09.2111.2111.2	3.451	0.5036	1759.01	1	5710.0%	3	K.ALLNNSHYYHMAHGK.D
	TK010303_lung_E18_mito_3_step09.4220.4220.2	2.6087	0.3462	1719.51	3	3930.0%	4	K.AEVITCDVLLVCIGR.R
*	TK010303_lung_E18_mito_3_step09.3446.3446.2	1.2998	0.0243	2385.39	1	2750.0%	1	R.RPFTQNLGLEELGIELDPKGR.I
	TK010303_lung_E18_mito_3_step06.4071.4071.3	2.3712	0.1079	4247.68	7	1120.0%	6	K.AEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGK.S
	TK010303_lung_E18_mito_3_step09.3755.3755.3	4.1068	0.3413	3356.66	1	2500.0%	6	R.VLGAHILGPGAGEMVNEAALALEYGASCEDIAR.V
*	TK010303_lung_E18_mito_3_step07.4025.4025.2	4.5232	0.5466	2532.91	1	4790.0%	25	R.LGADVTAVEFLGHVGGIGIDMEISK.N
UQ9DBG699.6%6187.9%631690635.8(Q9DBG6) 1300012C06Rik protein
	TK010303_lung_E18_mito_3_step01.2739.2739.2	1.9426	0.0668	2609.7	3	2390.0%	1	K.EETVLATVQALQTASHLSQQADLR.N
	TK010303_lung_E18_mito_3_step02.2369.2369.2	3.6264	0.5683	2526.33	1	4090.0%	1	R.YHVPVVVVPEGSTSDTQEQAILR.L
	TK010303_lung_E18_mito_3_step05.3333.3333.2	3.7177	0.5581	2909.77	1	3080.0%	4	R.LGKEETVLATVQALQTASHLSQQADLR.N
UQ9D1H899.6%52515.3%118127389.5(Q9D1H8) 1110007K17Rik protein (Mitochondrial ribosomal protein L53)
*	TK010303_lung_E18_mito_3_step09.3364.3364.2	5.2471	0.6443	1939.83	1	7650.0%	5	R.GAHLTTQEMLSALASHIR.D
UQ9D1I599.6%62016.3%178190179.1(Q9D1I5) 1110007A04Rik protein
*	TK010303_lung_E18_mito_3_step05.3370.3370.2	1.6853	0.1718	3006.81	1	1960.0%	4	R.DVLGAQVSEVVPLPEHGVSVVFVNLGNTK.M
UTFR1_MOUSE99.6%225.9%763857316.6(Q62351) Transferrin receptor protein 1 (TfR1) (TR) (TfR) (Trfr)
*	TK010303_lung_E18_mito_3_step09.1807.1807.2	1.4165	0.0842	2876.92	9	1600.0%	1	K.DFEELSYSVNGSLVIVRAGEITFAEK.V
*	TK010303_lung_E18_mito_3_step12.3060.3060.2	4.8334	0.6292	2097.29	1	6390.0%	1	R.HIFWGSGSHTLSALVENLK.L
UQ9CRK799.6%3916.1%118128626.8(Q9CRK7) 9430095H01Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step07.2446.2446.2	3.9154	0.6394	2082.25	1	5000.0%	3	K.TITGFQTHTTPVLLAHGER.A
UQ9DAU199.6%4618.8%276305385.6(Q9DAU1) 1600025D17Rik protein (Putative retinoic acid-regulated protein) (RIKEN cDNA 1600025D17 gene)
	TK010303_lung_E18_mito_3_step05.2777.2777.2	1.0797	0.0159	2709.6	77	1520.0%	1	K.GVKVVMDIPYELWNETSAEVADLK.K
	TK010303_lung_E18_mito_3_step10.3745.3745.2	3.9126	0.5445	2486.97	1	5000.0%	2	K.KQCDVLVEEFEEVIEDWYR.N
	TK010303_lung_E18_mito_3_step07.2070.2070.1	1.2424	0.0859	1145.83	4	5000.0%	1	K.RLLDYSLHK.E
UQ99JA399.6%242.9%578653608.4(Q99JA3) Neuronal development-associated protein (Neuronal development-associated protein 7)
*	TK010303_lung_E18_mito_3_step12.2172.2172.2	3.4304	0.5215	1960.87	1	4060.0%	2	K.RPPDNEALPVPFLHAQR.Y
UFLNA_HUMAN99.6%162012.7%26472807596.1(P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin)
*	TK010303_lung_E18_mito_3_step10.4221.4221.3	1.7244	0.0355	2417.13	59	1800.0%	1	R.AGQSAAGAAPGGGVDTRDAEMPATEK.D
*	TK010303_lung_E18_mito_3_step03.2564.2564.2	1.5212	0.0604	2371.78	81	1750.0%	1	R.EGPYSISVLYGDEEVPRSPFK.V
*	TK010303_lung_E18_mito_3_step11.2595.2595.2	1.2593	0.1118	2684.78	1	2390.0%	2	R.CSYQPTMEGVHTVHVTFAGVPIPR.S
*	TK010303_lung_E18_mito_3_step11.1060.1060.2	3.4521	0.6521	1635.38	1	6000.0%	1	R.VHGPGIQSGTTNKPNK.F
*	TK010303_lung_E18_mito_3_step10.2415.2415.3	1.6567	0.0096	3380.29	249	1290.0%	1	R.VTYCPTEPGNYIINIKFADQHVPGSPFSVK.V
*	TK010303_lung_E18_mito_3_step07.2105.2105.2	2.344	0.1993	2588.3	1	2950.0%	1	K.KTHIQDNHDGTYTVAYVPDVTGR.Y
*	TK010303_lung_E18_mito_3_step03.2891.2891.2	1.8668	0.2302	2440.47	1	2860.0%	1	R.VSGQGLHEGHTFEPAEFIIDTR.D
*	TK010303_lung_E18_mito_3_step04.4202.4202.2	3.3655	0.5156	2699.46	1	3080.0%	1	K.SADFVVEAIGDDVGTLGFSVEGPSQAK.I
*	TK010303_lung_E18_mito_3_step04.1975.1975.2	2.1579	0.3628	1701.78	1	5000.0%	2	R.TGVELGKPTHFTVNAK.A
*	TK010303_lung_E18_mito_3_step05.2004.2004.1	1.0606	0.0786	838.33	108	5000.0%	1	K.HGGKAPLR.V
*	TK010303_lung_E18_mito_3_step01.2007.2007.1	1.6165	0.2955	1102.79	2	5500.0%	1	R.VRAVPTGDASK.C
*	TK010303_lung_E18_mito_3_step02.3609.3609.2	1.6315	0.0609	2894.52	2	1960.0%	1	K.VGSAADIPINISETDLSLLTATVVPPSGR.E
*	TK010303_lung_E18_mito_3_step07.2726.2726.3	1.8165	0.0762	3971.5	3	1450.0%	1	R.LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASK.V
*	TK010303_lung_E18_mito_3_step11.2221.2221.3	1.5939	0.1331	4562.19	18	1010.0%	1	K.AHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIR.N
UQ6164699.6%115.8%347387526.3(Q61646) Haptoglobin
*	TK010303_lung_E18_mito_3_step08.3090.3090.2	4.1336	0.5797	2127.95	1	4740.0%	1	R.HGLTTGATLISDQWLLTTAK.N
UQ9D1L099.6%1115.7%153156619.6(Q9D1L0) Ethanol induced 6
*	TK010303_lung_E18_mito_3_step11.1069.1069.2	3.9316	0.6419	2153.15	1	5000.0%	1	R.RAPAAQPPAAAAPSAVGSPAAAPR.Q
UPOR3_MOUSE99.6%4167.1%283307538.8(Q60931) Voltage-dependent anion-selective channel protein 3 (VDAC-3) (mVDAC3) (Outer mitochondrial membrane protein porin 3)
	TK010303_lung_E18_mito_3_step08.2553.2553.2	2.6845	0.4651	2102.31	1	3950.0%	4	K.VNNASLIGLGYTQTLRPGVK.L
UHS71_MOUSE99.6%71317.3%641699945.6(P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2)
	TK010303_lung_E18_mito_3_step03.2188.2188.2	1.3942	0.1424	2531.41	77	1740.0%	1	R.GVPQIEVTFDIDANGILNVTATDK.S
	TK010303_lung_E18_mito_3_step09.3654.3654.3	1.6912	0.0534	3234.87	18	1700.0%	1	K.MKEIAEAYLGHPVTNAVITVPAYFNDSQR.Q
	TK010303_lung_E18_mito_3_step02.2602.2602.2	2.7242	0.458	2775.0	1	3700.0%	3	K.QTQTFTTYSDNQPGVLIQVYEGER.A
	TK010303_lung_E18_mito_3_step06.3443.3443.2	1.4323	0.1182	2531.36	11	1920.0%	1	R.VCSPIISGLYQGAGAPGAGGFGAQAPK.G
	TK010303_lung_E18_mito_3_step01.0032.0032.1	1.2054	0.142	687.43	1	7500.0%	1	R.LIGDAAK.N
UK1CR_MOUSE99.6%3510.7%422473735.3(P05784) Keratin, type I cytoskeletal 18 (Cytokeratin 18) (Cytokeratin endo B) (Keratin D)
*	TK010303_lung_E18_mito_3_step05.2917.2917.2	1.8177	0.1373	2882.62	1	1920.0%	2	K.KNHEEEVQGLEAQIASSGLTVEVDAPK.S
	TK010303_lung_E18_mito_3_step11.3720.3720.2	4.1047	0.5817	2177.47	1	6180.0%	1	R.LQLETEIEALKEELLFMK.K
UHS47_HUMAN99.6%83816.8%417462678.3(P29043) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Colligin 1)
	TK010303_lung_E18_mito_3_step07.3373.3373.2	3.0086	0.5617	2220.65	1	4170.0%	6	R.TDGALLVNAMFFKPHWDEK.F
	TK010303_lung_E18_mito_3_step07.4038.4038.2	1.213	0.1262	2772.85	23	1590.0%	1	R.TDGALLVNAMFFKPHWDEKFHHK.M
*	TK010303_lung_E18_mito_3_step10.3773.3773.3	1.421	0.0161	4704.22	17	980.0%	1	K.ATTLAEPSTGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGK.A
UQ9H72499.6%229.4%554610156.3(Q9H724) Hypothetical protein FLJ21478
	TK010303_lung_E18_mito_3_step03.4539.4539.3	1.6841	0.0177	3850.36	1	1530.0%	1	R.QVLPPSELLDHLFFHYEFQNQRFSAEVLSSLR.Q
*	TK010303_lung_E18_mito_3_step09.3662.3662.2	3.1059	0.5843	2373.73	1	3680.0%	1	R.EHPSLELLHLYFNELSSEGR.Q
UDPP4_MOUSE99.6%392.2%760874376.4(P28843) Dipeptidyl peptidase IV (EC 3.4.14.5) (DPP IV) (T-cell activation antigen CD26) (Thymocyte-activating molecule) (THAM)
*	TK010303_lung_E18_mito_3_step07.2216.2216.2	3.5466	0.4563	1974.53	1	4690.0%	3	R.FRPAEPHFTSDGSSFYK.I
UQ9CYA099.6%51121.1%350382204.6(Q9CYA0) 5730592L21Rik protein
*	TK010303_lung_E18_mito_3_step12.3160.3160.2	2.8223	0.5412	1961.01	1	5000.0%	3	K.EHPNLFEWFCVHTLK.A
*	TK010303_lung_E18_mito_3_step09.4354.4354.3	1.9797	0.1043	4316.18	2	1320.0%	1	R.LLEIMEGLCDSSDFECNQLLEQQEEQLEAWWQTLK.K
*	TK010303_lung_E18_mito_3_step09.2474.2474.3	1.7941	0.0544	2441.93	83	1850.0%	1	-.MHLLLAAAFGLLLLLPPPGAVASR.K
UO8849399.6%14865.8%26572868818.6(O88493) Type VI collagen alpha 3 subunit
*	TK010303_lung_E18_mito_3_step05.2773.2773.3	1.5639	0.1298	4151.4	3	1400.0%	1	K.SAAVKPASANKPVAAKPVATNTATATARPALAAKPAAAKPAATR.D
*	TK010303_lung_E18_mito_3_step06.3490.3490.2	4.604	0.7088	2339.12	1	5250.0%	9	K.LLTPITTLTSQQIHQILASTR.Y
*	TK010303_lung_E18_mito_3_step07.3977.3977.2	1.342	0.1648	2601.48	5	1960.0%	1	R.VIGGLLAGQLYHVVVVSYLQSQVR.A
*	TK010303_lung_E18_mito_3_step10.3799.3799.3	2.1192	0.1487	3894.02	101	1140.0%	1	K.CPCCYGPLECPVLPTELAFALDTSEGVTQDTFSR.M
	TK010303_lung_E18_mito_3_step03.2012.2012.2	1.3024	0.0919	1679.51	57	2690.0%	1	K.STELNEEPLMRFGR.L
*	TK010303_lung_E18_mito_3_step06.2490.2490.2	2.1755	0.1672	1804.35	1	3820.0%	1	K.GELGEIGLDGLDGEEGDK.G
UQ920L199.6%114.7%447523239.3(Q920L1) Delta-5 desaturase
	TK010303_lung_E18_mito_3_step03.2784.2784.2	4.121	0.6073	2330.5	1	6000.0%	1	R.VISHYAGQDATDPFVAFHINK.G
UQ9D8A199.6%4612.9%341389138.2(Q9D8A1) 5033417E09Rik protein
	TK010303_lung_E18_mito_3_step10.2443.2443.2	3.5807	0.5091	1826.81	1	5670.0%	2	K.ACPLLANDNILHHLPK.T
	TK010303_lung_E18_mito_3_step06.2777.2777.3	2.07	0.1366	2746.04	5	2170.0%	1	K.YPGFIDVKACPLLANDNILHHLPK.T
	TK010303_lung_E18_mito_3_step01.0516.0516.2	1.1394	0.1177	2175.18	38	2110.0%	1	R.WTAHKLDAVVVSTDYGLAPK.H
UIDHG_MOUSE99.6%51710.9%393427859.0(P70404) Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial precursor (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD+-specific ICDH)
	TK010303_lung_E18_mito_3_step09.3166.3166.2	3.9417	0.5747	2149.21	1	4740.0%	4	R.HTVTMIPGDGIGPELMLHVK.S
	TK010303_lung_E18_mito_3_step03.2289.2289.2	3.1423	0.4902	2658.53	1	4320.0%	1	R.HACVPVDFEEVHVSSNADEEDIR.N
UP4H1_MOUSE99.6%154321.2%534609105.9(Q60715) Prolyl 4-hydroxylase alpha-1 subunit precursor (EC 1.14.11.2) (4-PH alpha-1) (Procollagen-proline,2-oxoglutarate-4-dioxygenase alpha-1 subunit)
*	TK010303_lung_E18_mito_3_step05.3670.3670.2	3.4848	0.3771	1861.46	1	6070.0%	5	K.RLNTEWSELENLILK.D
*	TK010303_lung_E18_mito_3_step07.3780.3780.3	6.3381	0.5581	3765.54	1	2980.0%	1	K.VAYTEADYYHTELWMEQALTQLEEGELSTVDK.V
	TK010303_lung_E18_mito_3_step06.4033.4033.3	2.0914	0.1947	4255.85	4	1350.0%	3	R.INMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFAR.K
	TK010303_lung_E18_mito_3_step01.1232.1232.1	0.9482	0.0181	700.59	76	5000.0%	1	K.DLAKPR.L
	TK010303_lung_E18_mito_3_step09.3288.3288.3	1.6132	0.0436	3743.64	142	1060.0%	1	R.IQDLTGLDVSTAEELQVANYGVGGQYEPHFDFAR.K
	TK010303_lung_E18_mito_3_step01.0900.0900.1	1.5818	0.0262	1167.6	1	5500.0%	2	R.HAACPVLVGNK.W
	TK010303_lung_E18_mito_3_step03.2043.2043.1	1.9701	0.2837	1378.5	1	5500.0%	1	K.KLLELDPEHQR.A
*	TK010303_lung_E18_mito_3_step10.1929.1929.2	1.7237	0.0523	1704.73	1	4620.0%	1	R.LNTEWSELENLILK.D
UHBA_MOUSE99.6%105244.0%141149548.2(P01942) Hemoglobin alpha chain
	TK010303_lung_E18_mito_3_step12.2665.2665.3	1.9938	0.12	3854.52	2	1320.0%	1	R.VDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDK.F
	TK010303_lung_E18_mito_3_step01.1342.1342.1	1.9773	0.2755	1031.53	1	6880.0%	1	R.MFASFPTTK.T
	TK010303_lung_E18_mito_3_step02.1901.1901.1	1.2595	0.0318	1087.43	96	5000.0%	1	K.LRVDPVNFK.L
	TK010303_lung_E18_mito_3_step03.2335.2335.2	2.3658	0.3058	1823.3	1	5000.0%	7	K.TYFPHFDVSHGSAQVK.G
UQ9QWJ799.6%6361.0%21542509285.5(Q9QWJ7) Non-erythrocyte beta spectrin
	TK010303_lung_E18_mito_3_step07.2728.2728.2	3.8778	0.5657	2320.92	1	4250.0%	6	R.MPLATSTDHGHNLQTVQLLIK.K
URBB9_MOUSE99.6%118.6%186209126.0(O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein)
*	TK010303_lung_E18_mito_3_step08.2896.2896.2	3.5085	0.4959	1885.36	1	5000.0%	1	R.GHFQNTEFHELISVVK.S
UQ922B199.6%41016.0%243271208.1(Q922B1) Similar to LRP16 protein
	TK010303_lung_E18_mito_3_step09.2612.2612.2	1.4989	0.0324	1977.03	53	2330.0%	1	R.SCYLSSLDLLLEHRLR.S
*	TK010303_lung_E18_mito_3_step03.4516.4516.2	1.3434	0.1218	2380.25	2	2500.0%	3	K.YVIHTVGPIAVGQPTASQAAELR.S
UACDM_MOUSE99.6%71114.7%421464818.4(P45952) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor (EC 1.3.99.3) (MCAD)
*	TK010303_lung_E18_mito_3_step07.1677.1677.2	3.427	0.3919	1469.24	1	7140.0%	2	R.TRPTVAAGAVGLAQR.A
*	TK010303_lung_E18_mito_3_step01.1843.1843.1	1.2637	0.061	1150.9	5	4440.0%	1	K.SGEYPFPLIK.R
*	TK010303_lung_E18_mito_3_step06.3609.3609.2	2.1688	0.0674	2017.94	19	2650.0%	1	K.LLVEHQGVSFLLAEMAMK.V
*	TK010303_lung_E18_mito_3_step08.2833.2833.2	4.1252	0.6183	2001.21	1	3890.0%	1	K.AFTGFIVEADTPGIHIGKK.E
*	TK010303_lung_E18_mito_3_step02.2762.2762.2	3.2438	0.4748	1873.83	1	5000.0%	2	K.AFTGFIVEADTPGIHIGK.K
UPSPA_MOUSE99.6%62348425.8%248261575.4(P35242) Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP)
*	TK010303_lung_E18_mito_3_step11.3097.3097.2	1.6258	0.0966	2365.56	2	2630.0%	1	K.VFSTNGQSVNFDTIREMCTR.A
*	TK010303_lung_E18_mito_3_step02.1212.1212.1	2.0157	0.4027	850.38	1	6880.0%	1	R.AGGHIAAPR.N
*	TK010303_lung_E18_mito_3_step05.3250.3250.2	5.1442	0.6502	2346.76	1	5710.0%	59	K.HQILQTMGVLSLQGSMLSVGDK.V
*	TK010303_lung_E18_mito_3_step05.2042.2042.2	3.1613	0.522	2247.3	1	4290.0%	1	R.AGGHIAAPRNPEENEAIASITK.K
UA2A2_MOUSE99.6%579.4%9381041016.9(P17427) Adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) (100 kDa coated vesicle protein C) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit)
	TK010303_lung_E18_mito_3_step12.2229.2229.3	1.7656	0.1211	3245.94	234	1200.0%	1	R.IVTSASTDLQDYTYYFVPAPWLSVKLLR.L
	TK010303_lung_E18_mito_3_step11.1808.1808.2	1.5918	0.057	1995.86	4	3440.0%	1	R.LYRTSPDLVPMGDWTSR.V
	TK010303_lung_E18_mito_3_step11.4027.4027.2	1.4256	0.0387	2745.19	3	2000.0%	2	R.VVHLLNDQHLGVVTAATSLITTLAQK.N
	TK010303_lung_E18_mito_3_step03.3049.3049.2	1.682	0.0524	1928.77	1	4060.0%	1	K.TVFEALQAPACHENLVK.V
UIDHP_HUMAN99.6%71920.4%452509098.7(P48735) Isocitrate dehydrogenase [NADP], mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) (ICD-M)
*	TK010303_lung_E18_mito_3_step12.1732.1732.3	1.8192	0.0796	2510.13	97	1850.0%	1	R.ASGSRPAWAPAALTAPTSQEQPRR.H
	TK010303_lung_E18_mito_3_step03.4053.4053.3	2.8665	0.3201	3260.21	1	2330.0%	1	K.NYDGDVQSDILAQGFGSLGLMTSVLVCPDGK.T
	TK010303_lung_E18_mito_3_step01.4243.4243.2	1.2093	0.0651	2261.79	1	2890.0%	1	R.FAQMLEKVCVETVESGAMTK.D
	TK010303_lung_E18_mito_3_step09.3606.3606.2	4.4093	0.5637	1875.66	1	6560.0%	4	K.GRPTSTNPIASIFAWTR.G
UTCPH_MOUSE99.6%147813.4%544596527.8(P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta)
	TK010303_lung_E18_mito_3_step03.2288.2288.1	2.0956	0.3442	1156.55	1	5560.0%	2	R.SLHDAIMIVR.R
	TK010303_lung_E18_mito_3_step07.3750.3750.2	3.3627	0.4947	2895.8	1	3700.0%	8	R.VHTVEDYQAIVDAEWNILYDKLEK.I
	TK010303_lung_E18_mito_3_step07.3438.3438.2	1.4113	0.113	2254.45	23	1900.0%	1	K.SQDAEVGDGTTSVTLLAAEFLK.Q
	TK010303_lung_E18_mito_3_step07.2542.2542.2	2.459	0.4768	2020.0	1	3750.0%	3	K.QVKPYVEEGLHPQIIIR.A
ULICH_MOUSE99.6%5255.5%397455517.8(Q9Z0M5) Lysosomal acid lipase/cholesteryl ester hydrolase precursor (EC 3.1.1.13) (LAL) (Acid cholesteryl ester hydrolase) (Sterol esterase) (Lipase A) (Cholesteryl esterase)
*	TK010303_lung_E18_mito_3_step07.2986.2986.2	3.998	0.6216	2487.86	1	4520.0%	5	R.WGYPGEEHSVLTGDGYILSIHR.I
URB1A_HUMAN99.6%95118.5%205226786.2(P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein)
	TK010303_lung_E18_mito_3_step01.0870.0870.1	1.39	0.1003	643.49	1	8000.0%	1	K.LLVGNK.C
	TK010303_lung_E18_mito_3_step10.3667.3667.2	1.784	0.1671	2309.05	9	2250.0%	7	R.GAHGIIVVYDVTDQESFNNVK.Q
	TK010303_lung_E18_mito_3_step01.1746.1746.1	1.4668	0.1403	1071.65	1	5500.0%	1	K.LLLIGDSGVGK.S
UPPOX_MOUSE99.6%4413.2%477508718.8(P51175) Protoporphyrinogen oxidase (EC 1.3.3.4) (PPO)
*	TK010303_lung_E18_mito_3_step12.1229.1229.1	2.0639	0.2195	1455.58	1	5450.0%	1	K.EPPSHCLVHLHK.N
*	TK010303_lung_E18_mito_3_step12.2307.2307.3	1.8648	0.0583	2727.88	130	1740.0%	1	R.WSQWSLRGGLEVLPQALHNHLASK.G
*	TK010303_lung_E18_mito_3_step04.3141.3141.2	1.5282	0.0993	2914.2	5	1730.0%	1	R.TLLLVSELGLESEVLPVRGDHPAAQNR.F
*	TK010303_lung_E18_mito_3_step06.2606.2606.2	3.2388	0.4661	1784.82	1	4380.0%	1	R.GGLEVLPQALHNHLASK.G
ULA_MOUSE99.6%243.9%415477569.8(P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog)
	TK010303_lung_E18_mito_3_step05.3116.3116.2	4.037	0.6167	2073.5	1	6330.0%	2	K.ICHQIEYYFGDFNLPR.D
URS1A_HUMAN99.6%125643.4%1291470810.1(P39027) 40S ribosomal protein S15a
*	TK010303_lung_E18_mito_3_step05.2613.2613.3	2.5369	0.1506	2551.28	1	2880.0%	1	R.FLTVMMKHGYIGEFEIIDDHR.A
*	TK010303_lung_E18_mito_3_step09.3454.3454.2	2.5982	0.4525	2225.35	1	3420.0%	7	R.QFGFIVLTTSAGIMDHEEAR.R
*	TK010303_lung_E18_mito_3_step05.2613.2613.2	4.0617	0.5597	1701.19	1	7690.0%	1	K.HGYIGEFEIIDDHR.A
*	TK010303_lung_E18_mito_3_step07.3493.3493.3	2.1597	0.0553	3335.48	1	1880.0%	2	K.WQNNLLPSRQFGFIVLTTSAGIMDHEEAR.R
*	TK010303_lung_E18_mito_3_step01.3519.3519.1	1.3794	0.291	744.42	1	8000.0%	1	K.ILGFFF.-
UDNPE_HUMAN99.6%228.8%475524287.4(Q9ULA0) Aspartyl aminopeptidase (EC 3.4.11.21)
	TK010303_lung_E18_mito_3_step12.1111.1111.1	2.4	0.4261	1444.65	1	5000.0%	1	K.HEENHRPLFHK.G
	TK010303_lung_E18_mito_3_step01.2986.2986.3	1.7625	0.0108	3432.65	5	1580.0%	1	R.VLDLGSPQLAMHSIREMACTTGVLQTLTLFK.G
UQ9NSE499.6%6811.0%9931118016.9(Q9NSE4) Mitochondrial isoleucine tRNA synthetase (Fragment)
*	TK010303_lung_E18_mito_3_step04.2147.2147.2	3.3914	0.3105	2649.01	1	3260.0%	2	K.TEFCLHDGPPYANGDPHVGHALNK.I
*	TK010303_lung_E18_mito_3_step10.3749.3749.3	2.0222	0.1537	4262.08	2	1210.0%	1	K.DEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPK.E
*	TK010303_lung_E18_mito_3_step01.1799.1799.1	2.0356	0.2225	1476.64	1	4580.0%	1	R.DTVLLPQTSFPMK.L
*	TK010303_lung_E18_mito_3_step01.2560.2560.2	1.5582	0.1716	2080.86	46	2110.0%	1	R.LLVRSVSGASNHQPNSNSGR.Y
*	TK010303_lung_E18_mito_3_step11.1204.1204.2	1.4956	0.0633	1771.76	24	2670.0%	1	K.FIPGSALNGMVEMMDR.R
UGLG1_MOUSE99.6%797.2%11751337346.8(Q61543) Golgi apparatus protein 1 precursor (Golgi sialoglycoprotein MG-160) (E-selectin ligand 1) (ESL-1) (Selel)
	TK010303_lung_E18_mito_3_step01.2694.2694.2	3.8647	0.602	1998.28	1	6180.0%	1	K.ADIFVDPVLHTACALDIK.H
	TK010303_lung_E18_mito_3_step03.2988.2988.2	4.618	0.6545	2055.37	1	7190.0%	2	K.HTWSNNLAVLECLQDVR.E
	TK010303_lung_E18_mito_3_step08.1458.1458.2	2.961	0.5011	1432.13	1	7270.0%	1	R.GEIEHHCSGLHR.K
	TK010303_lung_E18_mito_3_step10.2150.2150.3	2.0914	0.0436	3458.52	10	1700.0%	1	R.MLMEDFSLSPEIILSCRGEIEHHCSGLHR.K
	TK010303_lung_E18_mito_3_step11.1419.1419.3	1.605	0.0614	2580.86	3	2250.0%	1	R.VEELEMTEDIRLEPDLYEACK.S
USCB1_MOUSE99.6%95111.5%426462445.9(Q9Z2I9) Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursor (EC 6.2.1.5) (Succinyl-CoA synthetase, betaA chain) (SCS-betaA) (ATP-specific succinyl-CoA synthetase beta subunit) (Fragment)
*	TK010303_lung_E18_mito_3_step10.4359.4359.2	1.1387	0.014	1741.99	87	2690.0%	1	-.FNKHGLQVQQQQQR.T
*	TK010303_lung_E18_mito_3_step02.2992.2992.2	3.1297	0.4667	2617.9	1	3400.0%	7	K.LHGGTPANFLDVGGGATVQQVTEAFK.L
	TK010303_lung_E18_mito_3_step01.0756.0756.1	1.521	0.0626	890.2	5	5620.0%	1	K.ALIADSGLK.I
UVTDB_MOUSE99.6%2213.1%472530865.3(P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment)
*	TK010303_lung_E18_mito_3_step04.1907.1907.3	1.152	0.0347	3666.58	14	1290.0%	1	K.HSDFASKCCSINSPPLYCSSQIDAEMIDTLQS.-
*	TK010303_lung_E18_mito_3_step08.2969.2969.3	3.7161	0.4777	3582.51	1	2760.0%	1	R.KLCMAALSHQPQEFPTYVEPTNDEICEAFR.R
UQ9DAS899.6%112.5%637693016.0(Q9DAS8) 1600029N02Rik protein
*	TK010303_lung_E18_mito_3_step11.2348.2348.2	4.0173	0.6251	1963.22	1	6330.0%	1	K.LVHLWSSETHQPVWSR.S
UQ9DCC699.6%153917.9%291328848.8(Q9DCC6) 2010012D11Rik protein
	TK010303_lung_E18_mito_3_step05.1842.1842.2	2.9574	0.5543	1394.55	1	7270.0%	1	K.VAVNGVHLHYQR.V
	TK010303_lung_E18_mito_3_step10.2459.2459.3	2.003	0.1569	2031.23	5	2660.0%	1	K.DPLVPRFHADFLLQHVK.G
	TK010303_lung_E18_mito_3_step08.2733.2733.1	3.2865	0.4313	1357.59	1	7500.0%	4	R.FHADFLLQHVK.G
	TK010303_lung_E18_mito_3_step11.2671.2671.2	3.9862	0.5799	1954.65	1	5940.0%	2	R.HLLPLVQCPTLIVHGEK.D
	TK010303_lung_E18_mito_3_step11.1117.1117.1	1.7246	0.2246	791.54	10	7000.0%	2	K.HNLHLR.F
UQ9DCC499.6%246.9%274286947.3(Q9DCC4) 1110058B13Rik protein
	TK010303_lung_E18_mito_3_step03.2556.2556.2	3.7151	0.5833	2002.39	1	5280.0%	2	R.TDVLTPAGTTIHGLHALER.G
UTCPB_MOUSE99.6%464.9%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta)
	TK010303_lung_E18_mito_3_step01.2768.2768.1	2.0967	0.3313	1555.71	2	3850.0%	1	R.SLHDALCVLAQTVK.D
	TK010303_lung_E18_mito_3_step12.1963.1963.1	1.4798	0.0796	1435.59	4	4090.0%	1	K.KIHPQTIISGWR.E
	TK010303_lung_E18_mito_3_step07.2472.2472.1	2.072	0.4255	1308.52	1	5000.0%	2	K.IHPQTIISGWR.E
UPA1B_HUMAN99.6%2224.9%229255695.9(Q29459) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit)
*	TK010303_lung_E18_mito_3_step12.3363.3363.2	4.6307	0.5085	2450.9	1	5790.0%	1	K.ICKPLHELIMQLLEETPEEK.Q
*	TK010303_lung_E18_mito_3_step03.3683.3683.3	1.9018	0.1434	3998.86	1	1460.0%	1	K.VIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAK.I
UQ9D0K299.6%99301728.7%520559898.5(Q9D0K2) 2610008O03Rik protein (RIKEN cDNA 2610008O03 gene)
	TK010303_lung_E18_mito_3_step01.1242.1242.1	1.8817	0.402	1169.57	1	6670.0%	1	K.FYTDPVEAVK.D
*	TK010303_lung_E18_mito_3_step06.4219.4219.2	2.921	0.5583	2827.28	1	3150.0%	7	K.DIPNGATLLVGGFGLCGIPENLIGALLK.T
*	TK010303_lung_E18_mito_3_step08.3792.3792.2	3.468	0.0791	2160.63	1	4720.0%	1	K.KNGLTLIELWEGLTVDDIK.K
	TK010303_lung_E18_mito_3_step05.4062.4062.2	3.5394	0.5659	2381.91	1	4500.0%	35	R.EFNGQHFILEEAITGDFALVK.A
*	TK010303_lung_E18_mito_3_step08.3658.3658.2	2.4384	0.4468	2841.16	1	2500.0%	41	K.AAGTTVVEVEEIVDIGSFAPEDIHIPK.I
*	TK010303_lung_E18_mito_3_step06.3458.3458.2	2.9743	0.3694	2395.28	1	4290.0%	5	K.ETVTVLPGASFFSSDESFAMIR.G
*	TK010303_lung_E18_mito_3_step05.3466.3466.2	2.3808	0.2092	2162.78	4	2500.0%	3	K.DLTAVSNNAGVDNFGLGLLLR.S
*	TK010303_lung_E18_mito_3_step05.3853.3853.2	3.9453	0.2966	2159.55	1	5280.0%	5	K.NGLTLIELWEGLTVDDIKK.S
UNDR2_MOUSE99.6%115.9%371407895.4(Q9QYG0) NDRG2 protein (Ndr2 protein)
*	TK010303_lung_E18_mito_3_step09.3315.3315.2	3.7701	0.5327	2660.85	1	4050.0%	1	R.GIIQHAPNLENIELYWNSYNNR.R
UQ9D20199.6%1111.5%130144017.8(Q9D201) A930008K15Rik protein
	TK010303_lung_E18_mito_3_step04.1935.1935.2	3.6001	0.6232	1912.19	1	5710.0%	1	R.KPPEESTCFERPCFK.W
UQ9D1Q699.6%4610.8%406468535.3(Q9D1Q6) 1110001E24Rik protein (RIKEN cDNA 1110001E24 gene)
*	TK010303_lung_E18_mito_3_step02.3270.3270.2	4.7271	0.6892	2548.08	1	5450.0%	1	R.VASILHDDCAFLSAFGDLSKPER.Y
	TK010303_lung_E18_mito_3_step06.2503.2503.2	1.3511	0.1083	1583.32	2	4170.0%	1	K.QFVFDLHSGKLHR.E
	TK010303_lung_E18_mito_3_step12.1321.1321.1	2.0438	0.2211	987.75	1	7140.0%	2	R.HPLLHIQK.T
UMY5C_HUMAN99.6%557.4%17422027937.7(Q9NQX4) Myosin Vc (Myosin 5C)
*	TK010303_lung_E18_mito_3_step11.4043.4043.3	1.5904	0.0417	4477.83	4	1320.0%	1	R.IYHQFIIIMEKNIQPIIVPGMLEYESLQGISGLKPTGFR.K
*	TK010303_lung_E18_mito_3_step06.2027.2027.2	3.4795	0.4201	1545.23	1	7080.0%	1	K.VVHLSQEINHLQK.L
*	TK010303_lung_E18_mito_3_step08.4346.4346.2	1.3421	0.0584	2785.16	1	2000.0%	1	K.IVTSSETVVKPMTRPQAVNARDALAK.K
*	TK010303_lung_E18_mito_3_step05.2522.2522.2	1.0516	0.0485	3193.92	10	1540.0%	1	R.SSLYLLMETLNATTPHYVRCIKPNDEK.L
*	TK010303_lung_E18_mito_3_step09.3122.3122.2	1.1932	0.0139	2758.99	8	1960.0%	1	R.CTSLSAVQIIKILNSYTPIDDFEK.R
UQ922N299.6%81221.6%811912006.6(Q922N2) Unknown (Protein for MGC:11980)
*	TK010303_lung_E18_mito_3_step02.4004.4004.3	1.6599	0.0038	3484.66	3	1750.0%	1	R.VFLPSHSLDAVSPTDVLLCFELLSPELAKER.V
*	TK010303_lung_E18_mito_3_step12.4140.4140.3	1.7926	0.0147	3695.22	97	1140.0%	1	R.VWPPADRGPVPSTSGLSSEMLASGPIEGCPLLAGER.V
	TK010303_lung_E18_mito_3_step02.3466.3466.3	2.0082	0.0594	3882.51	3	1820.0%	2	K.EEQLPSYDLYAVINHYGGMIGGHYTACARLPNDR.S
*	TK010303_lung_E18_mito_3_step06.2923.2923.2	1.5328	0.0123	2520.71	96	1670.0%	1	R.LEDKGETPLELGDDCSLALVWR.N
*	TK010303_lung_E18_mito_3_step12.2108.2108.3	4.1662	0.5287	3278.01	1	2590.0%	1	R.VSRPEAAVPGYQHSSESVNTHTPQFFIYK.I
*	TK010303_lung_E18_mito_3_step09.1892.1892.3	2.0885	0.1496	2299.24	4	2500.0%	2	R.ASHSEHHPDLGPAAEAAASQASR.I
UIF3A_MOUSE99.6%9158.4%13441619506.8(P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin)
*	TK010303_lung_E18_mito_3_step10.3727.3727.2	1.5165	0.1561	2422.48	2	2750.0%	1	R.IGLINDMVRFSVLQYVVPEVK.D
	TK010303_lung_E18_mito_3_step01.2260.2260.1	1.3397	0.0542	1264.67	7	4550.0%	1	R.NQLTAMSSVLAK.A
	TK010303_lung_E18_mito_3_step09.1798.1798.1	1.376	0.1564	855.48	1	7500.0%	1	R.EKALEHK.N
*	TK010303_lung_E18_mito_3_step06.2471.2471.2	2.9912	0.3336	1616.63	1	5380.0%	1	K.AIEVIRPAHILQEK.E
	TK010303_lung_E18_mito_3_step07.2248.2248.1	0.979	0.1286	1005.4	7	3750.0%	3	R.ANEFLEVGK.K
	TK010303_lung_E18_mito_3_step09.2207.2207.2	3.839	0.5053	2659.53	1	4320.0%	1	R.HHNQSTAINLNNPESQSMHLETR.L
	TK010303_lung_E18_mito_3_step11.3157.3157.2	1.397	0.1072	3088.11	27	1350.0%	1	K.AVEDIHGLFSLSKKPPKPQLMANYYNK.V
UQ9DB2099.6%134731.0%2132336410.0(Q9DB20) DNA segment, Chr 12, Wayne state University 28, expressed (Unknown) (Protein for MGC:19017)
	TK010303_lung_E18_mito_3_step06.2169.2169.2	2.6931	0.4498	1583.89	1	5380.0%	4	K.LVRPPVQVYGIEGR.Y
*	TK010303_lung_E18_mito_3_step08.3568.3568.2	3.7783	0.4884	2033.58	1	5280.0%	5	R.LGNTQGIISAFSTIMSVHR.G
	TK010303_lung_E18_mito_3_step08.3608.3608.2	1.285	0.1486	2709.21	93	1460.0%	1	K.LVRPPVQVYGIEGRYATALYSAASK.E
*	TK010303_lung_E18_mito_3_step01.2330.2330.2	3.7351	0.4881	2304.45	1	5000.0%	1	R.GEVPCTVTTASPLDDAVLSELK.T
UQ91VT499.6%116.8%236253579.8(Q91VT4) Unknown (Protein for MGC:6971)
*	TK010303_lung_E18_mito_3_step10.2901.2901.2	3.6036	0.5901	1692.78	1	7330.0%	1	K.HLGPVNFLVNAAGINR.G
URS4_HUMAN99.6%206215.3%2622946710.2(P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10)
	TK010303_lung_E18_mito_3_step07.1800.1800.2	2.469	0.3219	1217.06	1	7000.0%	3	K.GIPHLVTHDAR.T
	TK010303_lung_E18_mito_3_step11.1400.1400.1	2.2528	0.3246	1510.17	1	5000.0%	2	R.ERHPGSFDVVHVK.D
	TK010303_lung_E18_mito_3_step01.0716.0716.1	1.2087	0.0050	736.58	2	8000.0%	1	K.ITDFIK.F
	TK010303_lung_E18_mito_3_step05.2345.2345.1	1.4822	0.0666	1169.71	25	3890.0%	4	K.GNKPWISLPR.G
	TK010303_lung_E18_mito_3_step09.2032.2032.1	2.5221	0.3869	1223.59	1	6000.0%	5	R.HPGSFDVVHVK.D
UCOX2_MOUSE99.6%81636.6%227259764.7(P00405) Cytochrome c oxidase polypeptide II (EC 1.9.3.1)
*	TK010303_lung_E18_mito_3_step07.2574.2574.2	1.3196	0.0682	2893.37	18	1730.0%	1	R.MLISSEDVLHSWAVPSLGLKTDAIPGR.L
*	TK010303_lung_E18_mito_3_step07.2746.2746.2	2.0044	0.1575	2007.52	7	3120.0%	1	R.LLEVDNRVVLPMELPIR.M
*	TK010303_lung_E18_mito_3_step02.3318.3318.2	4.7576	0.6591	2183.95	1	6050.0%	2	R.MLISSEDVLHSWAVPSLGLK.T
*	TK010303_lung_E18_mito_3_step11.3457.3457.3	3.3315	0.3223	4396.74	1	1450.0%	3	R.LNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLK.Y
*	TK010303_lung_E18_mito_3_step01.2240.2240.1	2.3044	0.0705	1169.7	2	6110.0%	1	R.VVLPMELPIR.M
UQ99J9999.6%5718.5%297330236.6(Q99J99) Similar to thiosulfate sulfurtransferase (Rhodanese)
*	TK010303_lung_E18_mito_3_step11.2268.2268.2	3.5539	0.4549	1599.97	1	6430.0%	1	R.AFGHHSVSLLDGGFR.H
*	TK010303_lung_E18_mito_3_step01.3110.3110.2	2.2873	0.2674	2914.7	2	2310.0%	2	R.DGIEPGHIPGSVNIPFTEFLTNEGLEK.S
*	TK010303_lung_E18_mito_3_step01.2692.2692.1	1.667	0.1646	1386.82	12	4170.0%	1	R.ALVSAQWVAEALK.A
UODB2_MOUSE99.6%186828.6%482531608.7(P53395) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor (EC 2.3.1.-) (E2) (Dihydrolipoamide branched chain transacylase) (BCKAD E2 subunit)
*	TK010303_lung_E18_mito_3_step10.2577.2577.2	1.3283	0.0744	2282.88	3	2380.0%	1	K.QTGAILPPSPKSEITPPPPQPK.D
*	TK010303_lung_E18_mito_3_step04.3109.3109.2	2.2352	0.1862	2049.57	1	4060.0%	1	K.IPHFGYCDEIDLTQLVK.L
*	TK010303_lung_E18_mito_3_step05.3438.3438.2	1.407	0.0438	2194.27	29	2000.0%	1	K.ASHNIGIAMDTELGLIVPNVK.N
	TK010303_lung_E18_mito_3_step09.3256.3256.2	1.9227	0.272	2445.98	15	2140.0%	1	K.AQIMNVSWSADHRVIDGATMSR.F
*	TK010303_lung_E18_mito_3_step02.3705.3705.2	1.7106	0.1162	2772.29	1	3040.0%	2	R.LYYNLDDIAYVGKPLIDIETEALK.D
*	TK010303_lung_E18_mito_3_step01.3884.3884.2	1.1414	0.1151	2792.5	2	1800.0%	1	K.ASHNIGIAMDTELGLIVPNVKNVQVR.S
*	TK010303_lung_E18_mito_3_step05.2385.2385.2	2.2842	0.5242	1603.15	1	5000.0%	7	R.TFPTPIAKPPVFTGK.D
*	TK010303_lung_E18_mito_3_step08.2489.2489.1	1.3642	0.0124	1397.99	103	4090.0%	3	K.LREELKPVALAR.G
UIM8A_MOUSE99.6%2415.5%97110425.2(Q9WVA2) Mitochondrial import inner membrane translocase subunit TIM8 A (Deafness dystonia protein 1 homolog)
	TK010303_lung_E18_mito_3_step03.2743.2743.2	3.8565	0.5724	1979.99	1	6430.0%	2	R.FQQLVHQMTELCWEK.C
UQ8VCM799.6%51116.5%436493915.9(Q8VCM7) Similar to fibrinogen, gamma polypeptide
	TK010303_lung_E18_mito_3_step09.3674.3674.2	1.1137	0.0494	2223.87	5	2500.0%	1	K.IHLISMQSTIPYALRIQLK.D
	TK010303_lung_E18_mito_3_step05.3861.3861.3	1.8262	0.1059	4076.72	3	1620.0%	1	R.FGSFCPTTCGIADFLSSYQTDVDNDLRTLEDILFR.A
	TK010303_lung_E18_mito_3_step08.1702.1702.2	2.437	0.4703	1988.54	1	4120.0%	3	K.CHAGHLNGVYHQGGTYSK.S
UDHAM_MOUSE99.6%80105244.9%519565387.6(P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2)
	TK010303_lung_E18_mito_3_step06.3451.3451.3	2.3394	0.1037	4236.05	1	1430.0%	1	K.TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWK.L
	TK010303_lung_E18_mito_3_step01.2804.2804.1	1.69	0.0807	1406.89	1	4550.0%	4	K.EEIFGPVMQILK.F
*	TK010303_lung_E18_mito_3_step07.3093.3093.2	3.3418	0.2177	2444.3	1	3480.0%	3	K.VAFTGSTEVGHLIQVAAGSSNLKR.V
*	TK010303_lung_E18_mito_3_step05.2634.2634.2	2.4176	0.1714	1775.75	1	5770.0%	2	R.TFVQENVYDEFVER.S
	TK010303_lung_E18_mito_3_step03.3828.3828.2	1.8738	0.0981	2723.45	2	2270.0%	3	R.HEPVGVCGQIIPWNFPLLMQAWK.L
*	TK010303_lung_E18_mito_3_step01.2011.2011.1	1.9185	0.2518	1043.0	1	6670.0%	7	K.YGLAAAVFTK.D
*	TK010303_lung_E18_mito_3_step01.4339.4339.2	1.8645	0.1912	2962.28	2	2000.0%	1	K.EAGFPPGVVNIVPGFGPTAGAAIASHEGVDK.V
	TK010303_lung_E18_mito_3_step01.2271.2271.1	1.5804	0.2193	1533.7	1	4170.0%	2	K.TIPIDGDFFSYTR.H
	TK010303_lung_E18_mito_3_step01.1788.1788.1	1.2033	0.0359	1134.73	1	5560.0%	1	R.AAFQLGSPWR.R
*	TK010303_lung_E18_mito_3_step01.1798.1798.2	2.7995	0.3547	2835.32	1	3200.0%	1	K.TFPTVNPSTGEVICQVAEGNKEDVDK.A
	TK010303_lung_E18_mito_3_step10.4198.4198.2	1.5616	0.0173	3161.03	1	2040.0%	13	R.TYLAALETLDNGKPYVISYLVDLDMVLK.C
*	TK010303_lung_E18_mito_3_step02.1874.1874.1	1.5665	0.0372	834.41	19	5830.0%	3	K.KILGYIK.S
*	TK010303_lung_E18_mito_3_step01.2738.2738.2	6.228	0.5718	2290.23	1	5450.0%	27	K.VAFTGSTEVGHLIQVAAGSSNLK.R
	TK010303_lung_E18_mito_3_step01.1979.1979.1	1.8614	0.2198	1371.78	18	3460.0%	6	K.LGPALATGNVVVMK.V
*	TK010303_lung_E18_mito_3_step01.2179.2179.1	2.1243	0.4549	1473.63	1	5420.0%	3	R.GYFIQPTVFGDVK.D
*	TK010303_lung_E18_mito_3_step01.1080.1080.1	1.3938	0.1519	706.53	1	8000.0%	1	K.ILGYIK.S
	TK010303_lung_E18_mito_3_step01.0194.0194.1	1.7471	0.0547	904.58	2	6430.0%	2	K.TIEEVVGR.A
UQ921M499.6%112.6%617707024.8(Q921M4) Unknown (Protein for MGC:11816)
	TK010303_lung_E18_mito_3_step06.2881.2881.2	3.3813	0.358	1910.87	1	4670.0%	1	R.ERPGLGSNPCIPFFYR.A
UCOPA_HUMAN99.6%91310.3%12241383317.7(P53621) Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) [Contains: Xenin (Xenopsin-related peptide); Proxenin]
*	TK010303_lung_E18_mito_3_step11.1773.1773.2	3.0163	0.4508	1885.56	1	5670.0%	1	R.ERPAYAVHGNMLHYVK.D
*	TK010303_lung_E18_mito_3_step04.2114.2114.1	1.9132	0.2401	1596.63	1	4580.0%	1	R.KLDALCNIHENIR.V
*	TK010303_lung_E18_mito_3_step08.3860.3860.3	2.7474	0.261	4045.98	7	1250.0%	1	R.TCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVR.V
*	TK010303_lung_E18_mito_3_step11.2879.2879.3	1.7551	0.0436	3155.6	86	1520.0%	1	R.ASNLENSTYDLYTIPKDADSQNPDAPEGK.R
*	TK010303_lung_E18_mito_3_step05.2746.2746.2	3.1535	0.4856	2115.08	1	4170.0%	2	K.SGAWDESGVFIYTTSNHIK.Y
*	TK010303_lung_E18_mito_3_step09.2074.2074.2	4.29	0.6317	1659.1	1	7310.0%	2	R.GHYNNVSCAVFHPR.Q
URL15_MOUSE99.6%81417.8%2142466811.1(Q9CZM2) 60S ribosomal protein L15
	TK010303_lung_E18_mito_3_step04.1862.1862.2	3.1594	0.5713	1565.02	1	5830.0%	2	R.NPDTQWITKPVHK.H
	TK010303_lung_E18_mito_3_step12.1055.1055.2	3.0416	0.4961	1707.29	1	4330.0%	2	K.GATYGKPVHHGVNQLK.F
	TK010303_lung_E18_mito_3_step11.1419.1419.2	2.7209	0.4668	1720.91	1	4620.0%	1	R.RNPDTQWITKPVHK.H
	TK010303_lung_E18_mito_3_step11.1352.1352.1	1.0713	0.0055	1134.71	6	5000.0%	1	K.YIQELWRK.K
UKC21_MOUSE99.6%359.5%391451628.0(Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37)
	TK010303_lung_E18_mito_3_step03.4263.4263.2	1.9455	0.178	2682.04	3	2750.0%	1	R.FYMYEILKALDYCHSMGIMHR.D
	TK010303_lung_E18_mito_3_step05.3621.3621.2	1.7122	0.0112	2006.18	27	2670.0%	2	R.KEPFFHGHDNYDQLVR.I
UADT2_MOUSE99.6%214414.4%298329319.7(P51881) ADP,ATP carrier protein, fibroblast isoform (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2)
	TK010303_lung_E18_mito_3_step01.2812.2812.1	3.2605	0.1312	1221.97	1	6250.0%	21	K.DFLAGGVAAAISK.T
UQ921X999.6%4164.8%517592677.5(Q921X9) Similar to for protein disulfide isomerase-related
*	TK010303_lung_E18_mito_3_step08.3041.3041.2	3.8879	0.5796	2910.62	1	4380.0%	4	R.GHIVLAGMNVYPSEFENIKEEYNVR.G
USPCN_HUMAN99.6%19735.9%24722842815.3(Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
*	TK010303_lung_E18_mito_3_step02.2378.2378.3	1.5471	0.025	3848.42	4	1480.0%	1	R.NVEDIELWLYEVEGHLASDDYGKDLTNVQNLQK.K
*	TK010303_lung_E18_mito_3_step06.3377.3377.2	1.4804	0.0655	2179.91	5	2630.0%	1	K.KHEALMSDLSAYGSSIQALR.E
*	TK010303_lung_E18_mito_3_step01.2202.2202.1	1.6207	0.1057	1112.71	6	5560.0%	1	K.DLIGVQNLLK.K
*	TK010303_lung_E18_mito_3_step11.1195.1195.2	4.8458	0.6511	1685.64	1	7140.0%	1	K.KHQALQAEIAGHEPR.I
*	TK010303_lung_E18_mito_3_step05.4361.4361.2	1.3905	0.1887	2698.53	2	2270.0%	3	R.NVEDIELWLYEVEGHLASDDYGK.D
	TK010303_lung_E18_mito_3_step11.3345.3345.2	3.0845	0.3976	2879.21	1	2800.0%	7	R.AGTFQAFEQFGQQLLAHGHYASPEIK.Q
	TK010303_lung_E18_mito_3_step07.2200.2200.2	1.1146	0.0261	2293.66	2	2250.0%	1	R.EAFLNTEDKGDSLDSVEALIK.K
	TK010303_lung_E18_mito_3_step02.2493.2493.2	5.1584	0.6933	2219.19	1	6500.0%	1	K.RLEAELAAHEPAIQGVLDTGK.K
UMA32_MOUSE99.6%145648.9%278310134.9(O35658) Complement component 1, Q subcomponent binding protein, mitochondrial precursor (Glycoprotein gC1qBP) (GC1q-R protein)
	TK010303_lung_E18_mito_3_step07.4225.4225.2	1.8991	0.2488	3121.29	1	2000.0%	6	R.DTNYTLNTDSLDWALYDHLMDFLADR.G
	TK010303_lung_E18_mito_3_step02.2829.2829.2	1.4116	0.2311	2864.78	13	1800.0%	1	K.ITVTFNINNSIPPTFDGEEEPSQGQK.A
	TK010303_lung_E18_mito_3_step07.3066.3066.2	3.5675	0.4828	1699.77	1	7690.0%	3	K.AFVEFLTDEIKEEK.K
	TK010303_lung_E18_mito_3_step05.4373.4373.3	2.4128	0.2984	3443.28	8	1550.0%	3	R.GVDNTFADELVELSTALEHQEYITFLEDLK.S
	TK010303_lung_E18_mito_3_step02.2993.2993.3	2.279	0.2352	4658.92	1	1470.0%	1	K.TLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWR.D
UQ922Y799.6%118.0%464510285.3(Q922Y7) Unknown (Protein for MGC:6388)
	TK010303_lung_E18_mito_3_step03.3271.3271.3	5.6353	0.6203	4185.67	1	2500.0%	1	K.KIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYK.G
UGBR2_HUMAN99.6%5514.1%9411058218.7(O75899) Gamma-aminobutyric acid type B receptor, subunit 2 precursor (GABA-B receptor 2) (GABA-B-R2) (Gb2) (GABABR2) (G protein-coupled receptor 51) (GPR 51) (HG20)
*	TK010303_lung_E18_mito_3_step07.3320.3320.3	2.3034	0.2343	3826.57	2	1520.0%	1	R.FSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVK.K
*	TK010303_lung_E18_mito_3_step10.3354.3354.2	1.2877	0.0075	3128.63	13	1730.0%	1	R.GVLPAVELAIEQIRNESLLRPYFLDLR.L
*	TK010303_lung_E18_mito_3_step04.2183.2183.3	1.9807	0.0865	2692.82	203	1350.0%	1	K.TSTSVTSVNQASTSRLEGLQSENHR.L
*	TK010303_lung_E18_mito_3_step01.1483.1483.1	2.0542	0.4406	1158.77	1	5500.0%	1	R.NVSIPALNDSK.Y
*	TK010303_lung_E18_mito_3_step08.3948.3948.3	1.4646	0.0103	3858.9	85	1210.0%	1	R.RLSLQLPILHHAYLPSIGGVDASCVSPCVSPTASPR.H
UFKB4_MOUSE99.6%228.8%457514415.7(P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59)
	TK010303_lung_E18_mito_3_step05.2612.2612.2	3.3802	0.5296	2039.5	1	4720.0%	1	K.GEHSIVYLKPSYAFGSVGK.E
	TK010303_lung_E18_mito_3_step10.3002.3002.2	1.1862	0.0496	2455.56	23	2000.0%	1	R.VFVHYTGWLLDGTKFDSSLDR.K
URTN4_MOUSE99.6%117.0%199224669.4(Q99P72) Reticulon 4 (Neurite outgrowth inhibitor) (Nogo protein)
	TK010303_lung_E18_mito_3_step06.2141.2141.2	3.3104	0.516	1608.31	1	7310.0%	1	R.HQAQIDHYLGLANK.S
UQ91VU399.6%3522.8%215247238.5(Q91VU3) SEC22, vesicle trafficking protein (S. cerevisiae)-like 1
	TK010303_lung_E18_mito_3_step09.3891.3891.2	1.3919	0.053	3165.03	25	1430.0%	1	R.VADGLPLAASMQEDEQSGRDLQQYQSQAK.Q
	TK010303_lung_E18_mito_3_step06.3235.3235.2	4.539	0.5468	2380.26	1	5000.0%	2	K.KLAFAYLEDLHSEFDEQHGK.K
UGR75_MOUSE99.6%97336134.0%679735286.2(P38647) Stress-70 protein, mitochondrial precursor (75 kDa glucose regulated protein) (GRP 75) (Peptide-binding protein 74) (PBP74) (P66 MOT) (Mortalin)
	TK010303_lung_E18_mito_3_step06.4070.4070.2	3.8906	0.5821	2313.28	1	4760.0%	54	R.GVPQIEVTFDIDANGIVHVSAK.D
	TK010303_lung_E18_mito_3_step01.1496.1496.1	1.9239	0.3442	1245.05	1	5910.0%	2	K.DAGQISGLNVLR.V
	TK010303_lung_E18_mito_3_step01.0984.0984.1	1.1577	0.2073	715.67	18	5000.0%	1	R.LVGMPAK.R
	TK010303_lung_E18_mito_3_step01.4306.4306.1	1.4857	0.2595	1594.98	1	4290.0%	3	K.LLGQFTLIGIPPAPR.G
	TK010303_lung_E18_mito_3_step07.4101.4101.3	5.7957	0.6148	4594.82	1	2170.0%	15	K.AVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTK.L
*	TK010303_lung_E18_mito_3_step02.2794.2794.2	1.6568	0.11	2626.72	17	1740.0%	1	K.CELSSSVQTDINLPYLTMDASGPK.H
	TK010303_lung_E18_mito_3_step01.3008.3008.1	1.8425	0.256	1448.63	3	3850.0%	2	K.SDIGEVILVGGMTR.M
	TK010303_lung_E18_mito_3_step11.1653.1653.2	1.2813	0.0359	2404.04	15	2170.0%	1	K.GAVVGIDLGTTNSCVAVMEGKQAK.V
	TK010303_lung_E18_mito_3_step02.2685.2685.2	3.5287	0.417	2142.05	1	4720.0%	1	K.ERVEAVNMAEGIIHDTETK.M
	TK010303_lung_E18_mito_3_step01.2695.2695.1	1.5745	0.0551	1556.02	4	3460.0%	1	K.LYSPSQIGAFVLMK.M
*	TK010303_lung_E18_mito_3_step01.2538.2538.1	1.9611	0.0254	1334.62	12	4550.0%	1	R.AQFEGIVTDLIK.R
	TK010303_lung_E18_mito_3_step07.4001.4001.2	2.5796	0.3967	2255.42	1	5000.0%	14	K.VIAVYDLGGGTFDISILEIQK.G
URHOA_MOUSE99.6%94120.2%193217826.1(Q9QUI0) Transforming protein RhoA
	TK010303_lung_E18_mito_3_step02.3746.3746.2	3.0298	0.1443	2777.92	1	3480.0%	2	K.DQFPEVYVPTVFENYVADIEVDGK.Q
	TK010303_lung_E18_mito_3_step10.2377.2377.2	3.0524	0.478	1738.22	1	6430.0%	1	K.HFCPNVPIILVGNKK.D
	TK010303_lung_E18_mito_3_step10.2503.2503.2	3.1832	0.5486	1609.1	1	7690.0%	6	K.HFCPNVPIILVGNK.K
UTRBM_MOUSE99.6%3315.8%577618684.6(P15306) Thrombomodulin precursor (Fetomodulin) (TM)
*	TK010303_lung_E18_mito_3_step12.3804.3804.3	2.0331	0.1087	4464.98	19	1130.0%	1	R.DPEAAHISSTYNTPFGVSGADFQTLPVGSSAAVEPLGLELVCR.A
*	TK010303_lung_E18_mito_3_step05.1801.1801.2	4.3349	0.6478	1824.76	1	7000.0%	1	R.CICAPGFAPKPDEPHK.C
*	TK010303_lung_E18_mito_3_step02.3152.3152.3	2.5341	0.2389	3658.85	3	1530.0%	1	K.LQPTGSQCVEHECFALFQGPATFLDASQACQR.L
UQ91W4899.6%5115.3%511572306.2(Q91W48) Archain 1
*	TK010303_lung_E18_mito_3_step09.2235.2235.1	2.5449	0.3375	1591.64	1	5000.0%	3	K.VHAPPINMESVHMK.I
	TK010303_lung_E18_mito_3_step01.2418.2418.1	1.7334	0.0398	1560.49	1	5830.0%	1	R.NTLEWCLPVIDAK.N
UQ9D5V999.6%51111.4%396453589.2(Q9D5V9) 4921514D13Rik protein
	TK010303_lung_E18_mito_3_step07.2356.2356.2	3.2995	0.5228	2117.06	1	5880.0%	3	K.HGEQHEGQHYSIPLQDLK.T
	TK010303_lung_E18_mito_3_step10.2635.2635.3	2.0214	0.3003	2918.77	8	1700.0%	1	R.TSDSDPAKHGEQHEGQHYSIPLQDLK.T
	TK010303_lung_E18_mito_3_step02.3216.3216.2	1.3103	0.0149	2491.52	1	2500.0%	1	K.EFESSFQYYLENNWLQHEK.A
UQ91V4199.6%4428.8%215238976.2(Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512)
	TK010303_lung_E18_mito_3_step05.2705.2705.2	3.8416	0.5829	1624.47	1	7140.0%	1	R.NLTNPNTVIILIGNK.A
	TK010303_lung_E18_mito_3_step02.1938.1938.2	2.9552	0.5849	3152.36	1	3450.0%	1	K.IYQNIQDGSLDLNAAESGVQHKPSAPQGGR.L
	TK010303_lung_E18_mito_3_step05.2273.2273.2	1.2588	0.0903	1839.97	471	2000.0%	1	K.FMADCPHTIGVEFGTR.I
	TK010303_lung_E18_mito_3_step09.2344.2344.3	3.0748	0.3857	3279.15	1	2080.0%	1	K.KIYQNIQDGSLDLNAAESGVQHKPSAPQGGR.L
UQ99PC399.6%114.1%3924659810.0(Q99PC3) CGI-74-like SR-rich protein
	TK010303_lung_E18_mito_3_step07.2041.2041.2	4.1803	0.4638	1865.34	1	7000.0%	1	K.SHLLNCCPHDVLSGTR.M
UQ91WP299.6%287023.6%10231164496.8(Q91WP2) Hypothetical 116.4 kDa protein
*	TK010303_lung_E18_mito_3_step01.2796.2796.1	2.0998	0.3467	1404.98	1	5450.0%	3	R.FLDTAFDLDAFK.K
	TK010303_lung_E18_mito_3_step11.2545.2545.3	2.438	0.3069	2814.79	1	2600.0%	1	R.QNGIVLLLPHGMEGMGPEHSSARPER.F
	TK010303_lung_E18_mito_3_step01.2508.2508.2	2.8957	0.5002	2377.0	1	4770.0%	1	R.NITLSLVANPSHLEAADPVVMGK.T
	TK010303_lung_E18_mito_3_step08.1485.1485.1	2.5639	0.3255	1343.72	1	6500.0%	3	R.HHVLHDQNVDK.R
	TK010303_lung_E18_mito_3_step03.2861.2861.3	1.5187	0.0545	4447.91	5	1150.0%	1	R.TFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPK.S
*	TK010303_lung_E18_mito_3_step03.3029.3029.2	1.4756	0.0411	2307.04	11	2250.0%	2	K.TIIDMSSANGVDYVIMGMPHR.G
*	TK010303_lung_E18_mito_3_step03.3143.3143.2	3.3449	0.5352	2197.36	1	6050.0%	4	K.VFHLPTTTFIGGQEPALPLR.E
*	TK010303_lung_E18_mito_3_step10.2546.2546.2	1.6202	0.1315	2431.51	2	2620.0%	1	K.LRPLTASQTVKTFSQNKPAAIR.T
	TK010303_lung_E18_mito_3_step09.3703.3703.3	1.7142	0.0467	3579.45	59	1210.0%	1	R.SSPYPTDVARVVNAPIFHVNSDDPEAVMYVCK.V
	TK010303_lung_E18_mito_3_step02.2594.2594.2	1.0184	0.0103	2506.17	195	1670.0%	1	R.VVNAPIFHVNSDDPEAVMYVCK.V
	TK010303_lung_E18_mito_3_step02.2481.2481.2	2.7587	0.4259	2339.21	1	4440.0%	1	R.RNGHNEMDEPMFTQPLMYK.Q
	TK010303_lung_E18_mito_3_step08.1904.1904.1	1.4454	0.1701	1076.5	2	6430.0%	2	K.YHLGMYHR.R
	TK010303_lung_E18_mito_3_step08.1596.1596.1	2.4731	0.1947	1127.64	1	6880.0%	4	K.KTHLTELQR.F
UODPA_MOUSE99.6%122813.6%390432328.2(P35486) Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursor (EC 1.2.4.1) (PDHE1-A type I)
	TK010303_lung_E18_mito_3_step07.1529.1529.1	1.7158	0.2012	1595.58	15	3460.0%	3	R.YHGHSMSDPGVSYR.T
	TK010303_lung_E18_mito_3_step03.2183.2183.1	2.1047	0.3368	1031.6	1	6250.0%	1	K.RGDFIPGLR.V
	TK010303_lung_E18_mito_3_step01.1420.1420.1	1.3387	0.1641	1413.68	2	3750.0%	2	R.LEEGPPVTTVLTR.E
*	TK010303_lung_E18_mito_3_step01.1774.1774.1	1.3079	0.0167	943.79	3	5620.0%	1	R.AILAELTGR.R
	TK010303_lung_E18_mito_3_step04.1873.1873.1	1.4709	0.1885	938.48	1	7140.0%	3	R.AHGFTFTR.G
UQ9D0H299.6%4416.5%496539175.6(Q9D0H2) 2610017G09Rik protein
*	TK010303_lung_E18_mito_3_step10.2967.2967.3	2.3505	0.0443	4016.73	3	1490.0%	1	K.ETFHDIAQAASEFPGAQHYVGGNAALIGQRFAANTDLK.V
*	TK010303_lung_E18_mito_3_step04.2331.2331.2	3.7745	0.0929	1702.06	1	7310.0%	1	R.IVLNPDKPVVEWHR.E
*	TK010303_lung_E18_mito_3_step08.3318.3318.3	3.6133	0.4357	3784.52	1	2210.0%	1	R.FFSDKETFHDIAQAASEFPGAQHYVGGNAALIGQR.F
*	TK010303_lung_E18_mito_3_step12.2469.2469.2	2.0419	0.0093	2638.72	1	2500.0%	1	K.DPVRTVGLGDAISAEGLFYSEARPD.-
URM13_MOUSE99.6%2414.0%178206779.4(Q9D1P0) 60S ribosomal protein L13, mitochondrial (L13mt)
*	TK010303_lung_E18_mito_3_step11.2040.2040.2	1.8756	0.2959	2880.45	1	2500.0%	2	K.LQGLNKPVYHQLSDCGDHVVIINTR.H
UQ91ZB199.6%187619.9%559590886.0(Q91ZB1) Dihydrolipoamide S-acetyltransferase (Fragment)
	TK010303_lung_E18_mito_3_step01.3120.3120.1	1.3469	0.0904	1593.7	264	1790.0%	4	R.VVDGAVGAQWLAEFK.K
	TK010303_lung_E18_mito_3_step02.2958.2958.2	3.8785	0.6238	2462.47	1	4050.0%	2	R.DVPVGSIICITVEKPQDIEAFK.N
*	TK010303_lung_E18_mito_3_step01.2442.2442.1	2.2587	0.1944	1525.71	1	5000.0%	2	R.DVPLGAPXCIIVEK.Q
	TK010303_lung_E18_mito_3_step03.3316.3316.2	1.1155	0.1098	2424.17	1	2380.0%	7	K.LQPHEFQGGTFTISNLGMFGIK.N
	TK010303_lung_E18_mito_3_step01.1064.1064.1	2.3648	0.517	1319.56	1	6070.0%	1	K.AAPAAAAAMAPPGPR.V
	TK010303_lung_E18_mito_3_step01.1118.1118.1	1.6959	0.0935	860.55	19	5000.0%	1	R.VFVSPLAK.K
	TK010303_lung_E18_mito_3_step01.2962.2962.1	2.2984	0.3034	1492.95	1	4290.0%	1	K.GLETIASDVVSLASK.A
UP5CS_MOUSE99.6%689.9%795872967.6(Q9Z110) Delta 1-pyrroline-5-carboxylate synthetase (P5CS) [Includes: Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase) (GK); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)]
*	TK010303_lung_E18_mito_3_step07.2654.2654.2	1.0071	0.0039	1663.66	1	4620.0%	1	R.QRLLPWVQSIAVPR.S
*	TK010303_lung_E18_mito_3_step11.1556.1556.1	1.2864	0.2179	1366.57	55	3500.0%	1	K.YLHENLPVPQR.N
	TK010303_lung_E18_mito_3_step06.2491.2491.2	4.4435	0.6218	2594.03	1	4570.0%	2	K.KVGTFFSEVKPAGPTVEQQGEMAR.S
	TK010303_lung_E18_mito_3_step12.3696.3696.2	1.3827	0.072	3175.97	29	1380.0%	1	R.LAVEMKTDLLIVLSDVEGLFDSPPGSDDAK.L
UZNT1_MOUSE99.6%3310.9%503547166.6(Q60738) Zinc transporter 1 (ZnT-1)
	TK010303_lung_E18_mito_3_step11.3765.3765.2	1.7113	0.0476	2835.35	2	2000.0%	1	K.TIKDVFHNHGIHATTIQPEFASVGSK.S
*	TK010303_lung_E18_mito_3_step02.3544.3544.2	1.4466	0.1472	3071.07	11	1610.0%	1	R.APDQEETNTLVANTSNSNGLKADQAEPEK.L
	TK010303_lung_E18_mito_3_step11.2080.2080.2	3.4497	0.4266	2492.6	1	4090.0%	1	K.DVFHNHGIHATTIQPEFASVGSK.S
UQ99PL599.6%9195.6%16051728789.3(Q99PL5) Ribosome binding protein 1 (Ribosome receptor protein) (RRp) (P180)
	TK010303_lung_E18_mito_3_step01.1047.1047.1	2.1032	0.2596	1390.86	1	4580.0%	1	R.DALNQATSQVESK.Q
*	TK010303_lung_E18_mito_3_step01.0951.0951.1	1.1975	0.1003	1139.68	1	6110.0%	1	K.QLHLAEAQTK.E
*	TK010303_lung_E18_mito_3_step02.2408.2408.1	3.3458	0.5521	1569.75	1	5000.0%	3	K.KPPTLEPSMDIVLK.L
*	TK010303_lung_E18_mito_3_step02.3853.3853.2	2.8898	0.3821	2975.07	1	3200.0%	2	K.ETLLALLPGLSISAHQNYAEWLQEFK.E
*	TK010303_lung_E18_mito_3_step08.3002.3002.3	1.6527	0.0493	2896.18	3	1830.0%	2	R.SIEALLEAGQAQDTQASHAEANQQQTR.L
UDYHC_MOUSE99.6%15215.4%46445320306.4(Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain)
*	TK010303_lung_E18_mito_3_step08.4434.4434.2	2.2877	0.0852	1857.54	1	4000.0%	2	R.ILVDDTIITTLENLKR.E
	TK010303_lung_E18_mito_3_step02.2424.2424.3	1.7007	0.0302	4289.76	2	1390.0%	2	R.KVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLK.Q
*	TK010303_lung_E18_mito_3_step09.3496.3496.3	2.4792	0.2503	3433.59	1	1720.0%	1	R.VLTLSEDSPYETLHSFISNAVAPFFKSYIR.E
*	TK010303_lung_E18_mito_3_step04.3098.3098.2	1.7908	0.1427	2708.44	4	2500.0%	1	K.AHQANQLYPFAISLIESVRTYER.T
*	TK010303_lung_E18_mito_3_step01.0786.0786.1	1.3387	0.0010	901.57	15	5000.0%	1	R.SNLPDNLK.K
*	TK010303_lung_E18_mito_3_step04.2150.2150.2	1.241	0.0563	2298.41	9	2350.0%	2	K.VMVACFEVFQTWDDEYEK.L
*	TK010303_lung_E18_mito_3_step12.3100.3100.2	3.2172	0.5059	2371.54	1	3750.0%	1	R.TLHTTASNWLHLIPQTLSPLK.R
	TK010303_lung_E18_mito_3_step06.1789.1789.3	1.7465	0.0012	2531.71	48	2140.0%	1	R.LRWQASSLPADDLCTENAIMLK.R
	TK010303_lung_E18_mito_3_step08.2621.2621.3	1.8064	0.0988	4065.9	11	1430.0%	1	R.VLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSR.V
	TK010303_lung_E18_mito_3_step02.2578.2578.2	1.0027	0.0358	3044.61	16	1800.0%	1	R.MLSAVSQQVQCIQEALREHSNPNYDK.T
	TK010303_lung_E18_mito_3_step11.2512.2512.2	3.4726	0.5508	1616.02	1	7500.0%	1	R.KLEHLITELVHQR.D
*	TK010303_lung_E18_mito_3_step10.3090.3090.2	1.2767	0.1402	2530.01	16	2140.0%	1	R.TLHTTASNWLHLIPQTLSPLKR.T
UNRP1_MOUSE99.6%6129.9%9231030206.0(P97333) Neuropilin-1 precursor (A5 protein)
*	TK010303_lung_E18_mito_3_step03.3548.3548.3	2.0518	0.0244	3209.91	9	1470.0%	1	K.GNLGGIAVDDISINNHISQEDCAKPTDLDK.K
*	TK010303_lung_E18_mito_3_step05.2766.2766.2	1.2796	0.0895	2391.21	14	2110.0%	1	R.IKPVSWETGISMRFEVYGCK.I
*	TK010303_lung_E18_mito_3_step05.2002.2002.2	2.9004	0.6322	2374.26	1	4000.0%	3	K.IENPGYLTSPGYPHSYHPSEK.C
*	TK010303_lung_E18_mito_3_step12.1645.1645.2	1.0726	0.0087	2150.23	15	2370.0%	1	K.FCGKIAPSPVVSSGPFLFIK.F
UQ922H299.6%4109.4%415479238.8(Q922H2) Similar to pyruvate dehydrogenase kinase, isoenzyme 3
	TK010303_lung_E18_mito_3_step09.1964.1964.3	1.7327	0.1692	1995.48	1	3060.0%	1	R.AAPLAGFGYGLPISRLYAR.Y
*	TK010303_lung_E18_mito_3_step11.2455.2455.2	2.528	0.3538	2207.42	1	3950.0%	3	R.MLINQHTLLFGGDTNPAHPK.H
URT22_MOUSE99.6%41010.0%359411928.6(Q9CXW2) Mitochondrial 28S ribosomal protein S22 (MRP-S22)
*	TK010303_lung_E18_mito_3_step03.2897.2897.2	2.7015	0.4511	2422.99	1	4000.0%	3	R.HADVLNLCVAQFEPDSAEYIK.V
*	TK010303_lung_E18_mito_3_step12.1857.1857.2	1.8466	0.2132	1757.23	1	5000.0%	1	K.TFRPAIQPLKPPTYK.L
UODBA_HUMAN99.6%104022.9%445504718.3(P12694) 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component alpha chain (E1)) (BCKDH E1-alpha)
*	TK010303_lung_E18_mito_3_step09.2680.2680.2	1.0193	0.0015	1673.46	11	3210.0%	1	R.QGQIINPSEDPHLPK.E
*	TK010303_lung_E18_mito_3_step05.2070.2070.3	1.8197	0.2274	3288.91	2	1880.0%	1	R.SHPPRQQQQFSSLDDKPQFPGASAEFIDK.L
*	TK010303_lung_E18_mito_3_step06.2315.2315.2	3.1837	0.5203	2003.2	1	5330.0%	6	R.HLQTYGEHYPLDHFDK.-
*	TK010303_lung_E18_mito_3_step08.4432.4432.2	1.1752	0.072	1931.51	4	2810.0%	1	R.QGQIINPSEDPHLPKEK.V
*	TK010303_lung_E18_mito_3_step10.4419.4419.3	1.7679	0.1016	4451.64	95	830.0%	1	R.ISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYR.D
UQ9DBP999.6%186812.4%9491058336.6(Q9DBP9) 1200017E13Rik protein
*	TK010303_lung_E18_mito_3_step08.3677.3677.2	1.7287	0.3154	2641.38	1	2620.0%	6	K.DYSDLAPFITEGLEVHFVEHYR.D
*	TK010303_lung_E18_mito_3_step08.2164.2164.1	2.1861	0.4722	1282.58	1	5910.0%	4	K.ILCFHGPPGVGK.T
*	TK010303_lung_E18_mito_3_step06.2226.2226.3	1.5052	0.0281	3187.32	26	1610.0%	1	K.IVSGEAQTVQVTPENLQDFVGKPVFTVER.M
*	TK010303_lung_E18_mito_3_step01.0198.0198.1	1.3362	0.3333	782.6	2	5710.0%	1	K.VLPVGGIK.E
*	TK010303_lung_E18_mito_3_step03.3337.3337.3	2.2897	0.0202	3925.36	2	1590.0%	2	K.RDDNNESDVVESLDEIYHTGTFAQIHEMQDLGDK.L
*	TK010303_lung_E18_mito_3_step01.2348.2348.1	2.1362	0.2432	1487.04	1	5830.0%	1	K.TENPLVLIDEVDK.I
URL7A_MOUSE99.6%168018.1%2652984510.6(P12970) 60S ribosomal protein L7a (Surfeit locus protein 3)
	TK010303_lung_E18_mito_3_step12.1451.1451.1	2.0422	0.0961	1220.76	2	6500.0%	1	R.RHWGGNVLGPK.S
	TK010303_lung_E18_mito_3_step11.1080.1080.1	1.302	2.0E-4	737.49	5	5000.0%	1	K.RPPVLR.A
	TK010303_lung_E18_mito_3_step12.4261.4261.2	3.06	0.5629	2690.82	1	3700.0%	5	K.AQLVVIAHDVDPIELVVFLPALCR.K
	TK010303_lung_E18_mito_3_step11.1145.1145.1	1.0364	0.0593	831.62	18	5000.0%	2	R.LGHLVHR.K
	TK010303_lung_E18_mito_3_step05.1917.1917.1	2.5272	0.4387	1066.52	1	6670.0%	7	R.HWGGNVLGPK.S
URL22_MOUSE99.6%1120.5%127146289.2(P41104) 60S ribosomal protein L22 (Heparin binding protein HBp15)
	TK010303_lung_E18_mito_3_step01.3370.3370.2	2.8718	0.5421	3086.64	1	3600.0%	1	K.FTLDCTHPVEDGIMDAANFEQFLQER.I
UQ91ZA399.6%81612.2%724796607.4(Q91ZA3) Propionyl CoA-carboxylase alpha-subunit
	TK010303_lung_E18_mito_3_step04.2370.2370.2	4.1567	0.6236	1929.05	1	6670.0%	3	R.HKQEDIPISGWAVECR.V
	TK010303_lung_E18_mito_3_step01.2182.2182.1	1.5364	0.0757	1205.63	58	4000.0%	1	R.SSQQQLLGTLK.H
	TK010303_lung_E18_mito_3_step01.2347.2347.2	1.4626	0.0894	2760.22	6	2000.0%	1	R.LAAEDVTFIGPDTHAIQAMGDKIESK.L
	TK010303_lung_E18_mito_3_step09.3850.3850.2	3.0234	0.4497	2837.27	1	3750.0%	1	R.LQVEHPVTECITGLDLVQEMILVAK.G
	TK010303_lung_E18_mito_3_step02.2040.2040.1	1.5617	0.2256	1119.74	1	6110.0%	2	R.GVTHNIPLLR.E
USPCA_MOUSE99.6%15238.3%24152799935.0(P08032) Spectrin alpha chain, erythrocyte (Erythroid alpha-spectrin)
*	TK010303_lung_E18_mito_3_step09.2315.2315.2	2.7894	0.4435	1733.59	1	4640.0%	2	R.KLAPDELPGFPQHQR.E
*	TK010303_lung_E18_mito_3_step10.3073.3073.2	2.8544	0.4625	1976.74	1	3750.0%	3	K.KHEAFLVDLNAFENSIK.A
*	TK010303_lung_E18_mito_3_step06.3558.3558.2	2.3467	0.0354	2343.21	2	3160.0%	1	K.ANVQLQQYLADLHEAEAWIK.E
*	TK010303_lung_E18_mito_3_step05.3790.3790.2	3.2066	0.4756	3187.62	1	3080.0%	1	R.GVNLEESLEYLQFMENAEEEEAWLGEK.C
*	TK010303_lung_E18_mito_3_step01.2396.2396.1	1.2824	0.108	1305.68	3	5000.0%	1	R.LERNLAVMDDK.V
	TK010303_lung_E18_mito_3_step05.4133.4133.2	1.0438	0.016	1405.72	7	4170.0%	1	R.DDLDKAITAQEGK.I
*	TK010303_lung_E18_mito_3_step02.3752.3752.2	1.6289	0.0139	2505.84	25	2000.0%	1	K.ALAAWKSQLDDVHAFQQFNWK.A
*	TK010303_lung_E18_mito_3_step08.3478.3478.2	1.3122	0.0443	2310.1	3	2500.0%	1	K.ETAVESSGPKVLETAEEIQHR.R
*	TK010303_lung_E18_mito_3_step10.2947.2947.3	2.1143	0.1181	4111.0	2	1390.0%	1	K.HGLLESDVTARQNQMDTLTDMAAHFEEIGHPDSGDIR.A
*	TK010303_lung_E18_mito_3_step01.1178.1178.1	1.3183	0.1776	591.37	7	7000.0%	1	K.TASLAK.A
*	TK010303_lung_E18_mito_3_step06.1871.1871.2	2.913	0.4118	1541.2	1	7080.0%	1	K.KHEALENDFAVHK.N
UC560_MOUSE99.6%61831.4%169183829.9(Q9CZB0) Succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursor (Integral membrane protein CII-3) (QPS1) (QPs-1)
*	TK010303_lung_E18_mito_3_step09.2248.2248.2	2.9257	0.5464	1831.46	1	5330.0%	4	K.NTSSNRPLSPHLTIYK.W
*	TK010303_lung_E18_mito_3_step10.2389.2389.3	1.728	0.0399	3623.87	8	1570.0%	1	R.HLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGGLAAL.-
*	TK010303_lung_E18_mito_3_step12.1587.1587.2	3.0558	0.5181	1956.58	1	4380.0%	1	K.KNTSSNRPLSPHLTIYK.W
UQ8R1S299.6%3642027.1%549603468.1(Q8R1S2) Similar to aldehyde dehydrogenase 4 family, member A1 (Fragment)
*	TK010303_lung_E18_mito_3_step03.2036.2036.1	1.8925	0.2132	1390.6	1	6000.0%	2	R.KEWDLKPMADR.A
*	TK010303_lung_E18_mito_3_step01.0220.0220.1	1.9199	0.3166	1447.59	1	3930.0%	1	K.STGSVVGQQPFGGAR.A
*	TK010303_lung_E18_mito_3_step04.1841.1841.1	1.1583	0.0269	1240.6	2	5560.0%	2	K.ETHKPLGDWR.Y
	TK010303_lung_E18_mito_3_step05.1808.1808.2	3.4189	0.3482	1683.53	1	5330.0%	3	R.ASGTNDKPGGPHYILR.W
*	TK010303_lung_E18_mito_3_step07.2850.2850.2	3.6648	0.5061	2178.01	1	4210.0%	19	K.NFHFVHSSADVDSVVSGTLR.S
*	TK010303_lung_E18_mito_3_step02.4450.4450.2	1.6653	0.2383	3034.29	2	1920.0%	1	R.FNAKFAVELEGEQPISVPPSTNHTVYR.G
	TK010303_lung_E18_mito_3_step05.4042.4042.2	1.7073	0.1905	2025.25	1	3530.0%	2	K.TVIQAEIDAAAELIDFFR.F
*	TK010303_lung_E18_mito_3_step10.3129.3129.3	3.2313	0.5146	3659.29	1	2580.0%	6	K.GQTEAIPCVVGDEEVWTSDIQYQLSPFNHAHK.V
UQ99L1399.6%4619.7%335354408.1(Q99L13) Similar to 3-hydroxyisobutyrate dehydrogenase
*	TK010303_lung_E18_mito_3_step01.3068.3068.2	1.3442	0.1851	2410.84	4	2270.0%	1	R.IITMLPSSMNAVEVYSGANGILK.K
*	TK010303_lung_E18_mito_3_step05.3026.3026.2	3.9889	0.6386	1582.57	1	7310.0%	2	K.TPILLGSLAHQIYR.M
*	TK010303_lung_E18_mito_3_step07.3420.3420.2	1.1071	0.0019	3106.32	4	1610.0%	1	K.ICNNMLLAISMIGTAEAMNLGIRSGLDPK.L
UFETA_MOUSE99.6%3519529.8%605673375.9(P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein)
*	TK010303_lung_E18_mito_3_step01.2027.2027.1	1.144	0.0107	1069.7	1	7500.0%	1	K.QELLINLVK.Q
*	TK010303_lung_E18_mito_3_step02.3976.3976.3	2.0722	0.2193	4626.82	1	1380.0%	1	K.NSGDGCLESQLSVFLDEICHETELSNKYGLSGCCSQSGVER.H
*	TK010303_lung_E18_mito_3_step10.3607.3607.2	1.4872	0.1674	3084.42	1	1730.0%	5	K.NSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK010303_lung_E18_mito_3_step04.2653.2653.1	1.8958	0.2811	1347.75	1	5450.0%	7	R.THPNLPVSVILR.I
*	TK010303_lung_E18_mito_3_step08.3758.3758.2	2.968	0.5044	2683.99	1	2830.0%	9	K.NVLSIATITFTQFVPEATEEEVNK.M
*	TK010303_lung_E18_mito_3_step10.4154.4154.2	1.4719	0.0954	2183.16	6	2780.0%	4	K.WSGCGEGMADIFIGHLCIR.N
*	TK010303_lung_E18_mito_3_step02.3392.3392.2	4.111	0.5473	2519.38	1	4090.0%	2	K.QKPELTEEQLAAVTADFSGLLEK.C
*	TK010303_lung_E18_mito_3_step09.4320.4320.3	2.1175	0.0748	4303.24	2	1320.0%	1	K.WITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEK.N
*	TK010303_lung_E18_mito_3_step09.2195.2195.2	1.8313	0.1771	1450.85	3	5000.0%	1	K.FGSRNLQATTIIK.L
UAS3A_MOUSE99.6%359.0%445498436.3(P70158) Acid sphingomyelinase-like phosphodiesterase 3a precursor (EC 3.1.4.-) (ASM-like phosphodiesterase 3a)
*	TK010303_lung_E18_mito_3_step09.2280.2280.2	3.0008	0.3528	1723.25	1	5710.0%	1	R.YSSVIAGQFYGHTHR.D
*	TK010303_lung_E18_mito_3_step08.3148.3148.2	2.604	0.3979	2907.28	1	2920.0%	2	R.APAVGQFWHVTDLHLDPTYHITDDR.T
UDDX5_HUMAN99.6%113.3%614691488.9(P17844) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5)
*	TK010303_lung_E18_mito_3_step12.3024.3024.2	3.3597	0.5131	2361.56	1	5260.0%	1	K.TLSYLLPAIVHINHQPFLER.G
UFKB1_MOUSE99.6%2247.7%107117918.2(P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12)
	TK010303_lung_E18_mito_3_step06.2063.2063.2	3.5034	0.5998	1951.34	1	5310.0%	1	K.RGQTCVVHYTGMLEDGK.K
*	TK010303_lung_E18_mito_3_step11.3136.3136.3	2.2286	0.0361	3649.42	14	1360.0%	1	K.LIISSDYAYGATGHPGIIPPHATLVFDVELLKLE.-
UMPPA_MOUSE99.6%175317.9%524582796.8(Q9DC61) Mitochondrial processing peptidase alpha subunit, mitochondrial precursor (EC 3.4.24.64) (Alpha-MPP) (P-55)
*	TK010303_lung_E18_mito_3_step09.3696.3696.2	1.2181	0.0902	2917.01	20	1670.0%	1	K.NYYTPDRMVLAGVGVEHEHLVECAR.K
*	TK010303_lung_E18_mito_3_step04.2421.2421.2	4.0499	0.6094	2008.01	1	6470.0%	2	R.MVLAGVGVEHEHLVECAR.K
	TK010303_lung_E18_mito_3_step01.2284.2284.1	1.5377	0.0018	1279.75	1	6000.0%	1	K.YLSGIAHFLEK.L
*	TK010303_lung_E18_mito_3_step07.3352.3352.2	4.8134	0.5884	2796.56	1	4230.0%	6	R.GKPAVAALGDLTDLPTYEHIQAALSSR.N
	TK010303_lung_E18_mito_3_step11.2007.2007.1	1.6725	0.0324	1382.69	2	5000.0%	2	R.KLPHELCTLIR.N
*	TK010303_lung_E18_mito_3_step12.1009.1009.3	1.9307	0.2038	3198.3	19	1550.0%	1	K.MLRGKPAVAALGDLTDLPTYEHIQAALSSR.N
*	TK010303_lung_E18_mito_3_step07.3850.3850.2	3.075	0.5263	1832.09	1	4060.0%	1	K.GLDTVVDLLADVVLHPR.L
USE1L_MOUSE99.6%5510.8%790883405.6(Q9Z2G6) Sel-1 homolog precursor (Suppressor of lin-12-like protein) (Sel-1L)
*	TK010303_lung_E18_mito_3_step06.2498.2498.2	1.2322	0.0308	2115.68	81	2220.0%	1	R.VSYALLFGDYLTQNIQAAK.E
	TK010303_lung_E18_mito_3_step09.3040.3040.2	1.5809	0.1825	2544.86	82	1670.0%	1	K.MYSEGSDIVPQSNETALHYFKK.A
*	TK010303_lung_E18_mito_3_step05.3408.3408.2	1.5114	0.1017	2585.76	1	2500.0%	1	K.ALERVSYALLFGDYLTQNIQAAK.E
	TK010303_lung_E18_mito_3_step09.3904.3904.3	1.5443	0.0407	4728.97	5	1130.0%	1	R.AFDYFNLAANAGNSHAMAFLGKMYSEGSDIVPQSNETALHYFK.K
	TK010303_lung_E18_mito_3_step06.2167.2167.2	3.4732	0.599	1842.21	1	6180.0%	1	K.GDVQAQVGLGQLHLHGGR.G
UK1CS_MOUSE99.6%41010.7%403445425.4(P19001) Keratin, type I cytoskeletal 19 (Cytokeratin 19) (K19) (CK 19)
*	TK010303_lung_E18_mito_3_step07.2866.2866.2	1.3063	0.0717	2320.02	110	1840.0%	1	R.VLDELTLARTDLEMQIESLK.E
*	TK010303_lung_E18_mito_3_step02.4232.4232.2	1.4104	0.2098	2527.66	2	2270.0%	3	R.YGVQLSQIQSVISGFEAQLSDVR.A
UTRM3_MOUSE99.6%113.0%744807757.8(Q9R1R2) Tripartite motif protein 3 (RING finger protein 22) (RING finger protein HAC1)
	TK010303_lung_E18_mito_3_step06.3815.3815.2	3.2136	0.5596	2433.55	1	3570.0%	1	R.KAEALAQISAAFEDLEQALQQR.K
URS7_HUMAN99.6%95326.8%1942212710.1(P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8)
	TK010303_lung_E18_mito_3_step04.3725.3725.2	4.5055	0.5879	2371.58	1	5000.0%	7	R.TLTAVHDAILEDLVFPSEIVGK.R
	TK010303_lung_E18_mito_3_step05.3722.3722.3	6.0069	0.6382	3333.12	1	3020.0%	2	K.IVKPNGEKPDEFESGISQALLELEMNSDLK.A
UPAGT_MOUSE99.6%5517.2%559642557.7(O08912) Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase) (UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase) (GalNAc-T1) (ppGaNTase-T1)
	TK010303_lung_E18_mito_3_step04.2799.2799.2	1.5198	0.0456	2096.77	4	2650.0%	1	R.SPRHMIEEIVLVDDASER.D
*	TK010303_lung_E18_mito_3_step12.2448.2448.3	4.022	0.337	2995.78	1	2590.0%	1	R.GLPAGDVLELVQKPHEGPGEMGKPVVIPK.E
	TK010303_lung_E18_mito_3_step10.2431.2431.2	1.0865	0.0933	2872.06	1	2080.0%	1	K.VYPDNLPTTSVVIVFHNEAWSTLLR.T
	TK010303_lung_E18_mito_3_step06.4045.4045.2	1.3139	0.0413	2701.75	24	1740.0%	1	K.VGIFNCHGMGGNQVFSYTANKEIR.T
UQ96HR099.6%4631.1%254278736.8(Q96HR0) Similar to RIKEN cDNA 0610025L15 gene
	TK010303_lung_E18_mito_3_step12.1855.1855.2	3.7018	0.0081	2350.6	1	4000.0%	2	R.LLYAVNTHCHADHITGSGLLR.S
	TK010303_lung_E18_mito_3_step12.2308.2308.3	1.8738	6.0E-4	3096.46	6	2230.0%	1	R.SLLPGCQSVISRLSGAQADLHIEDGDSIR.F
	TK010303_lung_E18_mito_3_step12.4001.4001.2	1.1	0.0683	3085.01	4	1610.0%	1	R.ASPGHTPGCVTFVLNDHSMAFTGDALLIR.G
UNIDO_MOUSE99.6%466.4%12451366235.5(P10493) Nidogen precursor (Entactin)
*	TK010303_lung_E18_mito_3_step03.2617.2617.2	1.292	0.1497	2807.9	1	2290.0%	1	K.LVLKQQFSGIDEHGHLTISTELEGR.V
*	TK010303_lung_E18_mito_3_step05.2838.2838.2	3.1538	0.3532	2145.67	1	4500.0%	2	K.SSNAGHQGVWVFEIGSPATAK.G
*	TK010303_lung_E18_mito_3_step03.4161.4161.3	1.764	0.1645	3878.37	212	980.0%	1	R.QTITFQECAHDDARPALPSTQQLSVDSVFVLYNK.E
UTCPE_MOUSE99.6%93914.8%541596246.0(P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon)
	TK010303_lung_E18_mito_3_step11.3099.3099.3	2.0164	0.0045	3916.83	1	1530.0%	1	K.LMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
	TK010303_lung_E18_mito_3_step06.3910.3910.2	2.9697	0.5731	3117.88	1	2590.0%	6	K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
	TK010303_lung_E18_mito_3_step11.2039.2039.3	2.051	0.0881	3363.56	15	1500.0%	1	R.AFADALEVIPMALSENSGMNPIQTMTEVRAR.Q
*	TK010303_lung_E18_mito_3_step03.2117.2117.1	2.1547	0.3451	1464.6	1	5910.0%	1	K.HKLDVMSVEDYK.A
URNP6_MOUSE99.6%4624.7%259296096.4(Q9CQ01) Ribonuclease 6 precursor (EC 3.1.27.-)
*	TK010303_lung_E18_mito_3_step02.2472.2472.2	1.4743	0.0794	2459.49	2	2500.0%	1	K.FGIKPSINYYQLADFKDALTR.I
*	TK010303_lung_E18_mito_3_step10.2511.2511.3	1.4593	0.0010	3561.45	8	1470.0%	1	K.IQCLMPEQGESVQTVGQIELCFTKEDLHLR.N
	TK010303_lung_E18_mito_3_step07.2436.2436.2	1.2989	0.0050	1596.08	111	3330.0%	2	K.LILTQHWPPTVCK.E
UABD3_MOUSE99.6%112.7%659754839.3(P55096) ATP-binding cassette, sub-family D, member 3 (70 kDa peroxisomal membrane protein) (PMP70) (PMP68)
*	TK010303_lung_E18_mito_3_step11.1857.1857.2	3.3097	0.5574	2172.98	1	5290.0%	1	R.HLHSTHSELLEDYYQSGR.M
UQ91V3199.6%51716.9%295328384.9(Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence)
	TK010303_lung_E18_mito_3_step06.3117.3117.2	3.9667	0.5215	2620.02	1	4090.0%	4	K.FLAAGTHLGGTNLDFQMEQYIYK.R
	TK010303_lung_E18_mito_3_step01.2491.2491.2	4.3633	0.64	2999.97	1	3850.0%	1	R.ADHQPLTEASYVNLPTIALCNTDSPLR.Y
UANX2_MOUSE99.6%3311.2%338385457.7(P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV)
	TK010303_lung_E18_mito_3_step08.3782.3782.2	4.8032	0.518	1652.25	1	6670.0%	1	K.SALSGHLETVILGLLK.T
	TK010303_lung_E18_mito_3_step11.1308.1308.3	1.3026	0.0395	1639.13	12	2500.0%	1	K.TPAQYDASELKASMK.G
*	TK010303_lung_E18_mito_3_step08.1569.1569.3	1.5567	0.2284	2389.16	11	2050.0%	1	K.ELPSALKSALSGHLETVILGLLK.T
UARF1_HUMAN99.6%98110.0%180205666.8(P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1
	TK010303_lung_E18_mito_3_step07.2961.2961.2	2.5751	0.0312	2156.96	1	4410.0%	9	R.HYFQNTQGLIFVVDSNDR.E
UCYPH_MOUSE99.6%1010016.6%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18)
	TK010303_lung_E18_mito_3_step02.2680.2680.2	4.0496	0.4744	2795.89	1	3850.0%	10	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
UQ6444999.6%9139.5%14791671126.0(Q64449) Lectin lambda
*	TK010303_lung_E18_mito_3_step07.3908.3908.3	1.1437	0.0154	3809.87	17	1290.0%	1	R.FEQAFVSSLIYNWEGEYFWTALQDLNSTGSFR.W
*	TK010303_lung_E18_mito_3_step03.3163.3163.2	1.649	0.0813	2388.32	94	1670.0%	1	R.GGGDLLSIHSMAELEFITKQIK.Q
*	TK010303_lung_E18_mito_3_step04.3955.3955.2	1.0408	0.072	2487.95	4	2370.0%	1	R.EHCYSFHMEVLLGHKEALQR.C
*	TK010303_lung_E18_mito_3_step04.4347.4347.2	1.4084	0.0825	2861.86	12	1800.0%	1	R.SSHSGPAEATEKNILVSDMEMNEQQE.-
*	TK010303_lung_E18_mito_3_step03.2959.2959.2	2.6569	0.3091	2498.4	1	2500.0%	2	K.LSSDQEQHWWIGLHTLESDGR.F
*	TK010303_lung_E18_mito_3_step10.1951.1951.1	1.1201	0.169	827.58	1	6670.0%	2	R.MAVSYTR.G
*	TK010303_lung_E18_mito_3_step09.2182.2182.2	3.1539	0.4998	1631.74	1	7500.0%	1	K.FFEHHSSWAQAQR.I
UQ99LG099.6%449.0%825934066.2(Q99LG0) Similar to ubiquitin specific protease 16
	TK010303_lung_E18_mito_3_step06.4019.4019.2	1.4045	0.086	2499.43	3	2500.0%	1	R.TVSLVHESFLDLSLPVLDDQSGK.K
*	TK010303_lung_E18_mito_3_step07.2612.2612.2	3.1522	0.511	2068.32	1	4710.0%	1	K.GQWFHISDTHVQAVPITK.V
*	TK010303_lung_E18_mito_3_step09.4363.4363.2	1.1301	0.0165	2163.35	296	2110.0%	1	K.SENLAKETIPMDSASQITVK.G
*	TK010303_lung_E18_mito_3_step03.3067.3067.3	1.3426	0.0083	3665.62	7	1420.0%	1	K.GQWFHISDTHVQAVPITKVLNSQAYLLFYER.I
UQ8R0B299.6%3514.8%236263696.8(Q8R0B2) Hypothetical 26.4 kDa protein (Fragment)
	TK010303_lung_E18_mito_3_step11.1525.1525.1	2.6345	0.4166	1496.6	1	6250.0%	2	K.LFHTAPNVPHYAK.N
	TK010303_lung_E18_mito_3_step09.3390.3390.2	1.375	0.0378	2519.17	140	1430.0%	1	R.KLVQTTYECLMQAIDAVKPGVR.Y
UQ9CZ4799.6%114.4%388435066.6(Q9CZ47) 2610040F05Rik protein
*	TK010303_lung_E18_mito_3_step11.2587.2587.2	3.1852	0.4882	2089.21	1	5000.0%	1	R.KQENLMPAVHWWQPVPK.A
UH11_MOUSE99.6%229.4%2122165410.9(P43275) Histone H1.1 (H1 VAR.3) (H1A)
*	TK010303_lung_E18_mito_3_step11.2667.2667.2	3.1801	0.5107	2012.84	1	5790.0%	1	R.KKPAGPSVSELIVQAVSSSK.E
*	TK010303_lung_E18_mito_3_step07.3086.3086.2	2.0554	0.3131	1884.02	111	2220.0%	1	K.KPAGPSVSELIVQAVSSSK.E
UIDE_HUMAN99.6%112.4%10181178906.8(P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease)
*	TK010303_lung_E18_mito_3_step12.2653.2653.2	3.1387	0.5191	2513.66	1	2830.0%	1	K.SNPGHYLGHLIGHEGPGSLLSELK.S
UQ9JHJ399.6%138112.9%404438046.1(Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene)
*	TK010303_lung_E18_mito_3_step07.4348.4348.2	1.3406	0.0090	2654.81	52	1670.0%	1	R.GNHSLFGLEVATLGQGPDCPSVNER.N
*	TK010303_lung_E18_mito_3_step02.3477.3477.2	3.1956	0.448	2880.48	1	3270.0%	8	R.LLEFDSTNASEGAQPPGKPYPPYSLAK.F
URL4_MOUSE99.6%356.7%4194715411.0(Q9D8E6) 60S ribosomal protein L4 (L1)
	TK010303_lung_E18_mito_3_step01.2062.2062.1	2.084	0.2569	1270.77	1	5910.0%	2	R.NIPGITLLNVSK.L
	TK010303_lung_E18_mito_3_step12.2351.2351.2	3.1386	0.5046	1861.92	1	5670.0%	1	K.APIRPDIVNFVHTNLR.K
UPYRG_MOUSE99.6%243.7%591667116.6(P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase)
*	TK010303_lung_E18_mito_3_step05.2106.2106.2	3.1536	0.4765	2391.62	1	4520.0%	2	K.TSHPVVIDMPEHNPGQMGGTMR.L
UDHBK_MOUSE99.5%395.1%312347429.5(O70503) Putative steroid dehydrogenase KIK-I (EC 1.1.1.-)
*	TK010303_lung_E18_mito_3_step05.1997.1997.2	2.7821	0.4525	1805.26	1	5330.0%	3	K.IQKPTLDKPSAETFVK.S
UGDIC_MOUSE99.5%2210.3%445505376.2(Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3)
	TK010303_lung_E18_mito_3_step03.3581.3581.2	3.2199	0.428	2298.52	1	4210.0%	1	K.KFDLGQDVIDFTGHSLALYR.T
	TK010303_lung_E18_mito_3_step02.4282.4282.2	1.0669	0.0149	2971.68	2	1800.0%	1	K.KVLHMDQNPYYGGESASITPLEDLYK.R
UQ9D7R699.5%3518.1%216250309.4(Q9D7R6) 2010005E08Rik protein
	TK010303_lung_E18_mito_3_step06.3361.3361.2	1.2191	0.0465	2562.15	114	1590.0%	1	R.IIPKPEFPRADGIVPETWTDGPK.D
	TK010303_lung_E18_mito_3_step07.2253.2253.2	3.0662	0.44	1732.58	1	5330.0%	2	R.GTMIASEAPLLHHQVK.L
UGLYM_HUMAN99.5%51712.3%504559938.5(P34897) Serine hydroxymethyltransferase, mitochondrial precursor (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT)
*	TK010303_lung_E18_mito_3_step10.2831.2831.3	3.1041	0.3577	2577.71	1	3040.0%	4	R.EVCDEVKAHLLADMAHISGLVAAK.V
*	TK010303_lung_E18_mito_3_step12.2131.2131.3	1.7788	0.0834	4128.43	8	1220.0%	1	R.ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR.I
UPGBM_MOUSE99.5%14168.9%37073982956.3(Q05793) Basement membrane-specific heparan sulfate proteoglycan core protein precursor (HSPG) (Perlecan) (PLC)
*	TK010303_lung_E18_mito_3_step06.3149.3149.2	1.2754	0.0171	3188.61	10	1550.0%	1	K.VGGHLRPGIVQSGTIIRIAHVELADAGQYR.C
*	TK010303_lung_E18_mito_3_step09.2970.2970.2	2.3506	0.3539	2444.31	1	2950.0%	1	K.MASVGLSDIVMDTTVTHTTIHGR.A
*	TK010303_lung_E18_mito_3_step05.1782.1782.1	1.2914	0.0889	969.48	28	5000.0%	1	R.VDGGRPVLR.S
*	TK010303_lung_E18_mito_3_step12.2101.2101.2	1.4702	0.0444	2314.23	13	2000.0%	1	R.AELLVAEAPSKPIMVTVEEQR.S
*	TK010303_lung_E18_mito_3_step12.3711.3711.3	2.2979	0.0956	3617.7	40	1250.0%	2	R.VPAGSAAVFPCMASGYPTPAITWSKVDGDLPPDSR.L
*	TK010303_lung_E18_mito_3_step04.3138.3138.3	1.8252	0.018	4661.56	7	1220.0%	1	R.IQNLDQNCQGTYVCQAHGPWGQAQATAQLIVQALPSVLINVR.T
*	TK010303_lung_E18_mito_3_step06.2614.2614.1	2.1614	0.0559	1592.2	1	4640.0%	1	R.VTMTSEGGRGTLIIR.D
*	TK010303_lung_E18_mito_3_step12.4012.4012.2	1.5333	0.1077	2779.16	1	2500.0%	1	R.SPTNLANRQPDFISFGLVGGRPEFR.F
*	TK010303_lung_E18_mito_3_step05.3982.3982.3	1.7528	0.1816	4126.56	113	1000.0%	1	R.VGSAEAFAQVLVQGSSSNLPDTSIPGGSTPTVQVTPQLETR.N
*	TK010303_lung_E18_mito_3_step07.3145.3145.3	1.6741	0.0812	2783.9	16	1610.0%	1	R.ATFSSVPRAASISAVSLEGAQPGPSSGPR.A
	TK010303_lung_E18_mito_3_step07.2585.2585.2	3.2177	0.4205	2746.42	1	3700.0%	1	R.HQGSELHFPSVQPSDAGVYICTCR.N
*	TK010303_lung_E18_mito_3_step12.3572.3572.2	1.5269	0.091	2567.23	1	2620.0%	1	R.LCNECSDGSFHLSKQNPDGCLK.C
	TK010303_lung_E18_mito_3_step09.1908.1908.2	2.141	0.2921	1720.99	1	4640.0%	1	S.CVVPGQAHAQVTWHK.R
UQ8R0W099.5%118.2%231252245.2(Q8R0W0) Hypothetical 25.2 kDa protein (Fragment)
	TK010303_lung_E18_mito_3_step04.2427.2427.2	3.1823	0.4267	2014.71	1	4170.0%	1	R.LLEAQIATGGVIDPVHSHR.V
UO8852699.5%115.0%323357177.9(O88526) Nitrilase homolog 1
	TK010303_lung_E18_mito_3_step08.2076.2076.2	3.0899	0.5306	1837.8	1	5670.0%	1	R.KTHLCDVEIPGQGPMR.E
UQ9CZ5699.5%2250.0%132141939.2(Q9CZ56) 2810405J23Rik protein
	TK010303_lung_E18_mito_3_step12.2891.2891.2	3.0801	0.5284	2853.02	1	3460.0%	1	K.GAHNGQGLGNAFLSHISACDGIFHLTR.K
	TK010303_lung_E18_mito_3_step02.3888.3888.3	1.9761	0.1693	4243.91	7	1320.0%	1	K.IGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESR.V
UIF5_HUMAN99.5%228.1%431491245.6(P55010) Eukaryotic translation initiation factor 5 (eIF-5)
*	TK010303_lung_E18_mito_3_step10.2469.2469.2	1.3924	0.0127	1761.91	40	2860.0%	1	K.YFGCELGAQTQFDVK.N
*	TK010303_lung_E18_mito_3_step11.2945.2945.2	3.1114	0.5196	2312.18	1	4470.0%	1	R.YLLHGLECVVAMHQAQLISK.I
UECH1_MOUSE99.5%5713.5%327361187.7(O35459) Delta3,5-delta2,4-dienoyl-CoA isomerase, mitochondrial precursor (EC 5.3.3.-)
*	TK010303_lung_E18_mito_3_step01.0652.0652.1	0.8903	0.0029	761.64	226	5000.0%	1	K.RNAMNR.A
*	TK010303_lung_E18_mito_3_step05.2957.2957.3	1.7471	0.0694	3071.8	2	2000.0%	1	R.DHSVDESLDYMATWNMSMLQTQDIIK.S
*	TK010303_lung_E18_mito_3_step12.1384.1384.1	1.7238	0.148	1471.88	1	5000.0%	2	K.HVLHVQLNRPEK.R
UGCST_HUMAN99.5%5178.9%403439468.6(P48728) Aminomethyltransferase, mitochondrial precursor (EC 2.1.2.10) (Glycine cleavage system T protein) (GCVT)
*	TK010303_lung_E18_mito_3_step11.2103.2103.2	0.9558	0.0382	2500.39	25	2270.0%	1	R.VGLMCEGAPMRAHSPILNMEGTK.I
*	TK010303_lung_E18_mito_3_step07.2289.2289.1	2.563	0.3858	1457.63	1	4580.0%	4	R.TPLYDFHLAHGGK.M
UGBB2_HUMAN99.5%4167.1%340373316.0(P11016) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit) (P11016) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2) (G protein beta 2 subunit)
	TK010303_lung_E18_mito_3_step08.3542.3542.2	3.0951	0.5181	2742.95	1	3260.0%	4	R.ADQELLMYSHDNIICGITSVAFSR.S
UQ9D28599.5%119.7%134149088.5(Q9D285) Adult male colon cDNA, RIKEN full-length enriched library, clone:9030215D04, full insert sequence
	TK010303_lung_E18_mito_3_step12.1173.1173.1	2.5036	0.4097	1596.56	1	6250.0%	1	R.VHIYHHTGNNTFR.V
UDHE3_MOUSE99.5%2419419.7%558613378.0(P26443) Glutamate dehydrogenase, mitochondrial precursor (EC 1.4.1.3) (GDH)
	TK010303_lung_E18_mito_3_step01.2655.2655.1	1.6558	0.1043	1241.74	8	4500.0%	1	R.YSTDVSVDEVK.A
	TK010303_lung_E18_mito_3_step03.3883.3883.2	1.3969	0.0976	2744.46	1	2390.0%	1	R.NIMVIPDLYLNAGGVTVSYFEWLK.N
	TK010303_lung_E18_mito_3_step10.4053.4053.2	2.877	0.4958	3036.36	1	2590.0%	4	R.GVFHGIENFINEASYMSILGMTPGFGDK.T
	TK010303_lung_E18_mito_3_step03.2744.2744.2	2.4446	0.4705	1749.3	1	4670.0%	1	K.TFVVQGFGNVGLHSMR.Y
	TK010303_lung_E18_mito_3_step03.2056.2056.1	1.1814	0.0413	997.43	133	5710.0%	1	R.RFTMELAK.K
	TK010303_lung_E18_mito_3_step03.2360.2360.1	1.6572	0.2339	1198.7	1	6500.0%	13	K.LQHGSILGFPK.A
	TK010303_lung_E18_mito_3_step01.1375.1375.1	1.5691	0.0365	1220.52	12	4090.0%	1	K.CAVVDVPFGGAK.A
UQ9D8P499.5%2227.3%176202499.8(Q9D8P4) Ribosomal protein, mitochondrial, L26
*	TK010303_lung_E18_mito_3_step11.3671.3671.3	3.2904	0.4272	4040.27	1	1790.0%	1	R.DSNLTLLNQLLLGLQQDLHHNQDASLHSSCTVQTPK.T
*	TK010303_lung_E18_mito_3_step10.2306.2306.2	1.3556	0.0755	1374.59	1	5450.0%	1	K.GNYLPPLPLPHR.D
UCHD1_MOUSE99.5%465.4%17111964107.4(P40201) Chromodomain-helicase-DNA-binding protein 1 (CHD-1)
*	TK010303_lung_E18_mito_3_step10.3915.3915.3	3.2722	0.4341	3773.3	1	2060.0%	2	K.SVVSDAPVHITASGEPVPIAEESEELDQKTFSICK.E
*	TK010303_lung_E18_mito_3_step04.2763.2763.2	1.3532	0.0457	2556.37	33	1820.0%	1	K.RAETHENEPGPLSVGDELLSQFK.V
*	TK010303_lung_E18_mito_3_step07.4398.4398.3	1.4465	0.025	3598.69	3	1540.0%	1	K.QPQQAQQQRPASSNSGSEEDSSSSEDSDDSSSGAK.R
UQ91V8699.4%398.2%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence)
*	TK010303_lung_E18_mito_3_step01.1082.1082.1	2.1003	0.4182	1106.65	1	6360.0%	3	K.VVAGVAAALAHK.Y
UQ91YJ299.4%114.2%450517785.8(Q91YJ2) Similar to sorting nexin 4
*	TK010303_lung_E18_mito_3_step04.2885.2885.2	2.5229	0.5061	2178.08	1	4440.0%	1	R.KHELMQYDLETAAQDLAAK.K
ULMA5_MOUSE99.4%162210.2%37184040136.7(Q61001) Laminin alpha-5 chain precursor
*	TK010303_lung_E18_mito_3_step02.4262.4262.3	1.6622	0.0683	4190.65	12	1320.0%	1	R.HEFVDMEGWVLLSSDRQVVPHEHRPEIELLHADLR.S
*	TK010303_lung_E18_mito_3_step09.4230.4230.3	2.371	0.1616	4482.7	1	1530.0%	1	R.CYCRPNFTGELCAACAEGYTDFPHCYPLPSFPHNDTR.E
*	TK010303_lung_E18_mito_3_step12.2635.2635.3	1.9469	0.038	3974.18	3	1500.0%	1	K.AKMPYVSLELEMRPLAAAGLIFHLGQALATPYMQLK.V
*	TK010303_lung_E18_mito_3_step03.3849.3849.2	2.7576	0.504	2477.6	1	3910.0%	1	K.ATLQAASLILGHVSELLQGIDQAK.E
*	TK010303_lung_E18_mito_3_step09.3166.3166.3	2.7352	0.3535	3223.31	1	1980.0%	1	R.IVPLENGEIVVSLVNGRPGALNFSYSPLLR.D
*	TK010303_lung_E18_mito_3_step12.3237.3237.2	1.8223	0.2453	2813.01	1	2290.0%	1	R.YAFLLHGYQPVHPSFPVEVLINGGR.I
*	TK010303_lung_E18_mito_3_step09.1867.1867.3	1.6162	0.0423	3430.72	26	1450.0%	1	K.VDLVEAAEAHAQKLNQLAINLSGIILGINQDR.F
*	TK010303_lung_E18_mito_3_step01.3192.3192.2	1.3131	0.1328	2746.42	3	1800.0%	1	R.LHLSMLVRPHAASQGLLLSTAPMSGR.S
*	TK010303_lung_E18_mito_3_step08.3658.3658.3	1.6519	0.0017	4261.23	4	1380.0%	3	R.NAATSLSLFYNNGALPCGCHEVGAVSPTCEPFGGQCPCR.G
*	TK010303_lung_E18_mito_3_step12.2820.2820.2	1.2732	0.1595	2693.13	35	1600.0%	1	K.ADPLQPPQALTAASKAIQVFLLAGNR.K
*	TK010303_lung_E18_mito_3_step12.1968.1968.2	1.667	0.1784	2370.19	2	2890.0%	1	R.CVCHGHADVCDAKDPLDPFR.L
*	TK010303_lung_E18_mito_3_step09.2187.2187.2	2.5145	0.4531	1436.46	1	7500.0%	1	K.DHYLPDLHHMR.L
*	TK010303_lung_E18_mito_3_step03.2517.2517.3	1.9797	0.0072	4035.98	4	1590.0%	1	R.VQEQLTSFWEENQSLATHIRDQLAQYESGLMDLR.E
*	TK010303_lung_E18_mito_3_step09.3998.3998.2	1.3256	0.0427	2888.06	1	2170.0%	1	R.LMARVQEQLTSFWEENQSLATHIR.D
UBUB3_MOUSE99.4%3322.7%326369856.7(Q9WVA3) Mitotic checkpoint protein BUB3 (WD-repeat type I transmembrane protein A72.5)
	TK010303_lung_E18_mito_3_step12.1328.1328.3	1.371	0.0033	3168.13	38	1800.0%	1	R.CVEYCPEVNVMVTGSWDQTVKLWDPR.T
	TK010303_lung_E18_mito_3_step04.2954.2954.2	2.8988	0.5318	3189.45	1	2410.0%	1	K.YQHTGAVLDCAFYDPTHAWSGGLDHQLK.M
	TK010303_lung_E18_mito_3_step03.4055.4055.3	1.5965	0.1302	4761.28	1	1190.0%	1	K.MHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVK.L
UPL10_MOUSE99.4%579.5%660731417.2(P16381) Putative ATP-dependent RNA helicase PL10
	TK010303_lung_E18_mito_3_step01.3215.3215.1	1.5995	0.2188	1128.99	2	5560.0%	1	K.DLLDLLVEAK.Q
	TK010303_lung_E18_mito_3_step06.1778.1778.1	1.6909	0.3178	1180.54	2	5000.0%	2	R.GCHLLVATPGR.L
*	TK010303_lung_E18_mito_3_step07.2046.2046.3	1.7748	0.1226	2675.23	9	1980.0%	1	K.TAAFLLPILSQIYTDGPGEALRAMK.E
	TK010303_lung_E18_mito_3_step02.2869.2869.2	2.5167	0.4911	2147.98	1	4060.0%	1	K.QEVPSWLENMAFEHHYK.G
URL30_HUMAN99.4%3337.7%114126539.6(P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30
	TK010303_lung_E18_mito_3_step02.2265.2265.1	2.4808	0.2982	1446.84	1	5000.0%	1	R.KSEIEYYAMLAK.T
	TK010303_lung_E18_mito_3_step07.1706.1706.2	2.3874	0.5191	2016.33	1	3610.0%	1	K.TGVHHYSGNNIELGTACGK.Y
	TK010303_lung_E18_mito_3_step01.1658.1658.1	1.27	0.0657	1353.96	9	3640.0%	1	K.LVILANNCPALR.K
UAMPE_MOUSE99.4%7156.5%9451079565.4(P16406) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopeptidase A) (APA) (BP-1/6C3 antigen)
*	TK010303_lung_E18_mito_3_step12.1993.1993.3	2.2274	0.03	3137.22	1	2130.0%	2	K.QEYVVIQAAEDLAATSGDSVYRLTMEFK.G
*	TK010303_lung_E18_mito_3_step03.3500.3500.2	1.1623	0.0305	2832.07	170	1250.0%	1	R.FLLDSKADPSQPPSELGYTWNIPVR.W
*	TK010303_lung_E18_mito_3_step03.3216.3216.2	2.8225	0.422	2516.54	1	3640.0%	3	K.KQEYVVIQAAEDLAATSGDSVYR.L
*	TK010303_lung_E18_mito_3_step02.2530.2530.1	1.3581	0.1463	952.79	2	6670.0%	1	R.DLWLHIR.E
UQ9CYW499.4%61236.7%251280276.8(Q9CYW4) 2810435D12Rik protein (RIKEN cDNA 2810435D12 gene)
*	TK010303_lung_E18_mito_3_step12.3315.3315.3	1.57	0.0327	3098.0	13	1610.0%	2	R.DSVPKEHILPSLSHLLPALDLLEASSPMS.-
*	TK010303_lung_E18_mito_3_step03.3363.3363.3	2.2609	0.1092	4525.48	22	1010.0%	2	R.ACVEPAVAAHVGDSYLCDYQGSQAVGMHSFLVAGSEPLDSAVR.D
*	TK010303_lung_E18_mito_3_step06.2623.2623.2	2.4881	0.3969	2303.19	2	3160.0%	2	R.EHFDFVLTSEAVGCPKPDPR.I
UCYC_MOUSE99.4%129010.6%104114749.6(P00009) Cytochrome c, somatic
	TK010303_lung_E18_mito_3_step03.2397.2397.1	1.794	0.392	1171.54	2	4500.0%	9	K.TGPNLHGLFGR.K
UQ9H8Y799.4%469.7%545596449.0(Q9H8Y7) Hypothetical protein FLJ13140
*	TK010303_lung_E18_mito_3_step12.3152.3152.3	1.7635	0.0028	2934.66	70	1630.0%	1	K.DSSGFIFDLQSNTVLAQGGAFENMKEK.I
*	TK010303_lung_E18_mito_3_step01.1320.1320.1	0.8966	0.0361	942.57	86	4290.0%	1	R.EVLPGNRR.G
*	TK010303_lung_E18_mito_3_step05.3478.3478.2	2.9552	0.5172	2159.65	1	4410.0%	2	K.SNNEIILVLQHFDNCVDK.T
UQ9Z1X599.4%5118.8%701786426.0(Q9Z1X5) GLUT4 vesicle protein (Fragment)
	TK010303_lung_E18_mito_3_step03.2991.2991.2	2.674	0.5039	2548.96	1	3180.0%	1	K.VLQAGVLDNWYPLQGGQGQVHLR.L
	TK010303_lung_E18_mito_3_step02.1980.1980.2	1.4422	0.203	3039.72	1	1920.0%	1	R.YKVSLTTVLNSGFLDEWLTLEDVPSGR.L
	TK010303_lung_E18_mito_3_step09.2040.2040.1	1.7233	0.3528	1408.66	1	4550.0%	3	R.KPHAESLELQVR.G
UQ9D7N999.4%2210.8%415464346.3(Q9D7N9) 2310001A20Rik protein (Integral plasma membrane protein)
*	TK010303_lung_E18_mito_3_step11.1305.1305.2	2.5578	0.416	2035.01	2	3820.0%	1	R.RPLRPQVVTDDGQVPEVK.E
*	TK010303_lung_E18_mito_3_step02.3748.3748.2	2.6623	0.5096	2849.87	1	2500.0%	1	R.LFENQLSGPESIVNIGDVLFTGTADGR.V
UO5489399.4%6129.9%11711275236.2(O54893) Putative membrane-associated guanylate kinase 1
*	TK010303_lung_E18_mito_3_step10.4439.4439.3	2.2702	0.1474	3517.29	1	1820.0%	1	R.SLHTASPSHGIQVLPEYLPADAPAPDQTDSSGQK.K
	TK010303_lung_E18_mito_3_step04.2391.2391.1	1.9935	0.4006	1271.8	1	5000.0%	3	R.YDVLGVIDSCK.E
*	TK010303_lung_E18_mito_3_step07.2017.2017.3	1.4009	0.0127	4368.72	4	1330.0%	1	K.RTPQGSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSAVLQPYDVEIR.R
*	TK010303_lung_E18_mito_3_step07.3942.3942.2	1.2499	0.0978	2699.36	5	2290.0%	1	K.IATITTTHAPSQQGTQETRTTTKPK.Q
UQ9ER5899.4%114.0%423468634.9(Q9ER58) Testican-2 protein precursor
*	TK010303_lung_E18_mito_3_step08.2173.2173.2	2.4481	0.5274	2030.9	1	4380.0%	1	K.KKPGVFIPSCDEDGYYR.K
UQ9CYN699.4%4413.5%711808527.2(Q9CYN6) 5730405E07Rik protein
*	TK010303_lung_E18_mito_3_step12.1839.1839.1	2.3161	0.4003	1585.66	1	4580.0%	1	K.SLLPEHIQHHFAR.D
*	TK010303_lung_E18_mito_3_step12.2280.2280.2	1.4548	0.1207	2411.05	8	2370.0%	1	K.IFLYPNADQLKCLEELLSSR.D
*	TK010303_lung_E18_mito_3_step12.3459.3459.2	3.1349	0.4225	2582.0	1	3640.0%	1	R.LKEDGSYQLPVVVLMLNLPHASR.D
*	TK010303_lung_E18_mito_3_step06.3893.3893.3	2.3626	0.2047	4631.28	22	1030.0%	1	R.YNIEPSLYCPFLSLGACMEGLNVLFNKLLGITLYAEQTFK.G
UQ8R1S099.4%448.5%470507937.0(Q8R1S0) Similar to CGI-10 protein (Fragment)
*	TK010303_lung_E18_mito_3_step12.2563.2563.2	2.3889	0.3996	1868.26	1	4380.0%	1	R.ALFPLGLGHAAEYVRPR.V
*	TK010303_lung_E18_mito_3_step09.1898.1898.1	1.82	0.338	1078.53	1	6670.0%	1	R.HAVALLKPTK.V
	TK010303_lung_E18_mito_3_step01.2159.2159.1	1.8047	0.2217	1380.96	1	5420.0%	1	R.HNTALLAATDLLK.R
UATY2_MOUSE99.4%578.3%12001323788.0(Q9EPE9) Probable cation-transporting ATPase 2 (EC 3.6.3.-) (CATP)
*	TK010303_lung_E18_mito_3_step06.4022.4022.2	1.2251	0.0412	2690.93	2	2200.0%	1	R.LRPGLAAGPALIANGDELVAAVWPYR.R
*	TK010303_lung_E18_mito_3_step03.3777.3777.3	1.7437	0.0787	4016.16	44	1180.0%	1	K.EVTPVSSIPIETHRALASCHSLMQLDDGTLVGDPLEK.A
	TK010303_lung_E18_mito_3_step12.2191.2191.2	2.9555	0.5294	3047.93	1	3200.0%	1	K.GAPETLHSMFSQCPPDYHHIHTEISR.E
	TK010303_lung_E18_mito_3_step07.2700.2700.2	2.0144	0.0653	1342.75	66	4000.0%	2	R.CTLVTTLQMFK.I
UQ8R2K399.4%2412.2%148171579.8(Q8R2K3) Similar to single-stranded DNA binding protein
	TK010303_lung_E18_mito_3_step06.3139.3139.2	3.0679	0.4707	1996.2	1	4120.0%	2	R.QATTIIADNIIFLSDQTK.E
UQ9QZE599.4%91126.9%874975135.3(Q9QZE5) Coat protein gamma-cop (Coatomer protein complex, subunit gamma 1)
	TK010303_lung_E18_mito_3_step07.3756.3756.2	3.1681	0.3972	2628.07	1	3330.0%	1	K.ETGLSHLCEFIEDCEFTVLATR.I
*	TK010303_lung_E18_mito_3_step12.2293.2293.2	2.0587	0.0347	2554.29	3	2390.0%	1	K.DEESGGGSNPLQHLEKSAVLQEAR.V
	TK010303_lung_E18_mito_3_step04.4137.4137.3	2.3299	0.2442	4073.59	1	1420.0%	1	K.HEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPK.A
*	TK010303_lung_E18_mito_3_step07.3796.3796.2	2.5262	0.3861	3035.41	1	3200.0%	2	K.VNFEAAWDEVGDEFEKEETFTLSTIK.T
	TK010303_lung_E18_mito_3_step02.2090.2090.1	1.7505	0.3175	1204.61	1	7000.0%	1	R.ILHLLGQEGPK.T
*	TK010303_lung_E18_mito_3_step11.1583.1583.3	1.9504	0.0663	4031.41	3	1460.0%	1	K.ALNAGYILNGLTVSIPGLEKALQQYTLEPSEKPFDLK.S
*	TK010303_lung_E18_mito_3_step10.4041.4041.3	2.1666	0.1832	4480.45	4	1220.0%	1	R.QEIFQEQLAAVPEFQGLGPLFKSSPEPVALTESETEYVIR.C
*	TK010303_lung_E18_mito_3_step04.3111.3111.3	1.7698	0.0391	4319.94	133	970.0%	1	K.FTVKDCDPNTGEIDEEGYEDEYVLEDLEVTVADHIQK.V
UGNT1_MOUSE99.4%112.9%447516908.9(P27808) Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC 2.4.1.101) (N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I) (GNT-I) (GlcNAc-T I)
	TK010303_lung_E18_mito_3_step05.2062.2062.1	2.5535	0.3723	1499.54	1	5000.0%	1	K.GVSHGQFFDQHLK.F
UQ9D05099.4%245.1%312345548.1(Q9D050) 2310034D24Rik protein
	TK010303_lung_E18_mito_3_step11.2744.2744.2	3.0973	0.47	1778.03	1	5000.0%	2	R.SAATLITHPFHVITLR.S
UQ9D6E699.4%4623.3%172198614.8(Q9D6E6) 2900073G15Rik protein
*	TK010303_lung_E18_mito_3_step02.3302.3302.2	1.3431	0.0314	2364.64	6	2630.0%	1	R.NAFACFDEEAIGTIQEDYLR.E
*	TK010303_lung_E18_mito_3_step08.2996.2996.3	1.9521	0.1107	3381.67	11	1520.0%	1	R.NAFACFDEEAIGTIQEDYLRELLTTMGDR.F
	TK010303_lung_E18_mito_3_step03.2271.2271.1	2.3489	0.3861	1390.78	1	6500.0%	2	K.KGNFNYIEFTR.I
UQ8R2M599.4%4613.8%536601295.7(Q8R2M5) Hypothetical 60.1 kDa protein (Fragment)
	TK010303_lung_E18_mito_3_step12.2503.2503.1	1.827	0.2405	1416.54	1	4550.0%	1	R.VWGVPIPVFHHK.T
*	TK010303_lung_E18_mito_3_step03.3127.3127.3	2.5856	0.3087	4373.67	32	1010.0%	1	R.FLLGNLTGFNPETDSVPVKNMYVIDQYMLHLIQDFATK.I
*	TK010303_lung_E18_mito_3_step09.3878.3878.2	3.1293	0.4439	2747.71	1	3480.0%	2	R.AFAPILPHLAEEVFQHIPYVTEPK.S
UQ9DCN399.4%51113.2%627716856.7(Q9DCN3) 0610016I07Rik protein
	TK010303_lung_E18_mito_3_step05.2429.2429.3	2.4034	0.1745	4150.66	6	1390.0%	1	R.MLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLR.G
	TK010303_lung_E18_mito_3_step09.3836.3836.2	1.2875	0.0156	2294.2	8	2110.0%	1	R.RFCQTGAVLFLLVTVIVNIK.L
	TK010303_lung_E18_mito_3_step07.2526.2526.2	2.8224	0.4929	2691.73	1	2800.0%	3	K.KPPSVTPIFLEPPPKEEGAPGAAEQT.-
UPIMT_MOUSE99.3%3524.3%226245037.6(P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase)
	TK010303_lung_E18_mito_3_step04.1842.1842.1	1.9321	0.2545	1479.79	1	4230.0%	2	K.SGGASHSELIHNLR.K
*	TK010303_lung_E18_mito_3_step12.2759.2759.3	2.0417	0.1986	4203.48	3	1190.0%	1	R.LVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR.L
UITA2_MOUSE99.3%338.2%11781289275.2(Q62469) Integrin alpha-2 precursor (Platelet membrane glycoprotein Ia) (GPIa) (Collagen receptor) (VLA-2 alpha chain) (CD49b)
*	TK010303_lung_E18_mito_3_step10.2254.2254.2	3.0444	0.4778	2444.81	1	4250.0%	1	K.CSEHHISIQKPSDVVNPLDLR.V
*	TK010303_lung_E18_mito_3_step03.3269.3269.3	1.8191	0.0739	4340.26	14	1190.0%	1	R.NHSSFLGYSVAAISTEDGVHFVAGAPRANYTGQIVLYSVNK.Q
*	TK010303_lung_E18_mito_3_step08.3732.3732.3	2.4917	0.0123	3555.6	1	1540.0%	1	-.MGPGQAGGALLLQLLMLVQGILNCLAYNVGLPGAK.I
UMPCP_MOUSE99.3%5535.9%357396329.3(Q8VEM8) Phosphate carrier protein, mitochondrial precursor (PTP)
	TK010303_lung_E18_mito_3_step12.1444.1444.2	3.1415	0.4193	1588.19	1	4620.0%	1	R.LPRPPPPEMPESLK.K
*	TK010303_lung_E18_mito_3_step07.3740.3740.2	1.8249	0.2482	2910.84	2	1920.0%	1	K.YYALCGFGGVLSCGLTHTAVVPLDLVK.C
*	TK010303_lung_E18_mito_3_step01.2508.2508.3	1.9639	0.138	3564.99	1	1740.0%	1	K.AEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNK.E
*	TK010303_lung_E18_mito_3_step11.2956.2956.3	1.485	0.0177	4598.84	39	850.0%	1	K.ALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEAAK.V
*	TK010303_lung_E18_mito_3_step01.3062.3062.1	1.6316	0.2622	1198.92	1	5500.0%	1	K.GIFNGFSITLK.E
UQ8VDP199.3%113.3%425468204.4(Q8VDP1) Similar to hypothetical protein FLJ10276 (Fragment)
	TK010303_lung_E18_mito_3_step09.2440.2440.2	3.0122	0.4907	1657.84	1	6150.0%	1	K.MVPAAVSHSEFWHR.Y
UFKB2_MOUSE99.3%5726.4%140153448.9(P45878) FK506-binding protein precursor (FKBP-13) (Peptidyl-prolyl cis-trans isomerase) (PPiase) (EC 5.2.1.8)
	TK010303_lung_E18_mito_3_step01.0243.0243.1	1.5314	0.0207	1259.58	9	4500.0%	1	K.GDVLHMHYTGK.L
	TK010303_lung_E18_mito_3_step11.1368.1368.1	2.1837	0.3822	1387.51	1	5450.0%	2	R.KGDVLHMHYTGK.L
*	TK010303_lung_E18_mito_3_step03.3041.3041.2	1.1842	0.1021	2615.34	2	2290.0%	1	R.LSWILTILSICLSALAAATGAEGKR.K
USSDH_HUMAN99.3%61017.0%535572158.3(P51649) Succinate semialdehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.24) (NAD(+)-dependent succinic semialdehyde dehydrogenase)
*	TK010303_lung_E18_mito_3_step02.3352.3352.2	1.983	0.1767	2909.18	1	2410.0%	1	R.VAEQLEVGMVGVNEGLISSVECPFGGVK.Q
*	TK010303_lung_E18_mito_3_step03.2748.2748.2	1.5555	0.1093	2277.39	18	2250.0%	2	K.NLRVGNGFEEGTTQGPLINEK.A
*	TK010303_lung_E18_mito_3_step11.1223.1223.1	2.1552	0.383	1204.54	1	6000.0%	2	K.ILLHHAANSVK.R
*	TK010303_lung_E18_mito_3_step11.3685.3685.2	1.608	0.2531	3155.61	6	1500.0%	1	K.RVSMELGGLAPFIVFDSANVDQAVAGAMASK.F
UCTNB_MOUSE99.3%4412.9%781854715.9(Q02248) Beta-catenin
	TK010303_lung_E18_mito_3_step04.3738.3738.3	2.5314	0.1534	4729.78	2	1310.0%	1	K.GNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTR.A
	TK010303_lung_E18_mito_3_step12.1093.1093.1	2.1686	0.3936	1504.56	1	4170.0%	1	R.CTAGTLHNLSHHR.E
	TK010303_lung_E18_mito_3_step09.3550.3550.3	1.7543	0.2196	3784.21	74	1060.0%	1	R.GLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDK.E
	TK010303_lung_E18_mito_3_step06.1913.1913.2	2.6399	0.3762	1446.5	1	6670.0%	1	R.NLALCPANHAPLR.E
URCN1_MOUSE99.3%51710.5%325381134.8(Q05186) Reticulocalbin 1 precursor
	TK010303_lung_E18_mito_3_step01.0903.0903.1	2.3163	0.3268	1232.56	1	7780.0%	1	R.HLVYESDKNK.D
	TK010303_lung_E18_mito_3_step05.2501.2501.2	1.964	0.3943	2789.43	1	3260.0%	4	K.QATYGYYLGNPAEFHDSSDHHTFK.K
UFMO5_MOUSE99.3%242.1%532598988.7(P97872) Dimethylaniline monooxygenase [N-oxide forming] 5 (EC 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5)
	TK010303_lung_E18_mito_3_step04.2254.2254.1	1.4827	0.2301	1352.24	14	4000.0%	2	R.FDHEMFGLKPK.H
UQ9R0B999.3%7371.5%737845266.8(Q9R0B9) Lysyl hydroxylase isoform 2
	TK010303_lung_E18_mito_3_step08.1905.1905.1	1.8119	0.3375	1245.58	1	6000.0%	6	R.LTHLHEGLPVK.N
UNPC2_MOUSE99.3%248.1%149164427.7(Q9Z0J0) Epididymal secretory protein E1 precursor
*	TK010303_lung_E18_mito_3_step01.1558.1558.1	1.9696	0.3848	1357.74	1	5450.0%	2	R.VPFPIPEPDGCK.S
UQ8VCM499.3%113.8%373421468.5(Q8VCM4) Similar to lipoyltransferase
*	TK010303_lung_E18_mito_3_step10.2125.2125.2	2.5959	0.4938	1864.7	1	5000.0%	1	R.HQNPWQECNLHLMR.Q
UPHB_MOUSE99.3%83015.1%272298205.8(P24142) Prohibitin (B-cell receptor associated protein 32) (BAP 32)
	TK010303_lung_E18_mito_3_step01.0092.0092.1	2.0049	0.391	914.52	1	6880.0%	1	R.NVPVITGSK.D
	TK010303_lung_E18_mito_3_step10.2153.2153.2	2.3256	0.2656	1398.11	1	6360.0%	5	R.ILFRPVASQLPR.I
	TK010303_lung_E18_mito_3_step08.3710.3710.2	1.5388	0.0835	2122.6	4	2630.0%	2	R.AATFGLILDDVSLTHLTFGK.E
UQ9CRD799.3%4415.7%395443926.4(Q9CRD7) 1700021I09Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step12.1048.1048.1	0.6912	0.1508	1079.5	69	4380.0%	1	R.VFCGHCGNK.T
	TK010303_lung_E18_mito_3_step05.1916.1916.2	1.1475	0.0241	1443.89	15	4500.0%	1	R.SYILRCHGCFK.T
*	TK010303_lung_E18_mito_3_step12.2220.2220.2	2.336	0.4961	2373.42	1	3330.0%	1	K.VSSSIQHPETALHISGFHLPSK.S
*	TK010303_lung_E18_mito_3_step02.3552.3552.2	1.5254	0.0461	2269.13	6	2370.0%	1	K.VSVTINDDGTLHMHFSRNPK.V
UQ99LP699.3%6189.7%217243078.4(Q99LP6) Putative grpE protein homolog
	TK010303_lung_E18_mito_3_step01.0114.0114.1	1.1995	0.1782	1000.52	13	3890.0%	1	K.EPGTVALVSK.V
	TK010303_lung_E18_mito_3_step05.2132.2132.1	2.0645	0.3856	1154.78	2	6500.0%	4	R.TLRPALVGVVK.D
UCAH2_MOUSE99.3%5539.8%259289607.0(P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II)
	TK010303_lung_E18_mito_3_step12.3181.3181.3	1.7661	0.0458	4569.38	25	1030.0%	1	R.AAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLR.E
	TK010303_lung_E18_mito_3_step08.2993.2993.3	2.1092	0.1647	2874.62	5	2190.0%	1	R.TLNFNEEGDAEEAMVDNWRPAQPLK.N
	TK010303_lung_E18_mito_3_step07.2576.2576.1	2.4538	0.3571	1584.45	1	6250.0%	1	K.YAAELHLVHWNTK.Y
	TK010303_lung_E18_mito_3_step05.2889.2889.2	1.2195	0.094	3146.82	1	2120.0%	1	R.TLNFNEEGDAEEAMVDNWRPAQPLKNR.K
	TK010303_lung_E18_mito_3_step12.2740.2740.2	1.6032	0.1297	2642.0	2	2500.0%	1	R.LIQFHFHWGSSDGQGSEHTVNKK.K
URL29_MOUSE99.3%116.9%1591745611.8(P47915) 60S ribosomal protein L29
*	TK010303_lung_E18_mito_3_step11.1163.1163.2	2.9795	0.4782	1192.89	1	8000.0%	1	K.ALVKPQAIKPK.M
UQ99KR399.3%116.2%288327546.3(Q99KR3) Hypothetical 32.8 kDa protein
*	TK010303_lung_E18_mito_3_step08.2014.2014.2	3.1731	0.2915	1901.92	1	5880.0%	1	K.ANIIYPGHGPVIHNAEAK.I
UTHI2_MOUSE99.2%3527.7%166182557.9(P97493) Thioredoxin, mitochondrial precursor (Mt-TRX) (Thioredoxin 2)
*	TK010303_lung_E18_mito_3_step02.3565.3565.2	2.1569	0.3174	2728.86	1	2920.0%	2	K.VDIDDHTDLAIEYEVSAVPTVLAIK.N
	TK010303_lung_E18_mito_3_step02.2537.2537.2	2.9497	0.4854	2429.82	1	4250.0%	1	R.VVNSETPVVVDFHAQWCGPCK.I
UQ923C199.2%4416.2%569647957.1(Q923C1) Similar to alpha 1,2-mannosidase (Fragment)
*	TK010303_lung_E18_mito_3_step11.1093.1093.1	1.4227	0.1681	878.47	1	7860.0%	1	K.HIHSLSGK.K
*	TK010303_lung_E18_mito_3_step09.3918.3918.3	2.0769	0.0583	3526.9	71	1370.0%	1	K.NVDVNLFESTIRILGGLLSTYHLSGDSLFLTK.A
*	TK010303_lung_E18_mito_3_step05.4000.4000.3	1.9903	0.1161	3852.59	15	1250.0%	1	K.IPYSDVNIGTGFAHSPQWTSDSTVAEVTSIQLEFR.E
	TK010303_lung_E18_mito_3_step12.3207.3207.2	2.9523	0.4709	2151.49	1	5310.0%	1	R.HNLLRPETVESLFYLYR.V
UTPP2_HUMAN99.2%335.3%12491384496.4(P29144) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase)
*	TK010303_lung_E18_mito_3_step06.2283.2283.3	0.9743	0.116	3181.49	53	1440.0%	1	R.NYKEAQEYGSFGTAEMLNYSVNIYDDR.N
*	TK010303_lung_E18_mito_3_step11.3761.3761.2	1.6669	0.0375	2722.06	13	2380.0%	1	R.DVLPNNRQLYEMVLTYNFHQPK.S
*	TK010303_lung_E18_mito_3_step10.2413.2413.2	2.9587	0.4869	1952.15	1	4380.0%	1	K.KADVIPVHYYLIPPPTK.T
UEZRI_MOUSE99.2%688.9%585692156.1(P26040) Ezrin (p81) (Cytovillin) (Villin 2)
	TK010303_lung_E18_mito_3_step08.1994.1994.1	2.6241	0.0881	1089.83	2	7500.0%	2	K.KFVIKPIDK.K
	TK010303_lung_E18_mito_3_step07.1774.1774.2	3.1196	0.3735	1176.86	1	8750.0%	1	R.IQVWHAEHR.G
	TK010303_lung_E18_mito_3_step01.3572.3572.2	1.2951	0.1041	3026.15	1	2120.0%	1	R.VTTMDAELEFAIQPNTTGKQLFDQVVK.T
	TK010303_lung_E18_mito_3_step01.0868.0868.1	1.1647	0.0567	892.45	2	6670.0%	1	R.ETVEREK.E
UQ91YK999.2%2220.5%161187635.7(Q91YK9) RIKEN cDNA 0610009D10 gene
	TK010303_lung_E18_mito_3_step01.3491.3491.2	3.0159	0.3835	2494.03	1	5000.0%	1	R.NIIPFDQMTIDDLNEIFPETK.L
	TK010303_lung_E18_mito_3_step01.2107.2107.1	2.3937	0.3647	1556.75	1	5000.0%	1	K.YPYWPHQPIENL.-
UQ8R0M499.2%8832.1%616670966.0(Q8R0M4) Hypothetical 67.1 kDa protein (Fragment)
*	TK010303_lung_E18_mito_3_step09.2551.2551.3	3.1751	0.3967	2879.51	1	2400.0%	1	R.MPGHPPLPEIPSEMGVCDSEKPESTR.A
	TK010303_lung_E18_mito_3_step07.3036.3036.3	2.2914	0.0875	3923.34	21	1400.0%	1	R.ASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDK.Y
*	TK010303_lung_E18_mito_3_step01.0488.0488.3	1.8837	0.1539	4372.89	1	1160.0%	1	K.DDIDNSKPGAGLSRPGPSPLVNQYSLTVGLDLGPHDTKSLLK.C
	TK010303_lung_E18_mito_3_step05.4320.4320.3	1.6358	0.1942	3223.26	1	2410.0%	1	K.VFLQHLSPLLSLSTFAALWLTILDFMDK.Y
	TK010303_lung_E18_mito_3_step11.3697.3697.3	1.785	0.2286	4608.55	3	1130.0%	1	R.ADAPDAGAQSDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGK.I
	TK010303_lung_E18_mito_3_step11.1121.1121.3	1.5305	0.1562	2144.58	52	2060.0%	1	R.MQALTYLQRALLVHDLQK.L
*	TK010303_lung_E18_mito_3_step10.2113.2113.1	0.5834	0.0654	1278.21	412	2000.0%	1	R.RPRGSNQHATR.G
	TK010303_lung_E18_mito_3_step07.3186.3186.2	1.1748	0.07	2918.32	14	1590.0%	1	R.TLWAHCWCPLLQGIACLCCDARR.Q
UNOC4_MOUSE99.2%4630.0%207233486.2(O70378) Neighbor of COX4
	TK010303_lung_E18_mito_3_step05.1878.1878.2	2.0966	0.2229	2274.7	1	4060.0%	2	R.CRDPHHDYCEDWPEAQR.I
*	TK010303_lung_E18_mito_3_step02.2041.2041.2	1.7639	0.3128	2322.15	2	3610.0%	1	K.FTMDCAAPTIHVYEQHENR.W
*	TK010303_lung_E18_mito_3_step01.3636.3636.2	1.2378	0.0403	3139.69	29	1200.0%	1	R.SYETLVDFDNHLDDIRSDWTNPEINK.A
UHG2A_MOUSE99.2%3329.4%279315578.3(P04441) H-2 class II histocompatibility antigen, gamma chain (MHC class II associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD74 antigen)
*	TK010303_lung_E18_mito_3_step06.2422.2422.2	2.8173	0.469	2188.62	1	3610.0%	1	K.CQEEVSHIPAVYPGAFRPK.C
*	TK010303_lung_E18_mito_3_step04.2434.2434.3	1.4635	0.0462	4145.35	11	1320.0%	1	K.CDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSR.G
*	TK010303_lung_E18_mito_3_step04.2810.2810.2	1.1934	0.0707	3089.94	2	1850.0%	1	R.HNCSEPLDMEDLSSGLGVTRQELGQVTL.-
UTO1B_MOUSE99.2%393.6%336378787.8(Q9ER41) Torsin B precursor
	TK010303_lung_E18_mito_3_step08.2316.2316.1	2.3421	0.3601	1351.64	1	5910.0%	3	K.HSGLWHSGLIDK.N
USORL_MOUSE99.1%12149.2%22152471205.6(O88307) Sortilin-related receptor precursor (Sorting protein-related receptor containing LDLR class A repeats) (mSorLA) (SorLA-1) (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding repeats) (LR11) (Gp250)
*	TK010303_lung_E18_mito_3_step12.3801.3801.2	1.5085	0.0676	2860.45	11	1880.0%	1	K.TSALIKWESPYDSPDQDLFYAIAVK.D
*	TK010303_lung_E18_mito_3_step12.3001.3001.3	1.8314	0.0702	3744.16	4	1410.0%	1	R.WREALPGPHYYTWGDHGGIIMAIAQGMETNELK.Y
*	TK010303_lung_E18_mito_3_step02.4132.4132.2	1.4395	0.065	2577.31	8	1900.0%	1	K.CNGFHCPNGTCIPSSKHCDGLR.D
*	TK010303_lung_E18_mito_3_step03.2000.2000.2	2.7691	0.4823	1979.93	1	5000.0%	1	R.YFQFHCENGHCIPNR.W
*	TK010303_lung_E18_mito_3_step01.3447.3447.3	1.9913	0.0693	4596.59	3	1310.0%	1	R.EALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWK.T
*	TK010303_lung_E18_mito_3_step12.1233.1233.1	1.5605	0.1718	1013.63	1	6250.0%	2	R.HLHAVHIGK.T
*	TK010303_lung_E18_mito_3_step12.2392.2392.2	2.3993	0.4304	2347.4	1	3500.0%	1	R.EEEGVILGHWAPPVHTHGLIR.E
*	TK010303_lung_E18_mito_3_step11.2384.2384.2	1.2364	0.0016	2244.24	28	1940.0%	1	K.WESPYDSPDQDLFYAIAVK.D
	TK010303_lung_E18_mito_3_step11.1001.1001.1	1.2115	0.0613	1363.55	15	3640.0%	1	K.KIEVANPDGDFR.L
*	TK010303_lung_E18_mito_3_step10.2274.2274.2	1.5545	0.0728	1761.78	12	2940.0%	1	R.DLRLGTHGDAPGASPAAR.K
	TK010303_lung_E18_mito_3_step05.3798.3798.3	1.9871	0.1272	4342.4	1	1350.0%	1	R.LTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYR.S
URL13_MOUSE99.1%355.2%2102417411.5(P47963) 60S ribosomal protein L13 (A52)
*	TK010303_lung_E18_mito_3_step12.1575.1575.1	2.013	0.1973	1324.92	2	5500.0%	2	R.NGMILKPHFHK.D
URT16_MOUSE99.1%1111.1%135151929.7(Q9CPX7) 28S ribosomal protein S16, mitochondrial precursor (MRP-S16)
	TK010303_lung_E18_mito_3_step12.1611.1611.2	3.0888	0.4415	1752.84	1	5360.0%	1	R.HWIGCGAHLSKPMEK.L
UQ9EPF199.1%3310.8%648715125.8(Q9EPF1) L-gicerin/MUC18
*	TK010303_lung_E18_mito_3_step02.2862.2862.2	2.7877	0.4401	2289.67	1	4250.0%	1	R.LSLQDSVATLALSHVTPHDER.M
*	TK010303_lung_E18_mito_3_step10.2637.2637.3	1.6912	0.077	3548.97	21	1410.0%	1	K.LPQPESKGVVIVAVIVCTLVLAVLGAALYFLYK.K
*	TK010303_lung_E18_mito_3_step05.1850.1850.2	3.1281	0.3803	1872.11	1	5670.0%	1	R.CLTDGNPQPHFTINKK.D
UQ96L1999.1%2413.7%234256267.9(Q96L19) Similar to lactate dehydrogenase 1, A chain
*	TK010303_lung_E18_mito_3_step07.2989.2989.3	3.1215	0.3961	3382.74	1	1850.0%	2	K.NFAEEEAIHHNKISIVGTGSVGVACAISILLK.G
UQ9BY4499.1%4612.0%609678519.0(Q9BY44) CDA02
*	TK010303_lung_E18_mito_3_step11.3036.3036.3	1.9435	0.1011	3621.36	3	1640.0%	2	K.CDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLR.G
*	TK010303_lung_E18_mito_3_step02.2209.2209.2	1.2366	0.0348	3180.45	8	1610.0%	1	K.NTVLATWQPYSTSKDGTAGIPNLQLYDVK.T
*	TK010303_lung_E18_mito_3_step11.2105.2105.1	2.2514	0.3751	1355.58	1	6500.0%	1	K.IWHYTGSILHK.Y
UQ9CPW299.1%41027.6%174187666.0(Q9CPW2) B230118G17Rik protein
*	TK010303_lung_E18_mito_3_step06.1938.1938.1	2.1946	0.3653	1425.38	1	5450.0%	3	R.NFYVDGHIPKPH.-
*	TK010303_lung_E18_mito_3_step06.3503.3503.3	2.0551	0.0204	4023.15	11	1140.0%	1	R.HGVDLEGACEASLACSTCHVYVSEAHLDLLPPPEER.E
UQ91V1299.1%245.9%338375557.5(Q91V12) Acyl-CoA hydrolase (Hypothetical 37.6 kDa protein)
	TK010303_lung_E18_mito_3_step03.2024.2024.2	2.3636	0.2766	2078.16	1	4210.0%	2	R.IMRPDDANVAGNVHGGTILK.M
UHBD_HUMAN99.1%1115.1%146159248.0(P02042) Hemoglobin delta chain
*	TK010303_lung_E18_mito_3_step05.2760.2760.2	2.6762	0.4667	2630.36	1	2860.0%	1	K.GTFSQLSELHCDKLHVDPENFR.L
UQ9EQR099.1%12209.7%25042724266.6(Q9EQR0) Fatty acid synthase
*	TK010303_lung_E18_mito_3_step05.3433.3433.3	2.3005	0.203	3817.81	1	1640.0%	1	R.LQVVDRPLPVRGGNVGINSFGFGGSNVHVILQPNTR.Q
*	TK010303_lung_E18_mito_3_step12.2675.2675.2	1.6481	0.1569	2963.11	1	2000.0%	1	R.IPALLNTQPMLQLEYTATDRHPQALK.D
*	TK010303_lung_E18_mito_3_step12.3981.3981.3	1.8422	0.0044	4277.74	1	1340.0%	2	R.LLLEVSYEAIVDGGINPASLRGTNTGVWVGVSGSEASEALSR.D
*	TK010303_lung_E18_mito_3_step10.3522.3522.3	2.3933	0.2881	4288.78	8	1280.0%	3	R.CPAGVVPACHNSEDTVTISGPQAAVNEFVEQLKQEGVFAK.E
*	TK010303_lung_E18_mito_3_step06.2349.2349.3	1.8956	0.1785	2541.79	4	2190.0%	1	R.GGNVGINSFGFGGSNVHVILQPNTR.Q
*	TK010303_lung_E18_mito_3_step09.2456.2456.2	1.2294	0.0969	2689.61	19	1540.0%	1	R.QAPLLIGSTKSNMGHPEPASGLAALTK.V
*	TK010303_lung_E18_mito_3_step12.2860.2860.3	1.6149	0.0637	3025.27	2	1850.0%	1	R.EEEPEAVLPGAQPTLISAISKTFCPAHK.S
*	TK010303_lung_E18_mito_3_step10.3085.3085.2	2.6864	0.4832	2501.61	1	3410.0%	1	K.VHLTGINVNPNALFPPVEFPAPR.G
*	TK010303_lung_E18_mito_3_step02.2526.2526.2	1.1862	0.0903	2369.96	25	2140.0%	1	R.SDEAVKPLGVKVSDLLLSTDER.T
UQ9DBD399.1%118.5%246262377.8(Q9DBD3) 1300017C12Rik protein
	TK010303_lung_E18_mito_3_step02.1844.1844.2	2.489	0.4794	2294.01	1	4250.0%	1	R.ELGLVNHAVAQNEEGNAAYHR.A
UQ9DC2099.1%112.4%803906139.1(Q9DC20) 1200006O19Rik protein
*	TK010303_lung_E18_mito_3_step09.2202.2202.2	2.3662	0.477	2199.9	1	4440.0%	1	R.NYGHFPGTNSHYLGGCQYK.M
UQ9D02399.1%229.4%1271428610.6(Q9D023) 2610205H19Rik protein (RIKEN cDNA 2610205H19 gene)
	TK010303_lung_E18_mito_3_step12.1209.1209.2	2.4774	0.4844	1391.34	1	6360.0%	1	K.LRPLYNHPAGPR.T
USCB2_MOUSE99.1%5710.4%404438576.2(Q9Z2I8) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, betaG chain) (SCS-betaG) (GTP-specific succinyl-CoA synthetase beta subunit) (Fragment)
*	TK010303_lung_E18_mito_3_step05.2656.2656.1	1.7709	0.2365	934.45	1	8330.0%	2	K.LYHLFLK.I
*	TK010303_lung_E18_mito_3_step08.1510.1510.1	2.0129	0.3722	1058.43	1	6880.0%	1	K.KLMSEHGVR.V
*	TK010303_lung_E18_mito_3_step01.2142.2142.1	1.6014	0.2035	1280.76	1	6360.0%	1	R.MAENLGFLGSLK.N
*	TK010303_lung_E18_mito_3_step01.1356.1356.1	1.9458	0.1349	1556.72	9	4230.0%	1	R.LEGTNVQEAQNILK.S
URL11_MOUSE99.1%85013.0%177201529.6(Q9CXW4) 60S ribosomal protein L11
	TK010303_lung_E18_mito_3_step12.3000.3000.2	1.4719	0.142	2551.14	36	1820.0%	1	R.KNNFSDTGNFGFGIQEHIDLGIK.Y
	TK010303_lung_E18_mito_3_step05.3990.3990.2	1.3406	0.0801	2426.88	2	2380.0%	7	K.NNFSDTGNFGFGIQEHIDLGIK.Y
UQ6391899.1%599.1%418467645.2(Q63918) Serum deprivation response (Sdpr protein)
	TK010303_lung_E18_mito_3_step08.1822.1822.2	2.6477	0.3727	1364.83	1	7500.0%	2	K.RLENNHAQLLR.R
*	TK010303_lung_E18_mito_3_step05.2137.2137.3	1.9998	0.1514	3096.26	1	1830.0%	1	K.EELADENKSLEETLHNVDLSSDDELPR.D
UQ9CVB699.1%3327.6%170199138.4(Q9CVB6) 2210023N03Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step09.2679.2679.3	1.7065	0.1293	2935.96	24	1540.0%	1	K.DTDAAVGDNIGYITFVLFPRHTNATAR.D
	TK010303_lung_E18_mito_3_step11.1601.1601.1	1.9756	0.3531	1450.65	1	4170.0%	1	R.ASHTAPQVLFSHR.E
	TK010303_lung_E18_mito_3_step12.2025.2025.2	2.3769	0.3974	2256.58	1	3420.0%	1	R.ASHTAPQVLFSHREPPLELK.D
UQ8R01699.1%3314.9%455525116.5(Q8R016) Similar to bleomycin hydrolase
*	TK010303_lung_E18_mito_3_step01.0014.0014.2	0.921	0.0321	2504.96	27	1940.0%	1	K.KFNIEEFEFSQSYLFFWDK.V
*	TK010303_lung_E18_mito_3_step11.1763.1763.2	2.6338	0.484	2728.29	1	2920.0%	1	R.ATVQGAQHVFQHVVPQEGKPVTNQK.S
*	TK010303_lung_E18_mito_3_step11.2757.2757.3	1.5697	0.0251	2977.59	7	2170.0%	1	K.EHVKPLFNMEDKICFVNDPRPQHK.Y
UCYPM_MOUSE99.1%61428.6%206217379.2(Q99KR7) Peptidyl-prolyl cis-trans isomerase, mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin F)
	TK010303_lung_E18_mito_3_step11.1311.1311.1	1.6936	0.3713	924.53	1	5710.0%	2	K.HVVFGHVK.E
	TK010303_lung_E18_mito_3_step05.2972.2972.2	2.8656	0.462	2819.66	1	2880.0%	3	K.HVGPGVLSMANAGPNTNGSQFFICTIK.T
*	TK010303_lung_E18_mito_3_step06.4249.4249.2	1.174	0.0644	2344.72	42	1740.0%	1	R.GANSSSGNPLVYLDVGADGQPLGR.V
UHS9A_MOUSE99.1%8129.6%732846575.0(P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA)
	TK010303_lung_E18_mito_3_step01.1728.1728.1	1.5993	0.0118	1513.67	6	3460.0%	1	R.GVVDSEDLPLNISR.E
	TK010303_lung_E18_mito_3_step01.0070.0070.1	1.09	0.0122	731.49	6	7000.0%	1	R.IKEIVK.K
*	TK010303_lung_E18_mito_3_step02.2025.2025.1	2.1209	0.3648	1211.6	1	6110.0%	2	K.HIYFITGETK.D
	TK010303_lung_E18_mito_3_step03.1929.1929.1	0.9551	0.079	722.44	112	5000.0%	1	K.VILHLK.E
	TK010303_lung_E18_mito_3_step04.3438.3438.2	1.4346	0.0891	2581.81	1	2500.0%	1	K.HGLEVIYMIEPIDEYCVQQLK.E
	TK010303_lung_E18_mito_3_step01.1871.1871.1	1.5326	0.0974	1351.89	1	4170.0%	2	R.TLTIVDTGIGMTK.A
UQ9UFH299.1%578.0%12731448035.8(Q9UFH2) Hypothetical protein
*	TK010303_lung_E18_mito_3_step07.4301.4301.2	1.309	0.0858	2700.32	29	1900.0%	1	K.TPYVVVAFQECERMNILTNEMR.R
*	TK010303_lung_E18_mito_3_step01.1848.1848.1	1.9169	0.3752	1581.66	2	3570.0%	2	K.AAKWILAAVALLLQV.-
*	TK010303_lung_E18_mito_3_step02.3994.3994.3	1.822	0.0181	4092.4	14	1140.0%	1	R.ELEAWTTDFALPTTVWLAGFFNPQSFLTAIMQSMAR.K
*	TK010303_lung_E18_mito_3_step08.3954.3954.3	1.2992	0.0355	3578.76	51	1430.0%	1	R.LILHTKYFNPHYKPEMQAQCTLINFLVTR.D
UQ91VH999.1%245.0%437490625.7(Q91VH9) Eukaryotic translation termination factor 1
	TK010303_lung_E18_mito_3_step04.3119.3119.2	2.5084	0.4912	2656.5	1	3330.0%	2	K.KVNIDFEPFKPINTSLYLCDNK.F
UST13_MOUSE99.1%114.6%371416565.3(Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13)
	TK010303_lung_E18_mito_3_step03.2868.2868.2	2.5278	0.4883	1934.13	1	4690.0%	1	R.LLGHWEEAAHDLALACK.L
UNSF_MOUSE99.1%112.2%744825656.9(P46460) Vesicular-fusion protein NSF (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) (SKD2 protein)
	TK010303_lung_E18_mito_3_step03.2921.2921.2	2.6115	0.4756	1631.87	1	5000.0%	1	R.TPLVSVLLEGPPHSGK.T
UTCPQ_MOUSE99.0%3312.2%548595565.6(P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta)
*	TK010303_lung_E18_mito_3_step12.2400.2400.3	2.1918	0.3438	4104.16	28	1220.0%	1	K.TVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFK.H
	TK010303_lung_E18_mito_3_step03.2184.2184.1	1.8587	0.2354	1568.0	1	4620.0%	1	K.HEKEDGAISTIVLR.G
*	TK010303_lung_E18_mito_3_step06.2438.2438.2	3.142	0.338	1756.27	1	6070.0%	1	K.KAHEILPELVCCSAK.N
UR10A_MOUSE99.0%4425.3%2172491610.0(P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6)
	TK010303_lung_E18_mito_3_step02.2496.2496.1	2.0271	0.1257	1484.68	1	5000.0%	1	K.KYDAFLASESLIK.Q
	TK010303_lung_E18_mito_3_step01.1946.1946.1	2.4346	0.3393	1451.69	1	5830.0%	1	K.AVDIPHMDIEALK.K
*	TK010303_lung_E18_mito_3_step12.2305.2305.2	1.0929	0.019	2514.7	15	2000.0%	1	K.STPRPKFSVCVLGDQQHCDER.K
	TK010303_lung_E18_mito_3_step01.0119.0119.1	1.4645	0.251	811.65	1	5710.0%	1	R.ILGPGLNK.A
UQ9D66599.0%4109.4%394438946.8(Q9D665) 4632417N05Rik protein
	TK010303_lung_E18_mito_3_step06.3419.3419.3	2.1676	0.0661	4260.69	19	1110.0%	3	R.LVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSR.T
	TK010303_lung_E18_mito_3_step04.2362.2362.2	1.6378	0.2496	2364.1	23	2110.0%	1	R.NGDESLPYLPLHLHPDHYSR.T
UCATH_MOUSE99.0%6832.7%333371848.4(P49935) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3) (Cathepsin BA)
*	TK010303_lung_E18_mito_3_step01.0054.0054.1	1.988	0.3017	927.37	1	6880.0%	1	K.KGNVVSPVK.N
*	TK010303_lung_E18_mito_3_step02.2714.2714.2	2.5733	0.4697	2536.24	1	3330.0%	2	K.MLSLAEQQLVDCAQAFNNHGCK.G
*	TK010303_lung_E18_mito_3_step01.1543.1543.1	2.1023	0.295	1501.51	1	5420.0%	1	K.GIMEEDSYPYIGK.D
*	TK010303_lung_E18_mito_3_step04.3578.3578.3	1.7338	0.0562	4786.06	19	1010.0%	1	K.AVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYK.S
*	TK010303_lung_E18_mito_3_step12.4193.4193.2	3.1151	0.3704	2447.75	1	3330.0%	1	K.VNHAVLAVGYGEQNGLLYWIVK.N
USG2N_MOUSE98.9%4104.6%796871505.3(Q9ERG2) Cell-cycle autoantigen SG2NA (S/G2 antigen)
*	TK010303_lung_E18_mito_3_step09.2911.2911.2	1.6722	0.0399	2333.68	1	3160.0%	1	K.NQLLSCSADGTIRLWNPQEK.L
	TK010303_lung_E18_mito_3_step05.2105.2105.2	2.5507	0.4721	1872.9	1	4060.0%	3	R.VVSHPTLPVTITAHEDR.H
UQ9D15798.9%4612.8%366410007.8(Q9D157) 0610025K21Rik protein
*	TK010303_lung_E18_mito_3_step11.1455.1455.1	2.3676	0.3325	1545.7	1	5450.0%	2	R.WMYHHSQLQGTR.G
*	TK010303_lung_E18_mito_3_step11.2041.2041.3	1.8081	0.052	3647.62	56	1400.0%	1	R.GHSELDTAFMYCDGQSENIPGGLGLGLGSGDCTVK.I
UPTB_MOUSE98.9%61218.8%527564788.3(P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)
	TK010303_lung_E18_mito_3_step02.1929.1929.1	2.5371	0.2936	1433.82	1	5450.0%	3	R.GQPIYIQFSNHK.E
	TK010303_lung_E18_mito_3_step04.3309.3309.2	1.1329	0.0356	2946.52	5	2000.0%	1	K.IITFTKNNQFQALLQYADPVSAQHAK.L
	TK010303_lung_E18_mito_3_step01.3626.3626.3	1.6929	0.051	4297.19	9	1060.0%	1	R.IAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQR.V
	TK010303_lung_E18_mito_3_step05.3129.3129.2	2.461	0.428	2088.52	1	3680.0%	1	R.KLPSDVTEGEVISLGLPFGK.V
UQ6221998.8%3311.5%444482287.2(Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5)
	TK010303_lung_E18_mito_3_step02.2217.2217.2	1.0978	0.0377	2059.78	164	2110.0%	1	K.GLCGSCNKPIAGQVVTALGR.A
	TK010303_lung_E18_mito_3_step03.4088.4088.2	1.3172	0.0429	2743.15	2	2120.0%	1	R.GVPTQAKGLCGSCNKPIAGQVVTALGR.A
*	TK010303_lung_E18_mito_3_step09.3048.3048.2	2.7664	0.4599	2743.09	2	2610.0%	1	R.AWHPEHFLCSGCSTTLGGSSFFEK.D
UQ96MT398.8%3312.0%831943106.2(Q96MT3) Hypothetical protein FLJ31937
*	TK010303_lung_E18_mito_3_step06.4365.4365.3	1.7599	0.0113	4710.94	11	1160.0%	1	R.DSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEK.M
*	TK010303_lung_E18_mito_3_step04.2727.2727.2	1.0048	0.0165	2320.02	12	2370.0%	1	K.LDDLSLSRQGTSFASEEFWK.G
*	TK010303_lung_E18_mito_3_step03.3279.3279.3	3.0415	0.4041	4363.55	2	1280.0%	1	R.SSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEK.V
UQ9GZV298.8%3311.0%710765396.7(Q9GZV2) PGE1 transporter (Organic anion transporter polypeptide-related protein 3)
	TK010303_lung_E18_mito_3_step03.3263.3263.3	3.1371	0.3656	2830.47	1	2400.0%	1	R.WGAEGRDVCAANGSGGDEGPDPDLICR.N
	TK010303_lung_E18_mito_3_step08.2041.2041.1	0.7969	0.0583	858.41	399	2220.0%	1	K.KPGGSSGGGR.S
	TK010303_lung_E18_mito_3_step02.4481.4481.3	1.7934	0.1267	4653.64	3	1190.0%	1	R.LLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYR.Y
URAB2_MOUSE98.8%247.1%212235486.5(P53994) Ras-related protein Rab-2
	TK010303_lung_E18_mito_3_step10.2481.2481.2	2.8104	0.4487	1686.69	1	5000.0%	2	R.QHSNSNMVIMLIGNK.S
UQ6200998.8%449.5%811902557.3(Q62009) Osteoblast specific factor 2 precursor (OSF-2)
*	TK010303_lung_E18_mito_3_step12.2552.2552.2	2.7869	0.4479	2502.96	1	3330.0%	1	R.RGLENNVNVELLNALHSHMVNK.R
*	TK010303_lung_E18_mito_3_step08.4361.4361.2	1.4306	0.0962	2504.44	45	1900.0%	1	R.GLENNVNVELLNALHSHMVNKR.M
*	TK010303_lung_E18_mito_3_step01.2667.2667.1	1.4116	0.0133	1539.81	4	3750.0%	1	K.EIPMTVYRPAMTK.I
*	TK010303_lung_E18_mito_3_step10.3273.3273.3	1.9189	0.0726	4511.03	1	1190.0%	1	R.VIHGNQIATNGVVHVIDRVLTQIGTSIQDFLEAEDDLSSFR.A
UQ9DC4498.8%51112.5%480525169.2(Q9DC44) 1200003J13Rik protein
	TK010303_lung_E18_mito_3_step05.3866.3866.2	1.9454	0.2063	2314.53	44	2050.0%	1	R.DGADIHSDLFISIAQAILGGTAK.A
	TK010303_lung_E18_mito_3_step03.2108.2108.2	1.9192	0.1734	1681.91	3	4620.0%	3	R.INSYGYGDHYIHIK.I
	TK010303_lung_E18_mito_3_step12.1635.1635.3	1.3398	0.0147	2492.2	33	1930.0%	1	R.LTGTKSFPFVCTTSFHTSASLAK.D
UDLK_MOUSE98.7%71918.4%385413205.9(Q09163) Delta-like protein precursor (DLK) (Preadipocyte factor 1) (Pref-1) (Adipocyte differentiation inhibitor protein) [Contains: Fetal antigen 1 (FA1)]
*	TK010303_lung_E18_mito_3_step04.2323.2323.2	1.7915	0.2457	2006.76	1	3610.0%	1	R.GASPVQVTHLPSGYGLTYR.L
*	TK010303_lung_E18_mito_3_step10.1962.1962.3	1.7245	0.086	2610.17	19	1930.0%	1	R.LTPGVHELPVQQPEQHILKVSMK.E
*	TK010303_lung_E18_mito_3_step08.2238.2238.2	2.9395	0.3709	2165.29	1	4170.0%	4	R.LTPGVHELPVQQPEQHILK.V
*	TK010303_lung_E18_mito_3_step11.3233.3233.3	1.8579	0.0348	3358.12	7	1610.0%	1	K.NLLLQYNSGEELAVNIIFPEKIDMTTFNK.E
UQ9DAE498.6%115.6%342389265.5(Q9DAE4) 1700012F10Rik protein
	TK010303_lung_E18_mito_3_step12.1780.1780.2	2.4002	0.4687	2334.55	1	3890.0%	1	R.HLEHSTIIYEDPQHHPLLR.L
UQ9CT4598.6%1111.4%167195975.0(Q9CT45) 2600014C01Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step04.2758.2758.2	2.7481	0.4491	2134.04	1	4170.0%	1	R.ATHKEEVTELMSQIETSAK.E
UBRF3_HUMAN98.6%242.0%12141365996.7(Q9ULD4) Bromodomain and PHD finger-containing protein 3 (Fragment)
	TK010303_lung_E18_mito_3_step12.1852.1852.3	3.0446	0.3884	2563.82	1	2720.0%	2	R.EGLLHNGVPIPVPPLDVLKLGEQK.Q
URS26_HUMAN98.6%1110.4%1151301511.0(P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26
	TK010303_lung_E18_mito_3_step09.1928.1928.2	2.3007	0.4739	1474.99	1	7270.0%	1	K.LHYCVSCAIHSK.V
UCALX_MOUSE98.6%6107.8%591672784.6(P35564) Calnexin precursor
	TK010303_lung_E18_mito_3_step02.1374.1374.1	1.394	0.1312	1300.9	4	4440.0%	1	R.KPEDWDERPK.I
*	TK010303_lung_E18_mito_3_step01.1291.1291.1	1.6664	0.0416	1404.57	7	4550.0%	1	K.TAELSLDQFHDK.T
	TK010303_lung_E18_mito_3_step09.2752.2752.1	1.3104	0.1946	834.49	1	7000.0%	2	K.LHFIFR.H
*	TK010303_lung_E18_mito_3_step12.2389.2389.2	2.6843	0.4333	2244.23	1	3820.0%	2	K.WKPPMIDNPNYQGIWKPR.K
UIMD2_MOUSE98.6%3315.2%514557857.3(P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2)
	TK010303_lung_E18_mito_3_step04.2531.2531.3	1.7987	0.1203	3559.54	4	1720.0%	1	R.VGMGSGSICITQEVLACGRPQATAVYKVSEYAR.R
	TK010303_lung_E18_mito_3_step11.2311.2311.2	2.744	0.4534	2048.47	1	3420.0%	1	R.RFGVPVIADGGIQNVGHIAK.A
	TK010303_lung_E18_mito_3_step03.3161.3161.3	1.854	0.0034	2802.91	20	1880.0%	1	K.FVPYLIAGIQHSCQDIGAKSLTQVR.A
U41_MOUSE98.6%337.3%858959905.6(P48193) Protein 4.1 (Band 4.1) (P4.1) (4.1R)
*	TK010303_lung_E18_mito_3_step12.2060.2060.2	1.5224	0.0469	2237.48	51	2370.0%	1	K.EGEGIEECSGTEVKEDPESR.A
*	TK010303_lung_E18_mito_3_step08.1581.1581.3	0.9913	0.0055	3466.79	3	1360.0%	1	K.EEGEGATNSGQQETQLEEASQAAAAEGSDQGEQK.L
	TK010303_lung_E18_mito_3_step07.1609.1609.1	2.1941	0.3414	1023.48	1	6880.0%	1	K.HHASISELK.K
UA1M2_HUMAN98.6%229.0%423481098.2(Q9Y6Q5) Adaptor-related protein complex 1, mu 2 subunit (Mu-adaptin 2) (Adaptor protein complex AP-1 mu-2 subunit) (Golgi adaptor HA1/AP1 adaptin mu-2 subunit) (Clathrin assembly protein assembly protein complex 1 medium chain 2) (AP-mu chain family member mu1B)
*	TK010303_lung_E18_mito_3_step01.1808.1808.1	1.9946	0.3468	1467.55	1	5000.0%	1	K.ILQEYITQQSNK.L
*	TK010303_lung_E18_mito_3_step08.4006.4006.2	1.274	0.0652	2946.81	135	1400.0%	1	K.EEVEGRPPIGVKFEIPYFTVSGIQVR.Y
URL12_MOUSE98.6%3343.6%165177919.4(P35979) 60S ribosomal protein L12
	TK010303_lung_E18_mito_3_step01.0110.0110.1	1.7019	0.3415	1418.47	2	3930.0%	1	R.CTGGEVGATSALAPK.I
	TK010303_lung_E18_mito_3_step02.4298.4298.3	1.6367	0.0026	3703.05	21	1320.0%	1	K.EILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS.-
*	TK010303_lung_E18_mito_3_step12.1641.1641.2	0.9485	0.0637	2380.4	29	1900.0%	1	K.LTIQNRQAQIEVVPSASGLIIK.A
UCD38_MOUSE98.6%4426.0%304344548.3(P56528) ADP-ribosyl cyclase 1 (EC 3.2.2.5) (Cyclic ADP-ribose hydrolase 1) (cADPr hydrolase 1) (NIM-R5 antigen) (I-19)
*	TK010303_lung_E18_mito_3_step08.2513.2513.3	1.8665	0.0361	3448.1	13	1340.0%	1	K.HLAHQYTWIQGKMFTLEDTLLGYIADDLR.W
*	TK010303_lung_E18_mito_3_step11.1785.1785.1	2.1013	0.3418	1482.62	1	4550.0%	1	K.HLAHQYTWIQGK.M
*	TK010303_lung_E18_mito_3_step03.3115.3115.2	1.4439	0.1213	2121.75	9	2780.0%	1	K.NSTFGSLEVFSLDPNKVHK.L
*	TK010303_lung_E18_mito_3_step11.3540.3540.3	1.8534	0.103	3437.54	26	1420.0%	1	K.LQAWVMHDIEGASSNACSSSSLNELKMIVQK.R
UQ924D098.6%339.1%396433729.0(Q924D0) NOGO-interacting mitochondrial protein
*	TK010303_lung_E18_mito_3_step01.2879.2879.1	1.8852	0.3454	1513.89	1	4580.0%	1	R.TFPFSEVPEAFLK.V
*	TK010303_lung_E18_mito_3_step10.2633.2633.3	1.7258	0.0107	2629.38	360	1700.0%	1	K.LFDFILDNVGGSTETWALNFLKK.W
*	TK010303_lung_E18_mito_3_step08.2392.2392.2	1.1587	0.1418	2504.02	164	1430.0%	1	K.LFDFILDNVGGSTETWALNFLK.K
UAMRP_MOUSE98.6%71913.3%360422157.9(P55302) Alpha-2-macroglobulin receptor-associated protein precursor (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) (Heparin binding protein-44) (HBP-44)
*	TK010303_lung_E18_mito_3_step06.1730.1730.1	1.1623	0.0974	822.41	10	5830.0%	1	R.LHLSPVR.L
*	TK010303_lung_E18_mito_3_step09.4076.4076.2	1.2996	0.0084	3189.1	113	1210.0%	1	R.VSTLPRLQLLVLLLLPLMLVPQPIAGHGGK.Y
*	TK010303_lung_E18_mito_3_step07.2580.2580.1	2.2567	0.2266	1277.85	1	6000.0%	4	K.LIHNLNVILAR.Y
UO1504598.6%463.2%15831846575.1(O15045) Hypothetical protein KIAA0336
*	TK010303_lung_E18_mito_3_step10.2735.2735.2	1.5334	0.073	2618.01	1	2860.0%	1	K.ISQEFESMKQQQASDVHELQQK.L
*	TK010303_lung_E18_mito_3_step11.2249.2249.1	1.9808	0.3317	1566.59	1	4230.0%	1	K.QAETDHLILQASLK.G
*	TK010303_lung_E18_mito_3_step09.2451.2451.2	1.7437	0.0837	1705.43	139	2690.0%	2	K.KLQLMVEEQDNLNK.L
UQ9CQ9998.6%4639.1%115116514.5(Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene)
	TK010303_lung_E18_mito_3_step10.4118.4118.2	1.8441	0.284	2778.83	1	2190.0%	1	K.LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK.K
*	TK010303_lung_E18_mito_3_step01.1851.1851.1	2.1434	0.3374	1244.66	1	6360.0%	2	K.NIEDVIAQGVGK.L
*	TK010303_lung_E18_mito_3_step05.3873.3873.3	2.3785	0.1142	4001.87	1	1530.0%	1	K.NIEDVIAQGVGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK.K
UAPP2_MOUSE98.6%354.5%695789454.7(Q06335) Amyloid-like protein 2 precursor (CDEI-box binding protein) (CDEBP)
	TK010303_lung_E18_mito_3_step05.1833.1833.1	1.9905	0.3464	1435.68	1	5000.0%	1	R.HYQHVLAVDPEK.A
	TK010303_lung_E18_mito_3_step11.2652.2652.2	1.9594	0.1173	2162.34	12	2780.0%	2	R.IALENYLAALQSDPPRPHR.I
UQ9DC1698.6%119.3%290325627.1(Q9DC16) 1200007D18Rik protein (RIKEN cDNA 1200007D18 gene)
*	TK010303_lung_E18_mito_3_step12.1457.1457.2	3.1201	0.2385	2952.5	2	3080.0%	1	K.VPGNFHVSTHSATAQPQNPDMTHTIHK.L
UTHIM_HUMAN98.6%2315532.7%397420398.3(P42765) 3-ketoacyl-CoA thiolase, mitochondrial (EC 2.3.1.16) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (Mitochondrial 3-oxoacyl-CoA thiolase) (T1)
*	TK010303_lung_E18_mito_3_step08.2024.2024.1	1.9576	0.2763	1190.69	1	6110.0%	11	R.ITAHLVHELR.R
*	TK010303_lung_E18_mito_3_step08.2894.2894.3	1.3989	0.0676	3313.59	57	1330.0%	1	K.VSPETVDSVIMGNVLQSSSDAIYLARHVGLR.V
*	TK010303_lung_E18_mito_3_step11.1361.1361.1	2.1324	0.2287	1085.73	1	6880.0%	2	K.KHNFTPLAR.I
*	TK010303_lung_E18_mito_3_step06.2066.2066.2	1.1647	0.0285	3155.77	29	1480.0%	1	K.ETPALTINRLCGSGFQSIVNGCQEICVK.E
*	TK010303_lung_E18_mito_3_step04.3693.3693.3	1.7525	0.0632	4482.64	102	960.0%	1	R.LCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVR.N
*	TK010303_lung_E18_mito_3_step01.1831.1831.1	1.7024	0.0388	1125.71	10	5500.0%	1	R.TPFGAYGGLLK.D
*	TK010303_lung_E18_mito_3_step02.1814.1814.2	2.1377	0.3702	2381.79	1	3950.0%	1	K.QTMQVDEHARPQTTLEQLQK.L
UP7038898.5%445.0%13121534876.9(P70388) RAD50
*	TK010303_lung_E18_mito_3_step01.4190.4190.1	1.2091	0.0181	1124.77	38	5000.0%	1	R.EMISCLGVSK.S
*	TK010303_lung_E18_mito_3_step05.2144.2144.2	1.2788	0.0057	2414.26	32	2000.0%	1	K.NMDQCSEIVKCSISSLGSYVH.-
*	TK010303_lung_E18_mito_3_step08.2760.2760.2	1.6458	0.1907	2090.11	17	2350.0%	1	K.QKETELNGVAVQLNECEK.H
	TK010303_lung_E18_mito_3_step05.1858.1858.2	2.9104	0.4419	1983.47	1	5000.0%	1	R.KLDQEMEQLNHHTTTR.T
UQ9QY0398.4%2212.1%464540846.5(Q9QY03) ERO1L
*	TK010303_lung_E18_mito_3_step12.2401.2401.3	1.9312	0.0859	4111.94	8	1250.0%	1	K.HDDSSDSFCEIDDIQSPDAEYVDLLLNPERYTGYK.G
*	TK010303_lung_E18_mito_3_step04.2949.2949.2	2.516	0.4503	2437.48	1	3250.0%	1	K.SFPLHFDENSFFAGDKNEAHK.L
UQ9WVJ398.4%5524.9%470518136.2(Q9WVJ3) Aminopeptidase
*	TK010303_lung_E18_mito_3_step07.2938.2938.2	1.2815	0.0419	2614.66	19	2050.0%	1	K.YQDGVPKIPTACITVEDAEMMSR.M
*	TK010303_lung_E18_mito_3_step12.1909.1909.2	1.2599	0.0141	2565.1	12	1740.0%	1	K.YSLVMEADSGTFLPTGLQFTGSDK.A
*	TK010303_lung_E18_mito_3_step11.3675.3675.2	1.7738	0.2482	2560.73	1	2080.0%	1	K.VGAVASLIQSVASFSIYSPHTGIQK.Y
*	TK010303_lung_E18_mito_3_step02.2696.2696.2	2.533	0.4472	2741.45	1	3180.0%	1	K.AIQIMYQNLQQDGLENVHLEQVR.I
*	TK010303_lung_E18_mito_3_step05.2902.2902.2	1.2056	0.0425	2492.15	1	2620.0%	1	R.LVLWTAEEQGGIGASQYYELHK.A
UMTP_MOUSE98.3%689.2%894991427.8(O08601) Microsomal triglyceride transfer protein, large subunit precursor
*	TK010303_lung_E18_mito_3_step06.2207.2207.1	2.3425	0.3187	1325.74	1	5000.0%	2	K.KLILGGLEKPEK.K
*	TK010303_lung_E18_mito_3_step11.3364.3364.2	2.0097	0.1767	2043.7	20	2500.0%	1	R.AASTYSLDILYSGSGILRR.S
*	TK010303_lung_E18_mito_3_step01.2863.2863.1	1.3677	0.0919	1391.9	4	4170.0%	1	K.NALLPEGIPLLLK.Y
*	TK010303_lung_E18_mito_3_step02.2452.2452.1	1.4109	0.1385	1143.25	87	5000.0%	1	R.REEILQILK.A
*	TK010303_lung_E18_mito_3_step12.1396.1396.3	1.9029	0.1507	3115.07	30	1610.0%	1	R.NPDGDDDQVIQVTITAVNVENAGQQRGEK.S
UQ9D5X898.3%73711.8%399447025.3(Q9D5X8) 4921508E09Rik protein
*	TK010303_lung_E18_mito_3_step04.3822.3822.2	1.8288	0.2551	2862.61	3	2200.0%	6	K.ISNINAEIQQGLLGGNNSPEFKEFIK.A
*	TK010303_lung_E18_mito_3_step10.2249.2249.3	1.5649	0.029	2473.35	1	2500.0%	1	R.TSDPDNDMEMIINMLYNSRSK.L
UCO3_MOUSE98.3%132511.8%16631864826.8(P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin]
*	TK010303_lung_E18_mito_3_step10.2682.2682.3	1.632	0.027	3362.9	17	1790.0%	1	K.RDILSSNNQHGILPLSWNIPELVNMGQWK.I
*	TK010303_lung_E18_mito_3_step03.2737.2737.2	1.1981	0.1268	2372.02	1	2620.0%	1	R.IILQGSPVVQMAEDAVDGERLK.H
*	TK010303_lung_E18_mito_3_step02.2353.2353.2	1.5821	0.2213	3118.92	44	1350.0%	1	R.QATKTMEAHPYSTMHNSNNYLHLSVSR.M
*	TK010303_lung_E18_mito_3_step10.3194.3194.2	1.4623	0.105	2388.13	159	1940.0%	3	R.SHFPQSWLWTIEELKEPEK.N
*	TK010303_lung_E18_mito_3_step04.2609.2609.2	2.7357	0.3947	1897.92	1	5000.0%	1	R.MELKPGDNLNVNFHLR.T
*	TK010303_lung_E18_mito_3_step08.4365.4365.2	1.0352	0.0073	2360.06	98	1500.0%	1	K.TSQGLQTEQRADLECTKPAAR.R
*	TK010303_lung_E18_mito_3_step05.3872.3872.2	1.332	0.053	2107.43	14	2500.0%	1	K.EGHKYVTVVANFGETVVEK.A
*	TK010303_lung_E18_mito_3_step04.2034.2034.2	1.191	0.1044	2199.96	120	2250.0%	1	K.VFSLAANLIAIDSHVLCGAVK.W
*	TK010303_lung_E18_mito_3_step02.4408.4408.2	1.6248	0.0478	2587.62	4	2050.0%	3	K.QKPDGVFQEDGPVIHQEMIGGFR.N
UTALI_MOUSE98.3%10128.9%25412698316.1(P26039) Talin
	TK010303_lung_E18_mito_3_step01.2367.2367.1	1.5103	0.092	1457.75	12	3460.0%	1	R.ILAQATSDLVNAIK.A
	TK010303_lung_E18_mito_3_step03.2081.2081.1	1.4894	0.1776	1335.54	1	4580.0%	1	K.VSHVLAALQAGNR.G
	TK010303_lung_E18_mito_3_step08.4341.4341.3	1.8896	0.0786	2753.5	2	2130.0%	1	R.GSQAQPDSPSAQLALIAASQSFLQPGGK.M
	TK010303_lung_E18_mito_3_step07.4384.4384.3	1.4844	0.1099	4229.1	44	1040.0%	1	K.AVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGK.M
	TK010303_lung_E18_mito_3_step09.3159.3159.3	1.7913	0.0029	3169.77	17	1610.0%	1	R.SLAQAARGVAALTSDPAVQAIVLDTASDVLDK.A
	TK010303_lung_E18_mito_3_step02.3857.3857.2	2.7758	0.4422	3052.64	1	2590.0%	1	K.GTEWVDPEDPTVIAENELLGAAAAIEAAAK.K
*	TK010303_lung_E18_mito_3_step03.3484.3484.3	2.0192	0.1237	3777.02	38	1250.0%	1	R.ECANGYLELLDHVLLTLQKPNPDLKQQLTGHSK.R
	TK010303_lung_E18_mito_3_step07.2197.2197.2	1.652	0.1431	2198.94	1	2620.0%	1	K.LGAASLGAEDPETQVVLINAVK.D
	TK010303_lung_E18_mito_3_step05.4364.4364.3	2.057	0.1654	4291.34	2	1380.0%	2	K.VEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHR.G
UQ8TD5798.2%11137.2%41164707746.4(Q8TD57) Axonemal heavy chain dynein type 3
*	TK010303_lung_E18_mito_3_step01.1010.1010.3	2.0409	0.0041	2990.75	26	1460.0%	1	K.YRDTDTNILCAIDDIQMLLDDHVIK.T
*	TK010303_lung_E18_mito_3_step06.3585.3585.3	3.0005	0.4101	3814.18	1	1950.0%	2	K.EVKTSLTFPGSRPMSPEQQLDVMLQQEMEMESK.E
	TK010303_lung_E18_mito_3_step11.4267.4267.3	1.6584	0.0297	4404.25	207	860.0%	1	K.FLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIK.K
	TK010303_lung_E18_mito_3_step09.3331.3331.3	2.2732	0.2709	4232.65	13	1250.0%	1	K.MSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLK.D
	TK010303_lung_E18_mito_3_step08.4324.4324.3	1.5705	0.0734	4066.24	18	1250.0%	1	R.NFGPLGWNIPYEFNESDLRISMWQIQMFLNDYK.E
*	TK010303_lung_E18_mito_3_step10.3246.3246.3	1.5741	0.0528	3336.21	17	1480.0%	1	K.DHLIQFQVDVNRDTNTSICNQYSHIADK.V
*	TK010303_lung_E18_mito_3_step05.3542.3542.3	1.816	0.0465	4461.43	7	1070.0%	1	K.NECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVK.L
*	TK010303_lung_E18_mito_3_step12.4221.4221.2	1.6797	0.0682	2928.46	1	2170.0%	1	K.HCLEAHQTLLNKWIPTCAQLFTSR.K
	TK010303_lung_E18_mito_3_step04.4206.4206.3	1.8659	0.0805	3531.14	29	1470.0%	1	R.CGMIYMEPHQLGWKPLKDSYMDTLPSSLTK.E
*	TK010303_lung_E18_mito_3_step02.2070.2070.3	1.5113	0.0446	2780.57	32	2020.0%	1	K.EHKELVNDMFMWLVQPCLEFGR.L
UQ8VF9098.2%1111.2%313356139.2(Q8VF90) Olfactory receptor MOR235-2
*	TK010303_lung_E18_mito_3_step12.2152.2152.3	2.9973	0.4081	4083.11	1	1620.0%	1	R.KALSTCGSHFTVVVLFFVPCIFTYMRPVTTYPVDK.L
UQ9JLN598.2%229.6%592665568.7(Q9JLN5) Erythroid membrane-associated protein ERMAP
	TK010303_lung_E18_mito_3_step05.2588.2588.2	2.2749	0.4567	1761.91	1	4670.0%	1	R.LHFVAVTLDPDTAHPK.L
*	TK010303_lung_E18_mito_3_step02.3429.3429.3	2.3669	0.2051	4244.65	1	1310.0%	1	K.TTAMIIGAPERGSLSSPAVALSVVLPVLGLLILLGIWLICK.Q
URS12_MOUSE98.2%117.6%131143947.2(P09388) 40S ribosomal protein S12
	TK010303_lung_E18_mito_3_step04.2319.2319.1	2.2353	0.3253	1191.46	1	6670.0%	1	K.KLGEWVGLCK.I
UQ9HCJ098.2%91115.5%14481521207.1(Q9HCJ0) Hypothetical protein KIAA1582 (Fragment)
*	TK010303_lung_E18_mito_3_step12.3077.3077.3	2.1012	0.023	3652.87	115	1150.0%	1	-.GISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK.Q
	TK010303_lung_E18_mito_3_step12.2743.2743.2	1.2787	0.0636	2781.88	464	1040.0%	1	K.SDSDKISNGSSINWPPEFHPGVPWK.G
*	TK010303_lung_E18_mito_3_step10.2299.2299.2	1.6904	0.2566	2332.19	1	2750.0%	1	R.TMQQPPQPPVQPLNSSQPSLR.A
*	TK010303_lung_E18_mito_3_step09.4380.4380.3	1.9798	0.143	3445.62	3	1450.0%	1	K.ESSVDRPTFLDKDGGLVEEPTPSPFLPSPSLK.L
*	TK010303_lung_E18_mito_3_step10.2406.2406.2	3.0248	0.4019	1654.92	1	4670.0%	2	K.QTGTGWIGGPVPVKQK.D
	TK010303_lung_E18_mito_3_step11.4008.4008.3	1.6939	0.1831	3998.11	6	1360.0%	1	R.NLTPQIDGSTLRTLCLQHGPLITFHLNLTQGNAVVR.Y
*	TK010303_lung_E18_mito_3_step02.2857.2857.2	1.2268	0.1133	3060.89	66	1430.0%	1	K.GSTGWESPSVTSQNPTVQPGGEHMNSWAK.A
*	TK010303_lung_E18_mito_3_step03.3755.3755.2	1.4195	0.0033	2657.22	11	1920.0%	1	R.SNPAWSAGGGDWADSSSVLGHLGDGKK.N
UTERA_MOUSE98.2%123416.6%806893085.3(Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
	TK010303_lung_E18_mito_3_step01.1504.1504.1	1.7363	0.1727	1542.85	1	4620.0%	1	R.LGDVISIQPCPDVK.Y
	TK010303_lung_E18_mito_3_step03.2221.2221.1	1.84	0.0913	1094.6	1	7500.0%	2	R.LEILQIHTK.N
	TK010303_lung_E18_mito_3_step12.3961.3961.3	1.9617	0.2245	3100.73	310	1250.0%	1	K.MDLIDLEDETIDAEVMNSLAVTMDDFR.W
	TK010303_lung_E18_mito_3_step10.3550.3550.3	1.6244	0.0809	4147.41	4	1470.0%	1	K.RIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIR.K
	TK010303_lung_E18_mito_3_step01.2439.2439.1	2.312	0.2566	1556.9	1	5830.0%	1	R.LDQLIYIPLPDEK.S
	TK010303_lung_E18_mito_3_step12.2651.2651.2	1.4818	0.2007	2521.95	34	1360.0%	5	K.NVFIIGATNRPDIIDPAILRPGR.L
	TK010303_lung_E18_mito_3_step01.3294.3294.1	1.9586	0.327	1432.96	1	6670.0%	1	R.IVSQLLTLMDGLK.Q
UTBL2_MOUSE98.1%3318.8%442495849.0(Q9R099) Transducin beta-like 2 protein
*	TK010303_lung_E18_mito_3_step11.3129.3129.2	1.5592	0.1444	2578.15	7	1960.0%	1	R.LALSPDTHVLALATGTNIHLFNTR.R
*	TK010303_lung_E18_mito_3_step02.3382.3382.3	1.9137	0.0572	4552.09	10	1120.0%	1	K.FIMTASSDTTVLIWNLKGQVLSTINTNQMNNSHAVISPCSR.F
*	TK010303_lung_E18_mito_3_step12.2011.2011.2	2.3992	0.4464	2017.93	1	5000.0%	1	K.EKPQQHSFTHPLLAAALK.S
UANX6_MOUSE98.1%241.6%672757555.5(P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II)
*	TK010303_lung_E18_mito_3_step02.1820.1820.1	2.2848	0.3233	1361.54	1	6500.0%	2	K.KTNYDIEHVIK.K
UTCP1_MOUSE98.1%469.0%556603416.1(P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A)
	TK010303_lung_E18_mito_3_step10.2499.2499.2	2.9911	0.3802	1391.07	1	8640.0%	1	K.WIGLDLVHGKPR.D
	TK010303_lung_E18_mito_3_step05.1846.1846.1	1.5136	0.2829	1230.62	9	4000.0%	2	K.IHPTSVISGYR.L
	TK010303_lung_E18_mito_3_step06.3791.3791.2	2.5642	0.3722	2703.71	2	2310.0%	1	K.SVVPGGGAVEAALSIYLENYATSMGSR.E
UQ9CXI598.1%399.5%179203748.1(Q9CXI5) 3230402M22Rik protein
	TK010303_lung_E18_mito_3_step11.1687.1687.2	3.0768	0.3	1926.32	1	4690.0%	3	K.IINEVSKPLAHHIPVEK.I
UR22A_MOUSE98.0%62642.9%4956665.1(P35285) Ras-related protein Rab-22A (RAB-14) (Fragment)
	TK010303_lung_E18_mito_3_step07.2372.2372.2	2.056	0.2799	2332.76	1	3250.0%	5	R.FVEDSFDPNINPTIGASFMTK.T
UQ9D2V298.0%111.7%823932819.0(Q9D2V2) 1300006C19Rik protein
	TK010303_lung_E18_mito_3_step05.2818.2818.2	2.9556	0.4048	1753.68	1	6540.0%	1	K.HLEEAFTSEHWLVR.I
UQ8R4I198.0%61015.3%867927209.8(Q8R4I1) Ataxin-7
*	TK010303_lung_E18_mito_3_step09.3748.3748.3	1.7194	0.0229	4096.52	7	1150.0%	2	R.VPHRTNSVPTSQGGISYLAATTVSAPPVLLSSTCISPNSK.S
*	TK010303_lung_E18_mito_3_step07.3406.3406.2	1.52	0.1185	2837.73	2	1920.0%	2	R.HSSSSKPALAVPHTSVFSLFPPLSKSK.G
*	TK010303_lung_E18_mito_3_step04.3794.3794.3	2.3271	0.0353	4028.58	20	1040.0%	1	K.RMSVMVNSSDSTLSLGPFIHQASELPVNPHSHTPLDK.L
*	TK010303_lung_E18_mito_3_step01.3272.3272.2	1.5289	0.2032	2916.06	4	1790.0%	1	R.KNSSPLLVPSSSSSSSSSSSSSHSVNSFR.K
UQ99KW298.0%3312.4%579665656.6(Q99KW2) Similar to myosin 5C
	TK010303_lung_E18_mito_3_step03.3128.3128.2	2.9355	0.4237	1436.05	1	6820.0%	1	K.LIQNLILDLKPR.G
*	TK010303_lung_E18_mito_3_step11.3205.3205.3	1.8663	0.0039	4448.79	14	1050.0%	1	R.IYHQFIIVMENNLQPIIVPGMLEYESLQGISGLKPTGFR.K
*	TK010303_lung_E18_mito_3_step05.2369.2369.2	1.3216	0.1243	2347.79	1	2500.0%	1	R.QAVKQLFYLVGAVTLNSLLLR.K
UDPP3_MOUSE98.0%5516.7%738829115.3(Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III)
*	TK010303_lung_E18_mito_3_step08.1628.1628.3	1.2088	0.0123	1925.44	138	2340.0%	1	R.AGLLALEFYTPEAANWR.Q
*	TK010303_lung_E18_mito_3_step03.2315.2315.2	1.4235	0.0136	3144.15	11	1380.0%	1	R.FVILRVLLEAGEGLVTVTPTTGSDGRPDAR.V
	TK010303_lung_E18_mito_3_step09.4446.4446.2	1.3538	0.1598	2824.63	11	2000.0%	1	R.AAWYGGLAVLLQTSPEAPYIYALLSR.L
*	TK010303_lung_E18_mito_3_step08.2065.2065.2	2.5578	0.4351	1682.12	1	5420.0%	1	K.RYEFQGNHFQVTR.G
	TK010303_lung_E18_mito_3_step12.2932.2932.3	2.156	0.1843	4102.47	22	1180.0%	1	R.QHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTK.F
UQ9DCY297.9%246.4%233259318.2(Q9DCY2) 2310045J23Rik protein
	TK010303_lung_E18_mito_3_step08.3018.3018.2	2.0893	0.143	1861.15	1	4640.0%	2	R.VVYRPEHISFEELLK.V
UTHI2_HUMAN97.9%2233.1%166183838.3(Q99757) Thioredoxin, mitochondrial precursor (Mt-TRX) (Thioredoxin 2)
*	TK010303_lung_E18_mito_3_step07.3857.3857.3	2.8762	0.4494	3472.2	1	2020.0%	1	K.VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDK.F
*	TK010303_lung_E18_mito_3_step09.4367.4367.3	2.118	0.089	2702.83	20	1930.0%	1	R.TIYTTRISLTTFNIQDGPDFQDR.V
UQ9DD1097.9%247.3%248275207.7(Q9DD10) B430104H02Rik protein
	TK010303_lung_E18_mito_3_step03.3133.3133.2	2.8869	0.4107	2076.04	1	4120.0%	2	K.KGDEVQCEIEELGVIINK.V
UQ8R11797.8%4422.6%340378016.8(Q8R117) Hypothetical 37.8 kDa protein (Fragment)
*	TK010303_lung_E18_mito_3_step08.3060.3060.2	2.8846	0.4001	1729.59	1	5360.0%	1	R.IHPSQTVHEVLELVK.N
*	TK010303_lung_E18_mito_3_step02.1978.1978.3	1.6839	0.2688	3452.65	4	1590.0%	1	K.GALDLMLQVNMTPGHSSAPPKETSIGILSAAVSR.L
*	TK010303_lung_E18_mito_3_step06.2315.2315.3	1.5795	0.0466	3004.3	1	1880.0%	1	K.ETSIGILSAAVSRLEQTPMPNMFGGGPLK.K
*	TK010303_lung_E18_mito_3_step08.3734.3734.2	1.0973	0.0327	1258.79	153	3180.0%	1	K.GAQKISALLQAR.G
UQ9DCI797.8%4424.8%335362568.9(Q9DCI7) 1200012F07Rik protein
	TK010303_lung_E18_mito_3_step09.2642.2642.3	1.551	0.0027	3060.86	72	1430.0%	1	K.VAGHPDVVINNAAGNFISPSERLTPNGWK.T
	TK010303_lung_E18_mito_3_step01.1538.1538.1	2.1096	0.2558	1126.68	1	7220.0%	1	R.FNIIQPGPIK.T
*	TK010303_lung_E18_mito_3_step03.4029.4029.2	1.1464	0.0146	2608.19	2	2000.0%	1	K.GAAFLAITTIYAESVSGFVMPSSSAK.S
	TK010303_lung_E18_mito_3_step04.3078.3078.2	2.2457	0.4543	2060.31	1	4710.0%	1	K.FFQPVLKPMLPPDAFQGK.V
UHNT1_MOUSE97.7%51154.4%125136466.9(P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)
	TK010303_lung_E18_mito_3_step12.2541.2541.2	2.4327	0.4433	2294.14	2	2630.0%	3	R.CLAFHDISPQAPTHFLVIPK.K
*	TK010303_lung_E18_mito_3_step09.4054.4054.2	1.3445	0.0108	2596.42	7	2170.0%	1	K.HISQISVADDDDESLLGHLMIVGK.K
*	TK010303_lung_E18_mito_3_step02.3529.3529.2	1.4166	0.0613	2546.28	414	1300.0%	1	R.MVVNEGADGGQSVYHIHLHVLGGR.Q
UPMG1_MOUSE97.6%2215.8%253287017.2(Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1)
	TK010303_lung_E18_mito_3_step05.2341.2341.2	1.4108	0.0842	2573.99	157	1430.0%	1	R.RSYDVPPPPMEPDHPFYSNISK.D
	TK010303_lung_E18_mito_3_step10.2394.2394.2	2.8697	0.3847	2115.64	1	4710.0%	1	K.NLKPIKPMQFLGDEETVR.K
UQ9D9F697.6%115.2%229255896.4(Q9D9F6) 1700082C19Rik protein
	TK010303_lung_E18_mito_3_step06.2865.2865.1	2.3738	0.2791	1395.08	1	5910.0%	1	K.AHQLWLSVEALK.Y
UPSPC_MOUSE97.6%61037.8%193210556.9(P21841) Pulmonary surfactant-associated protein C precursor (SP-C) (SP5) (Pulmonary surfactant-associated proteolipid SPL(Val))
*	TK010303_lung_E18_mito_3_step11.3547.3547.2	1.5597	0.0923	2331.62	3	2750.0%	1	R.DLAFLGLAVSTLCGELPLYYI.-
*	TK010303_lung_E18_mito_3_step01.2070.2070.1	1.5378	0.1423	1519.83	8	3460.0%	1	K.MAPESIPSLEAFAR.K
*	TK010303_lung_E18_mito_3_step05.2536.2536.2	2.1435	0.3137	1991.08	2	3750.0%	2	R.LLTAYKPAPGTYCYIMK.M
*	TK010303_lung_E18_mito_3_step09.4324.4324.2	2.8519	0.3918	2279.5	1	4000.0%	2	R.ADTIATFSIGSTGIVVYDYQR.L
UQ921V597.6%112.7%442510308.6(Q921V5) Similar to mannosyl (Alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (Hypothetical 51.0 kDa protein)
	TK010303_lung_E18_mito_3_step11.1128.1128.1	2.3603	0.2787	1410.38	1	6360.0%	1	R.IFHAGDCGMHHK.K
URAPB_HUMAN97.6%1114.1%184208255.8(P09526) Ras-related protein RAP-1b (GTP-binding protein smg p21B)
	TK010303_lung_E18_mito_3_step08.3533.3533.2	2.8683	0.3806	2987.99	1	2400.0%	1	K.QVEVDAQQCMLEILDTAGTEQFTAMR.D
UPODX_MOUSE97.6%2211.5%503533895.0(Q9R0M4) Podocalyxin-like protein 1 precursor
	TK010303_lung_E18_mito_3_step03.2895.2895.2	2.2948	0.4429	2809.68	1	2800.0%	1	K.ASFKPAEDLCTLHVAPILDNQAVAVK.R
*	TK010303_lung_E18_mito_3_step08.3236.3236.3	1.6994	0.0023	3612.43	7	1530.0%	1	K.VVNLNGELGDSWIVPLDNLTKDDLDEEEDTHL.-
UQ96M7797.5%5721.2%425473148.7(Q96M77) Hypothetical protein FLJ32771
*	TK010303_lung_E18_mito_3_step12.1749.1749.1	1.0848	0.0061	1183.59	16	3640.0%	1	K.SIGAKEGSGFTK.Q
*	TK010303_lung_E18_mito_3_step06.3522.3522.3	2.0542	0.0308	3777.92	1	1800.0%	2	R.GEQAQDHFQSVASQSYRPLEVPDGKHPLPWSMR.Q
*	TK010303_lung_E18_mito_3_step06.4409.4409.2	1.4133	0.054	2294.63	36	2110.0%	1	K.SDFLPKTHLHGDEFLPVLAR.G
*	TK010303_lung_E18_mito_3_step10.4346.4346.3	3.1432	0.3133	2842.21	1	2190.0%	1	K.VHFDTQEHGPQAITGLEPREVPLLR.Q
UQ96B9497.5%339.4%745832975.8(Q96B94) Similar to KIAA0807 protein
	TK010303_lung_E18_mito_3_step01.3312.3312.1	1.6019	0.322	1245.99	4	4500.0%	1	R.HRLLSGDSTEK.R
	TK010303_lung_E18_mito_3_step03.4001.4001.3	1.9949	0.1783	3829.86	31	1180.0%	1	K.SASATALSLLIPSEHHTCSPLASPMSPHSQSSNPSSR.D
	TK010303_lung_E18_mito_3_step05.4289.4289.2	1.5006	0.0087	2390.95	5	2380.0%	1	R.CSGLLDAPRFPEGPEEASSTLR.R
URAPA_HUMAN97.5%2214.1%184209876.6(P10113) Ras-related protein RAP-1A (C21KG) (KREV-1 protein) (GTP-binding protein SMG-P21A) (G-22K) (P10113) Ras-related protein RAP-1A (C21KG) (KREV-1 protein) (GTP-binding protein SMG-P21A) (G-22K)
	TK010303_lung_E18_mito_3_step01.1147.1147.1	1.5002	0.2799	985.7	1	6000.0%	1	K.LVVLGSGGVGK.S
	TK010303_lung_E18_mito_3_step09.2930.2930.3	3.0244	0.3594	2632.0	3	2100.0%	1	K.LVVLGSGGVGKSALTVQFVQGIFVEK.Y
UEF1G_MOUSE97.4%61216.7%437500616.7(Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma)
	TK010303_lung_E18_mito_3_step12.1924.1924.2	2.4938	0.3687	1711.23	1	4640.0%	3	R.VLSAPPHFHFGQTNR.T
	TK010303_lung_E18_mito_3_step03.3573.3573.2	1.515	0.03	2590.31	2	2500.0%	1	R.KYSNEDTLSVALPYFWEHFDK.D
	TK010303_lung_E18_mito_3_step07.2009.2009.1	1.748	0.2047	1125.59	1	5000.0%	1	K.AKDPFAHLPK.S
*	TK010303_lung_E18_mito_3_step07.3912.3912.2	1.5852	0.1968	3140.33	31	1540.0%	1	K.LDPGSEETQTLVREYFSWEGTFQHVGK.A
UMLEN_MOUSE97.3%51720.6%141157314.9(Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment)
	TK010303_lung_E18_mito_3_step01.4287.4287.2	1.6188	0.0553	1890.85	1	3330.0%	1	K.VLDFEHFLPMLQTVAK.N
	TK010303_lung_E18_mito_3_step01.0188.0188.1	1.9604	0.1222	1356.64	26	3330.0%	4	R.ALGQNPTNAEVLK.V
UQ9CPN897.3%226.0%579635758.9(Q9CPN8) 10 days embryo cDNA, RIKEN full-length enriched library, clone:2610036B18, full insert sequence (Igf2 mRNA-binding protein 3)
*	TK010303_lung_E18_mito_3_step07.1885.1885.2	3.0563	0.2444	1848.34	1	5670.0%	1	K.MELHGKPMEVEHSVPK.R
*	TK010303_lung_E18_mito_3_step03.2999.2999.2	1.4858	0.055	2101.71	1	2780.0%	1	K.VAYIPDETAAQQNPSPQLR.G
UQ91ZW297.3%356.4%393446898.4(Q91ZW2) GDP-fucose protein O-fucosyltransferase 1 precursor (EC 2.4.1.-) (O-fucosyltransferase) (O-FucT-1)
*	TK010303_lung_E18_mito_3_step05.1806.1806.2	1.0088	0.0215	2752.99	4	2080.0%	1	R.FPAKEHPVLALPGAPAQFPVLEEHR.E
*	TK010303_lung_E18_mito_3_step10.2638.2638.2	2.558	0.3564	2308.48	1	3500.0%	2	K.EHPVLALPGAPAQFPVLEEHR.E
UHERP_MOUSE97.3%229.7%391439075.5(Q9JJK5) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
*	TK010303_lung_E18_mito_3_step06.4193.4193.3	2.003	0.042	2999.26	1	2310.0%	1	K.GAESTEQPDNSNQTQHPGDSSSDGLRQR.E
	TK010303_lung_E18_mito_3_step11.1765.1765.1	2.2213	0.3138	1218.65	1	6670.0%	1	R.HVLHLVCNVK.N
UO8881197.2%3311.1%523574555.1(O88811) HRS binding protein (1200004O12RIK protein) (Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2)
*	TK010303_lung_E18_mito_3_step08.3976.3976.3	1.8119	0.0139	4479.18	39	1010.0%	1	R.ALYDFEAVEDNELTFKHGELITVLDDSDANWWQGENHR.G
*	TK010303_lung_E18_mito_3_step08.4404.4404.2	2.0492	0.3125	2313.61	6	2370.0%	1	K.HSELSELNVKVLEALDLYNK.L
*	TK010303_lung_E18_mito_3_step04.3086.3086.2	2.2196	0.4382	2594.94	1	2620.0%	1	K.HGELITVLDDSDANWWQGENHR.G
UODBB_HUMAN97.2%112.6%392431236.3(P21953) 2-oxoisovalerate dehydrogenase beta subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component beta chain (E1)) (BCKDH E1-beta)
*	TK010303_lung_E18_mito_3_step01.1944.1944.1	1.9194	0.3161	1147.54	1	6110.0%	1	K.GLLLSCIEDK.N
USMO_MOUSE97.2%225.4%793873008.4(P56726) Smoothened homolog precursor (SMO)
*	TK010303_lung_E18_mito_3_step07.2874.2874.3	2.0159	0.1569	3260.12	126	1210.0%	1	R.QGAWTLVSNPFCPEPSPHQDPFLPGASAPR.V
*	TK010303_lung_E18_mito_3_step01.1714.1714.1	1.7079	0.3127	1467.63	1	5000.0%	1	K.FNSSGQCEAPLVR.T
UCH10_MOUSE97.2%2132935.6%101108318.3(Q64433) 10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (CPN10)
	TK010303_lung_E18_mito_3_step01.2303.2303.1	1.9875	0.2311	1288.65	2	5000.0%	18	K.VLQATVVAVGSGGK.G
	TK010303_lung_E18_mito_3_step01.1263.1263.1	0.9625	9.0E-4	1076.61	2	5560.0%	2	K.VLLPEYGGTK.V
	TK010303_lung_E18_mito_3_step01.2360.2360.1	1.6707	0.1075	1532.83	1	5000.0%	1	K.VVLDDKDYFLFR.D
UQ924I097.1%469.7%751836686.8(Q924I0) Elongation factor G
	TK010303_lung_E18_mito_3_step02.2684.2684.2	2.8162	0.3734	2315.42	1	3950.0%	2	R.FVLQDGAHHMVDSNEISFIR.A
*	TK010303_lung_E18_mito_3_step01.4167.4167.2	0.9112	0.1086	2048.0	21	2060.0%	1	K.ETIVSGMGELHLEIYAQR.M
*	TK010303_lung_E18_mito_3_step11.3272.3272.3	1.7043	0.0245	3774.71	4	1620.0%	1	K.QALANGTLCIIEPIMSVEVIAPNEFQGTVFAGINR.R
UO3540597.1%5921.1%488543896.5(O35405) Schwannoma-associated protein
*	TK010303_lung_E18_mito_3_step01.3960.3960.3	1.6577	0.0097	4479.95	12	1100.0%	2	R.ASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLR.D
*	TK010303_lung_E18_mito_3_step02.4064.4064.3	1.8218	0.0104	4096.83	1	1530.0%	1	R.SFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGR.T
*	TK010303_lung_E18_mito_3_step04.3566.3566.2	2.0141	0.1339	2466.07	1	2830.0%	2	R.IAVSKPNGPLADLQSLLQSGAQVR.M
UNEO1_MOUSE97.1%335.4%14931631596.5(P97798) Neogenin precursor
*	TK010303_lung_E18_mito_3_step05.2078.2078.3	1.6465	0.0388	3203.15	11	1670.0%	1	K.HGPGVSTQDVAVRTLSDVPSAAPQNLSLEVR.N
*	TK010303_lung_E18_mito_3_step04.2910.2910.2	2.7894	0.3902	2721.55	1	3480.0%	1	K.HNKPDEGFYQCVATVDNLGTIVSR.T
*	TK010303_lung_E18_mito_3_step03.3035.3035.3	1.6061	0.0944	2947.84	11	1900.0%	1	R.QSQGASVRTFTPFYFLVEPVDTLSVR.G
UQ9JJ0697.1%113.9%363423047.2(Q9JJ06) Core1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase (EC 2.4.1.122)
	TK010303_lung_E18_mito_3_step11.2067.2067.2	2.7637	0.3977	1731.78	1	6150.0%	1	K.ETFHPFVPEHHLIK.G
UQ8R33997.0%242.2%642679428.6(Q8R339) Hypothetical 67.9 kDa protein
*	TK010303_lung_E18_mito_3_step01.2442.2442.1	2.2587	0.1944	1525.71	1	5000.0%	2	R.DVPLGAPLCIIVEK.Q
UQ9CUB497.0%5727.1%321364557.3(Q9CUB4) 4933430B08Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step04.4053.4053.2	1.4655	0.0358	3061.19	109	1150.0%	2	R.LYLEGTGINPTPVDLHEQQLSLNQHSR.A
	TK010303_lung_E18_mito_3_step12.1980.1980.2	2.7471	0.4013	2587.81	2	3410.0%	1	R.LKPVIGVNTDPERSEGHLCLPVR.Y
	TK010303_lung_E18_mito_3_step04.2517.2517.2	1.3648	0.0675	2756.48	155	1400.0%	1	R.SEASGPQLLPVRALNEVFIGESLSSR.A
	TK010303_lung_E18_mito_3_step01.2824.2824.1	1.6393	0.0647	1256.77	4	5000.0%	1	R.RQGNLTLPLNK.D
UQ6402896.9%114712.5%10121063679.1(Q64028) Early development regulator protein 1 (RAE-28) (Polyhomeotic protein homolog) (MPH1)
*	TK010303_lung_E18_mito_3_step03.3160.3160.2	1.2487	0.1568	2162.03	5	2370.0%	3	K.AESEEERDDLSALASVLPTK.A
*	TK010303_lung_E18_mito_3_step11.2799.2799.3	2.0878	0.0327	4077.52	5	1380.0%	1	K.NSLGEKAEPVASLNANPPNSDLVALAPTPSAPPPTLALVSR.Q
	TK010303_lung_E18_mito_3_step10.3101.3101.3	1.7365	0.0409	2995.78	67	1610.0%	1	R.GQEDSSRGSDNSSYDEALSPTSPGPLSVR.A
	TK010303_lung_E18_mito_3_step05.3908.3908.3	2.3091	0.1757	4018.74	3	1360.0%	6	R.TATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQK.Q
UCOXG_MOUSE96.9%1112.9%8599408.7(P56391) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1) (AED)
	TK010303_lung_E18_mito_3_step02.2449.2449.2	2.7057	0.3985	1554.37	1	7500.0%	1	K.NCWQNYLDFHR.C
UQ96T2696.8%228.2%552619767.2(Q96T26) Lung seven transmembrane receptor 1
	TK010303_lung_E18_mito_3_step11.1165.1165.1	1.6341	0.3062	817.56	4	6670.0%	1	R.VHHLALK.D
	TK010303_lung_E18_mito_3_step10.4246.4246.3	2.2687	0.1677	4364.41	83	950.0%	1	K.SFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGK.E
UH2AO_HUMAN96.6%2422.5%1291396410.9(P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615) (P20670) Histone H2A.o (H2A/o) (H2A.2) (H2a-615)
	TK010303_lung_E18_mito_3_step03.3959.3959.2	2.9923	0.3238	2937.07	1	2500.0%	2	R.VGAGAPVYMAAVLEYLTAEILELAGNAAR.D
UQ9JJ2896.6%579.4%12711448036.1(Q9JJ28) Fliih protein
	TK010303_lung_E18_mito_3_step12.2724.2724.2	3.0024	0.3272	2253.3	1	4210.0%	1	R.LVHLQTLVLNGNPLLHAQLR.Q
	TK010303_lung_E18_mito_3_step03.2575.2575.3	1.6778	0.197	4272.63	17	1180.0%	2	R.LDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGK.F
*	TK010303_lung_E18_mito_3_step09.4131.4131.3	2.1341	0.0255	3635.32	58	1210.0%	1	R.TAEWYNIDFSLQNQLRLAGASPATVAAAAAVGSGSK.D
	TK010303_lung_E18_mito_3_step05.2408.2408.3	1.858	0.0159	2883.72	13	1800.0%	1	K.VPFESEDNQGIVYAWVGRASDPDEAK.L
UQ9WV6696.6%2210.0%693765997.8(Q9WV66) Axotrophin
*	TK010303_lung_E18_mito_3_step10.3369.3369.3	2.037	0.0842	3731.17	47	1290.0%	1	R.LDSEYQSASASACASPCQPAWYSESEIPQGARAR.A
*	TK010303_lung_E18_mito_3_step12.3712.3712.3	2.9182	0.381	3661.58	2	1760.0%	1	R.FAVPPALGSNLADNVMITVDIIPSGWNSTDGKNDK.A
UQ8VC9496.6%118.4%167190249.8(Q8VC94) Hypothetical 19.0 kDa protein
	TK010303_lung_E18_mito_3_step01.1715.1715.1	2.0353	0.3037	1547.73	1	4620.0%	1	K.VLEQLTGQTPVFSK.A
UNUCG_MOUSE96.6%2211.2%294321919.5(O08600) Endonuclease G, mitochondrial precursor (EC 3.1.30.-) (Endo G)
	TK010303_lung_E18_mito_3_step09.2376.2376.1	2.053	0.2983	1296.6	1	6000.0%	1	K.NHVAVPTHFFK.V
*	TK010303_lung_E18_mito_3_step01.4160.4160.2	1.5441	0.1728	2529.58	32	2140.0%	1	R.TYQNVYVCTGPLFLPRTEADGK.S
UYAB1_MOUSE96.5%6841.9%298343345.8(Q60936) Hypothetical heart protein (Fragment)
	TK010303_lung_E18_mito_3_step08.2908.2908.2	1.4897	0.0751	2650.02	1	2730.0%	2	R.DKLEYFEERPFAAASIGQVHLAR.M
	TK010303_lung_E18_mito_3_step08.2718.2718.3	1.8478	0.0181	4230.42	62	1030.0%	1	R.ELFEFHVMQTDPNWSNFFYDPQQHKVALLDFGATR.E
*	TK010303_lung_E18_mito_3_step08.3460.3460.2	1.9224	0.1952	2555.65	10	1960.0%	1	R.GAALKLGQMLSIQDDAFINPHLAK.I
	TK010303_lung_E18_mito_3_step05.4161.4161.2	1.0404	0.0631	2666.14	2	2270.0%	1	K.LEYFEERPFAAASIGQVHLARMK.G
	TK010303_lung_E18_mito_3_step06.4391.4391.3	1.4946	0.0253	4552.42	19	1190.0%	1	K.IQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLR.R
UEMD_MOUSE96.5%2218.1%259294365.0(O08579) Emerin
*	TK010303_lung_E18_mito_3_step08.3541.3541.2	1.4265	0.1068	3141.92	17	1720.0%	1	R.SSLGLSYYPTSSTSSVSSSSSSPSSWLTRR.A
*	TK010303_lung_E18_mito_3_step03.1969.1969.2	2.159	0.4385	1908.18	1	3120.0%	1	R.QPGTSLVDADTFHHQVR.D
UM3K3_MOUSE96.5%113.0%626707768.9(Q61084) Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.1.-) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3)
	TK010303_lung_E18_mito_3_step07.1608.1608.2	2.1274	0.4729	2085.69	1	3060.0%	1	K.IATQPTNPQLPSHISEHGR.D
UQ96GK896.5%117.8%371413614.9(Q96GK8) cAMP responsive element binding protein 3 (Luman)
*	TK010303_lung_E18_mito_3_step12.3111.3111.3	3.1952	0.2354	3206.56	1	2230.0%	1	K.TSSSSTCILVLLVSFCLLLVPAIYSSDTR.G
UQ8WZ3996.5%1135.8%109122638.6(Q8WZ39) Hypothetical protein
*	TK010303_lung_E18_mito_3_step03.3865.3865.3	3.1217	0.281	4108.66	5	1320.0%	1	R.LECSGAISAHCNLHLLGSSYSPVSASQVAGTTGLCHHAR.L
UPHS3_HUMAN96.4%111.7%843966966.9(P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1)
*	TK010303_lung_E18_mito_3_step11.2472.2472.2	2.5906	0.4025	1737.25	1	5000.0%	1	K.ARPEYMLPVHFYGR.V
UH2AZ_HUMAN96.4%2211.0%1271342210.6(P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z)
	TK010303_lung_E18_mito_3_step09.2135.2135.2	2.9799	0.2986	1371.94	1	6540.0%	1	K.ATIAGGGVIPHIHK.S
UQ9BX8096.4%446.2%13821543178.0(Q9BX80) ATP-binding cassette transporter MRP8
	TK010303_lung_E18_mito_3_step12.2404.2404.3	1.9293	9.0E-4	4222.96	12	1180.0%	1	K.MCVSEAPLHMEGTSCPQGWPQHGEIIFQDYHMKYR.D
	TK010303_lung_E18_mito_3_step08.4426.4426.3	2.0651	0.0241	2756.2	1	2190.0%	1	R.LIFDALLGICFCIASVLGPILIIPK.I
	TK010303_lung_E18_mito_3_step01.2066.2066.1	2.4708	0.0751	1505.72	3	5420.0%	1	R.VTSEVLTCIKLIK.M
	TK010303_lung_E18_mito_3_step04.1971.1971.1	1.5588	0.082	1344.76	13	4090.0%	1	K.ASTALHNKLFNK.V
UQ8VEL496.4%2220.9%244283919.8(Q8VEL4) Hypothetical 28.4 kDa protein
	TK010303_lung_E18_mito_3_step08.3712.3712.3	2.8222	0.4684	4371.61	1	1510.0%	1	K.ILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDK.H
	TK010303_lung_E18_mito_3_step01.2942.2942.1	1.1296	0.0722	1446.88	18	4090.0%	1	R.QHCTLELGSYIK.D
UMBNL_MOUSE96.4%243.2%341369768.6(Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein)
	TK010303_lung_E18_mito_3_step11.1399.1399.1	1.9615	0.2983	1310.75	1	7000.0%	2	K.YFHPPAHLQAK.I
UCYB5_MOUSE96.4%41032.3%133151105.1(P56395) Cytochrome b5
*	TK010303_lung_E18_mito_3_step11.1844.1844.1	1.9234	0.2965	1122.58	2	6250.0%	3	K.STWVILHHK.V
	TK010303_lung_E18_mito_3_step05.2034.2034.3	1.5456	0.0033	3698.98	92	1290.0%	1	K.FLEEHPGGEEVLREQAGGDATENFEDVGHSTDAR.E
UQ8VC4296.3%241.7%657749237.8(Q8VC42) Hypothetical 74.9 kDa protein
	TK010303_lung_E18_mito_3_step11.1663.1663.1	1.1904	0.2526	1276.83	12	3000.0%	2	K.GPDDRNPISFR.M
UQ9Y2K396.3%111.3%8911033835.5(Q9Y2K3) Hypothetical protein KIAA1000 (Fragment)
*	TK010303_lung_E18_mito_3_step11.2235.2235.1	1.8406	0.3032	1419.76	1	5000.0%	1	R.LSEEELLEATER.I
UQ9CVV396.3%113.5%2873252712.3(Q9CVV3) 1700026P10Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step11.1832.1832.1	1.7719	0.2962	1187.28	2	5560.0%	1	R.EQAQAREQAR.A
UQ8R3Q696.3%114.9%144166658.2(Q8R3Q6) Similar to CG15881 gene product (H. sapiens)
*	TK010303_lung_E18_mito_3_step12.1067.1067.1	1.7655	0.2944	852.48	1	8330.0%	1	R.VHFKPPK.N
UITA6_HUMAN96.3%7913.0%11301266186.8(P23229) Integrin alpha-6 precursor (VLA-6) (CD49f)
*	TK010303_lung_E18_mito_3_step12.2873.2873.2	1.3866	0.0161	2484.5	296	1320.0%	1	K.YQTLNCSVNVNCVNIRCPLR.G
*	TK010303_lung_E18_mito_3_step02.2277.2277.3	2.0732	0.2351	4265.52	4	1280.0%	1	K.TACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEK.E
*	TK010303_lung_E18_mito_3_step08.3201.3201.2	1.5791	0.0573	2030.17	99	1940.0%	1	R.NSYPDVAVGSLSDSVTIFR.S
*	TK010303_lung_E18_mito_3_step04.2407.2407.2	2.4717	0.4089	1992.55	1	3820.0%	1	K.LRPIPITASVEIQEPSSR.R
*	TK010303_lung_E18_mito_3_step08.3793.3793.2	1.9088	0.4469	3021.87	1	2780.0%	1	R.VINLGKPLTNLGTATLNIQWPKEISNGK.W
*	TK010303_lung_E18_mito_3_step01.3868.3868.2	1.521	0.0226	2330.54	2	2860.0%	2	R.AFIDVTAAAENIRLPNAGTQVR.V
UEHD1_MOUSE96.3%467.3%534606036.8(Q9WVK4) EH-domain containing protein 1 (mPAST1)
	TK010303_lung_E18_mito_3_step01.0672.0672.1	1.1381	0.0138	716.64	16	7000.0%	1	K.LNDLIK.R
	TK010303_lung_E18_mito_3_step01.3127.3127.1	1.2107	0.0657	1499.57	2	4090.0%	1	R.KLFEAEEQDLFK.D
*	TK010303_lung_E18_mito_3_step12.2120.2120.2	2.7104	0.3835	2288.33	1	3500.0%	2	K.VKLEGHELPADLPPHLIPPSK.R
UVINC_MOUSE96.1%8813.5%10651166745.9(Q64727) Vinculin (Metavinculin)
	TK010303_lung_E18_mito_3_step07.1950.1950.1	1.1172	0.0237	1118.57	1	6250.0%	1	R.QDLLAKCDR.V
	TK010303_lung_E18_mito_3_step09.1940.1940.2	1.0854	7.0E-4	1895.75	51	2350.0%	1	K.AASDELSKTISPMVMDAK.A
	TK010303_lung_E18_mito_3_step05.4465.4465.2	1.3027	0.0714	2702.51	44	1590.0%	1	K.VREAFQPQEPDFPPPPPDLEQLR.L
*	TK010303_lung_E18_mito_3_step12.2545.2545.3	2.1635	0.1171	3872.45	71	1060.0%	1	-.PVFHTRTIESILEPEAQQISHLVIMHEEGEVDGK.A
	TK010303_lung_E18_mito_3_step01.2828.2828.1	2.1874	0.2657	1214.91	1	6000.0%	1	K.ELLPVLISAMK.I
*	TK010303_lung_E18_mito_3_step11.2471.2471.2	1.2509	0.0555	2401.84	9	2270.0%	1	K.TISPMVMDAKAVAGNISDPDLQK.S
	TK010303_lung_E18_mito_3_step12.3385.3385.3	1.7959	0.0080	4031.4	129	1000.0%	1	R.LTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQK.A
	TK010303_lung_E18_mito_3_step01.0588.0588.1	1.3537	0.0103	1022.58	21	5710.0%	1	K.DEEFPEQK.A
UQ9ERN696.1%12165.1%49675649086.1(Q9ERN6) Cardiac Ca2+ release channel
*	TK010303_lung_E18_mito_3_step01.3624.3624.3	2.0068	0.1327	4611.75	2	1280.0%	2	R.SNCYMVCAGESMSPGQGRNNSNGLEIGCVVDAASGLLTFIANGK.E
	TK010303_lung_E18_mito_3_step06.2958.2958.2	0.8612	0.029	2396.37	1	2890.0%	1	K.GYPDIGWNPVEGERYLDFLR.F
	TK010303_lung_E18_mito_3_step10.2273.2273.3	1.6963	0.1794	3469.05	7	1500.0%	1	K.LIPHNPNAGLSDLMTNPVPVPEVQEKFQEQK.A
	TK010303_lung_E18_mito_3_step04.3913.3913.2	1.5749	0.0584	2732.63	7	2080.0%	1	R.ISLFGNDATSIVNCLHILGQTLDAR.T
*	TK010303_lung_E18_mito_3_step08.3282.3282.2	1.2641	0.1553	2558.69	2	2270.0%	1	K.NHRLYFLSAASRPLCTGGHASNK.E
	TK010303_lung_E18_mito_3_step07.3486.3486.2	1.4327	0.0799	2321.73	4	2500.0%	2	R.ALQEMLANTVEKSEGQVDVEK.W
	TK010303_lung_E18_mito_3_step10.3438.3438.3	3.2372	0.1649	3006.02	4	1940.0%	1	R.ALGMHETVMEVMVNVLGGGESKEITFPK.M
	TK010303_lung_E18_mito_3_step07.2650.2650.3	1.6193	0.0054	3603.53	89	1210.0%	1	K.NVPPDLSICTFVLEQSLSVRALQEMLANTVEK.S
	TK010303_lung_E18_mito_3_step03.2588.2588.2	1.7783	0.1008	2090.4	13	3440.0%	1	K.EFRSPPQEQINMLLNFK.D
	TK010303_lung_E18_mito_3_step09.4356.4356.2	1.4519	0.0044	3008.47	1	2500.0%	1	K.QMVDMLVESSNNVEMILKFFDMFLK.L
UQ9DBA296.1%1126.1%153157934.8(Q9DBA2) 1500000I11Rik protein
	TK010303_lung_E18_mito_3_step12.4259.4259.3	2.8981	0.3871	4172.59	1	1730.0%	1	K.QVDVPTLTGAFGILASHVPTLQVLRPGLVVVHTEDGTTTK.Y
UQ8R4Y796.0%71114.3%835931787.1(Q8R4Y7) Prominin-related protein
*	TK010303_lung_E18_mito_3_step11.1151.1151.1	1.2521	0.035	1194.6	78	3890.0%	2	K.KNISIVQAYR.Q
*	TK010303_lung_E18_mito_3_step07.2876.2876.2	1.3666	0.1011	2115.45	9	2630.0%	1	R.ELAPLVRASGPLNSLYGTVR.R
*	TK010303_lung_E18_mito_3_step06.2657.2657.3	2.5019	0.3866	4210.86	1	1640.0%	1	K.TDEVVRYEAGYVVCAVIAGLYLLLVPITGLCFCCCR.C
*	TK010303_lung_E18_mito_3_step12.1204.1204.1	1.2993	0.0184	1392.46	37	4090.0%	1	K.GELPVQINHILR.N
*	TK010303_lung_E18_mito_3_step03.3175.3175.3	2.8722	0.3922	4613.6	1	1500.0%	2	R.WILGCVLCSAILLVVICNLLGLSLGIWGLFAREDPSHSETK.G
UTARA_MOUSE95.9%112.7%561647626.4(Q99KW3) Protein Tara (Trio-associated repeat on actin) (Fragment)
*	TK010303_lung_E18_mito_3_step06.1897.1897.2	2.5271	0.3939	1845.4	1	5710.0%	1	R.HNQELHSHLSEEIDR.L
UATPF_MOUSE95.8%113.5%256289499.1(Q9CQQ7) ATP synthase B chain, mitochondrial precursor (EC 3.6.3.14)
	TK010303_lung_E18_mito_3_step11.2028.2028.1	2.1121	0.2659	1235.72	1	6250.0%	1	K.RHYLFDVQR.N
UO9483695.8%337.4%10961229409.1(O94836) Hypothetical protein KIAA0731 (Fragment)
*	TK010303_lung_E18_mito_3_step09.1974.1974.1	2.0908	0.2874	1236.59	1	6110.0%	1	K.FQHPSHELLK.E
*	TK010303_lung_E18_mito_3_step06.4127.4127.3	1.2693	0.0347	3278.13	2	1520.0%	1	R.RPGLQSGGPSSPPAPLVGLGFTAAASNWEGAAPR.V
*	TK010303_lung_E18_mito_3_step02.3233.3233.3	1.8755	0.129	4032.8	177	970.0%	1	K.GSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVK.S
UCA39_HUMAN95.8%4611.0%684636167.7(Q14050) Collagen alpha 3(IX) chain precursor
*	TK010303_lung_E18_mito_3_step11.1728.1728.1	1.2892	0.1196	1577.6	23	2190.0%	1	R.GPIGFRGPPGIPGAPGK.A
*	TK010303_lung_E18_mito_3_step04.4327.4327.3	2.9791	0.361	4373.82	1	1470.0%	2	K.GTQGPNGTSGVQGVPGPPGPLGLQGVPGVPGITGKPGVPGKEASEQR.I
*	TK010303_lung_E18_mito_3_step11.1136.1136.1	0.8251	0.0578	1037.54	6	4000.0%	1	K.GPNGLPGLPGR.A
UQ9D1C395.7%1118.8%112125068.4(Q9D1C3) 2610022G08Rik protein
*	TK010303_lung_E18_mito_3_step12.3208.3208.2	2.4592	0.4053	2436.33	1	3500.0%	1	R.AEQPHTFHPALLQFLVCPLSK.K
UQ9NPL895.7%2410.9%285321938.2(Q9NPL8) C3orf1 hypothetical protein
	TK010303_lung_E18_mito_3_step10.3277.3277.3	3.0266	0.0608	3007.15	25	1830.0%	2	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
UQ8R3B495.7%687.5%10851249667.0(Q8R3B4) Similar to dysferlin (Fragment)
	TK010303_lung_E18_mito_3_step09.1764.1764.1	1.8609	0.2897	1401.48	2	5450.0%	2	K.ILHQHLGAPEER.L
*	TK010303_lung_E18_mito_3_step06.4287.4287.2	1.2819	0.0217	2005.51	1	2940.0%	1	R.SICSPLVKLNSETDITPK.L
*	TK010303_lung_E18_mito_3_step10.2429.2429.2	1.1093	0.063	2270.29	1	2630.0%	1	K.DVILDEKSITGEDMSDIYVK.G
	TK010303_lung_E18_mito_3_step08.4466.4466.3	1.5343	0.1676	3496.93	30	1500.0%	1	R.APNLYMVPQGIRPVVQLTAIEILAWGLRNMK.N
UPDX4_MOUSE95.7%3317.5%274310537.2(O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372)
	TK010303_lung_E18_mito_3_step02.1605.1605.1	1.2071	0.1298	1292.77	12	3180.0%	1	R.VSVADHSLHLSK.A
	TK010303_lung_E18_mito_3_step02.2161.2161.2	2.2904	0.334	2404.18	1	3640.0%	1	K.HGEVCPAGWKPGSETIIPDPAGK.L
*	TK010303_lung_E18_mito_3_step01.2006.2006.1	1.7852	0.2896	1481.28	2	4580.0%	1	R.IPLLSDLNHQISK.D
UZ334_HUMAN95.6%111.3%680796499.2(Q9HCZ1) Zinc finger protein 334
*	TK010303_lung_E18_mito_3_step01.2339.2339.1	2.3812	0.2544	949.73	9	6250.0%	1	K.CNPGGNSLK.T
UER29_MOUSE95.6%112938.2%262288236.1(P57759) Endoplasmic reticulum protein ERp29 precursor
*	TK010303_lung_E18_mito_3_step05.3498.3498.2	1.4576	0.1562	2655.95	2	2290.0%	4	K.RLAENSASSEELLVAEVGISDYGDK.L
*	TK010303_lung_E18_mito_3_step09.3544.3544.3	2.0989	0.0973	3442.89	2	2020.0%	1	R.LAENSASSEELLVAEVGISDYGDKLNMELSEK.Y
	TK010303_lung_E18_mito_3_step01.2451.2451.1	1.2231	0.1665	1036.81	2	6250.0%	1	K.SLNILTAFR.K
	TK010303_lung_E18_mito_3_step01.1968.1968.1	2.081	0.2874	1325.67	1	5450.0%	1	K.GALPLDTVTFYK.V
	TK010303_lung_E18_mito_3_step03.1932.1932.1	1.983	0.2521	1025.54	1	7140.0%	3	K.KWASQYLK.I
*	TK010303_lung_E18_mito_3_step01.3511.3511.3	1.8588	0.055	3600.54	111	1150.0%	1	-.MAAAAGVSGAASLSPLLSVLLGLLLLFAPHGGSGLHTK.G
UQ9H6M495.6%4108.9%674752939.5(Q9H6M4) Hypothetical protein FLJ22098 (Fragment)
*	TK010303_lung_E18_mito_3_step02.3368.3368.3	2.1378	0.1271	4226.21	9	1250.0%	1	K.VEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSPTVKGK.L
	TK010303_lung_E18_mito_3_step02.3694.3694.2	2.7106	0.3669	2066.48	1	3750.0%	3	K.IATAAKVVNANQNASPNVPGK.R
UQ9BWL495.5%116.3%505552447.2(Q9BWL4) Hypothetical protein
*	TK010303_lung_E18_mito_3_step11.4045.4045.3	3.1591	0.2509	3651.18	4	1690.0%	1	K.VFNTTPDDFDLHVIYDVSHNIAKVEQHVVDGK.E
UGTP1_MOUSE95.5%119.6%209234067.8(P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi)
	TK010303_lung_E18_mito_3_step12.2403.2403.2	2.8912	0.229	2135.9	2	4740.0%	1	K.ALPGHLKPFETLLSQNQGGK.A
UAAC4_MOUSE95.5%7913.5%9121049775.4(P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein)
	TK010303_lung_E18_mito_3_step07.2173.2173.2	1.5361	0.0252	1291.36	62	3640.0%	1	K.SFSTALYGESDL.-
*	TK010303_lung_E18_mito_3_step05.4388.4388.3	1.764	0.0338	4272.26	4	1190.0%	1	-.MVDYHAANQAYQYGPNSGGGNGAGGGGSMGDYMAQEDDWDR.D
	TK010303_lung_E18_mito_3_step08.3572.3572.3	1.9976	0.1807	4517.0	1	1450.0%	1	K.HEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR.C
	TK010303_lung_E18_mito_3_step06.3647.3647.2	1.3163	0.0452	2504.34	10	2000.0%	1	R.ISIEMNGTLEDQLSHLKQYER.S
	TK010303_lung_E18_mito_3_step07.1866.1866.2	2.8778	0.1971	1301.19	1	7220.0%	2	R.HRPELIEYDK.L
UDD17_HUMAN95.5%449.8%650723728.6(Q92841) Probable RNA-dependent helicase p72 (DEAD-box protein p72) (DEAD-box protein 17)
*	TK010303_lung_E18_mito_3_step12.2951.2951.2	2.6822	0.3682	2364.54	1	3680.0%	1	K.TLAYLLPAIVHINHQPYLER.G
*	TK010303_lung_E18_mito_3_step01.4139.4139.1	1.1025	0.1035	1542.08	208	2500.0%	1	R.RDGWPAMCIHGDK.S
*	TK010303_lung_E18_mito_3_step01.2356.2356.1	1.3809	0.0653	1354.83	1	5500.0%	1	R.CTYLVLDEADR.M
*	TK010303_lung_E18_mito_3_step01.3051.3051.2	1.1918	0.0019	2318.08	2	2370.0%	1	K.VLEEANQAINPKLMQLVDHR.G
UEF1B_MOUSE95.5%3518.3%224245774.6(O70251) Elongation factor 1-beta (EF-1-beta)
	TK010303_lung_E18_mito_3_step10.3758.3758.2	2.2958	0.4143	3167.4	1	2410.0%	1	K.VGTDMLEEQITAFEDYVQSMDVAAFNKI.-
	TK010303_lung_E18_mito_3_step01.2187.2187.1	1.4056	0.022	1349.8	7	3750.0%	2	R.SIQADGLVWGSSK.L
UQ9QWR895.4%3510.8%415471226.3(Q9QWR8) Alpha-N-acetylgalactosaminidase (EC 3.2.1.49)
	TK010303_lung_E18_mito_3_step07.3316.3316.3	1.5988	0.0102	3665.99	9	1250.0%	1	R.HQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESR.A
	TK010303_lung_E18_mito_3_step02.2500.2500.1	2.0618	0.2051	1522.86	2	4550.0%	2	R.FHCSLLELNYPK.G
UODO1_MOUSE95.3%106623.1%130151779.0(Q60597) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) (Fragment)
	TK010303_lung_E18_mito_3_step01.1951.1951.1	1.0159	0.0324	887.7	33	5830.0%	1	R.QILLPFR.K
	TK010303_lung_E18_mito_3_step04.2247.2247.1	2.0058	0.1169	1044.61	2	6250.0%	8	R.KPLIVFTPK.S
	TK010303_lung_E18_mito_3_step01.0803.0803.1	1.324	0.2107	1472.64	11	3080.0%	1	R.VIPENGPAAQDPHK.V
UFAAH_MOUSE95.3%116.4%579632217.9(O08914) Fatty-acid amide hydrolase (EC 3.1.-.-) (Oleamide hydrolase) (Anandamide amidohydrolase)
*	TK010303_lung_E18_mito_3_step12.2943.2943.3	2.8528	0.3775	4181.21	1	1530.0%	1	K.LQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSK.S
UA2MG_MOUSE95.2%669.8%14951658276.7(Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M)
*	TK010303_lung_E18_mito_3_step03.4431.4431.2	1.2486	0.054	2493.93	14	1960.0%	1	K.EEGTGIELTGIGSCEIANALSKLK.F
*	TK010303_lung_E18_mito_3_step12.1869.1869.3	1.7313	0.0139	3168.49	1	1900.0%	1	K.GGVDDEVTLSAYITIALLEMPLPVTHSAVR.N
*	TK010303_lung_E18_mito_3_step07.3274.3274.2	2.5677	0.3922	2602.67	1	2610.0%	1	K.HSLGDNDAHSIFQSVGINIFTNSK.I
*	TK010303_lung_E18_mito_3_step03.2888.2888.2	1.432	0.1466	2348.09	12	2250.0%	1	K.VNTNYRPGLPFSGQVLLVDEK.G
*	TK010303_lung_E18_mito_3_step04.2567.2567.2	1.29	0.0349	2558.39	4	2140.0%	1	R.STCHNQNSMSICAEFSQQADDK.G
*	TK010303_lung_E18_mito_3_step10.2917.2917.3	1.9044	0.1353	2907.69	4	1670.0%	1	R.VVSVDISFRPLNETFPVVYIETPKR.N
UGS27_MOUSE95.2%2215.6%212246827.7(O35166) 27 kDa Golgi SNARE protein (Golgi SNAP receptor complex member 2) (Membrin)
*	TK010303_lung_E18_mito_3_step12.3619.3619.2	2.738	0.3484	2706.77	1	2950.0%	1	K.QSVHLVENEIQASIEQIFSHLER.L
*	TK010303_lung_E18_mito_3_step11.1776.1776.1	1.6473	0.0789	1252.64	1	5560.0%	1	-.MEPLYQQTNK.Q
URL35_HUMAN95.2%598.2%1221442011.0(P42766) 60S ribosomal protein L35
*	TK010303_lung_E18_mito_3_step12.1353.1353.1	2.3719	0.0917	1259.63	3	6110.0%	2	K.KYKPLDLRPK.K
*	TK010303_lung_E18_mito_3_step06.1881.1881.1	1.3936	0.0606	1131.51	15	5620.0%	2	K.YKPLDLRPK.K
UATPG_MOUSE95.0%82018.1%298328869.0(Q91VR2) ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14)
*	TK010303_lung_E18_mito_3_step02.1837.1837.1	1.5891	0.1889	1098.53	1	5560.0%	3	K.HLIIGVSSDR.G
*	TK010303_lung_E18_mito_3_step02.2228.2228.1	1.8592	0.2747	1310.69	1	5500.0%	3	R.THSDQFLVSFK.D
*	TK010303_lung_E18_mito_3_step01.0102.0102.1	1.5451	0.1248	1199.52	1	5000.0%	1	R.GLCGAIHSSVAK.Q
*	TK010303_lung_E18_mito_3_step08.3856.3856.2	1.2875	0.014	2087.99	6	2500.0%	1	K.NEVAALTAAGKEVMIVGVGEK.I
U4F2_MOUSE95.0%6822.2%526583375.9(P10852) 4F2 cell-surface antigen heavy chain (4F2hc)
*	TK010303_lung_E18_mito_3_step01.2518.2518.1	1.6091	0.0024	1193.45	21	4440.0%	1	K.SHLEYLSTLK.V
*	TK010303_lung_E18_mito_3_step03.4493.4493.3	1.8818	0.1847	4411.84	7	990.0%	1	K.APLMPWNESSIFHIPRPVSLNMTVKGQNEDPGSLLTQFR.R
*	TK010303_lung_E18_mito_3_step09.3252.3252.2	1.2062	0.0883	2481.33	246	1250.0%	1	-.MSQDTEVDMKDVELNELEPEK.Q
*	TK010303_lung_E18_mito_3_step04.3443.3443.2	2.4665	0.3971	2363.54	1	3750.0%	2	R.SLLHGDFHALSSSPDLFSYIR.H
*	TK010303_lung_E18_mito_3_step12.2616.2616.2	1.3615	0.0496	2525.33	42	1600.0%	1	R.LGASNLPAGISLPASAKLLLSTDSAR.Q
UQ922S195.0%91322.4%508576458.0(Q922S1) Similar to phenylalanine-tRNA synthetase-like
	TK010303_lung_E18_mito_3_step08.3474.3474.3	1.7998	0.0985	4390.47	25	1190.0%	2	R.LEVADGGLDSAELATQLGVEHQAVVGAVKSLQALGEVIEAELR.S
	TK010303_lung_E18_mito_3_step06.3953.3953.2	1.8096	0.1701	3035.89	9	1550.0%	1	R.RLEVADGGLDSAELATQLGVEHQAVVGAVK.S
	TK010303_lung_E18_mito_3_step10.3073.3073.3	1.8294	0.019	2964.61	65	1700.0%	1	R.DRPFKPYNFSARGVLPDSGHLHPLLK.V
	TK010303_lung_E18_mito_3_step06.2162.2162.1	1.0159	0.0866	1190.58	19	4440.0%	1	R.EGSHEARVFR.S
	TK010303_lung_E18_mito_3_step04.2030.2030.3	1.6256	0.1705	2038.68	3	2640.0%	1	R.SIPLEGLVQSELMHLPSGK.V
	TK010303_lung_E18_mito_3_step12.2239.2239.2	1.7599	0.0335	1746.87	1	4290.0%	1	R.DPAEALQLPMDYVQR.V
	TK010303_lung_E18_mito_3_step07.2470.2470.1	1.917	0.2714	1483.65	1	4620.0%	2	R.GVLPDSGHLHPLLK.V
UO6046694.9%337.0%860971776.6(O60466) TGF beta receptor associated protein-1
*	TK010303_lung_E18_mito_3_step11.3479.3479.3	1.5389	0.1141	4477.91	8	1250.0%	1	R.ELISLYPFLLPTSSSFTRSHPPLHEYADLNQLTQGDQEK.M
*	TK010303_lung_E18_mito_3_step08.1829.1829.1	1.7518	0.278	1218.6	1	5500.0%	1	R.RTMQVALGLAR.S
*	TK010303_lung_E18_mito_3_step05.4245.4245.2	0.9525	0.0923	2287.77	16	2370.0%	1	R.TMQVALGLARSENLIYTYDK.M
UQ9CPT494.9%3530.7%166179826.8(Q9CPT4) DNA segment, Chr 17, Wayne state University 104, expressed (Stromal cell-derived growth factor SF20/IL25)
*	TK010303_lung_E18_mito_3_step02.4326.4326.3	1.4934	0.0147	4673.86	164	770.0%	1	K.FTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGK.S
*	TK010303_lung_E18_mito_3_step11.1087.1087.1	1.7026	0.2843	1173.57	1	7000.0%	2	K.TAVSHRPGAFK.A
UQ6112394.9%468.2%754868235.6(Q61123) MEM3
	TK010303_lung_E18_mito_3_step01.3743.3743.3	1.5611	0.0382	4460.0	55	1030.0%	1	R.LFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSK.A
	TK010303_lung_E18_mito_3_step12.1347.1347.1	2.0763	0.188	1305.68	1	6670.0%	2	K.HFHNTLEHLR.T
	TK010303_lung_E18_mito_3_step05.2156.2156.1	1.4079	0.0058	1394.7	7	3640.0%	1	R.GVQHPLRGLFLR.N
USYD_MOUSE94.9%227.0%501571176.5(Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS)
*	TK010303_lung_E18_mito_3_step09.2323.2323.2	1.0333	0.0223	3083.87	19	1460.0%	1	K.YDTDFYVLDKYPLAVRPFYTMPDPR.N
	TK010303_lung_E18_mito_3_step06.1713.1713.1	1.8245	0.272	1132.51	1	6110.0%	1	R.ALHHGIDLEK.I
UQ9CQN794.9%117.4%135152629.8(Q9CQN7) 2810443J12Rik protein
	TK010303_lung_E18_mito_3_step11.0996.0996.1	1.7869	0.2846	1157.87	1	6110.0%	1	K.YGFEPTQEGK.L
UQ9CQC794.9%229.3%129150819.9(Q9CQC7) 0610006N12Rik protein
*	TK010303_lung_E18_mito_3_step07.2037.2037.1	1.7556	0.2885	1406.73	3	4550.0%	1	K.RVSHIEDPALIR.W
UQ99LR194.9%2412.8%179208807.6(Q99LR1) Hypothetical 20.9 kDa protein
*	TK010303_lung_E18_mito_3_step12.3057.3057.2	2.4594	0.3972	2637.75	3	2500.0%	2	K.HISCPLLILHAEDDPVVPFHLGR.K
UQ9QYF194.9%3312.7%355396709.0(Q9QYF1) M42C60 protein
	TK010303_lung_E18_mito_3_step11.2077.2077.1	2.1505	0.234	1404.76	1	5000.0%	1	R.IVNLSSLGHHLGR.I
*	TK010303_lung_E18_mito_3_step12.3304.3304.2	1.4715	0.0562	2694.14	39	1670.0%	1	R.LWDVSCDLLASQWIGKWWFGPK.R
	TK010303_lung_E18_mito_3_step11.1336.1336.1	1.7089	0.0024	1222.61	1	6670.0%	1	R.IHFHNLQGEK.F
UR37A_HUMAN94.9%3913.2%911014410.4(P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a
	TK010303_lung_E18_mito_3_step02.1846.1846.1	1.9353	0.193	1405.55	1	4550.0%	3	R.AVGIWHCGSCMK.T
UM2B1_MOUSE94.7%7155.2%10131146048.1(O09159) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24) (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1)
	TK010303_lung_E18_mito_3_step10.2297.2297.2	2.4949	0.2975	1422.27	1	7270.0%	3	R.VAWHIDPFGHSR.E
*	TK010303_lung_E18_mito_3_step02.3734.3734.3	2.2949	0.2869	3456.07	1	1830.0%	1	R.AAGYKTCPPTKPGMLNVHLLPHTHDDVGWLK.T
*	TK010303_lung_E18_mito_3_step01.2370.2370.1	1.2985	0.0275	1157.63	9	5000.0%	1	K.LASSQKGFYR.T
URM56_MOUSE94.7%3310.5%551607068.9(Q9EP89) Mitochondrial 39S ribosomal protein L56 (MRP-L56) (Serine beta lactamase-like protein LACTB)
*	TK010303_lung_E18_mito_3_step01.2152.2152.1	1.563	0.276	1486.73	2	4550.0%	1	K.KNDFEQGELYLK.E
*	TK010303_lung_E18_mito_3_step09.3308.3308.2	2.5662	0.3768	3163.81	1	3170.0%	1	R.HYASHTGGAVGASSVLLVLPEELDSEAVNNK.V
	TK010303_lung_E18_mito_3_step01.3359.3359.1	1.4805	0.1392	1521.87	1	4640.0%	1	K.WAGGGFLSTVGDLLK.F
UE4L1_MOUSE94.5%4411.0%879983155.7(Q9Z2H5) Band 4.1-like protein 1 (Neuronal protein 4.1) (4.1N)
*	TK010303_lung_E18_mito_3_step06.2466.2466.3	1.6876	0.0145	4485.05	36	1060.0%	1	K.CSSITVSSTSSLEAEVDFTVIGDYHGGAFEDFSRSLPELDR.D
	TK010303_lung_E18_mito_3_step04.2085.2085.1	1.9826	0.261	1371.54	1	4550.0%	1	K.LSMYGVDLHHAK.D
	TK010303_lung_E18_mito_3_step06.0253.0253.1	0.6533	0.0645	416.38	1	6670.0%	1	R.AGLR.E
*	TK010303_lung_E18_mito_3_step02.3241.3241.3	1.6348	0.0328	4263.55	176	830.0%	1	R.VSAADSTQVDGGTPMVKDFMTTPPCITTETISTTMENSLK.S
UG3P1_HUMAN94.5%2211.1%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12)
*	TK010303_lung_E18_mito_3_step01.0127.0127.1	1.9819	0.2644	1369.36	1	5000.0%	1	R.GAAQNLIPASTGAAK.A
*	TK010303_lung_E18_mito_3_step10.2213.2213.2	1.4435	0.0132	2386.75	3	2380.0%	1	K.RIVISAPSADAPMFVMGVNHFK.Y
UNTF2_HUMAN94.5%3921.3%127144785.4(P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15)
	TK010303_lung_E18_mito_3_step10.2942.2942.2	2.5945	0.363	3004.9	2	2120.0%	3	K.IQHSITAQDHQPTPDSCIISMVVGQLK.A
UM2B1_HUMAN94.5%6616.9%10101136737.3(O00754) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24) (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1)
*	TK010303_lung_E18_mito_3_step06.2783.2783.3	1.9256	0.1744	4414.07	2	1400.0%	1	R.TVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPR.W
*	TK010303_lung_E18_mito_3_step11.2369.2369.2	1.2608	0.1225	2866.33	65	1600.0%	1	K.NDIQHAGVQYILDSVISALLADPTRR.F
*	TK010303_lung_E18_mito_3_step05.2846.2846.3	1.9835	0.2062	4137.21	1	1710.0%	1	R.QTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSR.W
*	TK010303_lung_E18_mito_3_step05.4209.4209.2	1.1314	0.1316	1437.3	16	4550.0%	1	R.FQVIVYNPLGRK.V
*	TK010303_lung_E18_mito_3_step03.2712.2712.2	2.1936	0.4152	2387.36	1	3420.0%	1	K.TPLVQEVHQNFSAWCSQVVR.L
*	TK010303_lung_E18_mito_3_step12.1825.1825.3	2.2053	0.0713	3798.6	16	1400.0%	1	R.GCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGAR.A
UTHIO_MOUSE94.5%51147.1%104115444.9(P10639) Thioredoxin (ATL-derived factor) (ADF)
*	TK010303_lung_E18_mito_3_step01.2718.2718.1	1.366	0.0446	1323.82	1	4580.0%	1	K.EAFQEALAAAGDK.L
*	TK010303_lung_E18_mito_3_step11.2332.2332.1	1.7779	0.1885	1524.66	1	5450.0%	1	K.MIKPFFHSLCDK.Y
*	TK010303_lung_E18_mito_3_step09.3975.3975.2	1.7796	0.1917	2793.88	1	2390.0%	3	K.YSNVVFLEVDVDDCQDVAADCEVK.C
ULCB1_MOUSE94.4%3313.3%473524916.4(O35704) Serine palmitoyltransferase 1 (EC 2.3.1.50) (Long chain base biosynthesis protein 1) (LCB 1) (Serine-palmitoyl-CoA transferase 1) (SPT 1) (SPT1)
	TK010303_lung_E18_mito_3_step12.1445.1445.2	1.4016	0.1217	2496.17	141	1670.0%	1	R.FIVVEGLYMNTGTICPLPELVK.L
*	TK010303_lung_E18_mito_3_step07.4452.4452.2	1.3468	0.1213	2068.18	223	2060.0%	1	K.ECVNFASFNFLGLLANPR.V
*	TK010303_lung_E18_mito_3_step09.2363.2363.2	2.3351	0.3943	2457.38	1	2950.0%	1	K.NHPALNYNIVSGPPTHNIVVNGK.E
UHD_HUMAN94.4%665.6%31443478596.2(P42858) Huntingtin (Huntington's disease protein) (HD protein)
*	TK010303_lung_E18_mito_3_step06.2367.2367.3	2.1145	0.0347	3231.64	10	1500.0%	1	K.GDIGQSTDDDSAPLVHCVRLLSASFLLTGGK.N
*	TK010303_lung_E18_mito_3_step03.3831.3831.3	2.5192	0.2219	4460.75	5	1280.0%	1	R.TQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLK.A
*	TK010303_lung_E18_mito_3_step08.1918.1918.3	1.4269	0.0299	2138.25	25	2220.0%	1	R.GYNLLPSITDVTMENNLSR.V
*	TK010303_lung_E18_mito_3_step02.4009.4009.2	1.4102	0.0542	3024.27	82	1430.0%	1	K.VLLGEEEALEDDSESRSDVSSSALTASVK.D
*	TK010303_lung_E18_mito_3_step01.1734.1734.1	1.6151	0.2775	1332.54	1	5500.0%	1	R.YLVPLLQQQVK.D
*	TK010303_lung_E18_mito_3_step12.3369.3369.3	1.7163	0.0217	4752.57	3	1050.0%	1	R.IPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAR.E
UQ9ERL094.4%227.1%547607868.7(Q9ERL0) Btk-PH-domain binding protein
*	TK010303_lung_E18_mito_3_step02.2177.2177.3	1.8589	0.0295	4446.29	4	1350.0%	1	R.ERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDESTVR.K
*	TK010303_lung_E18_mito_3_step02.3621.3621.3	2.8193	0.4092	4283.75	1	1740.0%	1	R.NVLQQIVNLIEETGHFNVTNTTFDFDLFSLDESTVRK.L
UQ8VHB594.4%116.4%437472814.8(Q8VHB5) Carbonic anhydrase 9
	TK010303_lung_E18_mito_3_step09.2462.2462.3	2.82	0.4072	3117.26	4	1850.0%	1	R.YEGSLTTPPCSQGVIWTVFNETVKLSAK.Q
UQ96MI194.4%337.4%740856907.7(Q96MI1) Hypothetical protein FLJ32343
*	TK010303_lung_E18_mito_3_step08.2473.2473.3	2.0972	0.2001	2555.57	3	2380.0%	1	K.HSNQKPSETSTDEHQHVPEDPR.E
*	TK010303_lung_E18_mito_3_step10.2069.2069.2	1.3114	0.1341	1877.58	26	2330.0%	1	R.YGSMEIFQSKLEDAEK.A
*	TK010303_lung_E18_mito_3_step11.1911.1911.2	2.801	0.2665	2067.2	1	3750.0%	1	R.VRYFHDDDNLSLNDLVK.N
UTHTR_MOUSE94.3%4611.1%296333357.9(P52196) Thiosulfate sulfurtransferase (EC 2.8.1.1) (Rhodanese)
	TK010303_lung_E18_mito_3_step01.1456.1456.1	1.2773	0.0191	1353.75	8	3640.0%	1	R.VLDASWYSPGTR.Q
	TK010303_lung_E18_mito_3_step04.1853.1853.1	1.676	0.2517	1022.43	1	5710.0%	2	K.RFQLVDSR.A
	TK010303_lung_E18_mito_3_step02.1920.1920.1	1.933	0.2641	1500.64	1	5420.0%	1	K.KVDLSQPLIATCR.K
UQ9P2K294.3%339.7%806914075.2(Q9P2K2) Hypothetical protein KIAA1344 (Fragment)
*	TK010303_lung_E18_mito_3_step08.1544.1544.3	2.0396	0.1277	2074.39	8	2780.0%	1	K.DLILYSSVSVLGLFSPTMK.T
*	TK010303_lung_E18_mito_3_step12.2624.2624.2	1.5904	0.0024	2374.7	7	2370.0%	1	R.TLMEQPLTTLNIHLFIKTMK.A
*	TK010303_lung_E18_mito_3_step12.2883.2883.3	2.8172	0.3901	4641.98	1	1520.0%	1	K.TMKAPLLTEVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADR.R
UCTA2_HUMAN94.3%447.7%13311481676.6(Q9UHC6) Contactin associated protein-like 2 precursor (Cell recognition molecule Caspr2)
*	TK010303_lung_E18_mito_3_step12.1392.1392.2	0.9919	0.0154	2186.64	66	2220.0%	1	K.GCMESINYNGVNITDLARR.K
*	TK010303_lung_E18_mito_3_step10.4135.4135.2	1.2664	0.0114	3089.09	5	1550.0%	1	K.CDEPLVSGLPHVAFSSSSSISGSYSPGYAK.I
*	TK010303_lung_E18_mito_3_step03.2739.2739.2	1.2894	0.0221	2639.2	67	1740.0%	1	R.GGAGGWSPSDSDHYQWLQVDFGNR.K
*	TK010303_lung_E18_mito_3_step10.2427.2427.3	2.8075	0.4068	3225.32	1	1880.0%	1	K.APCILLYISSFTTDFLAVLVKPTGSLQIR.Y
UTCPG_MOUSE94.3%4411.4%545606306.7(P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin)
	TK010303_lung_E18_mito_3_step01.1546.1546.1	1.3881	0.091	1166.75	9	4500.0%	1	R.AVAQALEVIPR.T
	TK010303_lung_E18_mito_3_step01.1708.1708.1	1.4511	0.1856	1431.27	1	4170.0%	1	K.IPGGIIEDSCVLR.G
*	TK010303_lung_E18_mito_3_step11.3693.3693.3	3.129	0.2465	3430.03	1	2040.0%	1	R.ILQMEEEYIHQLCEDIIQLKPDVVITEK.G
	TK010303_lung_E18_mito_3_step01.0787.0787.1	1.7999	0.2314	1121.57	1	6110.0%	1	R.EIQVQHPAAK.S
UO9515394.3%444.1%18572001485.1(O95153) Peripheral benzodiazepine receptor interacting protein
*	TK010303_lung_E18_mito_3_step01.2120.2120.1	2.103	0.2336	1464.7	1	4620.0%	1	R.DLSETASALLAKDK.Q
	TK010303_lung_E18_mito_3_step12.2091.2091.3	2.006	0.122	4094.74	6	1470.0%	1	R.ENGAKSQPDPFCETDSDEEILEQILELPLQQFCSK.K
	TK010303_lung_E18_mito_3_step05.2365.2365.2	1.4235	0.0514	2392.34	23	1900.0%	1	R.AEKEDTAELGVHLVNSLVDHGR.N
	TK010303_lung_E18_mito_3_step01.1231.1231.1	0.9951	0.0141	728.49	56	5000.0%	1	R.RLVVLK.Q
URS16_MOUSE94.3%246.9%1441622510.2(P14131) 40S ribosomal protein S16
	TK010303_lung_E18_mito_3_step01.2530.2530.1	1.6442	0.2608	1097.36	2	5560.0%	2	K.LLEPVLLLGK.E
UGSN2_MOUSE94.3%229.1%308360909.6(Q9CY27) Synaptic glycoprotein SC2
	TK010303_lung_E18_mito_3_step09.3827.3827.2	1.0736	0.1438	2170.07	1	3060.0%	1	K.DEDVLQKLPVGTTATLYFR.D
	TK010303_lung_E18_mito_3_step07.1850.1850.1	2.2978	0.1301	1206.84	1	6880.0%	1	-.MKHYEVEIR.D
UCA64_HUMAN94.3%101016.6%16781624619.2(Q14031) Collagen alpha 6(IV) chain precursor
	TK010303_lung_E18_mito_3_step01.4258.4258.3	2.1624	0.2127	3804.17	1	1440.0%	1	K.GFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPK.G
	TK010303_lung_E18_mito_3_step02.4082.4082.3	1.8829	0.1612	4795.27	1	1250.0%	1	R.SLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGAR.G
	TK010303_lung_E18_mito_3_step05.2452.2452.3	1.7567	0.0413	3624.06	24	1220.0%	1	K.GATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLK.G
	TK010303_lung_E18_mito_3_step12.2691.2691.3	2.0428	0.0072	2882.5	8	1720.0%	1	R.GRPGPIGIQGPTGPQGFTGSTGLSGLKGER.G
	TK010303_lung_E18_mito_3_step11.0975.0975.3	1.0889	0.0233	1550.31	9	2790.0%	1	K.GSPGSPGVAGLPALSGPK.G
	TK010303_lung_E18_mito_3_step10.3141.3141.2	1.3565	0.0637	2270.38	41	1740.0%	1	K.GSVGFVGFPGIPGLPGISGTRGLK.G
	TK010303_lung_E18_mito_3_step05.4000.4000.2	1.203	0.0422	2568.73	10	1880.0%	1	R.DGLPGPPGPPGPPSPEFETETLHNK.E
	TK010303_lung_E18_mito_3_step01.2390.2390.1	2.0246	0.2575	1546.33	1	4330.0%	1	K.GDNGQTVEISGSPGPK.G
	TK010303_lung_E18_mito_3_step08.4397.4397.2	1.6835	0.0287	2548.85	14	1920.0%	1	R.GLPGLKGSSGITGFPGMPGESGSQGIR.G
	TK010303_lung_E18_mito_3_step04.2622.2622.3	1.5775	0.0306	3268.45	110	1140.0%	1	K.GSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLK.G
UQ9D65094.2%51712.7%292326765.6(Q9D650) 4731402F03Rik protein
	TK010303_lung_E18_mito_3_step04.4457.4457.2	1.4362	0.024	2588.18	9	2050.0%	4	R.ITHLNYSELPTGDPSGIEKDELR.V
	TK010303_lung_E18_mito_3_step02.1930.1930.1	1.6275	0.262	1453.06	4	3460.0%	1	R.QDSLYQAGAANVGR.V
UP7027194.1%114.8%330356748.0(P70271) RIL protein
*	TK010303_lung_E18_mito_3_step09.1956.1956.2	2.1268	0.4088	1850.97	2	4330.0%	1	K.GCHDHLTLSVSRPENK.N
UPIGO_MOUSE94.1%82213.4%10931191568.8(Q9JJI6) Phosphatidylinositol-glycan biosynthesis, class O protein (PIG-O)
*	TK010303_lung_E18_mito_3_step08.3706.3706.3	1.9039	0.174	3873.0	4	1460.0%	1	K.ALTTGSLPTFIDAGSNFASHAIVEDNVIQQLNSAGRR.V
*	TK010303_lung_E18_mito_3_step02.4284.4284.3	1.8441	0.0724	3869.2	4	1500.0%	4	K.SPEPPVLFVRWGMPLMVLGTAAYWALASGAEEAPPR.L
*	TK010303_lung_E18_mito_3_step06.3842.3842.3	1.816	0.2211	4744.84	6	1050.0%	2	R.ATPFLLGSLVFFLVAQLHWEGQLLPPKPLTMSRLGSSAPTAPPR.H
	TK010303_lung_E18_mito_3_step03.4339.4339.2	1.2864	0.0052	3096.5	2	1790.0%	1	K.VFAPKFIFEAVGFIVSSVGLLLGIALVMR.V
UQ9CWH594.0%6822.8%460529058.5(Q9CWH5) 2410075D05Rik protein
*	TK010303_lung_E18_mito_3_step06.2786.2786.2	1.5676	0.021	2610.41	15	1960.0%	1	R.LPEIKSLLSVIGGQFTNSQETYGK.S
*	TK010303_lung_E18_mito_3_step03.3888.3888.3	2.1304	0.16	4345.23	2	1250.0%	1	K.ENDLVFDPFVGTGGLLIASAHFGAYVCGTDIDYNTVHGLGK.A
*	TK010303_lung_E18_mito_3_step09.3294.3294.2	2.3979	0.389	2400.24	1	4000.0%	2	K.KPQHVFSILEDYGLDPNSIPK.D
*	TK010303_lung_E18_mito_3_step06.3181.3181.2	1.5059	0.2466	2319.45	3	3060.0%	1	K.YSHLLSDHFLPYQGHNSFR.E
UQ9CZP193.9%2211.1%305337995.4(Q9CZP1) 2700038L12Rik protein
	TK010303_lung_E18_mito_3_step11.1837.1837.1	1.852	0.2595	1487.65	1	5000.0%	1	K.LLHTLEGHAMPIR.S
	TK010303_lung_E18_mito_3_step07.1710.1710.3	1.6274	0.1112	3729.91	1	1440.0%	1	K.LLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIK.I
UQ8R4Y493.9%998.9%25712762556.7(Q8R4Y4) Stabilin-1
*	TK010303_lung_E18_mito_3_step10.2885.2885.3	1.823	0.1493	3291.79	1	1820.0%	1	R.AVLGSEPPPVALSLGVVVTSGTLLGLVAGALYLR.A
*	TK010303_lung_E18_mito_3_step03.2756.2756.1	0.9857	0.0024	1348.72	4	4440.0%	1	R.RQLCPWGWSR.N
*	TK010303_lung_E18_mito_3_step10.2853.2853.3	1.3479	0.0118	3149.5	100	1160.0%	1	R.AHFLQGAFSEEELARLNGQQVATLSATTR.W
	TK010303_lung_E18_mito_3_step08.1508.1508.1	1.8392	0.26	1194.71	4	5000.0%	1	R.CLHSHAEALR.E
*	TK010303_lung_E18_mito_3_step07.3829.3829.3	1.9006	0.3172	3665.06	1	1770.0%	1	R.SNPCSRPDRGGCSENAECVPGDLGTHHCICHK.G
*	TK010303_lung_E18_mito_3_step05.2682.2682.2	1.4453	0.0283	2281.91	41	2000.0%	1	R.CDEGLGGSGSCFCDEGWTGAR.C
*	TK010303_lung_E18_mito_3_step02.4554.4554.2	1.2684	0.0731	2800.58	5	1880.0%	1	R.DPCLDGHRGGCSEHADCLNTGPNTR.R
	TK010303_lung_E18_mito_3_step04.4457.4457.3	1.9415	0.053	3881.76	5	1400.0%	1	K.IQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDR.F
*	TK010303_lung_E18_mito_3_step12.1935.1935.3	1.865	0.061	3484.39	1	1770.0%	1	R.GSGQCNCHPGFAGTACELCAPGAFGPQCQACR.C
UPNPH_MOUSE93.9%3330.4%289322776.2(P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP)
*	TK010303_lung_E18_mito_3_step12.4035.4035.3	1.5811	0.0515	4111.9	167	880.0%	1	K.VTFPVRVFHLLGVETLVVTNAAGGLNPNFEVGDIMLIR.D
	TK010303_lung_E18_mito_3_step05.3213.3213.2	0.8417	0.0593	3104.4	70	1300.0%	1	K.WLLQHTEYRPQVAVICGSGLGGLTAHLK.E
	TK010303_lung_E18_mito_3_step04.2802.2802.2	2.2396	0.3938	2440.94	1	3100.0%	1	R.KLQEGTYVMLAGPNFETVAESR.L
UAC48_MOUSE93.8%7913.7%439505608.6(Q9R0X4) 48 kDa acyl-CoA thioester hydrolase, mitochondrial precursor (EC 3.1.2.-) (p48) (Mt-ACT48) (Protein U8)
*	TK010303_lung_E18_mito_3_step07.2937.2937.1	1.6418	0.0961	1085.45	1	5620.0%	1	R.KLLHSFLPK.S
*	TK010303_lung_E18_mito_3_step07.2490.2490.3	1.8824	0.0631	3055.09	2	2100.0%	1	R.FGRILEDLDSLGVLVCYMHNHNHSTK.M
*	TK010303_lung_E18_mito_3_step12.3036.3036.2	1.7542	0.1273	2697.88	2	2500.0%	1	R.ILEDLDSLGVLVCYMHNHNHSTK.M
	TK010303_lung_E18_mito_3_step09.0003.0003.1	0.4386	0.0454	429.13	11	3330.0%	1	R.AAIR.L
*	TK010303_lung_E18_mito_3_step08.1901.1901.1	1.5415	0.2368	1330.57	1	4000.0%	2	K.ISEPLHIHQVR.D
*	TK010303_lung_E18_mito_3_step07.1553.1553.2	1.1069	0.0091	1143.43	132	3890.0%	1	R.EIVGVSTVWR.D
UQ8WVL093.6%1111.6%292335019.5(Q8WVL0) Similar to RIKEN cDNA 3300001M08 gene
	TK010303_lung_E18_mito_3_step02.4360.4360.3	2.8949	0.3583	3786.17	1	2050.0%	1	K.LTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVK.D
UTKT_MOUSE93.5%3311.9%623676317.5(P40142) Transketolase (EC 2.2.1.1) (TK) (P68)
	TK010303_lung_E18_mito_3_step07.3613.3613.3	2.8698	0.3625	3884.33	1	1860.0%	1	R.LRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMR.Y
*	TK010303_lung_E18_mito_3_step01.1739.1739.1	1.1714	0.0065	1304.77	37	3500.0%	1	K.ALDPRNPHNDR.F
*	TK010303_lung_E18_mito_3_step09.1795.1795.3	1.3512	0.0392	3092.64	124	1440.0%	1	R.CEAFGWHTIIVDGHSVEELCKAFGQAK.H
URSP4_MOUSE93.4%243.7%295327194.8(P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor)
	TK010303_lung_E18_mito_3_step04.2486.2486.1	2.2827	0.1069	1265.52	2	6000.0%	2	R.KSDGIYIINLK.R
UTMLH_MOUSE93.3%244.8%421496108.3(Q91ZE0) Trimethyllysine dioxygenase, mitochondrial precursor (EC 1.14.11.8) (Epsilon-trimethyllysine 2-oxoglutarate dioxygenase) (TML-alpha-ketoglutarate dioxygenase) (TML hydroxylase) (TML dioxygenase) (TMLD)
*	TK010303_lung_E18_mito_3_step10.4326.4326.2	1.7173	0.2054	2406.02	5	2110.0%	2	K.TVHLDETMLFFTWPDGHVTR.Y
UO4316293.3%111.7%777866557.6(O43162) Hypothetical protein KIAA0435
*	TK010303_lung_E18_mito_3_step04.2141.2141.1	1.5848	0.2665	1404.74	1	4580.0%	1	R.TGWDGGTGSWPER.G
UPLE1_MOUSE93.2%335.3%9641116628.2(Q9QXS1) Plectin 1 (PLTN) (PCN) (Fragment)
	TK010303_lung_E18_mito_3_step02.3342.3342.2	1.6635	0.0277	2035.47	198	1940.0%	1	R.DGHNLISLLEVLSGDSLPR.E
*	TK010303_lung_E18_mito_3_step11.1612.1612.1	1.5139	0.243	1226.57	1	6110.0%	1	R.HKPMLIDMNK.V
*	TK010303_lung_E18_mito_3_step02.2753.2753.2	2.6752	0.3197	2424.41	1	3330.0%	1	R.RIDSAEWGVDLPSVEAQLGSHR.G
UQ99KK993.2%227.7%505569858.3(Q99KK9) Hypothetical 57.0 kDa protein
*	TK010303_lung_E18_mito_3_step12.3181.3181.2	1.3889	0.0384	3046.59	189	1110.0%	1	K.GLAPEVADRIGDFVQYHGGISLVEDLFK.D
*	TK010303_lung_E18_mito_3_step06.1861.1861.1	2.1839	0.2109	1327.6	4	5000.0%	1	K.SHQEKPNFVIK.V
UFAAA_MOUSE93.1%229.5%419461047.4(P35505) Fumarylacetoacetase (EC 3.7.1.2) (Fumarylacetoacetate hydrolase) (Beta-diketonase) (FAA)
*	TK010303_lung_E18_mito_3_step07.2332.2332.2	1.1859	0.1784	2087.58	1	2940.0%	1	K.ENALLPNWLHLPVGYHGR.A
*	TK010303_lung_E18_mito_3_step11.3109.3109.2	2.5311	0.3612	2546.13	1	3330.0%	1	K.HQHVFDETTLNNFMGLGQAAWK.E
UQ9WUB293.1%5711.1%991094610.0(Q9WUB2) NADH-ubiquinone oxidoreductase B8 subunit
	TK010303_lung_E18_mito_3_step10.2210.2210.2	1.748	0.293	1144.76	1	7780.0%	1	K.AHPNLPILIR.E
	TK010303_lung_E18_mito_3_step12.1900.1900.1	1.9198	0.0518	1273.76	2	5000.0%	2	K.KAHPNLPILIR.E
UEPB2_HUMAN93.1%113.2%10551175076.5(P29323) Ephrin type-B receptor 2 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor EPH-3) (DRT) (Receptor protein-tyrosine kinase HEK5) (ERK)
*	TK010303_lung_E18_mito_3_step08.3294.3294.3	3.0021	0.3378	3731.31	1	1740.0%	1	K.ESFANAGFTSFDVVSQMMMEDILRLGVTLAGHQK.K
UO6031093.0%669.9%14411628366.8(O60310) Hypothetical protein KIAA0564 (Fragment)
*	TK010303_lung_E18_mito_3_step03.3961.3961.2	1.2453	0.0046	2315.8	2	2500.0%	1	K.EEPPSTGFGVTQETEFSIPHK.I
*	TK010303_lung_E18_mito_3_step08.1884.1884.2	2.6993	0.2948	2448.74	1	3480.0%	1	K.HGKEDPDNMPHVGGNTWAGGTGGR.D
*	TK010303_lung_E18_mito_3_step06.2201.2201.2	1.7325	0.2403	2230.19	1	2890.0%	1	K.NLADATIEINTDDNLEPELK.D
*	TK010303_lung_E18_mito_3_step02.2017.2017.1	1.5878	0.1138	1269.69	12	4090.0%	1	R.RIVANSANVNGR.E
*	TK010303_lung_E18_mito_3_step12.2689.2689.3	1.5232	0.1156	4616.74	321	770.0%	1	R.TMEAVCMVMEAFENYEEKFQYDIVGHSGDGYNIGLVPMNK.I
*	TK010303_lung_E18_mito_3_step11.1859.1859.3	2.0305	0.029	2929.58	19	1700.0%	1	R.SESLSPYTTWLSTISDTDALLAEWDK.S
UPSB6_MOUSE93.0%2218.1%238254255.1(Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y)
	TK010303_lung_E18_mito_3_step11.2616.2616.3	2.6587	0.2612	3311.53	1	2250.0%	1	R.EDLMAGIIIAGWDPQEGGQVYSVPMGGMMVR.Q
*	TK010303_lung_E18_mito_3_step10.1935.1935.2	2.441	0.3767	1569.19	1	6820.0%	1	K.LTPIHDHIFCCR.S
UPGDR_MOUSE93.0%111.3%10981228065.1(P05622) Beta platelet-derived growth factor receptor precursor (EC 2.7.1.112) (PDGF-R-beta)
*	TK010303_lung_E18_mito_3_step10.1974.1974.2	2.5966	0.3248	1717.44	1	4620.0%	1	K.KVDIPLHVPYDHQR.G
UPCN2_HUMAN92.9%11117.9%33213763625.6(O95613) Pericentrin 2 (Kendrin)
	TK010303_lung_E18_mito_3_step01.2992.2992.3	1.3765	0.0055	4140.94	6	1360.0%	1	K.QVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQR.G
*	TK010303_lung_E18_mito_3_step02.2866.2866.2	1.3877	0.0302	2185.37	25	2370.0%	1	R.EGANLLSMLKADVNLSHSER.G
*	TK010303_lung_E18_mito_3_step02.4070.4070.3	1.351	0.1138	3525.22	2	1520.0%	1	R.VGLCLDDAGAGLALSTAPALEETWSDVALPELDR.T
	TK010303_lung_E18_mito_3_step12.3640.3640.2	1.4634	0.0166	3034.64	303	1000.0%	1	R.GMFTISDHQPEQRGMFTVSDHTPEQR.G
*	TK010303_lung_E18_mito_3_step03.3499.3499.2	1.6329	0.0585	1903.42	2	2630.0%	1	R.LAAAASPHSGGRATPSPNSR.L
*	TK010303_lung_E18_mito_3_step11.1008.1008.2	1.299	0.0966	1919.98	10	2670.0%	1	R.EKPAWLQAELEQSHPR.L
*	TK010303_lung_E18_mito_3_step01.3259.3259.1	2.2578	0.1117	1225.99	1	7780.0%	1	K.NEEILHLNLK.L
*	TK010303_lung_E18_mito_3_step11.1300.1300.1	1.3535	0.0018	1121.55	2	6250.0%	1	K.EKLQSEMEK.N
*	TK010303_lung_E18_mito_3_step11.2952.2952.3	2.0015	0.1618	4022.16	43	1120.0%	1	K.EDSALCGGGDICKSTSCDDTPDGAGGAFAAQPEDCDGEK.R
*	TK010303_lung_E18_mito_3_step05.3478.3478.3	2.1837	0.1697	3238.97	5	1560.0%	1	R.LSPGSGGPEAQTAGPVTPASISGRFQPLPEAMK.E
*	TK010303_lung_E18_mito_3_step03.1981.1981.2	1.4003	0.0343	2091.83	7	2780.0%	1	R.KSPVGMLDLSSWSSPEVLR.K
UWDR1_MOUSE92.9%7729.9%606664076.6(O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1)
	TK010303_lung_E18_mito_3_step09.3554.3554.3	2.1118	0.1212	3505.64	24	1330.0%	1	K.IQDAHRLHHVSSLAWLDEHTLVTTSHDASVK.E
*	TK010303_lung_E18_mito_3_step04.4399.4399.3	2.0125	0.0111	2844.59	3	2290.0%	1	K.QTRPYRLATGSDDNCAAFFEGPPFK.F
	TK010303_lung_E18_mito_3_step04.2499.2499.2	1.4232	0.1721	2902.38	22	1480.0%	1	K.AHDGGIYAISWSPDSTHLLSASGDKTSK.I
*	TK010303_lung_E18_mito_3_step02.2330.2330.2	2.1695	0.4017	2418.56	1	3100.0%	1	R.NIDNPAIADIYTEHAHQVVVAK.Y
*	TK010303_lung_E18_mito_3_step12.4308.4308.3	1.1933	0.189	3513.2	2	1530.0%	1	R.NGGKSYIYSGSHDGHINYWDSETGENDSFSGK.G
*	TK010303_lung_E18_mito_3_step06.2011.2011.2	1.7517	0.2737	1901.62	1	3240.0%	1	K.YAPSGFYIASGDISGKLR.I
*	TK010303_lung_E18_mito_3_step01.3555.3555.2	1.9816	0.3559	2857.08	1	2500.0%	1	K.DHLLSISLSGYINYLDKNNPSKPLR.V
UWDR1_HUMAN92.9%3310.4%606661946.7(O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1)
*	TK010303_lung_E18_mito_3_step02.2330.2330.2	2.1695	0.4017	2418.56	1	3100.0%	1	R.NIDNPALADIYTEHAHQVVVAK.Y
*	TK010303_lung_E18_mito_3_step12.3261.3261.3	1.7711	0.0726	2672.07	1	2080.0%	1	K.CVAVGPGGYAVVVCIGQIVLLKDQR.K
*	TK010303_lung_E18_mito_3_step09.3830.3830.3	1.9381	0.0841	4022.55	26	1150.0%	1	R.NIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGK.L
UPTN6_MOUSE92.7%339.9%595675597.8(P29351) Protein-tyrosine phosphatase, non-receptor type 6 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1C) (PTP-1C) (Hematopoietic cell protein-tyrosine phosphatase) (70Z-SHP) (SH-PTP1)
*	TK010303_lung_E18_mito_3_step10.2914.2914.2	1.4193	0.1455	2519.1	191	1500.0%	1	K.FATLTELVEYYTQQQGILQDR.D
*	TK010303_lung_E18_mito_3_step10.2107.2107.2	2.4189	0.3723	1981.48	1	3530.0%	1	R.WYHGHISGGQAESLLQAK.G
	TK010303_lung_E18_mito_3_step09.2647.2647.2	1.4076	0.0824	2101.16	8	2630.0%	1	R.QESLPHAGPIIVHCSAGIGR.T
UPON2_MOUSE92.7%3326.8%354394915.6(Q62086) Serum paraoxonase/arylesterase 2 (EC 3.1.1.2) (EC 3.1.8.1) (PON 2) (Serum aryldiakylphosphatase 2) (A-esterase 2) (Aromatic esterase 2)
	TK010303_lung_E18_mito_3_step05.3029.3029.3	2.1502	0.0993	4114.59	13	1150.0%	1	R.EVESVDLPNCHLIKGIETGAEDIDILPNGLAFFSVGLK.F
*	TK010303_lung_E18_mito_3_step10.3546.3546.2	2.5411	0.3592	2012.41	1	3750.0%	1	K.YVYVADILAHEIHVLEK.Q
*	TK010303_lung_E18_mito_3_step04.4390.4390.3	2.4223	0.153	4418.73	1	1670.0%	1	K.QPNMNLTQLKVLQLGTLVDNLSIDPSSGDIWVGCHPNGQR.L
UQ9P10792.6%449.0%9701067335.7(Q9P107) Gem-interacting protein
*	TK010303_lung_E18_mito_3_step09.1759.1759.3	1.4079	0.1234	2407.62	3	2500.0%	1	R.DFPEEVPFVVTKCTAEIEHR.A
*	TK010303_lung_E18_mito_3_step10.2454.2454.2	1.5088	0.0976	2232.82	3	2500.0%	1	R.WQGTPGPTPGSDVDSVGGGSESR.S
*	TK010303_lung_E18_mito_3_step06.4299.4299.2	2.0304	0.4365	2660.74	1	2600.0%	1	K.DGGGEVSSQGPEDSLLGTQSRGHFSR.Q
*	TK010303_lung_E18_mito_3_step10.2915.2915.2	1.796	0.1416	1850.29	5	2940.0%	1	R.ALVELSGNSPHDVSSVLK.R
UQ9H3H992.6%114.8%227258505.9(Q9H3H9) Brain my048 protein (MY0876G05 protein)
*	TK010303_lung_E18_mito_3_step01.2464.2464.1	1.7529	0.2568	1353.96	4	5500.0%	1	R.EFDNMARVEDK.R
URS11_HUMAN92.5%3511.4%1581843110.3(P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11
	TK010303_lung_E18_mito_3_step01.1168.1168.1	1.4909	0.3428	748.52	1	6670.0%	1	K.NIGLGFK.T
	TK010303_lung_E18_mito_3_step02.2020.2020.1	1.8296	0.2274	1347.66	1	5500.0%	2	K.NMSVHLSPCFR.D
UQ9CZX892.5%4612.7%2122294010.8(Q9CZX8) Ribosomal protein S19
*	TK010303_lung_E18_mito_3_step07.1745.1745.1	1.129	0.0296	1239.83	2	5000.0%	1	R.GARYASVETER.G
	TK010303_lung_E18_mito_3_step01.1528.1528.1	2.1527	0.1928	972.71	1	6880.0%	2	R.VLQALEGLK.M
	TK010303_lung_E18_mito_3_step01.1502.1502.1	1.4946	0.0895	733.67	5	7500.0%	1	R.ALAAFLK.K
UQ91YH592.4%4417.6%541605756.1(Q91YH5) Similar to likely ortholog of mouse ADP-ribosylation-like factor 6 interacting protein 2
	TK010303_lung_E18_mito_3_step03.3561.3561.2	2.1921	0.3902	2393.64	1	4410.0%	1	R.YQQELEEEIKELYENFCK.H
*	TK010303_lung_E18_mito_3_step12.3291.3291.2	1.3749	0.0906	2504.68	9	2000.0%	1	R.DWSFPYEYNYGLQGGMAFLDK.R
*	TK010303_lung_E18_mito_3_step02.2732.2732.2	1.404	0.044	3122.0	4	2200.0%	1	K.DIYYNNMEEICGGEKPYLSPDILEEK.H
	TK010303_lung_E18_mito_3_step03.2488.2488.2	1.1578	0.0493	3111.56	2	1720.0%	1	K.IYQGEDLPHPKSMLQATAEANNLAAAASAK.D
UUNRI_MOUSE92.3%242.8%351385135.1(Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein)
	TK010303_lung_E18_mito_3_step12.1299.1299.1	1.6779	0.2496	1181.28	1	5000.0%	2	K.GHFGPIHCVR.F
UQ9EPA692.3%223.4%739828425.1(Q9EPA6) Aspartyl beta-hydroxylase 6.6 kb transcript (Aspartyl beta-hydroxylase 4.5 kb transcript)
	TK010303_lung_E18_mito_3_step07.4432.4432.2	2.0579	0.4215	2094.89	1	3440.0%	1	R.LIFIVDVWHPELTPQQR.R
	TK010303_lung_E18_mito_3_step02.1882.1882.1	1.7714	0.039	1089.46	27	5000.0%	1	K.WYELGHKR.G
UQ96HG092.2%1120.4%2012188811.0(Q96HG0) Similar to RIKEN cDNA 0610006I08 gene (Fragment)
	TK010303_lung_E18_mito_3_step12.3076.3076.3	2.9741	0.3304	4416.49	1	1500.0%	1	R.FFTILGLFCAGQGVFWASMAVAAVSRPPVPVQPLDAEVPNR.G
UQ96N4692.2%111.2%770883198.6(Q96N46) Hypothetical protein FLJ31422
*	TK010303_lung_E18_mito_3_step06.4306.4306.1	2.201	0.0359	1083.64	3	6880.0%	1	R.EDNYGEDIK.T
UPERF_MOUSE92.2%226.5%554620818.1(P10820) Perforin 1 precursor (P1) (Lymphocyte pore forming protein) (Cytolysin)
*	TK010303_lung_E18_mito_3_step12.2819.2819.2	1.0539	0.0162	2858.41	32	1820.0%	1	K.SSHDSCQCECQDSKVTNQDCCPR.Q
*	TK010303_lung_E18_mito_3_step08.2341.2341.1	1.6686	0.2568	1498.71	2	4170.0%	1	R.QRGLAHLVVSNFR.A
URS30_HUMAN92.2%2232.2%59664812.1(Q05472) 40S ribosomal protein S30 (Q05472) 40S ribosomal protein S30
	TK010303_lung_E18_mito_3_step01.0923.0923.1	2.0772	0.2235	1237.48	1	5500.0%	1	R.FVNVVPTFGKK.K
	TK010303_lung_E18_mito_3_step11.1065.1065.1	1.3318	0.0545	867.49	3	7140.0%	1	-.KVHGSLAR.A
UQ9H0V792.2%1111.4%360411068.7(Q9H0V7) Hypothetical protein
	TK010303_lung_E18_mito_3_step11.4133.4133.3	2.797	0.3718	4467.68	1	1380.0%	1	K.LGTFLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIR.H
UDPG1_MOUSE92.2%559.9%12391388996.5(P54099) DNA polymerase gamma subunit 1 (EC 2.7.7.7) (Mitochondrial DNA polymerase catalytic subunit) (PolG-alpha)
	TK010303_lung_E18_mito_3_step08.1505.1505.3	1.4585	0.0133	2443.97	16	2500.0%	1	R.YKEDPWLWDLEWDLQEFK.Q
*	TK010303_lung_E18_mito_3_step02.2237.2237.3	1.8849	0.2236	4665.05	3	1100.0%	1	R.AEVPEESQWSSESSSWDWMDISSANNLADVHNLYVGGPPLEK.E
	TK010303_lung_E18_mito_3_step06.3433.3433.2	1.3146	0.0431	2638.09	23	2250.0%	1	K.WLFEEFAIDGRFCISIHDEVR.Y
*	TK010303_lung_E18_mito_3_step12.1345.1345.1	1.653	0.2562	1151.68	3	5620.0%	1	R.EQYLIQDSR.M
*	TK010303_lung_E18_mito_3_step02.3313.3313.3	2.2329	0.1158	3716.93	3	1480.0%	1	R.ALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSR.R
UDCE1_MOUSE92.2%224.4%593665847.1(P48318) Glutamate decarboxylase, 67 kDa isoform (EC 4.1.1.15) (GAD-67) (67 kDa glutamic acid decarboxylase)
	TK010303_lung_E18_mito_3_step01.2319.2319.1	1.6483	0.2555	1564.52	3	3850.0%	1	K.MMGVLLQCSAILVK.E
*	TK010303_lung_E18_mito_3_step11.1753.1753.2	1.4002	0.0951	1617.98	1	5000.0%	1	R.HVDINKFWLMWK.A
UCPT1_HUMAN92.2%227.0%773884298.7(P50416) Carnitine O-palmitoyltransferase I, mitochondrial liver isoform (EC 2.3.1.21) (CPT I) (CPTI-L)
*	TK010303_lung_E18_mito_3_step08.4001.4001.3	2.9669	0.3324	4257.64	2	1420.0%	1	R.GPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYR.R
*	TK010303_lung_E18_mito_3_step10.2581.2581.2	1.8685	0.1162	1703.57	30	3670.0%	1	K.RMTALAQDFAVGLGPR.L
UQ9Z0M392.2%51113.1%801889984.7(Q9Z0M3) Cadherin 7 precursor
	TK010303_lung_E18_mito_3_step03.2915.2915.2	2.6861	0.2208	2801.52	1	3700.0%	3	R.TGRPMEPESEFIIKIQDINDNEPK.F
*	TK010303_lung_E18_mito_3_step11.4033.4033.3	1.5672	0.0723	4286.73	6	1180.0%	1	K.AGQLIQTVSAVDQDDPHNGQHFYYSLAPEAANNPNFTVR.D
*	TK010303_lung_E18_mito_3_step04.2330.2330.3	1.6209	0.0454	4700.51	1	1280.0%	1	R.EEFSWHNITVLAMEMNNPSQVGSVAVTIKVLDVNDNAPEFPR.F
URAC1_HUMAN92.1%227.3%192214508.5(P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25)
	TK010303_lung_E18_mito_3_step11.1801.1801.2	1.8746	0.2107	1587.3	2	4620.0%	1	R.HHCPNTPIILVGTK.L
UQ9JIA592.1%2215.5%341374699.6(Q9JIA5) Protease (Fragment)
	TK010303_lung_E18_mito_3_step01.1887.1887.1	1.9088	0.2437	1017.6	5	6110.0%	1	R.GFEPPGAGKR.G
*	TK010303_lung_E18_mito_3_step04.3933.3933.3	1.9515	0.1218	4671.52	1	1250.0%	1	K.GFEGVIDTGADVTIIRGQDWPSNWPLSVSLTHLQEIGYASNPK.R
U143Z_MOUSE92.0%4421.2%245277714.8(P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit)
	TK010303_lung_E18_mito_3_step10.3483.3483.2	1.511	0.0372	2634.87	14	2050.0%	1	R.YDDMAACMKSVTEQGAELSNEER.N
	TK010303_lung_E18_mito_3_step01.3099.3099.1	1.8938	0.244	1420.44	1	6360.0%	1	R.DICNDVLSLLEK.F
*	TK010303_lung_E18_mito_3_step11.1691.1691.2	1.473	0.0182	1981.66	15	2810.0%	1	K.FLIPNASQPESKVFYLK.M
UQ9EP7191.9%104011.2%9791088526.3(Q9EP71) NORPEG-like protein (Ankycorbin)
*	TK010303_lung_E18_mito_3_step07.2721.2721.2	2.6063	0.3021	2482.93	1	4290.0%	1	K.TALHYAAAQGCLQAVQLLCEHK.S
*	TK010303_lung_E18_mito_3_step02.4016.4016.3	1.7786	0.0795	3830.97	6	1470.0%	6	K.DLDGNIPLLVAVQNGHSEACHFLLDHGADVNSRDK.N
*	TK010303_lung_E18_mito_3_step07.1805.1805.1	1.1888	0.0461	1268.12	1	6110.0%	1	K.HHQEVISVYR.M
*	TK010303_lung_E18_mito_3_step12.3308.3308.3	2.1908	0.1828	3253.88	3	1920.0%	1	K.HHQEVISVYRMHLLYAVQGQMDEDVQK.V
*	TK010303_lung_E18_mito_3_step02.4441.4441.2	1.3073	0.0805	2806.47	25	1800.0%	1	K.DKEAEADLSFQSFHSTQTDLAPSPGK.A
UQ9P2L291.9%112.2%9891110306.3(Q9P2L2) Hypothetical protein KIAA1334 (Fragment)
*	TK010303_lung_E18_mito_3_step07.2721.2721.2	2.6063	0.3021	2482.93	1	4290.0%	1	K.TALHYAAAQGCLQAVQILCEHK.S
UQ923I991.9%2411.4%446485127.1(Q923I9) Abl interactor 1
*	TK010303_lung_E18_mito_3_step12.4185.4185.3	2.0675	0.0435	4739.72	3	1150.0%	2	R.THSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTAGPAPGAAPGSQYGTMTR.Q
UNTC1_MOUSE91.8%444.6%25312713135.2(Q01705) Neurogenic locus notch homolog protein 1 precursor (Notch 1) (Motch A) (mT14) (p300)
*	TK010303_lung_E18_mito_3_step01.1872.1872.1	2.1492	0.1604	1218.98	2	5500.0%	1	K.NGANKDIENNK.E
*	TK010303_lung_E18_mito_3_step01.3863.3863.3	1.9305	0.078	4469.1	14	1190.0%	1	K.IEAVKSEPVEPPLPSQLHLMYVAAAAFVLLFFVGCGVLLSR.K
*	TK010303_lung_E18_mito_3_step08.2898.2898.3	1.5366	0.0601	4262.1	62	1070.0%	1	K.NSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVK.S
*	TK010303_lung_E18_mito_3_step08.1881.1881.3	1.7472	0.0541	3266.32	130	1520.0%	1	R.SPKCFNNGTCVDQVGGYTCTCPPGFVGER.C
UQ9BXA591.8%5253.3%330382839.0(Q9BXA5) G-protein coupled receptor 91
*	TK010303_lung_E18_mito_3_step01.0338.0338.1	1.5938	0.0147	1218.58	3	6000.0%	5	K.NWLAAEAALEK.Y
UQ99LJ391.7%226.0%400459185.0(Q99LJ3) Hypothetical 45.9 kDa protein (Fragment)
	TK010303_lung_E18_mito_3_step01.3698.3698.1	1.1234	0.0516	1581.68	2	3850.0%	1	K.ERLAILGIHNEVSK.I
*	TK010303_lung_E18_mito_3_step07.1590.1590.1	1.8423	0.2468	1314.57	1	5560.0%	1	K.HTNYNMEHIR.V
UO9549991.5%2218.2%314351298.7(O95499) Olfactory receptor 89
*	TK010303_lung_E18_mito_3_step12.3355.3355.2	1.2881	0.075	2918.79	74	1460.0%	1	R.DQPKFMALFYGVVTPSLNPFIYTLR.N
*	TK010303_lung_E18_mito_3_step05.2802.2802.3	2.8116	0.3623	3747.97	1	1770.0%	1	K.TISYMGCAVQLYFFHIMGGTECLLLAIMSFDR.Y
USNAA_MOUSE91.3%116.1%295331905.4(Q9DB05) Alpha-soluble NSF attachment protein (SNAP-alpha) (N-ethylmaleimide-sensitive factor attachment protein, alpha)
*	TK010303_lung_E18_mito_3_step07.3301.3301.2	2.6264	0.252	2128.3	2	3240.0%	1	K.HHISIAEIYETELVDVEK.A
UQ96P5291.2%3510.7%420468106.8(Q96P52) WD40-and FYVE-domain containing protein 3
*	TK010303_lung_E18_mito_3_step04.4027.4027.3	1.6798	0.0232	4131.57	33	1290.0%	2	R.SQQIVCCCMSEMNEWDTQNVIVTGHSDGVVRFWR.M
	TK010303_lung_E18_mito_3_step01.2790.2790.1	2.1643	0.1141	1435.6	1	5000.0%	1	R.DRTCIIWDLNK.L
UQ8VGC491.0%2218.3%312352038.9(Q8VGC4) Olfactory receptor MOR114-4
*	TK010303_lung_E18_mito_3_step12.3625.3625.3	1.6898	0.1053	3949.02	29	1210.0%	1	K.AFSTCSSHIIVVSITYGSCIFIYIKPSAKEGVAVNK.V
*	TK010303_lung_E18_mito_3_step07.1872.1872.3	2.7714	0.365	2311.38	4	2500.0%	1	K.VVSVLTTSVAPVMNPFIYTLR.N
UQ9DBD791.0%102832.1%424462268.1(Q9DBD7) 1300016K07Rik protein
	TK010303_lung_E18_mito_3_step09.4446.4446.3	1.6713	0.1637	4236.44	1	1510.0%	3	R.EFWKQLGSLGVLGITAPVQYGGSGLGYLEHVLVMEEISR.A
	TK010303_lung_E18_mito_3_step10.3810.3810.3	3.0581	0.2883	3993.92	2	1460.0%	1	K.DCAGVILYAAECATQVALDGIQCLGGNGYINDFPMGR.F
	TK010303_lung_E18_mito_3_step01.1394.1394.1	1.5624	0.0463	1149.6	2	6110.0%	1	K.IGQFQLMQGK.M
	TK010303_lung_E18_mito_3_step12.4028.4028.2	1.731	0.2145	2686.94	30	1670.0%	4	R.LVLAGGPLGIMQAVLDHTIPYLHVR.E
	TK010303_lung_E18_mito_3_step01.3764.3764.2	1.3992	0.0871	2524.69	88	1880.0%	1	K.LISGEFIGALAMSEPNAGSDVVSMK.L
UFGR3_HUMAN91.0%6364.6%806877105.9(P22607) Fibroblast growth factor receptor 3 precursor (EC 2.7.1.112) (FGFR-3)
*	TK010303_lung_E18_mito_3_step08.4265.4265.3	2.1659	0.0682	4018.1	1	1810.0%	6	R.VTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDK.K
UQ9H8F990.8%81623.8%541574466.9(Q9H8F9) Hypothetical protein FLJ13664
*	TK010303_lung_E18_mito_3_step04.2710.2710.3	1.4915	0.0575	4268.09	45	950.0%	1	R.LLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPR.L
*	TK010303_lung_E18_mito_3_step02.4397.4397.3	1.8999	0.0271	3600.55	3	1560.0%	3	R.GTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDR.F
*	TK010303_lung_E18_mito_3_step11.3435.3435.2	1.3854	0.0259	2031.99	109	2110.0%	1	R.APAGWTSGSLHTGPRAGRPR.A
*	TK010303_lung_E18_mito_3_step03.3541.3541.2	1.4705	0.0731	2586.48	14	1670.0%	2	R.KGGAWAPAGNPGPLHPLGVAVGMAGSGR.L
*	TK010303_lung_E18_mito_3_step03.2435.2435.3	2.175	0.1414	4180.76	10	1220.0%	1	R.TPSSPLQSCTPSLSPRSHVPSPHQALVTRPQKPSLEFK.E
UATPG_HUMAN90.8%393.4%298329969.2(P36542) ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14)
	TK010303_lung_E18_mito_3_step02.1837.1837.1	1.5891	0.1889	1098.53	1	5560.0%	3	K.HLLIGVSSDR.G
UQ9P2F290.8%445.0%16281814886.9(Q9P2F2) Hypothetical protein KIAA1395 (Fragment)
*	TK010303_lung_E18_mito_3_step09.3414.3414.3	2.2573	0.049	3299.39	1	1980.0%	1	R.ASSGDDACSFSGFRPATLTVTNFFKQEAER.L
*	TK010303_lung_E18_mito_3_step11.1208.1208.1	1.8307	0.234	1331.62	1	4580.0%	1	R.AHGTHPAISTLAR.S
*	TK010303_lung_E18_mito_3_step01.0451.0451.1	0.9219	0.0048	813.26	181	3570.0%	1	R.SGSPHSSR.R
*	TK010303_lung_E18_mito_3_step06.3586.3586.3	1.504	0.0352	3302.55	14	1550.0%	1	R.QQHFLAGLLLTELALALEPEAEGAFLLHKK.A
UCYB_MOUSE90.6%228.7%381432108.0(P00158) Cytochrome B
*	TK010303_lung_E18_mito_3_step07.3293.3293.2	1.1231	0.0027	2820.66	5	2000.0%	1	K.LGGVLALILSILILALMPFLHTSKQR.S
*	TK010303_lung_E18_mito_3_step11.1271.1271.1	1.508	0.2956	872.37	1	6670.0%	1	R.KTHPLFK.I
UQ9CTD490.5%3523.2%259301634.7(Q9CTD4) 6030455P07Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step07.3146.3146.3	1.9489	0.0036	4020.08	7	1290.0%	1	R.LDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGR.L
	TK010303_lung_E18_mito_3_step03.3224.3224.2	2.2047	0.3833	2718.22	1	3040.0%	2	K.AEILSNWNMFVGSQATNYGEDLTR.H
UPUR9_MOUSE90.4%3311.7%592641576.8(Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)]
*	TK010303_lung_E18_mito_3_step11.1488.1488.3	1.5794	0.0193	3630.13	28	1400.0%	1	R.SGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLR.L
	TK010303_lung_E18_mito_3_step12.1577.1577.1	2.0983	0.2015	1355.77	1	4580.0%	1	K.TLHPAVHAGILAR.N
*	TK010303_lung_E18_mito_3_step03.2715.2715.3	2.1099	0.1863	2560.11	12	2250.0%	1	K.NGNYCVLQMDQSCKPDENEVR.T
UM3K4_MOUSE90.4%799.6%15971799486.5(O08648) Mitogen-activated protein kinase kinase kinase 4 (EC 2.7.1.-) (MAPK/ERK kinase kinase 4) (MEK kinase 4) (MEKK 4)
	TK010303_lung_E18_mito_3_step12.1297.1297.1	1.9629	0.2306	1388.55	1	4550.0%	1	R.SLSRHSSPTEER.D
	TK010303_lung_E18_mito_3_step05.2413.2413.2	1.7149	0.2688	2058.24	5	2810.0%	1	R.VQALCLWLNITKDLNQK.L
*	TK010303_lung_E18_mito_3_step08.3828.3828.2	1.597	0.195	3085.92	5	1670.0%	1	R.CHSDPPNPHLIIPTPEGFSTRSVPSDAR.T
	TK010303_lung_E18_mito_3_step02.3254.3254.3	2.1112	0.0302	4010.49	71	1170.0%	1	R.AADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYK.V
	TK010303_lung_E18_mito_3_step07.2929.2929.2	0.9714	0.0016	2519.96	7	2140.0%	1	K.NIIGQVCDTPKSYDNVMHVGLR.K
*	TK010303_lung_E18_mito_3_step02.3050.3050.3	1.4947	0.0956	4580.92	34	980.0%	2	K.LFCDIAGMLLKSTGSFLESGLQESCAELWTSADDNGAADELR.R
UQ9D51790.4%359.9%314361318.0(Q9D517) DNA segment, Chr 10, Johns Hopkins University 12, expressed
*	TK010303_lung_E18_mito_3_step02.2850.2850.2	2.0113	0.3052	2325.7	1	3160.0%	1	R.RFPLEDIPADETSAAQWLHK.L
*	TK010303_lung_E18_mito_3_step01.1594.1594.1	1.7198	0.078	1213.77	2	5000.0%	2	K.GSSYGNQELKK.K
UQ9CR4490.2%116.9%159182139.3(Q9CR44) DNA segment, Chr 4, Wayne state University 125, expressed
*	TK010303_lung_E18_mito_3_step02.1905.1905.1	1.6218	0.2455	1308.72	1	5500.0%	1	K.KEPVLVCPPLR.S
URBP2_HUMAN90.2%554.3%32243582206.2(P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270)
*	TK010303_lung_E18_mito_3_step10.3766.3766.2	1.1851	0.0534	2806.83	108	1460.0%	1	K.DTSFLGSDDIGNIDVREPELEDLTR.Y
	TK010303_lung_E18_mito_3_step12.1808.1808.2	1.5066	0.0867	2259.01	80	2370.0%	1	R.ALSELAALCYLIAFQVPRPK.I
*	TK010303_lung_E18_mito_3_step06.3737.3737.3	1.5362	0.0044	4373.92	34	1150.0%	1	R.LPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALR.F
*	TK010303_lung_E18_mito_3_step01.1450.1450.1	1.9285	0.222	1490.64	3	3930.0%	1	K.APGTNVAMASNQAVR.I
*	TK010303_lung_E18_mito_3_step09.2406.2406.3	1.4887	0.0382	4405.46	16	1100.0%	1	K.CVACDASKPTHKPIAEAPSAFTLGSEMKLHDSSGSQVGTGFK.S
UQ9UNJ290.1%665.7%25482927058.8(Q9UNJ2) Myosin-IXa
	TK010303_lung_E18_mito_3_step01.4390.4390.3	1.3626	0.0474	3951.17	1	1360.0%	1	R.WSTELVPEGLQSPRGTPDSESSQGSLELLSYEESQK.S
	TK010303_lung_E18_mito_3_step01.4308.4308.1	1.5316	0.275	1040.7	2	5000.0%	1	K.DSSSAHLPPK.D
	TK010303_lung_E18_mito_3_step04.2950.2950.3	1.8178	0.0465	3692.96	13	1420.0%	1	K.TLSIGVLDIFGFEDYENNSFEQFCINFANER.L
*	TK010303_lung_E18_mito_3_step08.2606.2606.3	1.8205	0.0959	2889.88	3	1770.0%	1	K.GYGSLEIQGSDPSEWEDCSFDNRIK.A
	TK010303_lung_E18_mito_3_step07.4268.4268.2	1.4065	0.0773	2161.52	33	2780.0%	1	K.FIQVNYQETGTVLGAYVEK.Y
	TK010303_lung_E18_mito_3_step11.4313.4313.2	1.2041	0.0031	2788.56	53	1670.0%	1	R.IALQEDTNRMSANALAIVFAPCILR.C
URGS9_MOUSE90.0%101621.0%675769729.4(O54828) Regulator of G-protein signaling 9 (RGS9)
	TK010303_lung_E18_mito_3_step08.1590.1590.3	1.1098	0.0734	2324.25	151	2080.0%	1	R.HPHRYVLDAAQTHIYMLMK.K
	TK010303_lung_E18_mito_3_step02.1825.1825.1	1.0745	0.0316	1364.56	54	3180.0%	3	R.HLRSSPSPVILR.Q
	TK010303_lung_E18_mito_3_step01.0378.0378.1	1.5446	0.0936	901.41	2	5710.0%	1	R.VTNPNEVK.K
*	TK010303_lung_E18_mito_3_step09.2152.2152.3	1.6765	0.0672	3263.61	1	2220.0%	1	R.LWISNLEAQNLGNLIVKYGYIYPLQDPK.N
*	TK010303_lung_E18_mito_3_step01.3416.3416.1	1.1684	0.0831	1589.81	109	2690.0%	1	K.EMLAKAIEPQETTK.R
*	TK010303_lung_E18_mito_3_step08.4212.4212.2	1.1312	0.0099	3165.93	170	1030.0%	1	K.GEASWSGANSGPSVTENREPSADHSRPQPR.A
*	TK010303_lung_E18_mito_3_step04.4533.4533.2	1.2001	0.0192	2506.89	185	1520.0%	1	R.RPSIAICPSPSRVALEGSSGLEPK.G
	TK010303_lung_E18_mito_3_step01.0852.0852.1	1.1628	0.0462	800.43	10	5000.0%	1	K.LVEIPTK.M
UKI67_HUMAN90.0%15456.4%32563587479.4(P46013) Antigen KI-67
*	TK010303_lung_E18_mito_3_step11.1581.1581.3	1.2661	0.0838	4563.28	64	930.0%	1	K.DSLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLK.R
*	TK010303_lung_E18_mito_3_step04.3362.3362.2	1.3429	0.0112	2579.89	6	2140.0%	1	K.MPCQSLQPEPINTPTHTKQQLK.A
*	TK010303_lung_E18_mito_3_step06.2706.2706.1	1.8896	0.1861	1343.65	10	4550.0%	6	K.QESGSEIHVEVK.A
*	TK010303_lung_E18_mito_3_step06.4457.4457.2	1.1386	0.0339	2162.19	4	2500.0%	1	R.RPQTPKEEAQALEDLTGFK.E
*	TK010303_lung_E18_mito_3_step12.1217.1217.3	1.8504	0.045	2890.41	204	1300.0%	1	R.SGVDGPHFPLSLSTCLFGRGIECDIR.I
*	TK010303_lung_E18_mito_3_step10.4379.4379.2	1.4232	0.121	2897.95	6	1920.0%	1	K.SGLQTDYATEKESADGLQGETQLLVSR.K
*	TK010303_lung_E18_mito_3_step08.0221.0221.2	0.7584	0.1365	1976.59	6	1760.0%	1	K.ILCKSPQSDPADTPTNTK.Q
*	TK010303_lung_E18_mito_3_step01.1258.1258.1	1.5978	0.0579	1173.57	10	4500.0%	1	R.NVDAEDVIGSR.R
*	TK010303_lung_E18_mito_3_step11.1471.1471.1	0.793	0.1562	1060.25	44	3750.0%	1	K.KAEDNVCVK.K
*	TK010303_lung_E18_mito_3_step10.2717.2717.2	1.1515	0.0266	2259.94	8	2500.0%	1	K.EELLAVGKLTQTSGETTHTDK.E
UPER3_MOUSE89.9%111.1%11131209396.5(O70361) Period circadian protein 3 (mPER3)
*	TK010303_lung_E18_mito_3_step02.2098.2098.1	1.484	0.3064	1412.19	1	4550.0%	1	R.YLTSYSLPALKR.K
UQ8VHA689.9%3314.3%467507006.0(Q8VHA6) SOCS box protein ASB-18
*	TK010303_lung_E18_mito_3_step05.3944.3944.3	1.8592	0.0295	4372.7	2	1150.0%	1	R.GALHEACLGNHTACARLLLQHGADPDLLNSEGLAPLHLCR.T
*	TK010303_lung_E18_mito_3_step06.3582.3582.2	1.4919	0.0507	2851.28	19	1730.0%	1	R.ELLEHGATVQLEGGPGRDTPLHVAAQR.G
URW1_MOUSE89.8%796.6%18292005128.6(O70472) RW1 protein
*	TK010303_lung_E18_mito_3_step01.0482.0482.2	0.9045	0.0125	1493.76	184	2860.0%	1	K.NGNPTFAAVAAGYDK.S
*	TK010303_lung_E18_mito_3_step10.4418.4418.2	1.3505	0.0128	2641.48	67	1520.0%	2	K.DSPPPEWDAVPVHKPSSSTDSLYK.L
*	TK010303_lung_E18_mito_3_step05.3657.3657.2	1.3714	0.1346	2310.48	11	1960.0%	1	K.NGNPTFAAVAAGYDKSPGGNGFAK.I
*	TK010303_lung_E18_mito_3_step03.2811.2811.3	1.6805	0.0467	3656.57	8	1430.0%	1	R.QTSPTPASPSLPTAPCPFTSRGSYSSVVNSSGSDTK.A
*	TK010303_lung_E18_mito_3_step11.4140.4140.2	1.4237	0.0145	2612.67	5	2050.0%	1	K.DFDHHDSSPLDVFTEQPPSPMSK.S
*	TK010303_lung_E18_mito_3_step01.0291.0291.1	1.3239	0.0040	1447.76	113	2920.0%	1	K.YTKVASISFDASR.A
UO0899589.8%6810.9%10781187055.0(O08995) Myelin transcription factor 1
	TK010303_lung_E18_mito_3_step10.2659.2659.2	1.4555	0.0428	2214.33	11	2630.0%	1	K.QLEVPPYGSYRPNVAPATPR.A
*	TK010303_lung_E18_mito_3_step12.2332.2332.3	1.7268	0.0353	3375.24	5	1720.0%	1	R.IPPEILAMHENVLKCPTPGCTGQGHVNSYR.N
	TK010303_lung_E18_mito_3_step01.1638.1638.1	2.0907	0.1983	1540.72	3	3930.0%	1	K.CPVPGCVGLGHISGK.Y
*	TK010303_lung_E18_mito_3_step02.2428.2428.2	1.2331	0.0024	2676.45	3	1960.0%	2	K.ASPEFRGPELSSPKPEYSVIVEVR.S
*	TK010303_lung_E18_mito_3_step06.3113.3113.3	2.0933	0.1553	3109.58	2	2040.0%	1	R.DLNESNSGMEAAMVQLQSQISSMERNLK.N
UQ9D05289.8%115.8%190210519.9(Q9D052) 2610103J23Rik protein
*	TK010303_lung_E18_mito_3_step11.1040.1040.1	1.5279	0.271	1264.7	2	5000.0%	1	K.KLPEKPKPNGR.T
UQ96S8189.7%119.7%452493767.3(Q96S81) HNap1 binding protein
	TK010303_lung_E18_mito_3_step07.3280.3280.3	2.7365	0.3546	4297.02	1	1450.0%	1	R.ENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR.H
UGUAD_MOUSE89.7%73711.9%454510135.5(Q9R111) Guanine deaminase (EC 3.5.4.3) (Guanase) (Guanine aminase) (Guanine aminohydrolase) (GAH)
*	TK010303_lung_E18_mito_3_step09.4150.4150.3	2.2375	0.0869	4478.82	1	1320.0%	6	R.ELSHHEFFMPGLVDTHIHAPQYAFAGSNVDLPLLEWLNK.Y
*	TK010303_lung_E18_mito_3_step10.2187.2187.2	1.4407	0.1273	1818.02	105	2500.0%	1	K.NYTDVYDKNNLLTNK.T
UQ9Z1J089.7%355.7%10141138275.8(Q9Z1J0) Kinesin-related mitotic motor protein (Fragment)
*	TK010303_lung_E18_mito_3_step08.2438.2438.3	1.7786	0.0316	2642.78	3	2270.0%	2	K.QPPMMLNSSEASKETSQDMDEER.E
*	TK010303_lung_E18_mito_3_step09.4404.4404.3	2.7291	0.3505	3701.96	1	1760.0%	1	K.TLFGNLMSCSVSALDTITTTALESLVSIPENVSAR.V
UART1_MOUSE89.7%338.5%9301065996.1(Q9EQH2) Adipocyte-derived leucine aminopeptidase precursor (EC 3.4.11.-) (A-LAP) (ARTS-1) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (VEGF induced aminopeptidase)
	TK010303_lung_E18_mito_3_step03.2377.2377.1	1.792	0.2332	1224.52	1	5500.0%	1	R.HLAISNMPLVK.S
*	TK010303_lung_E18_mito_3_step07.3705.3705.2	1.3826	0.0449	2831.55	4	2080.0%	1	K.TEVEIIASRPTSTIIMHSHHLQISK.A
*	TK010303_lung_E18_mito_3_step06.2991.2991.3	2.2345	0.2869	4646.21	333	600.0%	1	K.SSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEK.S
UCNRB_HUMAN89.7%3310.7%854984075.3(P35913) Rod cGMP-specific 3',5'-cyclic phosphodiesterase beta-subunit (EC 3.1.4.17) (GMP-PDE beta)
*	TK010303_lung_E18_mito_3_step12.3296.3296.2	1.5916	0.1696	2937.01	7	1820.0%	1	K.YLNFATLYLKIYHLSYLHNCETR.R
*	TK010303_lung_E18_mito_3_step10.3895.3895.3	1.9091	0.0846	3557.23	107	1210.0%	1	R.DLCQVEESTALLELVQDMQESINMERVVFK.V
*	TK010303_lung_E18_mito_3_step03.4192.4192.3	2.7473	0.3473	4151.09	1	1550.0%	1	R.LFSVQPDSVLEDCLVPPDSEIVFPLDIGVVGHVAQTKK.M
UQ9JHL189.7%2216.6%337373937.6(Q9JHL1) MSlc9a3r2/E3karp/Sip-1/Tka-1/Octs2
*	TK010303_lung_E18_mito_3_step03.2688.2688.3	1.686	0.0017	4278.19	2	1340.0%	1	R.VVPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEK.D
	TK010303_lung_E18_mito_3_step09.2026.2026.2	2.4218	0.3589	1576.27	1	5770.0%	1	R.RGPQGYGFNLHSDK.S
UQ924D289.6%221.9%15611699007.9(Q924D2) Myosin light chain kinase (Fragment)
*	TK010303_lung_E18_mito_3_step04.4371.4371.2	1.6551	0.036	1920.31	18	2500.0%	1	R.FESQPQSQEVTEGQTVK.F
*	TK010303_lung_E18_mito_3_step09.2396.2396.2	2.5826	0.2663	1493.01	1	5000.0%	1	K.ITGRPPPQVTWLK.G
UHDA6_MOUSE89.5%449.4%11491257045.8(Q9Z2V5) Histone deacetylase 6 (HD6) (Histone deacetylase mHDA2)
*	TK010303_lung_E18_mito_3_step07.1970.1970.3	1.5064	0.0635	3957.36	5	1360.0%	1	R.ALRILIVDWDVHHGNGTQHIFEDDPSVLYVSLHR.Y
*	TK010303_lung_E18_mito_3_step03.4287.4287.2	1.232	0.0747	2622.56	6	1960.0%	1	K.KLSQPAEEDLVVGLQGLDLNPETR.V
*	TK010303_lung_E18_mito_3_step08.1746.1746.3	1.9576	0.0246	4317.5	3	1380.0%	1	R.VLAETYDSVYLHPNSYSCACLATGSVLRLVDALMGAEIR.N
*	TK010303_lung_E18_mito_3_step12.2499.2499.1	2.1026	0.1387	1470.69	2	5000.0%	1	R.YEHGRFWPHLK.A
URL10_MOUSE89.5%4612.7%2132447310.1(P45634) 60S ribosomal protein L10 (QM protein homolog)
	TK010303_lung_E18_mito_3_step03.2636.2636.1	1.3959	0.0348	1276.74	27	3890.0%	2	R.VRLHPFHVIR.I
	TK010303_lung_E18_mito_3_step04.1865.1865.1	1.4866	0.2902	766.36	1	8000.0%	1	K.KWGFTK.F
	TK010303_lung_E18_mito_3_step09.2818.2818.1	1.7437	0.2326	1252.6	1	6000.0%	1	R.VHIGQVIMSIR.T
UGLI3_MOUSE89.4%556.0%15961735127.6(Q61602) Zinc finger protein GLI3
*	TK010303_lung_E18_mito_3_step03.3847.3847.2	0.9729	0.0131	2494.55	1	2270.0%	1	R.GNLTLQQGQLSDMSQSSRVNSIK.M
*	TK010303_lung_E18_mito_3_step02.2162.2162.1	1.8747	0.2198	1419.7	1	4580.0%	1	-.MEAQAHSSTATER.K
	TK010303_lung_E18_mito_3_step12.2092.2092.2	1.4087	0.0159	2006.17	9	3670.0%	1	R.EQKPFKAQYMLVVHMR.R
*	TK010303_lung_E18_mito_3_step11.2556.2556.2	2.1811	0.2109	1907.42	1	4380.0%	1	R.SDLSGVDFTVLNTLNRR.D
*	TK010303_lung_E18_mito_3_step12.2196.2196.2	1.2942	0.2222	2810.3	173	1400.0%	1	R.TDVSEKAVASSTTSNEDESPGQIYHR.E
UQ8TC2089.2%228.0%700813615.4(Q8TC20) Hypothetical protein
*	TK010303_lung_E18_mito_3_step05.2502.2502.2	2.58	0.2471	1729.14	3	3930.0%	1	K.KTLQNLEEVLANTQK.H
*	TK010303_lung_E18_mito_3_step12.4032.4032.3	1.665	0.0124	4643.63	14	1190.0%	1	K.EIQNYGEIPEMSVSYEKEVTAEGVERPEIVSTWSSAGISWR.S
UQ9CY6888.7%113.7%300348186.4(Q9CY68) 7 days embryo cDNA, RIKEN full-length enriched library, clone:C430041K09, full insert sequence
*	TK010303_lung_E18_mito_3_step01.3810.3810.1	1.5797	0.244	1273.76	1	5000.0%	1	K.YILGVIEGNHR.A
URHOI_HUMAN88.5%116.1%229258619.4(O95661) Rho-related GTP-binding protein RhoI
*	TK010303_lung_E18_mito_3_step01.2458.2458.1	1.6462	0.2241	1420.71	1	4620.0%	1	R.DYRVVVVGTAGVGK.S
ULMG2_HUMAN88.4%447.8%11931309906.2(Q13753) Laminin gamma-2 chain precursor (Kalinin/nicein/epiligrin 100 kDa subunit) (Laminin B2t chain)
*	TK010303_lung_E18_mito_3_step11.2008.2008.1	2.1009	0.1167	1573.48	5	3930.0%	1	R.HPSAHDVILEGAGLR.I
*	TK010303_lung_E18_mito_3_step03.4325.4325.2	1.8478	0.2876	2586.35	2	2500.0%	1	R.AQEALSMGNATFYEVESILKNLR.E
*	TK010303_lung_E18_mito_3_step12.3159.3159.3	1.7626	0.0080	4394.7	115	960.0%	1	R.ATYGEYSTGYIDNVTLISARPVSGAPAPWVEQCICPVGYK.G
*	TK010303_lung_E18_mito_3_step05.1836.1836.2	1.3706	0.019	1663.67	155	2860.0%	1	R.LQGVSDQSFQVEEAK.R
UQ99J3088.3%2210.7%384433089.0(Q99J30) Similar to hypothetical protein FLJ14038
	TK010303_lung_E18_mito_3_step11.2837.2837.2	2.2133	0.3652	2419.6	1	3330.0%	1	K.DRPFMGGQKPNLADLAVYGVLR.V
	TK010303_lung_E18_mito_3_step12.4323.4323.2	0.8586	0.0756	2453.83	8	1940.0%	1	K.WRQWADDWLVHLISPNVYR.T
UQ9NYU288.2%668.9%15551771895.6(Q9NYU2) UDP-glucose:glycoprotein glucosyltransferase 1 precursor
*	TK010303_lung_E18_mito_3_step01.0040.0040.1	0.9615	0.0223	659.54	4	6000.0%	1	K.LEAAVR.I
*	TK010303_lung_E18_mito_3_step12.2605.2605.3	1.5812	0.0118	3523.0	29	1330.0%	1	K.GPIAKFLDMPQSPLFTLNLNTPESWMVESVR.T
*	TK010303_lung_E18_mito_3_step05.1909.1909.2	1.2158	0.078	3080.58	92	1300.0%	1	R.LGIEGLSLHNVLKLNIQPSEADYAVDIR.S
*	TK010303_lung_E18_mito_3_step08.4142.4142.2	1.2036	0.0045	2995.1	16	1400.0%	1	R.AVYLGELPHDQDVVEYIMNQPNVVPR.I
*	TK010303_lung_E18_mito_3_step01.1828.1828.1	1.9259	0.2187	990.74	3	6880.0%	1	R.ISMINNPAK.E
*	TK010303_lung_E18_mito_3_step12.2965.2965.3	1.9265	0.0428	4191.5	1	1420.0%	1	K.GTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEAR.V
UQ8R33288.0%4163.4%587594459.3(Q8R332) Hypothetical 59.4 kDa protein
*	TK010303_lung_E18_mito_3_step10.2838.2838.2	2.53	0.2656	2273.52	1	3420.0%	4	R.TQKTPPGLQHENTAPADYFR.I
UIBP4_MOUSE87.7%2222.8%254278077.2(P47879) Insulin-like growth factor binding protein 4 precursor (IGFBP-4) (IBP-4) (IGF-binding protein 4)
*	TK010303_lung_E18_mito_3_step07.2965.2965.2	2.5316	0.2542	2636.02	1	3100.0%	1	R.THEDLFIIPIPNCDRNGNFHPK.Q
	TK010303_lung_E18_mito_3_step01.2994.2994.3	1.8208	0.1409	4097.74	29	1290.0%	1	R.CRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPR.C
UMUTA_HUMAN87.5%6816.0%750831016.8(P22033) Methylmalonyl-CoA mutase, mitochondrial precursor (EC 5.4.99.2) (MCM)
	TK010303_lung_E18_mito_3_step07.2073.2073.3	1.8761	0.1745	4722.29	4	1250.0%	1	K.ELNSLGRPDILVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPK.A
	TK010303_lung_E18_mito_3_step05.2632.2632.3	1.8071	0.0956	3269.25	2	1690.0%	1	R.EVAQQAVDADVHAVGVSTLAAGHKTLVPELIK.E
	TK010303_lung_E18_mito_3_step11.1599.1599.2	1.9799	0.1088	1946.73	1	3750.0%	2	R.DTMDLPEELPGVKPFTR.G
	TK010303_lung_E18_mito_3_step07.2466.2466.3	1.5146	0.0233	3325.98	39	1480.0%	1	R.GPYPTMYTFRPWTIRQYAGFSTVEESNK.F
	TK010303_lung_E18_mito_3_step01.1499.1499.2	2.3043	0.3428	2372.93	3	2610.0%	1	R.EVAQQAVDADVHAVGVSTLAAGHK.T
UWN15_HUMAN87.4%398.4%357389718.9(O14905) WNT-15 protein precursor (WNT-14B)
*	TK010303_lung_E18_mito_3_step08.3517.3517.2	1.3742	0.0059	3039.48	3	1720.0%	3	-.MRPPPALALAGLCLLALPAAAASYFGLTGR.E
UQ91YS087.4%229.4%458511426.4(Q91YS0) Similar to diacylglycerol kinase (Fragment)
	TK010303_lung_E18_mito_3_step10.1939.1939.2	1.9573	0.4077	2513.47	1	3000.0%	1	R.YCAGTMPWGHPGEHHDFEPQR.H
*	TK010303_lung_E18_mito_3_step09.3292.3292.2	1.2359	0.078	2490.25	206	1430.0%	1	R.STAPLHSDQQPVPEQLRIQVSR.V
UK2C8_MOUSE87.4%3315.0%488543185.6(P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A)
	TK010303_lung_E18_mito_3_step12.4288.4288.3	2.1344	0.1202	3956.06	49	1130.0%	1	R.VGSSSSSFRGSMGTGVGLGGFGGAGVGGITAVTVNQSLLSPLK.L
	TK010303_lung_E18_mito_3_step03.3331.3331.2	1.9957	0.4253	2033.46	2	3530.0%	1	K.LKLEAELGNMQGLVEDFK.N
	TK010303_lung_E18_mito_3_step02.2254.2254.1	1.4981	0.0164	1552.63	3	4090.0%	1	R.QLREYQELMNVK.L
UO7048187.2%4102.4%17572002156.0(O70481) Ubiquitin-protein ligase E3 COMPONEN N-recognin (Ubiquitin-protein ligase E3-alpha)
*	TK010303_lung_E18_mito_3_step05.4522.4522.2	1.7048	0.0075	1878.76	1	4060.0%	3	R.LGSSAMNAQNIQMLLER.L
	TK010303_lung_E18_mito_3_step12.2415.2415.3	1.8131	0.0057	3136.52	61	1500.0%	1	K.DQDLIKQYNTLIEEMLQVLIYIVGER.Y
UO9520487.1%241.3%10381176157.0(O95204) Metalloprotease 1
*	TK010303_lung_E18_mito_3_step12.1063.1063.1	1.5855	0.2253	1567.65	1	5000.0%	2	K.QFHATHYHPSNAR.F
ULKHA_MOUSE87.1%223.6%610688906.4(P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase)
	TK010303_lung_E18_mito_3_step05.3305.3305.2	2.2736	0.3484	2408.67	1	2860.0%	1	K.SLSNVIAHEISHSWTGNLVTNK.T
UCAMG_MOUSE87.1%3319.7%294325147.8(P49070) Calcium-signal modulating cyclophilin ligand (CAML)
	TK010303_lung_E18_mito_3_step03.3181.3181.2	1.1736	0.0032	2890.53	59	1520.0%	1	K.YLSIFAPFLTLQLAYMGLYKYFPK.G
*	TK010303_lung_E18_mito_3_step01.1640.1640.3	1.489	0.0549	2255.01	79	1900.0%	1	K.VKTTVLTAALLLSGIPAEAINR.S
*	TK010303_lung_E18_mito_3_step08.2109.2109.1	1.9328	0.2104	1397.72	1	4550.0%	1	R.ASHHGLEQYLSR.F
UOCRL_HUMAN86.9%242.0%9011041336.6(Q01968) Inositol polyphosphate 5-phosphatase OCRL-1 (EC 3.1.3.-) (Lowe's oculocerebrorenal syndrome protein)
*	TK010303_lung_E18_mito_3_step11.1739.1739.2	2.5332	0.116	2104.65	3	3820.0%	2	R.EVPVTKLIDLEEDSFLEK.E
UQ9NRJ286.8%1114.1%1631765710.9(Q9NRJ2) MOST2
*	TK010303_lung_E18_mito_3_step12.3165.3165.2	2.0288	0.3801	2226.25	1	3640.0%	1	K.TSGTPTESTVATAAASTTEVPSR.L
UY152_HUMAN86.5%4617.5%292322345.4(Q14165) Hypothetical protein KIAA0152
*	TK010303_lung_E18_mito_3_step11.1671.1671.1	2.0787	0.149	1364.7	1	4550.0%	2	R.ASDYGMKLPILR.S
*	TK010303_lung_E18_mito_3_step10.2851.2851.2	1.1881	0.0089	2734.01	72	1360.0%	1	R.YNEETFGYEVPIKEEGDYVLVLK.F
*	TK010303_lung_E18_mito_3_step05.2322.2322.2	1.7823	0.1028	1761.75	2	3670.0%	1	R.VGHSTAHDEIIPMSIR.K
UCOXA_MOUSE85.9%114.8%145160306.5(P12787) Cytochrome c oxidase polypeptide Va, mitochondrial precursor (EC 1.9.3.1)
	TK010303_lung_E18_mito_3_step01.0170.0170.1	1.8542	0.2069	771.73	1	7500.0%	1	K.IIDAALR.A
UQ9CVH785.7%1125.5%106117349.5(Q9CVH7) 2010009P05Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step05.3038.3038.2	2.1753	0.3497	2935.87	3	1920.0%	1	-.MVHILTLGLAVSRPHSLGHLTLLPTTR.L
UQ8TEJ385.7%4618.2%573597649.7(Q8TEJ3) FLJ00204 protein (Fragment)
*	TK010303_lung_E18_mito_3_step12.2297.2297.3	2.7527	0.3318	4679.94	1	1360.0%	1	K.QLIEMDKPCPAAASSCNASLPSDSGAVASVAPSPTLSSSGAVSAFQR.R
*	TK010303_lung_E18_mito_3_step05.2600.2600.2	1.6675	0.3097	2222.45	3	2380.0%	2	K.GASLRTGVSGVFPGNYVTPVSR.V
*	TK010303_lung_E18_mito_3_step02.3736.3736.3	1.7551	0.0402	3507.17	295	880.0%	1	R.SPPSVSPTHDPQVAVDALLQGAVGPEVSSLSIHGR.A
UO8901985.7%8504.1%10621170629.2(O89019) Inversin
*	TK010303_lung_E18_mito_3_step02.3548.3548.3	2.756	0.3283	3591.34	1	1800.0%	1	R.TPIQSAAYGGNINCMAVLMENNADPNIQDKEGR.T
*	TK010303_lung_E18_mito_3_step04.4074.4074.3	2.1919	0.0227	4480.35	1	1440.0%	7	K.INPNVQDYAGRTPIQSAAYGGNINCMAVLMENNADPNIQDK.E
UBGLR_MOUSE85.6%2210.3%648742396.6(P12265) Beta-glucuronidase precursor (EC 3.2.1.31)
*	TK010303_lung_E18_mito_3_step05.4252.4252.3	2.0401	0.1346	4796.37	1	1280.0%	1	R.TSHYPYSEEVLQLCDRYGIVVIDECPGVGIVLPQSFGNESLR.H
*	TK010303_lung_E18_mito_3_step08.2353.2353.2	2.5123	0.2428	2772.07	1	3120.0%	1	K.THQKPIIQSEYGADAIPGIHEDPPR.M
USA18_MOUSE85.4%2211.5%312333049.3(Q9DB41) Solute carrier family 25, member 18 (Fragment)
*	TK010303_lung_E18_mito_3_step11.3873.3873.2	1.3299	0.0557	2457.74	276	1300.0%	1	R.TKIINGGIAGLVGVTCVFPIDLAK.T
*	TK010303_lung_E18_mito_3_step12.1589.1589.1	2.0645	0.1421	1380.62	1	5450.0%	1	K.LWTQEGPAAFMK.G
UQ9Y2L985.4%7279.2%793878016.2(Q9Y2L9) Hypothetical protein KIAA1016 (Fragment)
*	TK010303_lung_E18_mito_3_step10.3861.3861.3	1.7387	0.0523	4003.56	3	1400.0%	1	R.LSATEPSDEDTVSLNVPMSNIMEEEQIIKEDSCHR.L
*	TK010303_lung_E18_mito_3_step02.2514.2514.1	1.7963	0.2128	1465.78	1	3750.0%	1	K.VLPQELVDLPLVK.F
*	TK010303_lung_E18_mito_3_step05.4413.4413.3	2.2732	0.0712	3101.97	9	1880.0%	5	R.LVEVPMELCHFVSLEILNLYHNCIR.V
UQ9HCB685.3%114.1%807909886.1(Q9HCB6) VSGP/F-spondin
	TK010303_lung_E18_mito_3_step03.3553.3553.3	2.9138	0.3186	3917.5	4	1410.0%	1	K.CTVNEECSPSSCLMTEWGEWDECSATCGMGMKK.R
UNCPR_MOUSE85.3%182638.4%677769135.5(P37040) NADPH-cytochrome P450 reductase (EC 1.6.2.4) (CPR) (P450R)
*	TK010303_lung_E18_mito_3_step06.3702.3702.2	1.5238	0.1996	2678.74	4	2050.0%	1	R.EQFWPAVCEFFGVEATGEESSIR.Q
	TK010303_lung_E18_mito_3_step07.2268.2268.3	2.1314	0.1273	3349.52	14	1610.0%	1	R.LEQLGAQRIFELGLGDDDGNLEEDFITWR.E
*	TK010303_lung_E18_mito_3_step03.2588.2588.3	2.1458	0.1378	3135.1	1	2300.0%	1	R.RHILAILQDYPSLRPPIDHLCELLPR.L
*	TK010303_lung_E18_mito_3_step03.3889.3889.3	1.6358	0.0191	4766.8	1	1450.0%	1	R.YESGDHVAVYPANDSTLVNQIGEILGADLDVIMSLNNLDEESNK.K
*	TK010303_lung_E18_mito_3_step02.3073.3073.2	2.4043	0.1451	2586.9	1	3570.0%	2	R.TNVLYELAQYASEPSEQEHLHK.M
*	TK010303_lung_E18_mito_3_step06.2007.2007.2	2.3438	0.2678	1767.55	1	5330.0%	2	K.LIHEGGAHIYVCGDAR.N
*	TK010303_lung_E18_mito_3_step12.4109.4109.2	1.48	0.2094	2981.38	2	2080.0%	1	R.HILAILQDYPSLRPPIDHLCELLPR.L
*	TK010303_lung_E18_mito_3_step02.1962.1962.2	1.3499	0.1204	2898.65	62	1520.0%	1	K.HPFPCPTTYRTALTYYLDITNPPR.T
*	TK010303_lung_E18_mito_3_step12.3028.3028.2	1.5784	0.1193	2574.26	1	2380.0%	2	R.QYELVVHEDMDTAKVYTGEMGR.L
	TK010303_lung_E18_mito_3_step10.3911.3911.2	1.2755	0.0919	2452.65	7	2250.0%	1	R.IFELGLGDDDGNLEEDFITWR.E
*	TK010303_lung_E18_mito_3_step07.1681.1681.1	0.8985	0.044	1276.2	127	3890.0%	1	K.HPFPCPTTYR.T
*	TK010303_lung_E18_mito_3_step12.3795.3795.2	1.5296	0.0551	2990.37	5	1850.0%	1	R.LPFKPTTPVIMVGPGTGVAPFMGFIQER.A
*	TK010303_lung_E18_mito_3_step01.3547.3547.2	1.4152	0.0723	3021.07	7	1600.0%	2	K.DVQNTFYDIVAEFGPMEHTQAVDYVK.K
UQ9WV6985.1%2213.3%405454688.4(Q9WV69) Dematin 52 kDa subunit
	TK010303_lung_E18_mito_3_step12.1544.1544.2	2.1255	0.3466	2377.4	1	3420.0%	1	R.TSLPHFHHPETTRPDSNIYK.K
	TK010303_lung_E18_mito_3_step10.3270.3270.3	1.4175	0.0451	3910.56	44	1140.0%	1	K.FPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWR.K
UPF2R_HUMAN85.1%116.1%359400558.9(P43088) Prostaglandin F2-alpha receptor (Prostanoid FP receptor) (PGF receptor) (PGF2 alpha receptor)
*	TK010303_lung_E18_mito_3_step06.2842.2842.2	2.1302	0.3503	2458.13	1	2860.0%	1	K.MMLSGVCLFAVFIALLPILGHR.D
UCAPB_MOUSE85.0%119.0%277313455.7(P47757) F-actin capping protein beta subunit (CapZ beta)
	TK010303_lung_E18_mito_3_step01.3814.3814.2	2.1289	0.3434	2785.27	1	2500.0%	1	K.NLSDLIDLVPSLCEDLLSSVDQPLK.I
UCLR2_MOUSE84.8%161614.4%29203175935.7(Q9R0M0) Cadherin EGF LAG seven-pass G-type receptor 2 precursor (Flamingo 1) (mFmi1)
	TK010303_lung_E18_mito_3_step12.3552.3552.3	2.6732	0.3446	3425.84	1	1810.0%	1	R.TKPICVFWNHSILVSGTGGWSARGCEVVFR.N
*	TK010303_lung_E18_mito_3_step07.2984.2984.2	1.2552	0.1231	3098.46	3	1670.0%	1	K.TLTYVALGVTLAALMLTFLFLTLLRALR.S
*	TK010303_lung_E18_mito_3_step09.3038.3038.2	1.5421	0.1822	2008.8	3	2890.0%	1	R.LPLEQGTGSSRGSSISEGSR.H
*	TK010303_lung_E18_mito_3_step12.3009.3009.3	2.2384	0.0608	4389.85	14	1220.0%	1	R.TPMEVTVTVLDGNDNPPVFEQDEFDVFVEENSPIGLAVAR.V
*	TK010303_lung_E18_mito_3_step09.3618.3618.2	1.7678	0.1918	2507.03	1	2390.0%	1	R.AGHVRLSMEGTGLQASSLHLEPGR.A
	TK010303_lung_E18_mito_3_step03.4393.4393.3	1.7369	0.0293	3385.46	18	1450.0%	1	R.DSGLNGRVFYTFQGGDDGDGDFIVESTSGIVR.T
	TK010303_lung_E18_mito_3_step10.2405.2405.3	1.6877	0.0886	3437.43	165	1290.0%	1	R.SALATLTILVTDTNDHDPVFEQQEYKESLR.E
*	TK010303_lung_E18_mito_3_step09.3931.3931.3	1.8328	0.1312	4162.67	13	1080.0%	1	R.QSLQEQLNGVMPVAMSINAGTVDEDSSGSEFLFFNFLH.-
	TK010303_lung_E18_mito_3_step11.3025.3025.2	1.4669	0.0914	2541.66	42	1670.0%	1	K.SDTTYLEILVNDVNDNAPQFLR.D
*	TK010303_lung_E18_mito_3_step12.3523.3523.3	2.0062	0.0313	4578.19	1	1170.0%	1	R.GPGHAILSFNYGQQTAEGNLGPRLHGLHLSNITVGGVPGPASGVAR.G
	TK010303_lung_E18_mito_3_step08.3097.3097.3	2.5506	0.1147	3775.0	5	1770.0%	1	K.RHWELIQQTEGGTAWLLQHYEAYASALAQNMR.H
	TK010303_lung_E18_mito_3_step11.4224.4224.2	1.3132	0.0342	3105.79	1	1920.0%	1	R.RSALATLTILVTDTNDHDPVFEQQEYK.E
	TK010303_lung_E18_mito_3_step08.1466.1466.2	1.2934	0.0652	1269.64	59	4500.0%	1	R.VTAQDHGMPRR.S
*	TK010303_lung_E18_mito_3_step10.2809.2809.2	0.971	0.068	2517.38	25	1820.0%	1	R.NATQHTSGYFGSDVKVAYQLATR.L
*	TK010303_lung_E18_mito_3_step01.1098.1098.1	1.1686	5.0E-4	1059.48	13	4500.0%	1	R.VGSALLDAANK.R
*	TK010303_lung_E18_mito_3_step04.3086.3086.3	1.9069	0.0349	3891.9	78	1140.0%	1	R.LEYTMDALFDSRSNHFFSLDPITGVVTTAEELDR.E
UO9530384.8%111.6%27052888996.1(O95303) Gamma-filamin (Filamin 2)
*	TK010303_lung_E18_mito_3_step12.3401.3401.3	3.0264	0.2316	4243.61	1	1370.0%	1	R.ASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILGPEGKPK.K
UQ96JN584.8%225.2%13691536266.5(Q96JN5) Hypothetical protein KIAA1790 (Fragment)
*	TK010303_lung_E18_mito_3_step11.3869.3869.3	3.0598	0.2343	4152.91	2	1430.0%	1	R.IVYDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAK.K
*	TK010303_lung_E18_mito_3_step09.4479.4479.3	1.758	0.0053	3939.52	10	1250.0%	1	K.IYIYTLKGMCPLNTPQQALDTPAVVTCFLAVPVIK.K
URXRA_MOUSE84.8%112.8%467512177.8(P28700) Retinoic acid receptor RXR-alpha
	TK010303_lung_E18_mito_3_step01.3720.3720.1	1.767	0.2167	1458.93	1	4580.0%	1	K.HICAICGDRSSGK.H
UZ197_HUMAN84.5%333.9%10291188478.6(O14709) Zinc finger protein 197 (ZnF20)
*	TK010303_lung_E18_mito_3_step06.3430.3430.2	1.2882	0.0292	2588.75	48	1900.0%	1	K.AFSQSAYLLNHQRIHTGEKPYK.C
*	TK010303_lung_E18_mito_3_step04.2677.2677.1	1.7604	0.2057	1200.44	5	5560.0%	1	R.ECGKTFIMSK.S
*	TK010303_lung_E18_mito_3_step01.1432.1432.1	1.0432	0.0445	968.71	116	4290.0%	1	R.KNLTVHQK.I
UQ96AA284.4%26687.8%66207217015.8(Q96AA2) Obscurin
*	TK010303_lung_E18_mito_3_step10.3235.3235.2	1.2567	0.067	2279.91	7	2380.0%	1	R.LVLPQAGKADAGEYSCEAGGQR.V
*	TK010303_lung_E18_mito_3_step06.1959.1959.3	1.463	0.0263	3625.01	192	1290.0%	1	K.YAEEALLAGDPSQPPPPPLQHYLEQPVERVQR.Y
*	TK010303_lung_E18_mito_3_step11.2005.2005.3	1.8083	0.0092	2813.24	16	1800.0%	1	R.GVEQEDAGDYTCDTGHTQSMASLSVR.V
*	TK010303_lung_E18_mito_3_step06.2763.2763.2	1.3935	0.012	2452.08	2	2860.0%	1	R.VGDTAMFCVELAVPVGPVHWLR.N
*	TK010303_lung_E18_mito_3_step10.2513.2513.3	2.7021	0.2767	3656.87	1	1880.0%	7	K.EQSVHNEVQAEAGASAMLSCEVAQAQTEVTWYK.D
*	TK010303_lung_E18_mito_3_step06.3161.3161.3	1.6544	0.034	2785.21	198	1200.0%	1	R.AGATGVQWCLQGLPLQSNEVTEVAVR.D
*	TK010303_lung_E18_mito_3_step12.2044.2044.3	1.7585	0.0754	4780.6	5	1170.0%	1	R.LTVLGLPDPPEDAEVVAHSSHTVTLSWAAPMSDGGGGLCGYRVEVK.E
*	TK010303_lung_E18_mito_3_step11.2319.2319.3	1.9606	0.0425	2836.18	5	1830.0%	1	K.VTLEDAGTVSFHVGTCSSEAQLKVTAK.N
*	TK010303_lung_E18_mito_3_step04.2102.2102.3	1.6477	0.2033	3128.29	152	1160.0%	1	K.VQAEAGAIATLSCEVAQAQTEVTWYKDGK.K
*	TK010303_lung_E18_mito_3_step07.4416.4416.2	2.1036	0.3541	2751.11	1	2500.0%	1	K.ADAGEYSCEAGGQRVSFQLHITEPK.A
*	TK010303_lung_E18_mito_3_step04.3039.3039.3	2.0677	0.2278	3697.49	140	1030.0%	1	R.NAIGEAFAAVGLQVDAEAACAEQAPHFLLRPTSIR.V
*	TK010303_lung_E18_mito_3_step06.2999.2999.3	1.8446	0.0978	4007.25	9	1150.0%	1	K.MGPQGVSPTTEVPRSSSGHLFTLPGATPGGDPNSNNSNNK.L
	TK010303_lung_E18_mito_3_step09.4311.4311.3	1.5573	0.0242	2802.38	10	2080.0%	1	K.NQEAREGATAVLQCELNSAAPVEWR.K
*	TK010303_lung_E18_mito_3_step12.3947.3947.3	1.6119	0.0156	4325.44	4	1280.0%	1	R.LTVLGLPDPPEDAEVVAHSSHTVTLSWAAPMSDGGGGLCGYR.V
*	TK010303_lung_E18_mito_3_step09.4546.4546.2	0.9893	0.0986	2875.51	3	1880.0%	1	R.LCHELVPGPECVVDGLAPGETYRFR.V
*	TK010303_lung_E18_mito_3_step09.2304.2304.3	2.106	0.0758	3237.23	3	1900.0%	1	R.LVVQQAGQADAGEYSCEAGGQRLSFHLDVK.E
*	TK010303_lung_E18_mito_3_step01.0627.0627.1	1.164	0.0454	1050.53	19	5000.0%	1	R.LAQDGDLYR.L
*	TK010303_lung_E18_mito_3_step05.2792.2792.2	1.4487	0.0407	3144.75	55	1480.0%	1	R.GLQDVTVMEPAPAWFECETSIPSVRPPK.W
*	TK010303_lung_E18_mito_3_step11.2887.2887.2	1.4326	0.077	3154.97	16	1430.0%	1	K.EHEDIILTATLATPSAATVTWLKDGVEIR.R
*	TK010303_lung_E18_mito_3_step01.0155.0155.1	1.3617	0.1373	844.63	70	5000.0%	1	R.NATALAPGK.N
UQ9CY0084.0%112.1%664760965.1(Q9CY00) 2510042P03Rik protein
*	TK010303_lung_E18_mito_3_step01.2823.2823.1	2.0205	0.162	1547.83	4	3850.0%	1	K.LDGLAGMLTEQLRK.L
UQ9D0E183.8%225.6%729776498.6(Q9D0E1) 2610023M21Rik protein
	TK010303_lung_E18_mito_3_step02.2830.2830.2	1.2616	0.0241	1879.35	12	2940.0%	1	R.MGAGMGFGLERMAAPIDR.V
	TK010303_lung_E18_mito_3_step04.2262.2262.2	1.9333	0.3986	2035.31	2	2730.0%	1	R.GNFGGSFAGSFGGAGGHAPGVAR.K
URL19_HUMAN83.5%114.1%1962346611.5(P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19
	TK010303_lung_E18_mito_3_step07.1808.1808.2	2.4735	0.2509	1020.31	2	8570.0%	1	R.ILMEHIHK.L
UQ96GW783.5%111.6%911991174.7(Q96GW7) Chondroitin sulfate proteoglycan BEHAB/brevican
	TK010303_lung_E18_mito_3_step01.3566.3566.1	1.6657	0.2094	1589.87	3	3210.0%	1	R.WKALLIPPSSPMPGP.-
URL23_HUMAN83.4%3517.1%1401486510.5(P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17)
	TK010303_lung_E18_mito_3_step01.2044.2044.1	1.2291	0.0104	1460.64	129	2500.0%	1	R.LPAAGVGDMVMATVK.K
	TK010303_lung_E18_mito_3_step12.1103.1103.1	1.7531	0.2306	1020.65	6	6250.0%	2	K.KVHPAVVIR.Q
UQ8VIJ683.4%5714.3%699754429.4(Q8VIJ6) PTB-associated splicing factor
*	TK010303_lung_E18_mito_3_step03.3443.3443.2	1.4895	0.1183	2571.93	1	2410.0%	1	K.GGKMPGGPKPGGGPGMGAPGGHPKPPHR.G
	TK010303_lung_E18_mito_3_step01.4146.4146.2	1.0407	0.0133	3194.82	5	1720.0%	1	K.FPPLGGGGGIGYEANPGVPPATMSGSMMGSDMR.T
	TK010303_lung_E18_mito_3_step03.3759.3759.2	2.072	0.3576	2640.11	1	2730.0%	2	R.NLSPYVSNELLEEAFSQFGPIER.A
	TK010303_lung_E18_mito_3_step08.1690.1690.3	1.7889	0.061	1744.16	2	3170.0%	1	R.ALAEIAKAELDDTPMR.G
UCO1C_MOUSE83.3%4610.3%474531417.1(Q9WUM4) Coronin 1C (Coronin 3)
	TK010303_lung_E18_mito_3_step03.2157.2157.1	1.7986	0.2013	1207.61	2	5000.0%	1	R.VGIVAWHPTAR.N
	TK010303_lung_E18_mito_3_step02.3096.3096.2	1.195	0.0928	3146.47	21	1670.0%	1	K.SDLFQDDLYPDTAGPEAALEAEEWFEGK.N
	TK010303_lung_E18_mito_3_step01.3651.3651.3	1.8951	0.1223	4213.45	32	1220.0%	2	K.SDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLK.H
UHO1_MOUSE83.0%2216.3%289329296.5(P14901) Heme oxygenase 1 (EC 1.14.99.3) (HO-1) (P32 protein)
*	TK010303_lung_E18_mito_3_step05.3517.3517.3	2.9561	0.285	3592.29	1	1980.0%	1	R.AALEQDMAFWYGPHWQEIIPCTPATQHYVK.R
*	TK010303_lung_E18_mito_3_step08.2554.2554.2	1.3798	0.0578	2130.63	3	2810.0%	1	K.QNPVYAPLYFPEELHRR.A
UPCCA_HUMAN82.8%5716.1%703773547.1(P05165) Propionyl-CoA carboxylase alpha chain, mitochondrial precursor (EC 6.4.1.3) (PCCase alpha subunit) (Propanoyl-CoA:carbon dioxide ligase alpha subunit)
*	TK010303_lung_E18_mito_3_step10.2297.2297.3	1.4894	0.0051	2132.9	1	2500.0%	2	K.VHTVVASNNGSVFSVEVDGSK.L
*	TK010303_lung_E18_mito_3_step01.2680.2680.3	1.8371	0.0393	4120.83	27	1220.0%	1	R.SPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMTAGK.T
*	TK010303_lung_E18_mito_3_step04.2937.2937.2	2.194	0.3324	2915.03	1	2690.0%	1	R.CLAAEDVVFIGPDTHAIQAMGDKIESK.L
*	TK010303_lung_E18_mito_3_step06.2067.2067.3	1.9877	0.0625	2883.2	41	1770.0%	1	R.LQVEHPVTECITGLDLVQEMIRVAK.G
UQ99ML982.8%3310.1%9891078967.1(Q99ML9) Arkadia
*	TK010303_lung_E18_mito_3_step07.2269.2269.3	2.0565	0.324	3681.82	1	1670.0%	1	R.ISTVIQPLRQNAAEVVDLTVDEDEPTIVPTTSAR.M
*	TK010303_lung_E18_mito_3_step12.4085.4085.2	2.1871	0.3319	2394.03	1	2730.0%	1	R.THGSGGFHGASAFDPCCPVTSSR.A
*	TK010303_lung_E18_mito_3_step07.1558.1558.3	1.8429	0.2006	4404.27	2	1250.0%	1	R.AAVFGHQAAAAPTQPLSIDGYGSSMVAQPQPQPPPQPSLSSCR.H
UQ9D99082.8%1112.2%304329375.1(Q9D990) 4632415H16Rik protein
*	TK010303_lung_E18_mito_3_step11.3149.3149.3	2.9473	0.3102	3967.19	3	1390.0%	1	R.EEGPECETPAIFISMDDDSGLAETTLLDSSLEGPLPK.E
UQ9D1D482.7%4812.3%219249116.7(Q9D1D4) 1110014C03Rik protein
	TK010303_lung_E18_mito_3_step02.2036.2036.1	1.528	0.2325	1096.67	1	6250.0%	2	K.LKPLEVELR.R
	TK010303_lung_E18_mito_3_step06.4067.4067.2	1.2941	0.0153	2269.4	7	2350.0%	2	K.FAFTTEDYDMFEVCFESK.G
UML1A_MOUSE82.6%112.3%353398379.3(Q61184) Melatonin receptor type 1A (Mel-1A-R)
*	TK010303_lung_E18_mito_3_step04.3751.3751.1	1.6099	0.2073	1032.52	1	7140.0%	1	K.YDKIYSNK.N
UNCO2_MOUSE82.5%335.0%14621585116.7(Q61026) Nuclear receptor coactivator 2 (Transcriptional intermediary factor 2) (Glucocorticoid receptor-interacting protein 1) (GRIP-1)
*	TK010303_lung_E18_mito_3_step02.2421.2421.3	2.191	0.3849	4072.99	2	1600.0%	1	R.QPLMNQISSVSNVNLTLRPGVPTQAPINAQMLAQRQR.E
*	TK010303_lung_E18_mito_3_step01.0563.0563.1	1.4355	0.3135	887.45	1	5710.0%	1	K.QEPASPKK.K
*	TK010303_lung_E18_mito_3_step01.3564.3564.2	1.3568	0.116	2875.99	2	2220.0%	1	K.QAIINDLMQLTADSSPVPPAGAQKAALR.M
UO3573782.4%116.5%449491996.3(O35737) Heterogeneous nuclear ribonucleoprotein H
	TK010303_lung_E18_mito_3_step02.3296.3296.2	1.9483	0.3654	3081.84	4	1790.0%	1	R.GAYGGGYGGYDDYNGYNDGYGFGSDRFGR.D
URS2_MOUSE82.4%51113.7%2933121710.2(P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein)
	TK010303_lung_E18_mito_3_step11.1059.1059.1	1.1975	0.0117	1136.45	40	5000.0%	1	K.IGKPHTVPCK.V
	TK010303_lung_E18_mito_3_step04.3951.3951.2	1.4033	0.2115	2157.28	12	2220.0%	3	K.ESEIIDFFLGASLKDEVLK.I
	TK010303_lung_E18_mito_3_step01.0250.0250.1	1.4995	0.1988	1140.61	1	5500.0%	1	R.GCTATLGNFAK.A
U143B_MOUSE82.4%244.1%245279554.8(Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1)
	TK010303_lung_E18_mito_3_step01.2772.2772.1	1.8917	0.1955	1191.88	1	6670.0%	2	K.DSTLIMQLLR.D
UQ96JP882.4%998.0%28093003265.1(Q96JP8) Fibrillin3
*	TK010303_lung_E18_mito_3_step11.2141.2141.2	2.422	0.2807	2085.34	1	3950.0%	1	K.NSAEFQALCSSGLGITTDGR.D
*	TK010303_lung_E18_mito_3_step04.2510.2510.3	1.7501	0.0704	3814.92	9	1470.0%	1	R.AGQGHCVSGLGFSPGPQDTPDKEELLSSEACYECK.I
*	TK010303_lung_E18_mito_3_step12.1896.1896.3	1.6108	0.013	2803.41	102	1500.0%	1	R.DHQVNLATLDSEALLTLGLNLSHLGR.A
*	TK010303_lung_E18_mito_3_step09.1951.1951.2	1.3966	0.1426	2999.13	17	1250.0%	1	R.LLLAWSALLCMAGGQGRWDGALEAAGPGR.V
*	TK010303_lung_E18_mito_3_step11.2788.2788.2	1.4812	0.2081	2944.6	3	2000.0%	1	R.FGHCLNTAGSFHCLCQDGFELTADGK.N
*	TK010303_lung_E18_mito_3_step01.4172.4172.3	1.2261	0.0015	2904.26	81	1740.0%	1	R.TCVDVDECDLNPHICLHGDCENTK.G
*	TK010303_lung_E18_mito_3_step01.3756.3756.3	1.4109	0.0605	4529.89	32	940.0%	1	K.NLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQPDLCVNGR.C
*	TK010303_lung_E18_mito_3_step09.2031.2031.3	1.7044	0.03	3160.73	9	1880.0%	1	R.DHQVNLATLDSEALLTLGLNLSHLGRAER.I
*	TK010303_lung_E18_mito_3_step05.2268.2268.2	0.98	0.0278	2380.59	7	2370.0%	1	R.DVDECADGQQDCHARGMECK.N
UQ9DCP482.3%3915.2%223252519.3(Q9DCP4) 0610012H03Rik protein
*	TK010303_lung_E18_mito_3_step08.3138.3138.3	2.9356	0.293	3780.13	1	1670.0%	3	K.LAQFDTLACTTGSSVHVFVNPATNKPENLPEDFR.R
UQ9UKC782.2%3521.6%283304558.4(Q9UKC7) F-box protein Fbl6 (Fragment)
*	TK010303_lung_E18_mito_3_step10.2514.2514.2	1.1582	0.0036	2598.26	332	1250.0%	2	R.GVAPGPGFPSLEELCLASSTCNFVS.-
	TK010303_lung_E18_mito_3_step08.3224.3224.3	3.0456	0.1705	3982.33	2	1570.0%	1	R.KLWLTYSSQTTAILGALLGSCCPQLQVLEVSTGINR.N
UQ9H2S582.2%3314.3%420455248.4(Q9H2S5) HZFw1 protein
	TK010303_lung_E18_mito_3_step02.2894.2894.2	1.3569	0.1737	2711.49	3	1800.0%	1	R.DSSGEDADDEESHYAVGAAGESVQRK.G
*	TK010303_lung_E18_mito_3_step09.2983.2983.2	1.94	0.3822	2116.25	1	3680.0%	1	R.LWALTAPEPTLLGGVEPPPR.R
	TK010303_lung_E18_mito_3_step01.1578.1578.1	1.3205	0.0296	1347.71	13	3850.0%	1	R.SKAVTVVAEGAASR.S
UDHB8_HUMAN82.2%113.8%261269746.5(Q92506) Estradiol 17 beta-dehydrogenase 8 (EC 1.1.1.62) (17-beta-HSD 8) (17-beta-hydroxysteroid dehydrogenase 8) (Ke6 protein) (Ke-6)
*	TK010303_lung_E18_mito_3_step11.1972.1972.1	1.8745	0.1934	1218.66	1	5000.0%	1	-.MASQLQNRLR.S
URLA0_MOUSE82.0%41010.1%317342166.2(P14869) 60S acidic ribosomal protein P0 (L10E)
	TK010303_lung_E18_mito_3_step01.0232.0232.1	1.4354	0.0213	720.48	87	6000.0%	1	R.FLEGVR.N
	TK010303_lung_E18_mito_3_step02.2914.2914.2	1.7873	0.1058	2790.1	1	2600.0%	3	R.NVASVCLQIGYPTVASVPHSIINGYK.R
UATH1_MOUSE82.0%398.3%351378547.9(P48985) Atonal protein homolog 1 (Helix-loop-helix protein mATH-1) (MATH1)
*	TK010303_lung_E18_mito_3_step06.2509.2509.2	2.1025	0.0044	3039.8	2	1960.0%	3	R.ALTAMMAQKDLSPSLPGGILQPVQEDNSK.T
USUT3_HUMAN82.0%2213.8%399443628.5(O75486) Transcription initiation protein SPT3 homolog (SPT3-like protein)
*	TK010303_lung_E18_mito_3_step02.3180.3180.2	1.8916	0.4192	2484.24	1	2500.0%	1	R.STGKSISFATELQSMMYSLGDAR.R
*	TK010303_lung_E18_mito_3_step04.4498.4498.3	1.79	0.1547	3621.72	1	1770.0%	1	R.RPLHETAVLVEDVVHTQLINLLQQAAEVSQLR.G
UQ9C0D281.9%334.6%15161710615.8(Q9C0D2) Hypothetical protein KIAA1731 (Fragment)
*	TK010303_lung_E18_mito_3_step01.2662.2662.1	1.7163	0.2003	1441.68	1	6000.0%	1	R.NYQHQLLQQNR.L
*	TK010303_lung_E18_mito_3_step11.1796.1796.2	1.5453	0.0423	1875.13	2	3670.0%	1	K.RLSLSQPILSQQNNFK.F
*	TK010303_lung_E18_mito_3_step04.3470.3470.3	1.6351	0.0191	4678.81	15	1040.0%	1	K.STVSTSHSIISQMHDRPLLPSENITAQQGNMKALQEQLDLQK.K
UQ96BY681.8%112.0%542623246.2(Q96BY6) Hypothetical protein
*	TK010303_lung_E18_mito_3_step01.2832.2832.1	2.0318	0.1132	1258.31	3	6000.0%	1	K.IIQDSNKVNPK.D
UCES2_HUMAN81.8%336.0%14841642157.0(Q9BXF3) Cat eye syndrome critical region protein 2
*	TK010303_lung_E18_mito_3_step11.1016.1016.3	1.5931	0.0608	2885.76	2	1830.0%	1	R.SLFSDKNAMASLQGCETLNAALTSPTR.M
*	TK010303_lung_E18_mito_3_step02.2964.2964.2	2.4665	0.0024	2224.22	3	3820.0%	1	R.DITPQTFHSYLEDIINYR.W
*	TK010303_lung_E18_mito_3_step12.3813.3813.3	1.6384	0.0359	4550.94	2	1220.0%	1	R.LQPPPVPAPSSLFGAPAQALRGVQGGDSMMDSPEMIAMQQLSSR.V
UQ96T8881.8%469.8%793898147.6(Q96T88) Nuclear zinc finger protein Np95
*	TK010303_lung_E18_mito_3_step08.2349.2349.2	1.8412	0.0185	1956.52	1	3440.0%	2	R.ELYANVVLGDDSLNDCR.I
*	TK010303_lung_E18_mito_3_step11.3559.3559.2	2.4632	0.0465	2585.59	2	2950.0%	1	K.ECTIVPSNHYGPIPGIPVGTMWR.F
*	TK010303_lung_E18_mito_3_step11.4009.4009.3	1.7467	0.0119	4260.63	227	880.0%	1	K.SSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDAR.D
USAA2_MOUSE81.8%1118.0%122136226.9(P05367) Serum amyloid A-2 protein precursor [Contains: Amyloid protein A (Amyloid fibril protein AA)]
*	TK010303_lung_E18_mito_3_step12.3356.3356.2	2.4637	0.0586	2600.18	3	2860.0%	1	R.ESFQEFFGRGHEDTMADQEANR.H
UO3537981.7%558.8%15281711847.4(O35379) Multidrug resistance protein
*	TK010303_lung_E18_mito_3_step03.2924.2924.3	1.7415	0.0475	3330.98	3	1670.0%	1	R.NPCPESSASFLSRITFWWITGMMVHGYR.Q
	TK010303_lung_E18_mito_3_step01.3754.3754.1	1.699	0.2039	1485.8	1	5000.0%	1	K.LMNEILNGIKVLK.L
*	TK010303_lung_E18_mito_3_step12.2072.2072.3	2.2421	0.0789	3932.39	8	1280.0%	1	R.TYANAEQDLASEDDSVSGSGKESKPVENGMLVTDTVGK.H
*	TK010303_lung_E18_mito_3_step05.3453.3453.2	1.1624	0.0147	2866.32	19	1610.0%	1	R.GEPPTLNGITFSIPEGALVAVVGQVGCGK.S
*	TK010303_lung_E18_mito_3_step05.4270.4270.2	1.2635	0.174	2980.1	4	1730.0%	1	R.APVLLVSPTLLGITMLLATFLIQLERR.K
UQ1498181.6%391.4%21012362955.9(Q14981) NuMA protein
*	TK010303_lung_E18_mito_3_step11.3219.3219.3	2.0799	0.0282	3619.74	2	1720.0%	3	R.DGYEDSQQEEAQYGAMFQEQLMTLKEECEK.A
UQ9JI8481.6%2216.1%329375578.2(Q9JI84) EPCS24 (Fragment)
	TK010303_lung_E18_mito_3_step07.3217.3217.3	1.4895	0.0081	3441.85	46	1420.0%	1	K.GCDGGRPYDAFQYVKNNGGLEAEATYPYEAK.A
	TK010303_lung_E18_mito_3_step12.2896.2896.2	2.4355	0.2196	2415.01	2	2860.0%	1	K.TGKLIPLSVQNLMDCSVSYGTK.G
UROK_MOUSE81.6%226.7%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein)
	TK010303_lung_E18_mito_3_step07.2577.2577.3	1.3534	0.0142	1915.69	57	2080.0%	1	R.GSYGDLGGPIITTQVTIPK.D
	TK010303_lung_E18_mito_3_step01.2735.2735.1	1.9806	0.1837	1342.72	1	5910.0%	1	K.IILDLISESPIK.G
UQ99MD781.4%4416.1%657754197.9(Q99MD7) UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7
	TK010303_lung_E18_mito_3_step11.2659.2659.3	1.5411	0.0167	3918.58	18	1090.0%	1	K.DFFFELGLYDPGLQIWGGENFEISYKIWQCGGK.L
	TK010303_lung_E18_mito_3_step01.0392.0392.3	1.7318	0.0539	1832.67	69	2330.0%	1	K.EFGFNMVASDMISLDR.S
*	TK010303_lung_E18_mito_3_step12.3344.3344.3	1.5881	3.0E-4	3918.95	14	1290.0%	1	K.IGFILRSLLVVGSFLGLVVLWSSLSSRPDDQSPLSR.M
	TK010303_lung_E18_mito_3_step11.3013.3013.2	2.1624	0.3298	2432.59	1	3750.0%	1	R.FKPVVPWPHVEGVEVDLESIR.R
UBTK_MOUSE81.4%3311.8%659764387.9(P35991) Tyrosine-protein kinase BTK (EC 2.7.1.112) (Bruton's tyrosine kinase) (Agammaglobulinaemia tyrosine kinase) (ATK) (B cell progenitor kinase) (BPK) (Kinase EMB)
*	TK010303_lung_E18_mito_3_step06.2665.2665.3	1.8666	0.1371	3215.44	1	1830.0%	1	K.NGQEGYIPSNYITEAEDSIEMYEWYSK.H
*	TK010303_lung_E18_mito_3_step12.2880.2880.2	2.153	0.332	2234.6	1	3250.0%	1	K.QNKNAPSTAGLGYGSWEIDPK.D
	TK010303_lung_E18_mito_3_step10.3553.3553.3	2.6319	0.1187	3725.68	14	1640.0%	1	K.YHPCFWIDGQYLCCSQTAKNAMGCQILENR.N
UQ9NVU681.1%112.5%674733644.6(Q9NVU6) Hypothetical protein FLJ10499
*	TK010303_lung_E18_mito_3_step09.3224.3224.2	2.4574	0.1706	1857.34	1	3750.0%	1	R.IAQAQEELSPCLTPAAR.A
UQ8WYP581.1%888.9%22662525566.6(Q8WYP5) Transcription factor ELYS
*	TK010303_lung_E18_mito_3_step08.2169.2169.2	1.7673	0.0425	1949.36	38	2650.0%	1	K.DGDKDVFASEVTPSDLQK.Q
*	TK010303_lung_E18_mito_3_step08.4413.4413.2	1.6343	0.138	2491.34	22	2250.0%	1	K.FLQSSASVQNHEFLLVHHLQR.A
	TK010303_lung_E18_mito_3_step02.4001.4001.3	1.2949	0.0346	4434.53	36	900.0%	1	R.EEGVNEALSPDTSVSVFTWQVNIYGQGKPSVYLGLFDINR.W
	TK010303_lung_E18_mito_3_step02.3193.3193.2	1.4795	0.0927	2730.72	136	1520.0%	1	K.KEVNQDILENTSSVEQELQITTGR.E
*	TK010303_lung_E18_mito_3_step03.2716.2716.2	1.0662	0.0766	2645.79	17	1880.0%	1	K.ESAWSLPPIEIRLISPLASPADGVK.S
*	TK010303_lung_E18_mito_3_step11.2283.2283.3	2.0114	0.0385	4056.47	39	1210.0%	1	K.LPFTDTEQECLVKFLQSSASVQNHEFLLVHHLQR.A
*	TK010303_lung_E18_mito_3_step01.3543.3543.2	1.2222	0.0479	2888.32	9	2080.0%	1	R.LLDLVVQPVPRPSQCSEFIQQSSMK.S
	TK010303_lung_E18_mito_3_step08.2800.2800.3	2.662	0.3552	4171.81	1	1570.0%	1	R.SGEYLHNCSYFALWSLESVVSRTSPHGILDILVHER.S
URB5B_HUMAN81.0%114.7%215237078.1(P35239) Ras-related protein Rab-5B (P35239) Ras-related protein Rab-5B
	TK010303_lung_E18_mito_3_step02.1961.1961.1	2.0313	0.0993	1301.59	1	6110.0%	1	R.YHSLAPMYYR.G
UO1474581.0%3322.9%358388685.8(O14745) Ezrin-radixin-moesin binding phosphoprotein-50 (Solute carrier family 9 (Sodium/hydrogen exchanger), isoform 3 regulatory factor 1) (Similar to solute carrier family 9 (Sodium/hydrogen exchanger), isoform 3 regulatory factor 1)
*	TK010303_lung_E18_mito_3_step01.3804.3804.3	2.1901	0.0294	3657.57	5	1690.0%	1	R.EALAEAALESPRPALVRSASSDTSEELNSQDSPPK.Q
*	TK010303_lung_E18_mito_3_step11.2297.2297.2	1.142	0.0059	2398.8	3	2140.0%	1	R.IVEVNGVCMEGKQHGDVVSAIR.A
*	TK010303_lung_E18_mito_3_step09.3262.3262.2	2.0038	0.3476	2833.09	1	2500.0%	1	K.CRVIPSQEHLNGPLPVPFTNGEIQK.E
UQ9UL5180.9%338.4%889970569.1(Q9UL51) Hyperpolarization-activated, cyclic nucleotide-gated channel 2
*	TK010303_lung_E18_mito_3_step04.3559.3559.3	2.032	0.0496	3864.15	1	1540.0%	1	R.ASRPLSASQPSLPHGAPGPAASTRPASSSTPRLGPTPAAR.A
	TK010303_lung_E18_mito_3_step04.3310.3310.2	1.6657	0.0181	2990.41	1	2100.0%	1	R.LVRRPPPGPAPAAASPGPPPPASPPGAPASPR.A
	TK010303_lung_E18_mito_3_step12.3283.3283.2	1.9258	0.3826	2948.02	5	1450.0%	1	R.RPPPGPAPAAASPGPPPPASPPGAPASPRAPR.T
UQ9D8I880.8%223.3%793894486.8(Q9D8I8) 1810074P20Rik protein
*	TK010303_lung_E18_mito_3_step09.3712.3712.3	2.3279	0.2159	2963.35	32	1600.0%	1	R.VNIVDLQQVINVDLTHIESRVSDIIK.S
*	TK010303_lung_E18_mito_3_step08.3673.3673.2	2.3357	0.2974	2307.96	1	2890.0%	1	R.VNIVDLQQVINVDLTHIESR.V
UQ921N680.7%116.6%572649209.9(Q921N6) Similar to hypothetical protein FLJ20596
*	TK010303_lung_E18_mito_3_step03.3036.3036.3	2.6706	0.3246	4194.41	1	1620.0%	1	R.AAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADK.M
UQ9BUI880.6%118.9%417465117.8(Q9BUI8) Hypothetical protein
*	TK010303_lung_E18_mito_3_step03.3804.3804.3	2.9215	0.3051	4037.0	3	1320.0%	1	R.IMAYCDALSCLVISQPSPQASFLPGFGVKMLSTANMK.S
UYB1_MOUSE80.5%227.1%322357309.9(P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB)
	TK010303_lung_E18_mito_3_step01.0347.0347.1	1.7579	0.1968	1286.48	1	5500.0%	1	K.EDVFVHQTAIK.K
	TK010303_lung_E18_mito_3_step11.0475.0475.2	1.5323	0.2811	1422.32	3	5000.0%	1	R.RRPENPKPQDGK.E
UQ96EG180.5%114.4%525570616.6(Q96EG1) Similar to KIAA1001 protein
	TK010303_lung_E18_mito_3_step05.2721.2721.2	1.8595	0.3973	2491.61	1	2500.0%	1	K.VLLAGVSFSGFLYPLVDFCISGK.T
UVIL1_HUMAN80.4%111.3%826925646.4(P09327) Villin 1
	TK010303_lung_E18_mito_3_step11.1548.1548.1	1.5804	0.2051	1265.61	2	4500.0%	1	R.EVQGNESEAFR.G
UPLSB_MOUSE80.2%448.3%827936907.9(Q61586) Glycerol-3-phosphate acyltransferase, mitochondrial precursor (EC 2.3.1.15) (GPAT) (P90)
*	TK010303_lung_E18_mito_3_step11.1623.1623.3	1.7691	0.0959	2945.94	37	1670.0%	1	R.ALLHGHVVELLRQQQFLEIFLEGTR.S
*	TK010303_lung_E18_mito_3_step11.2244.2244.1	2.0838	0.0658	1356.62	1	5000.0%	1	R.ALLHGHVVELLR.Q
*	TK010303_lung_E18_mito_3_step06.1894.1894.2	1.0313	0.106	2267.91	3	2000.0%	1	K.APYIASGNNLNIPVFSTLIHK.L
	TK010303_lung_E18_mito_3_step01.0423.0423.2	1.2159	0.0896	2382.06	22	2500.0%	1	R.VQEAIAEVAAELNPDGSAQQQSK.A
UIF2G_MOUSE80.2%3316.3%471509348.4(Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X)
	TK010303_lung_E18_mito_3_step02.2954.2954.2	2.3875	0.2568	2572.78	1	3750.0%	1	K.IVSLFAEHNDLQYAAPGGLIGVGTK.I
	TK010303_lung_E18_mito_3_step06.3566.3566.2	1.424	0.0408	2563.29	4	2500.0%	1	R.SFDVNKPGCEVDDLKGGVAGGSILK.G
	TK010303_lung_E18_mito_3_step02.3416.3416.2	2.3734	0.1178	2850.29	7	2690.0%	1	K.LTPLSHEVISRQATINIGTIGHVAHGK.S
UQ9D18480.2%113.9%330367465.1(Q9D184) 2810434B10Rik protein
	TK010303_lung_E18_mito_3_step01.2248.2248.1	1.9536	0.154	1375.33	2	5420.0%	1	K.LGFGTGVSVYLMK.R
UQ9H4S780.1%4612.4%615684885.0(Q9H4S7) BA563A22B.1 (Contains a novel protein similar to otoferlin (A FER-1-like protein)) (Fragment)
	TK010303_lung_E18_mito_3_step10.4091.4091.2	1.4831	0.1636	2643.29	1	2270.0%	1	K.FKGSFLIYPESEAVLFSEPQISR.G
*	TK010303_lung_E18_mito_3_step05.2782.2782.2	1.9114	0.3789	2926.34	3	2080.0%	2	R.FTFRGHEDPPEEEGEMEETGDMMPK.G
*	TK010303_lung_E18_mito_3_step07.2569.2569.3	1.56	0.0551	3231.21	61	1390.0%	1	K.DTAPLFHPQDLPEQPYLQPPLSILVIER.R
UQ9H6U180.1%2210.3%320334045.7(Q9H6U1) Hypothetical protein FLJ21870
*	TK010303_lung_E18_mito_3_step04.2266.2266.2	1.8946	0.3842	1828.47	1	3530.0%	1	K.ELVNAVATVRVDPADGAK.Y
*	TK010303_lung_E18_mito_3_step09.3339.3339.2	1.4746	0.1517	1691.08	52	3210.0%	1	K.RFCEGPSEPSGDPPR.I
UQ925Q880.0%3315.3%634685898.9(Q925Q8) Dachshund-like protein DACH2
	TK010303_lung_E18_mito_3_step01.3871.3871.1	1.9081	0.1855	1592.35	2	4580.0%	1	K.DFETLFTDCTNAR.R
*	TK010303_lung_E18_mito_3_step05.3890.3890.3	1.9042	0.0407	3898.62	3	1510.0%	1	R.LTPNMINSFMANNHNGSVLGGGIGGGSGGSSNTNTNECR.M
*	TK010303_lung_E18_mito_3_step10.3487.3487.3	2.0797	0.0546	4521.38	1	1590.0%	1	K.DKIQSPLAASGPQHGIAHAALAGQPGLGGAPTLNPLQQNHLLSNR.L
UMLES_HUMAN80.0%1118.0%150168304.6(P24572) Myosin light chain alkali, smooth-muscle isoform (MLC3SM) (LC17B) (LC17-GI)
*	TK010303_lung_E18_mito_3_step04.3123.3123.2	2.0703	0.335	3154.77	2	2310.0%	1	K.MTEEEVEMLVAGHEDSNGCINYEELVR.M
UCDB6_HUMAN79.8%224.9%794873505.0(Q9Y5E3) Protocadherin beta 6 precursor (PCDH-beta6)
*	TK010303_lung_E18_mito_3_step01.2504.2504.1	1.9036	0.1746	1593.69	2	4620.0%	1	R.EMLLKISEITMPGK.I
*	TK010303_lung_E18_mito_3_step11.1191.1191.3	1.765	0.1002	2618.19	8	2190.0%	1	K.ALDFEEIQSYDVDVEATDGGGLSGK.C
UQ8WUG879.8%449.1%9351070858.0(Q8WUG8) Similar to hypothetical protein FLJ20311
	TK010303_lung_E18_mito_3_step10.2706.2706.3	2.1358	0.0448	3186.08	55	1470.0%	1	K.ACVASNDIEGIVCLTAAVHIILVINAGKHK.S
	TK010303_lung_E18_mito_3_step10.2683.2683.2	1.1113	0.0424	2409.53	16	2110.0%	1	K.ICPMEHILVRLETDSRPVSR.R
*	TK010303_lung_E18_mito_3_step05.4308.4308.2	1.2684	0.0673	2492.16	4	2380.0%	1	R.KVSDVEELTPPEHLSDLPPFSR.C
	TK010303_lung_E18_mito_3_step08.1981.1981.2	2.4167	0.161	1493.53	1	5830.0%	1	K.SSNVVRSFLDELK.A
UQ6140879.7%449.4%808916547.5(Q61408) Complement factor H-related protein
*	TK010303_lung_E18_mito_3_step11.2037.2037.2	1.3714	0.1889	2898.63	1	2000.0%	1	K.TSCPPPPQIPNTLVIETTVKYLDGEK.L
*	TK010303_lung_E18_mito_3_step03.3252.3252.2	1.2798	0.0651	2571.35	3	2250.0%	1	K.YSYKCDNGFSPPSGLFWDYLR.C
*	TK010303_lung_E18_mito_3_step09.1994.1994.1	1.6967	0.0463	1421.6	19	4500.0%	1	K.SCEFPQFKYGR.L
*	TK010303_lung_E18_mito_3_step02.2224.2224.2	2.4132	0.2215	2256.63	7	2650.0%	1	K.LNDKLDYECLIGHENEYK.H
UQ9BRP779.7%3311.7%625704886.8(Q9BRP7) Hypothetical protein (Fragment)
*	TK010303_lung_E18_mito_3_step05.3528.3528.3	1.9452	0.024	3916.39	25	1250.0%	1	K.ICLRPSLLVHVQDVIEVPDFLSGSLHILSGPVFQK.C
*	TK010303_lung_E18_mito_3_step12.2691.2691.2	2.4182	0.1194	1922.01	1	4690.0%	1	K.LGNQWFSFPEPEALVGK.L
*	TK010303_lung_E18_mito_3_step02.2662.2662.2	1.4509	0.0725	2608.49	18	2000.0%	1	K.SHSLYPPCYVHDVSFWIDQKK.G
UQ9Y4D779.7%101212.0%19852181887.8(Q9Y4D7) Hypothetical protein KIAA0620 (Fragment)
*	TK010303_lung_E18_mito_3_step10.3409.3409.3	1.9802	0.0037	3548.69	78	1290.0%	2	K.LGFVSAFLHPSDPPPGAQSYAYLALNSEARAGDK.E
*	TK010303_lung_E18_mito_3_step04.2143.2143.2	1.1136	0.1056	2616.39	104	1820.0%	1	R.CSLASLLTIALHGKLEYYTSIMK.E
*	TK010303_lung_E18_mito_3_step02.4514.4514.2	1.216	0.061	2820.63	30	1670.0%	1	R.ENIEAKPRNLNVSFQGCGMDSLSVR.A
*	TK010303_lung_E18_mito_3_step06.4393.4393.2	1.4622	0.164	2877.03	114	1400.0%	1	R.TDTSIACTMPEGALPAPVPVCVRFER.R
*	TK010303_lung_E18_mito_3_step03.3557.3557.2	1.2838	0.0806	1897.5	208	2060.0%	1	K.LTESYIQLGLQCAGGAGR.G
*	TK010303_lung_E18_mito_3_step06.2253.2253.3	1.7576	0.0162	3244.68	14	1750.0%	1	R.AARTACFVEPAPDVVAVLDSVVQGTGPACER.K
*	TK010303_lung_E18_mito_3_step12.3545.3545.3	2.0598	0.0681	4023.9	3	1320.0%	1	K.CSSLYEERYVLPSQTLNSQGSSQAQETHPLLGEWK.I
*	TK010303_lung_E18_mito_3_step06.0213.0213.3	1.1631	0.0271	3024.49	9	1600.0%	1	K.HHPGEPLTLVIHKEQDSLGLQSHEYR.V
*	TK010303_lung_E18_mito_3_step05.3852.3852.2	2.4051	0.1151	2474.09	1	3000.0%	1	K.DLDTEKYFHLVLPTDELAEPK.K
URS17_MOUSE79.7%4625.4%134153939.8(P06584) 40S ribosomal protein S17
	TK010303_lung_E18_mito_3_step02.2821.2821.2	1.753	0.1269	2492.94	1	3100.0%	1	R.DNYVPEVSALDQEIIEVDPDTK.E
	TK010303_lung_E18_mito_3_step03.2060.2060.1	2.0071	0.1444	1417.58	6	5910.0%	2	K.RVCEEIAIIPSK.K
U143E_HUMAN79.6%359.4%255291744.7(P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E)
	TK010303_lung_E18_mito_3_step05.2066.2066.1	1.4019	0.144	1324.46	1	4090.0%	2	R.KEAAENSLVAYK.A
	TK010303_lung_E18_mito_3_step01.2755.2755.1	2.0832	0.2823	1476.69	6	4090.0%	1	K.LICCDILDVLDK.H
UQ9CUR279.6%116.0%184207767.0(Q9CUR2) 4921517N04Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step01.3130.3130.1	2.0462	0.0064	1134.02	2	7000.0%	1	K.MADNLLAAADK.Y
UDBPA_HUMAN79.6%228.9%372400609.8(P16989) DNA-binding protein A (Cold shock domain protein A) (Single-strand DNA binding protein NF-GMB)
	TK010303_lung_E18_mito_3_step09.3023.3023.2	1.7621	0.1089	1769.04	1	3670.0%	1	K.ENQQATSGPNQPSVRR.G
	TK010303_lung_E18_mito_3_step09.2175.2175.2	1.88	0.3865	1744.44	1	4060.0%	1	R.GPPRPRPAPAVGEAEDK.E
UQ9H76079.5%245.5%200217398.8(Q9H760) Hypothetical protein FLJ21277
*	TK010303_lung_E18_mito_3_step09.1903.1903.1	1.6922	0.1972	1216.64	5	4500.0%	2	R.RDLGLGAWVAR.I
UENP1_MOUSE79.5%112.9%510572055.9(P55772) Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (NTPDase1) (Ecto-ATP diphosphohydrolase) (ATPDase) (Lymphoid cell activation antigen) (Ecto-apyrase) (CD39 antigen)
*	TK010303_lung_E18_mito_3_step09.2192.2192.2	2.3535	0.2744	1639.61	1	5000.0%	1	K.HHQTPVYLGATAGMR.L
UQ99LM179.5%71516.2%346412797.1(Q99LM1) Hypothetical 41.3 kDa protein
*	TK010303_lung_E18_mito_3_step02.1889.1889.2	1.4822	0.1289	2650.23	1	2860.0%	1	K.QDKPINFSEDTRPSPCYQLAQR.T
	TK010303_lung_E18_mito_3_step11.2300.2300.2	2.3477	0.2841	1840.9	1	3930.0%	2	R.EPVFEFVRPPPYHPK.Q
*	TK010303_lung_E18_mito_3_step12.1649.1649.1	1.0329	0.0563	1230.87	6	3890.0%	1	R.EHFVKETDPK.D
*	TK010303_lung_E18_mito_3_step11.1233.1233.1	1.2447	0.017	1181.39	7	4380.0%	3	K.RFPHEQPLR.Y
UQ9CZC679.3%1120.0%1501538011.5(Q9CZC6) 2810021B07Rik protein
*	TK010303_lung_E18_mito_3_step07.3300.3300.2	1.8902	0.3748	2926.85	2	1720.0%	1	R.AATQAPTPGPPRGPSISSATPQGSSRPTPR.V
UQ8WUV179.3%3328.1%267294334.9(Q8WUV1) Hypothetical protein
*	TK010303_lung_E18_mito_3_step09.2759.2759.3	1.8393	0.2044	3581.52	43	1370.0%	1	K.QGCYTVILNTFETYVYLAGALAIGVLAIEEER.A
	TK010303_lung_E18_mito_3_step12.1413.1413.1	1.5539	0.2133	1141.66	5	5000.0%	1	R.EFFTKELTK.H
	TK010303_lung_E18_mito_3_step02.2864.2864.3	2.1381	0.1259	4340.45	2	1420.0%	1	K.ELTKHYQGNNDTDVFSATWNSVMITFGCCGVNGPEDFK.F
UTGF2_MOUSE79.3%115.1%414476028.5(P27090) Transforming growth factor beta 2 precursor (TGF-beta 2)
*	TK010303_lung_E18_mito_3_step11.3696.3696.2	2.3076	0.291	2497.43	1	2750.0%	1	R.AEGEWLSFDVTDAVQEWLHHK.D
UECM_HUMAN79.2%7712.3%12281380727.9(Q13201) Endothelial cell multimerin precursor
*	TK010303_lung_E18_mito_3_step05.3166.3166.3	1.692	0.0245	2756.68	8	1770.0%	1	K.TLHEVLTMCHNASTSVSELNATIPK.W
*	TK010303_lung_E18_mito_3_step08.3494.3494.2	1.2769	0.0848	2575.86	14	1790.0%	1	K.SNEQATSLNTVGGTGGIGGVGGTGGVGNR.A
*	TK010303_lung_E18_mito_3_step03.2263.2263.2	1.7025	0.1935	1503.84	8	4090.0%	1	K.FRIPYLGVYVFK.Y
*	TK010303_lung_E18_mito_3_step11.3993.3993.2	1.0888	0.0484	2251.61	9	2370.0%	1	K.IENLTSAVNSLNFIIKELTK.R
*	TK010303_lung_E18_mito_3_step11.4323.4323.2	1.1939	0.0542	2454.74	1	2750.0%	1	R.HPCQNGGTCINGRTSFTCACR.H
*	TK010303_lung_E18_mito_3_step01.3746.3746.3	2.6378	0.383	4407.13	1	1410.0%	1	R.AQEQQSLIHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQK.M
*	TK010303_lung_E18_mito_3_step05.3932.3932.2	1.5322	0.0092	2862.55	28	1670.0%	1	K.CQLRAQEQQSLIHTNQAESHTAVGR.G
USTN3_MOUSE79.2%115.0%180209547.5(O70166) Stathmin 3 (SCG10-like protein) (SCG10-related protein HiAT3) (Hippocampus abundant transcript 3)
	TK010303_lung_E18_mito_3_step12.1324.1324.1	1.9241	0.1496	1176.67	1	6250.0%	1	R.EHEREVLHK.A
UQ9DAF779.0%41015.2%290316567.6(Q9DAF7) 1700011M07Rik protein
	TK010303_lung_E18_mito_3_step08.2765.2765.2	0.8847	0.0183	2160.0	119	1840.0%	1	R.MSSVELVHLLMDFGANAQAK.N
	TK010303_lung_E18_mito_3_step04.3541.3541.2	1.5402	0.2295	2613.88	6	1960.0%	3	R.GHLSCASVLLSHGAQVNGMTIDWR.T
UO1479278.9%4167.2%307357738.8(O14792) Heparan sulfate 3-O-sulfotransferase-1 precursor
*	TK010303_lung_E18_mito_3_step06.3135.3135.2	2.1934	0.2143	2264.85	4	2860.0%	4	R.DGVAPNGSAQQLPQTIIIGVRK.G
UNRP1_HUMAN78.9%5514.5%9231031205.9(O14786) Neuropilin-1 precursor (Vascular endothelial cell growth factor 165 receptor)
	TK010303_lung_E18_mito_3_step10.3019.3019.3	1.7515	0.0081	3953.54	15	1250.0%	1	R.SSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFK.C
	TK010303_lung_E18_mito_3_step12.2885.2885.2	1.0387	0.0476	2379.97	476	1360.0%	1	R.GLPLLCAVLALVLAPAGAFRNDK.C
*	TK010303_lung_E18_mito_3_step07.1665.1665.2	2.3868	0.1857	1852.3	1	4230.0%	1	K.TFCHWEHDNHVQLK.W
*	TK010303_lung_E18_mito_3_step03.3921.3921.3	1.761	2.0E-4	3780.17	26	1250.0%	1	K.VARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLR.V
	TK010303_lung_E18_mito_3_step06.2703.2703.2	1.1023	0.0439	3019.29	30	1350.0%	1	K.CGDTIKIESPGYLTSPGYPHSYHPSEK.C
UQ96MR078.8%228.7%549615218.4(Q96MR0) Hypothetical protein FLJ32020
*	TK010303_lung_E18_mito_3_step08.3957.3957.2	1.3035	0.0324	2882.04	8	1800.0%	1	R.TTFQEESAFISEAAAPRQGNMYTLSK.D
*	TK010303_lung_E18_mito_3_step11.2963.2963.2	1.8532	0.3963	2494.79	2	2380.0%	1	K.TQAEDMLVSYENIIQTAMMSSK.T
UT172_HUMAN78.7%573.6%18492068866.5(O14981) TBP-associated factor 172 (TAF-172) (TAF(II)170)
*	TK010303_lung_E18_mito_3_step12.1044.1044.1	0.7514	0.0074	1412.34	77	1670.0%	1	K.VLPWLGAIDDSVK.Q
*	TK010303_lung_E18_mito_3_step11.2891.2891.3	1.6653	0.0035	3428.33	12	1580.0%	1	K.MNIANTVISQENSSLQSMGTDQLLDLFTLDK.D
*	TK010303_lung_E18_mito_3_step01.1703.1703.1	1.8904	0.166	1160.63	2	6110.0%	2	R.TPCPNSKIIK.N
*	TK010303_lung_E18_mito_3_step01.3283.3283.1	1.112	0.0633	1544.92	35	2920.0%	1	K.RHNLIVASYDVVR.N
UNLD2_MOUSE78.6%2212.1%257290819.2(Q9CZR2) N-acetylated-alpha-linked acidic dipeptidase II (EC 3.4.17.21) (NAALADase II) (Fragment)
*	TK010303_lung_E18_mito_3_step03.2092.2092.2	1.2213	0.0479	2308.29	1	2890.0%	1	K.HDQQLRNHAVSFDPLFSAVK.N
	TK010303_lung_E18_mito_3_step11.1557.1557.1	1.9958	0.1289	1250.65	1	5000.0%	1	R.HIIFAPSSHNK.Y
UQ9DAX978.4%392.7%585668556.9(Q9DAX9) 1300003O07Rik protein (RIKEN cDNA 1300003O07 gene)
	TK010303_lung_E18_mito_3_step07.2633.2633.2	2.3986	0.1123	1869.36	2	3670.0%	3	R.VKALILEEIAIDCHNK.E
UQ9UPV078.3%448.0%14551635435.4(Q9UPV0) Hypothetical protein KIAA1052
*	TK010303_lung_E18_mito_3_step06.2453.2453.3	1.5922	0.0584	2648.4	49	1630.0%	1	R.DPPKSSLALGSSLAPVHVPLGGLAPLR.G
*	TK010303_lung_E18_mito_3_step05.1974.1974.1	1.175	0.0598	1286.5	100	3640.0%	1	R.EQAPSPPAACEK.G
*	TK010303_lung_E18_mito_3_step03.2008.2008.3	1.6116	0.0011	3762.0	30	1250.0%	1	K.AVTFDLSDMDSLSSESSESFSPPHLDSTPSLTSRK.I
*	TK010303_lung_E18_mito_3_step06.4247.4247.3	2.623	0.3697	4678.6	1	1430.0%	1	K.GLLGSIYEDKTALSLLGLGEETNEEDEEESDNQSVHSSSEPLR.N
USTA4_MOUSE78.3%81022.7%749859416.5(P42228) Signal transducer and activator of transcription 4
*	TK010303_lung_E18_mito_3_step06.3194.3194.3	1.8743	0.0142	4284.56	1	1530.0%	1	R.QQIACIGGPLHNGLDQLQNCFTLLAESLFQLRQQLEK.L
	TK010303_lung_E18_mito_3_step06.2823.2823.2	1.0742	0.0321	2367.41	13	2370.0%	1	K.FHGNPMHVAVVISNCLREER.R
*	TK010303_lung_E18_mito_3_step12.3011.3011.2	1.892	0.0898	2064.27	1	3750.0%	1	R.ATFLIYNLFKNSFVVER.Q
*	TK010303_lung_E18_mito_3_step10.2270.2270.2	1.0855	0.0378	2191.87	117	2220.0%	1	K.LQEQSTKMTYEGDPIPAQR.A
*	TK010303_lung_E18_mito_3_step11.2821.2821.2	1.1594	0.1229	2594.04	14	1820.0%	1	R.FSESHLGGITFTWVDQSENGEVR.F
	TK010303_lung_E18_mito_3_step09.2795.2795.2	2.0826	0.2407	1875.26	1	4330.0%	2	R.DYKVIMAENIPENPLK.Y
*	TK010303_lung_E18_mito_3_step02.3824.3824.3	1.6592	8.0E-4	4081.37	2	1420.0%	1	K.GYVPSVFIPISTIRSDSTEPQSPSDLLPMSPSAYAVLR.E
UQ9QWY878.2%7118.4%11471273957.6(Q9QWY8) ADP-ribosylation factor-directed GTPase activating protein isoform a
*	TK010303_lung_E18_mito_3_step05.3078.3078.2	1.3804	0.304	2262.39	1	3040.0%	1	K.GPTGPPSTLPLGTQTSSGSSTLSK.K
	TK010303_lung_E18_mito_3_step12.4151.4151.3	1.8693	0.1299	4018.15	1	1640.0%	2	K.FNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIK.K
	TK010303_lung_E18_mito_3_step06.2726.2726.2	1.5454	0.0735	2492.1	9	1900.0%	2	R.TADQTSLHLVDFLVQNCGNLDK.Q
	TK010303_lung_E18_mito_3_step06.3375.3375.2	1.4423	0.1043	2171.88	4	2500.0%	1	R.LFQLQMCEYLIKVNEIK.T
UQ9UKB378.2%1110.6%198234155.7(Q9UKB3) J domain containing protein 1 isoform A (BA57G10.2) (A J domain containing protein 1 (JDP1) isoform B)
*	TK010303_lung_E18_mito_3_step03.3011.3011.2	2.0555	0.3292	2263.61	1	3250.0%	1	K.SVSPQNSDSSGFADVNGWHLR.F
UNME4_MOUSE78.2%9397.2%13231429088.3(Q03391) Glutamate [NMDA] receptor subunit epsilon 4 precursor (N-methyl D-aspartate receptor subtype 2D) (NR2D) (NMDAR2D)
	TK010303_lung_E18_mito_3_step04.2726.2726.3	1.4297	0.1728	3887.09	4	1330.0%	1	K.LDIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWR.L
*	TK010303_lung_E18_mito_3_step10.4121.4121.1	1.3953	0.1889	1415.96	53	2920.0%	1	R.LAFEDESPPAPSR.W
	TK010303_lung_E18_mito_3_step10.2411.2411.2	1.1227	0.0761	2831.12	4	1880.0%	1	K.SIWLLWALVFNNSVPVENPRGTTSK.I
	TK010303_lung_E18_mito_3_step05.3601.3601.2	1.6848	0.0574	2760.27	1	2390.0%	6	R.DYSFNEDGFLVNPSLVVISLTRDR.T
UIMA1_MOUSE78.1%3313.2%538601835.0(Q60960) Importin alpha-1 subunit (Karyopherin alpha-1 subunit) (SRP1-beta) (RAG cohort protein 2) (Nucleoprotein interactor 1) (Importin alpha S1)
	TK010303_lung_E18_mito_3_step08.2898.2898.2	1.6471	0.1215	2841.74	6	2080.0%	1	K.ENCTLQFESAWVLTNIASGNSLQTR.N
	TK010303_lung_E18_mito_3_step02.3724.3724.3	2.4146	0.0448	3966.67	58	1110.0%	1	R.AVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIK.K
	TK010303_lung_E18_mito_3_step01.1786.1786.1	1.5764	0.2004	1132.71	1	6250.0%	1	R.REEEGLQLR.K
UIMA5_MOUSE78.1%111.7%533596035.0(O35345) Importin alpha-6 subunit (Karyopherin alpha-5 subunit) (Importin alpha S2)
	TK010303_lung_E18_mito_3_step01.1786.1786.1	1.5764	0.2004	1132.71	1	6250.0%	1	R.REEEGIQLR.K
ULMA4_MOUSE78.0%669.5%18162018186.2(P97927) Laminin alpha-4 chain precursor
*	TK010303_lung_E18_mito_3_step12.1609.1609.3	1.7509	0.0461	3629.25	13	1450.0%	1	K.FEIAFEVRPRSSSGTLVHGHSVNGEYLNVHMR.N
*	TK010303_lung_E18_mito_3_step07.3350.3350.3	2.3805	0.1086	2759.47	3	2080.0%	1	K.IQVSMMFDGQSAVEVHPKVSVDDLK.A
*	TK010303_lung_E18_mito_3_step03.3589.3589.3	1.8368	0.0183	3721.41	221	980.0%	1	R.VKEQMEVVGASLSMSADSLTIPQLTLEELDEIIK.N
*	TK010303_lung_E18_mito_3_step06.3031.3031.3	1.7654	0.0904	4416.22	1	1320.0%	1	K.LPASLNLPSYSGCLELATLNNDVISLYNFKHIYNMDPSK.S
*	TK010303_lung_E18_mito_3_step07.1673.1673.2	1.1275	0.0409	2754.82	1	2380.0%	1	R.FCQPCPCPLPHLANFAESCYRK.N
*	TK010303_lung_E18_mito_3_step02.2802.2802.2	2.3021	0.2758	2234.94	1	3420.0%	1	K.KIPFTDIYIGGAPQEVLQSR.T
UPTPJ_MOUSE77.9%594.3%12381367825.6(Q64455) Protein-tyrosine phosphatase eta precursor (EC 3.1.3.48) (R-PTP-eta) (HPTP beta-like tyrosine phosphatase)
*	TK010303_lung_E18_mito_3_step05.3297.3297.3	1.8517	0.0697	3281.42	10	1500.0%	2	R.QGQVLCAGAAPNPIFDIEAVVSPTSVLLTWK.H
	TK010303_lung_E18_mito_3_step01.3206.3206.1	1.3843	0.147	1516.8	8	3460.0%	1	K.DFIATQGPLPNTLK.D
*	TK010303_lung_E18_mito_3_step01.0970.0970.1	1.5256	0.1322	842.47	2	5710.0%	2	K.LIGISLPK.Y
URS5_MOUSE77.9%2223.5%204228899.7(P97461) 40S ribosomal protein S5
	TK010303_lung_E18_mito_3_step06.3010.3010.2	2.2027	0.3114	2325.58	1	2890.0%	1	K.WSTDDVQINDISLQDYIAVK.E
	TK010303_lung_E18_mito_3_step11.3223.3223.2	1.4255	0.0413	3064.69	4	2040.0%	1	K.HAFEIIHLLTGENPLQVLVNAIINSGPR.E
UCLC4_HUMAN77.8%229.9%760849176.9(P51793) Chloride channel protein 4 (ClC-4)
*	TK010303_lung_E18_mito_3_step09.4012.4012.3	2.6672	0.3253	4162.29	1	1490.0%	1	K.IPSGLFIPSMAVGAIAGRMVGIGVEQLAYHHHDWIIFR.N
*	TK010303_lung_E18_mito_3_step03.2724.2724.3	1.3254	0.0307	4149.81	1	1320.0%	1	-.MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFHTIDWLR.E
UQ8TD9177.7%355.3%643719094.9(Q8TD91) Hepatocellular carcinoma-associated protein HCA2
*	TK010303_lung_E18_mito_3_step08.2581.2581.2	1.961	0.3382	2554.04	1	2500.0%	1	R.AEMQMNVINTYTGYFPMIFRK.A
*	TK010303_lung_E18_mito_3_step05.2450.2450.2	1.5226	0.036	1671.27	73	3330.0%	2	K.QREEPQDWPLNEK.R
URL26_HUMAN77.6%3316.6%1451725810.6(Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26
	TK010303_lung_E18_mito_3_step12.1087.1087.1	1.4167	0.1989	1234.55	1	5000.0%	1	K.RHFNAPSHIR.R
	TK010303_lung_E18_mito_3_step07.1530.1530.2	2.2772	0.2896	1418.4	1	5380.0%	1	K.ANGTTVHVGIHPSK.V
	TK010303_lung_E18_mito_3_step11.1119.1119.1	1.4023	0.2235	1078.58	1	6250.0%	1	R.HFNAPSHIR.R
UGRAD_MOUSE77.4%4628.6%248275759.3(P11033) Granzyme D precursor (EC 3.4.21.-)
*	TK010303_lung_E18_mito_3_step10.2946.2946.3	1.9608	0.1161	3956.83	54	1140.0%	2	R.IYCGGFLIQDDFVLTAAHCKNSSMTVTLGAHNITAK.E
*	TK010303_lung_E18_mito_3_step06.2479.2479.3	2.9787	0.2447	2882.58	1	2400.0%	1	K.NSSMTVTLGAHNITAKEETQQIIPVAK.D
*	TK010303_lung_E18_mito_3_step10.2303.2303.3	1.8542	0.0555	2761.89	145	1520.0%	1	K.NGTISSGIFTKVVHFLPWISWNMK.L
UQ8VI5677.2%9910.6%19052120365.4(Q8VI56) LDLR dan
	TK010303_lung_E18_mito_3_step07.3940.3940.2	1.9954	0.3191	3176.41	1	2040.0%	1	R.CGDNNGGCTHLCLPSGQNYTCACPTGFR.K
	TK010303_lung_E18_mito_3_step12.2015.2015.2	1.4302	0.0773	2408.02	36	2250.0%	1	R.KVLINTDLGWPNGLTLDYDTR.R
	TK010303_lung_E18_mito_3_step03.2084.2084.3	1.2835	0.1839	3871.96	12	1450.0%	1	K.VLVWQNLDSPRAIVLYHEMGFMYWTDWGENAK.L
*	TK010303_lung_E18_mito_3_step08.2526.2526.3	1.8764	0.0458	2999.4	3	1830.0%	1	R.RWWGALLLGALLCAHGIASSLECACGR.S
	TK010303_lung_E18_mito_3_step11.3721.3721.2	1.7829	0.1983	2483.84	1	2750.0%	1	R.SEYTLLLNNLENAIALDFHHR.R
*	TK010303_lung_E18_mito_3_step09.2423.2423.2	1.823	0.367	2063.0	2	2650.0%	1	R.QVLVSHVSHPFALTQQDR.W
*	TK010303_lung_E18_mito_3_step11.4237.4237.2	1.7377	0.237	2438.16	1	2890.0%	1	R.CSDGSCIAEHWYCDGDTDCK.D
*	TK010303_lung_E18_mito_3_step02.4077.4077.3	1.9796	0.0726	4112.53	68	1100.0%	1	R.CDGEDDCADNSDEENCENTGSPQCASDQFLCWNGR.C
UIVD_HUMAN77.1%4165.9%423463198.2(P26440) Isovaleryl-CoA dehydrogenase, mitochondrial precursor (EC 1.3.99.10) (IVD)
*	TK010303_lung_E18_mito_3_step12.4028.4028.2	1.731	0.2145	2686.94	30	1670.0%	4	R.LVLAGGPLGLMQAVLDHTIPYLHVR.E
UQ9NWB777.0%2212.8%429491085.0(Q9NWB7) Hypothetical protein (HIP1-interacting protein HIPPI) (MHS4R2) (DERP8) (Dermal papilla derived protein 8)
*	TK010303_lung_E18_mito_3_step08.2869.2869.2	1.9112	0.3595	3120.39	3	2140.0%	1	R.GEGTGEVVLERGPGAAYHMFVVMEDLVEK.L
*	TK010303_lung_E18_mito_3_step03.3681.3681.2	1.2434	0.0854	2962.49	9	1800.0%	1	K.AGRPFEQPQEYDDPNATISNILSELR.S
UFLIH_HUMAN77.0%353.0%12691447516.1(Q13045) Flightless-I protein homolog
*	TK010303_lung_E18_mito_3_step07.2274.2274.3	1.3593	0.0171	3880.52	72	1180.0%	1	K.LDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCR.C
*	TK010303_lung_E18_mito_3_step10.3423.3423.2	2.3768	0.2075	3063.1	2	2200.0%	2	K.LTNLEEFMAANNNLELVPESLCRCPK.L
UVNN2_HUMAN76.9%243.5%520585216.5(O95498) Vascular non-inflammatory molecule 2 precursor (Vanin 2) (Glycosylphosphatidyl inositol-anchored protein GPI-80) (FOAP-4 protein)
*	TK010303_lung_E18_mito_3_step05.3460.3460.2	2.3752	0.1883	2049.4	2	3530.0%	2	K.EENEVYVLGAFTGLHGRR.R
UZEP1_MOUSE76.8%997.7%26882883427.6(Q03172) Zinc finger protein 40 (Transcription factor alphaA-CRYBP1) (Alpha A-crystallin-binding protein I) (Alpha A-CRYBP1)
*	TK010303_lung_E18_mito_3_step05.2652.2652.2	1.5437	0.0384	2214.14	15	2000.0%	1	R.ESSLSHASSFSASLDLEDISK.V
*	TK010303_lung_E18_mito_3_step01.1919.1919.1	1.5142	0.2204	1238.62	1	5500.0%	1	K.LIPSNSDHVVR.G
*	TK010303_lung_E18_mito_3_step11.2948.2948.2	1.2565	0.0254	2296.75	319	1580.0%	1	R.RAASEQISCVPTLMEVSDFR.S
*	TK010303_lung_E18_mito_3_step05.3206.3206.2	1.1649	0.0677	2230.28	14	2500.0%	1	R.LPDMASADCPAHTVHPQALAK.D
*	TK010303_lung_E18_mito_3_step11.1232.1232.3	1.5815	0.0101	2932.83	44	1730.0%	1	K.SHAHTIKLGLVLQPEAGGLFLSQECPK.A
*	TK010303_lung_E18_mito_3_step02.3493.3493.2	1.1925	0.0482	2281.48	9	2380.0%	1	K.TSAYTGWTVSSSNPNPLGLPTK.V
*	TK010303_lung_E18_mito_3_step11.3688.3688.3	2.0266	0.1359	3790.67	15	1320.0%	1	R.HEENKVIQGQRPPLVSGLSLVSSSDTQQPSFPSLK.T
	TK010303_lung_E18_mito_3_step07.2252.2252.1	1.1075	0.1026	1368.33	2	5000.0%	1	K.KFYCSELHGPK.T
*	TK010303_lung_E18_mito_3_step11.1413.1413.3	1.911	0.1907	4440.19	6	1220.0%	1	R.TDNSECSSPCCSTTPPSYTSTAFDVLLKAMEPELSTLSQK.G
UQ9H4H676.7%221.6%21312424815.7(Q9H4H6) DJ620E11.1.1 (Novel helicase C-terminal domain and SNF2 N-terminal domains containing protein, similar to KIAA0308 (Isoform 1)) (Fragment)
	TK010303_lung_E18_mito_3_step01.4006.4006.2	1.4438	0.0128	2968.48	1	2170.0%	1	K.ELCRPEILGPGNQGYWVQEEMFRR.T
	TK010303_lung_E18_mito_3_step01.3683.3683.1	1.7847	0.1778	1212.75	2	5000.0%	1	R.APTIAQLLQEK.T
UIBP5_MOUSE76.7%2212.9%271303728.1(Q07079) Insulin-like growth factor binding protein 5 precursor (IGFBP-5) (IBP-5) (IGF-binding protein 5)
	TK010303_lung_E18_mito_3_step07.2341.2341.2	2.238	0.2881	1643.04	2	4620.0%	1	R.QDEEKPLHALLHGR.G
	TK010303_lung_E18_mito_3_step10.3027.3027.3	1.5674	0.0136	2456.94	5	2380.0%	1	R.DSREHEEPTTSEMAEETYSPK.V
UQ9CU4676.7%247.1%523570455.5(Q9CU46) 6330406L22Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step10.2737.2737.3	2.256	0.1391	3981.55	1	1670.0%	2	K.MTPGNLGIVFGPTLLRPRPTDATVSLSSLVDYPHQAR.V
UPRLP_MOUSE76.5%112.6%378432939.5(Q9JK53) Prolargin precursor (Proline-arginine-rich end leucine-rich repeat protein)
*	TK010303_lung_E18_mito_3_step09.1750.1750.1	1.6469	0.1892	1233.52	1	6110.0%	1	R.RKPKPRPTPR.F
UQ9D87076.4%114.4%365413494.6(Q9D870) 2010110O17Rik protein
	TK010303_lung_E18_mito_3_step08.4188.4188.2	2.3759	0.1457	1717.24	4	4000.0%	1	K.GLGNYLYNFASAATKK.I
UBIG1_HUMAN76.4%445.5%18492087085.9(Q9Y6D6) Brefeldin A-inhibited guanine nucleotide-exchange protein 1 (Brefeldin A-inhibited GEP 1) (p200 ARF-GEP1) (p200 ARF guanine nucleotide exchange factor)
*	TK010303_lung_E18_mito_3_step12.3572.3572.3	2.1334	0.2084	3850.35	15	1360.0%	1	K.HFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIR.L
*	TK010303_lung_E18_mito_3_step08.2037.2037.2	1.281	0.0445	2227.94	5	2370.0%	1	R.IGVVFQISQPPEQELGINKQ.-
*	TK010303_lung_E18_mito_3_step10.2847.2847.3	1.5418	0.0072	3245.82	23	1570.0%	1	K.LIDRIIETICGCFQGPQTDEGVQLQIIK.A
*	TK010303_lung_E18_mito_3_step10.3223.3223.2	2.318	0.257	2425.63	1	3420.0%	1	K.TNFIEADKYFLPFELACQSK.C
UUBC8_HUMAN76.3%2225.0%152176377.9(O14933) Ubiquitin-conjugating enzyme E2-18 kDa UbcH8 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Retinoic acid induced gene B protein) (RIG-B)
*	TK010303_lung_E18_mito_3_step12.2692.2692.2	1.3094	0.0927	2275.24	12	2220.0%	1	R.EPLRMDLADLLTQNPELFR.K
*	TK010303_lung_E18_mito_3_step11.2191.2191.2	2.0906	0.3189	2271.89	1	3060.0%	1	R.ISFPPEYPFKPPMIKFTTK.I
UQ9HCI876.3%337.0%9951110328.2(Q9HCI8) Hypothetical protein KIAA1584 (Fragment)
	TK010303_lung_E18_mito_3_step10.2381.2381.3	1.8275	0.057	2901.4	116	1700.0%	1	K.DFANHFPTYVHCSFCRYNTSCSK.A
*	TK010303_lung_E18_mito_3_step08.2161.2161.3	1.9212	0.0652	4098.02	49	1180.0%	1	K.EVEDDDDDEPIFVGEISSSKPAISNILNRVNPSSYSR.G
*	TK010303_lung_E18_mito_3_step12.1361.1361.1	1.6265	0.1866	1187.15	1	6110.0%	1	K.EIARPNMAER.E
UDRG1_MOUSE76.3%3510.1%367405128.9(P32233) Developmentally regulated GTP-binding protein 1 (DRG 1) (Nedd3 protein)
	TK010303_lung_E18_mito_3_step11.1705.1705.3	1.836	0.0498	2911.67	38	1630.0%	1	K.GGINLTATCPQSELDAETVKSILAEYK.I
	TK010303_lung_E18_mito_3_step11.1595.1595.1	1.774	0.2092	1062.63	6	5560.0%	2	K.ATAHHLGLLK.A
URS29_HUMAN76.1%1120.0%55654610.1(P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29
	TK010303_lung_E18_mito_3_step11.1427.1427.1	2.0175	0.0942	1409.56	3	4500.0%	1	-.GHQQLYWSHPR.K
USMA4_MOUSE75.9%4417.4%551604177.1(P97471) Mothers against decapentaplegic homolog 4 (SMAD 4) (Mothers against DPP homolog 4) (Deletion target in pancreatic carcinoma 4 homolog) (Smad4)
	TK010303_lung_E18_mito_3_step04.4318.4318.2	1.704	0.2831	2872.23	1	2610.0%	1	K.GEGDVWVRCLSDHAVFVQSYYLDR.E
*	TK010303_lung_E18_mito_3_step06.2774.2774.3	1.9113	0.0079	3474.49	52	1290.0%	1	K.VPSSCPVVTVDGYVDPSGGDRFCLGQLSNVHR.T
*	TK010303_lung_E18_mito_3_step03.2203.2203.3	2.1859	0.2368	3418.42	1	1900.0%	1	K.DEYVHDFEGQPSLPTEGHSIQTIQHPPSNR.A
	TK010303_lung_E18_mito_3_step01.1387.1387.1	1.6118	0.1864	1267.75	5	5000.0%	1	R.LCILRMSFVK.G
UQ91VV375.9%4420.3%577646985.6(Q91VV3) Similar to hypothetical protein FLJ10783
*	TK010303_lung_E18_mito_3_step07.3788.3788.2	2.2665	0.2741	2584.0	1	2830.0%	1	K.TVRSGPWEPQSGPATLFSPANQPR.E
	TK010303_lung_E18_mito_3_step03.2605.2605.2	1.5734	0.1157	2288.02	3	2750.0%	1	K.WVAQDAGIGAGVDSYFEYLVK.G
*	TK010303_lung_E18_mito_3_step06.2642.2642.3	2.1345	0.1098	3655.65	5	1590.0%	1	R.LLIPLGLVCVLLPLHHGAPGPDGTAPDPAHYRER.V
*	TK010303_lung_E18_mito_3_step12.3792.3792.3	2.033	0.0235	4127.48	12	1150.0%	1	R.VVEVLQDNVDFDIDVNASVFETNIRVVGGLLSAHLLSK.K
UMYOF_HUMAN75.8%10129.5%20612347066.2(Q9NZM1) Myoferlin (Fer-1 like protein 3)
*	TK010303_lung_E18_mito_3_step08.2212.2212.3	1.4153	0.0344	1849.94	103	2500.0%	1	R.EYTGFPDPYDELNTGK.G
*	TK010303_lung_E18_mito_3_step11.3831.3831.2	1.4306	0.1705	2730.19	345	1250.0%	1	R.AEDIPQMDDAFSQTVKEIFGGNADK.K
*	TK010303_lung_E18_mito_3_step09.3584.3584.3	2.2184	0.1789	3514.89	39	1420.0%	1	K.DLTQTASSTARAMEELQDQEGWEYASLIGWK.F
*	TK010303_lung_E18_mito_3_step07.2852.2852.2	1.2276	0.0636	2366.16	92	1900.0%	1	R.IPAHQVLYSTSGENASGKYCGK.T
*	TK010303_lung_E18_mito_3_step01.1412.1412.1	1.9768	0.1261	1331.75	5	5500.0%	1	R.DYSLDEFEANK.I
*	TK010303_lung_E18_mito_3_step11.2705.2705.2	1.3728	0.1385	1724.87	35	2350.0%	1	R.GPGPKGPVGTVSEAQLAR.R
*	TK010303_lung_E18_mito_3_step07.2848.2848.3	1.6847	0.0663	2981.69	8	1880.0%	1	K.LKIYNCELENVAEFEGLTDFSDTFK.L
*	TK010303_lung_E18_mito_3_step11.1921.1921.2	1.2767	0.0633	2884.23	42	1880.0%	1	K.FNSFAEGTFTVFAEMYENQALMFGK.W
*	TK010303_lung_E18_mito_3_step08.2185.2185.2	2.256	0.1662	2725.94	6	2500.0%	2	K.VCTNIIEKNANPEWNQVVNLQIK.F
USHK2_HUMAN75.7%448.8%12531348005.6(Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)
*	TK010303_lung_E18_mito_3_step07.3290.3290.2	1.3846	0.0093	3174.23	3	1850.0%	1	K.EAFMDNEIDGSHLPNLQKEDLIDLGVTR.V
*	TK010303_lung_E18_mito_3_step12.3263.3263.2	1.5355	0.1294	2624.9	86	1520.0%	1	K.DKPEEIVPASKPSRAAENMAVEPR.V
*	TK010303_lung_E18_mito_3_step05.4321.4321.3	2.8368	0.2782	3618.33	1	1820.0%	1	R.SLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPK.S
*	TK010303_lung_E18_mito_3_step01.3712.3712.2	1.0839	0.1545	2483.05	13	1740.0%	1	R.RNSPAFLSTDLGDEDVGLGPPAPR.T
UBAG5_HUMAN75.6%224.9%447512006.0(Q9UL15) BAG-family molecular chaperone regulator-5 (BAG-5)
*	TK010303_lung_E18_mito_3_step01.0680.0680.1	1.252	0.0345	1209.49	2	5000.0%	1	R.QNHSILKIEK.V
*	TK010303_lung_E18_mito_3_step01.2128.2128.1	1.6038	0.1867	1392.78	3	4550.0%	1	R.LAQNILSYLDLK.S
UIQG1_MOUSE75.5%446.0%16571887556.5(Q9JKF1) Ras GTPase-activating-like protein IQGAP1
	TK010303_lung_E18_mito_3_step03.2480.2480.3	1.0771	0.0375	4103.05	7	1320.0%	1	K.IIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQR.R
*	TK010303_lung_E18_mito_3_step08.1892.1892.2	2.346	0.2309	1540.99	1	6250.0%	1	R.LAYLHSHKDEVVK.I
	TK010303_lung_E18_mito_3_step07.2760.2760.3	1.3534	0.0072	2194.26	32	2080.0%	1	R.HTDNVIQWLNAMDEIGLPK.I
*	TK010303_lung_E18_mito_3_step09.2518.2518.3	2.0645	0.0050	3344.44	61	1420.0%	1	R.TLSALRSPDVGLYGVIPECGETYQSDLAEAK.K
UGATM_MOUSE75.5%3316.5%423482977.9(Q9D964) Glycine amidinotransferase, mitochondrial precursor (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT)
*	TK010303_lung_E18_mito_3_step07.4198.4198.3	2.1841	0.115	4108.22	165	1000.0%	1	K.AGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEK.R
*	TK010303_lung_E18_mito_3_step04.1933.1933.3	1.8675	0.0416	3112.28	16	1630.0%	1	K.ATHPLPKDCPVSSYNEWDPLEEVIVGR.A
	TK010303_lung_E18_mito_3_step03.2141.2141.1	1.4387	0.2711	845.37	3	6670.0%	1	R.VHIISFK.D
UTAG2_MOUSE75.5%118.5%212235977.1(Q9WVA4) Transgelin 2
	TK010303_lung_E18_mito_3_step03.3544.3544.2	2.2437	0.2795	2102.37	1	4120.0%	1	R.YGINTTDIFQTVDLWEGK.N
UQ8R0C775.4%114.8%463530886.8(Q8R0C7) Similar to hypothetical protein FLJ10900 (Fragment)
*	TK010303_lung_E18_mito_3_step12.2557.2557.2	2.1384	0.3121	2538.17	1	3100.0%	1	K.LLHQHGISSFLVTNAQFPEEIR.K
UQ9CYY075.3%114.2%451522517.6(Q9CYY0) 2810431B21Rik protein
	TK010303_lung_E18_mito_3_step08.2549.2549.2	1.8002	0.3754	2400.28	1	2500.0%	1	R.RDQIDCQHYPVFHQLEGVR.L
URP3A_MOUSE75.3%225.9%681754898.3(P47708) Rabphilin-3A
	TK010303_lung_E18_mito_3_step07.2796.2796.2	1.1124	0.0391	1994.35	246	2350.0%	1	R.CVHLAAMDANGYSDPFVK.L
	TK010303_lung_E18_mito_3_step01.4259.4259.2	1.7911	0.3679	2346.35	1	2860.0%	1	R.GKILVSLMYSTQQGGLIVGIIR.C
UCATB_MOUSE75.2%3319.5%339372805.9(P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)
*	TK010303_lung_E18_mito_3_step01.1296.1296.1	1.4161	0.0823	1588.83	1	4580.0%	1	R.EQWSNCPTIGQIR.D
*	TK010303_lung_E18_mito_3_step02.3504.3504.3	2.1474	0.1518	3810.43	53	1250.0%	1	R.ILGWGVENGVPYWLAANSWNLDWGDNGFFKILR.G
	TK010303_lung_E18_mito_3_step03.2796.2796.2	1.9735	0.3278	2176.75	1	3160.0%	1	R.DQGSCGSCWAFGAVEAISDR.T
URIN1_HUMAN75.2%356.9%783841188.1(Q13671) Ras interaction/interference protein 1 (Ras inhibitor JC99)
*	TK010303_lung_E18_mito_3_step12.4116.4116.2	1.2086	0.0387	3011.2	1	2240.0%	2	R.EQSETTAEGGQGQAQEGPAQPGEPEAEGSR.A
*	TK010303_lung_E18_mito_3_step05.3741.3741.2	1.1785	0.0522	2591.09	2	2170.0%	1	R.AEWPETQGAVTEEEGSGQSEARSR.G
URS3A_MOUSE75.1%4109.5%263297549.7(P97351) 40S ribosomal protein S3a
	TK010303_lung_E18_mito_3_step02.2986.2986.2	2.1988	0.298	1953.56	1	3750.0%	1	R.VFEVSLADLQNDEVAFR.K
	TK010303_lung_E18_mito_3_step01.0510.0510.1	1.0373	0.0579	842.73	5	5710.0%	3	K.LIPDSIGK.D
UODO1_HUMAN75.0%3310.3%10021134757.1(Q02218) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase)
*	TK010303_lung_E18_mito_3_step03.2969.2969.3	2.8201	0.2906	3981.76	5	1540.0%	1	R.TCIPMNHLWPNQAPYTVCNSSLSEYGVLGFEAGLR.M
	TK010303_lung_E18_mito_3_step09.2591.2591.3	2.0942	0.0788	3788.14	23	1500.0%	1	K.EANFDINQLYDCNWVVVNCSTPGNFFHVLRR.Q
	TK010303_lung_E18_mito_3_step02.3945.3945.3	1.5594	0.1288	3887.74	22	1250.0%	1	R.SMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSR.I
UP9778975.0%668.4%17191943067.5(P97789) 5'-3' exonuclease
*	TK010303_lung_E18_mito_3_step07.4282.4282.2	1.1862	0.0693	3149.33	151	1150.0%	1	R.ICSLVGMPQPDFSFLRTTQTMTVCQVK.L
	TK010303_lung_E18_mito_3_step01.1743.1743.1	1.2761	0.0371	1215.66	3	5000.0%	1	K.ANVGLNLKFNK.K
*	TK010303_lung_E18_mito_3_step12.3979.3979.3	2.814	0.3007	3731.04	2	1600.0%	1	K.MTPQESPPASSSSSQAAQPVSSHVETASQGHVGSQPR.S
*	TK010303_lung_E18_mito_3_step08.3076.3076.2	1.356	0.1768	2261.28	59	1900.0%	1	K.EAQSSQATPLQTNKPGSSEATK.M
*	TK010303_lung_E18_mito_3_step04.3437.3437.3	1.8935	0.0308	2986.78	1	2200.0%	1	R.HCLYGLDADLIMLGLTSHEAHFSLLR.E
*	TK010303_lung_E18_mito_3_step12.3345.3345.2	1.3762	0.0385	2293.92	2	2620.0%	1	K.GQENSLSWAALDKSEGEGVASR.D
UA2BP_MOUSE75.0%1110.1%396425907.1(Q9JJ43) Ataxin 2-binding protein
	TK010303_lung_E18_mito_3_step03.4121.4121.3	2.816	0.2838	4292.43	1	1670.0%	1	R.TVYNTFRAAAPPPPIPAYGGVVYQDGFYGADIYGGYAAYR.Y
UZ132_HUMAN75.0%2210.9%589678898.7(P52740) Zinc finger protein 132
*	TK010303_lung_E18_mito_3_step11.1360.1360.3	2.8265	0.2741	2857.14	1	2290.0%	1	K.DILHLAEHQGTQSEEKPYTCGACGR.D
*	TK010303_lung_E18_mito_3_step03.3205.3205.3	1.7967	0.0862	4236.13	8	1320.0%	1	R.EGGKVILGSCDLLQLQAVDSGQKPYSNLGQLPEVCTTQK.L
UQ8R00074.9%2212.4%340377598.4(Q8R000) Hypothetical 37.8 kDa protein
*	TK010303_lung_E18_mito_3_step08.2244.2244.1	1.7199	0.1719	1233.56	2	5000.0%	1	K.MHLGEQNMGSK.F
*	TK010303_lung_E18_mito_3_step11.2488.2488.3	1.9034	0.1488	3507.11	13	1420.0%	1	R.YTAELLELLETNYSISPACFSHPPTAAQLLR.A
UQ91WA774.7%91116.2%12231364868.4(Q91WA7) Hypothetical 136.5 kDa protein
*	TK010303_lung_E18_mito_3_step02.3053.3053.2	1.2977	0.1511	3109.99	25	1540.0%	1	K.YLILPVHSNIPMMDQKAIFQQPPLGVR.K
*	TK010303_lung_E18_mito_3_step08.1785.1785.3	1.8821	0.0358	2372.61	1	2380.0%	1	R.LESKPPARGGALLFCTVGILLR.K
	TK010303_lung_E18_mito_3_step10.2474.2474.3	1.9154	0.0971	3729.24	3	1330.0%	1	K.LQSNPSLEGVSHVIVDEVHERDVNTDFLLILLK.G
*	TK010303_lung_E18_mito_3_step12.1971.1971.2	2.3543	0.2087	1997.5	3	3440.0%	1	R.RGPIWQEAPQLPVDPHR.D
*	TK010303_lung_E18_mito_3_step02.4020.4020.3	1.7084	0.0016	3824.21	85	1030.0%	2	R.SELAALPLSVQQEHGQLLALLAELLRGPCGSFDMR.K
	TK010303_lung_E18_mito_3_step08.2018.2018.3	1.7695	0.1311	3127.44	34	1540.0%	1	R.LQEALGMHESKYLILPVHSNIPMMDQK.A
	TK010303_lung_E18_mito_3_step07.2394.2394.2	1.288	0.1206	2635.66	3	2140.0%	1	R.ENYLEENLLYAPSLRFIHGLIK.Q
*	TK010303_lung_E18_mito_3_step03.4525.4525.2	1.1219	0.019	3092.21	20	1500.0%	1	R.SDGTQEAAEVESEVAPSEPGEGDGSMVNASR.D
UPAC2_MOUSE74.6%358.6%486558335.2(Q9WVE8) Protein kinase C and casein kinase substrate in neurons protein 2
	TK010303_lung_E18_mito_3_step06.3215.3215.2	1.8524	0.3432	2659.99	1	2730.0%	2	R.ANHGPGMAMNWPQFEEWSADLNR.T
*	TK010303_lung_E18_mito_3_step01.0496.0496.3	1.736	0.1144	2186.59	22	2640.0%	1	R.EVLLEVQKHLDLSNVASYK.T
UQ9JL3774.6%249.8%204228835.9(Q9JL37) ATP-binding cassette protein (Fragment)
	TK010303_lung_E18_mito_3_step10.2518.2518.2	2.3655	0.1921	2093.7	1	3420.0%	2	K.LLSCLLSNVAMAMGAQLIGK.F
UQ9258074.4%5512.7%11931337055.2(Q92580) Hypothetical protein KIAA0268 (Fragment)
*	TK010303_lung_E18_mito_3_step10.2895.2895.3	1.5626	0.0625	4161.5	20	1190.0%	1	R.SEFGSVDGPLPHPRWSAEASGKPSPSDPGSGTATMMNSSSR.G
*	TK010303_lung_E18_mito_3_step03.4244.4244.3	1.3681	0.1133	3729.82	86	1290.0%	1	R.VAENRDLGMNENNIFEEAAVLDDIQDLIYFVR.Y
*	TK010303_lung_E18_mito_3_step05.3729.3729.3	2.7774	0.2678	3860.21	1	1760.0%	1	R.GPLSQNGSFGPSPVSGGECSPPLTVEPPVRPLSATLNR.R
*	TK010303_lung_E18_mito_3_step12.2645.2645.3	1.9574	0.0401	4020.35	101	990.0%	1	R.RGPLSQNGSFGPSPVSGGECSPPLTVEPPVRPLSATLNR.R
*	TK010303_lung_E18_mito_3_step02.3972.3972.3	1.7451	8.0E-4	4283.12	14	1050.0%	1	K.HSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREK.T
UKDGD_HUMAN74.4%466.5%11951328257.6(Q16760) Diacylglycerol kinase, delta (EC 2.7.1.107) (Diglyceride kinase) (DGK-delta) (DAG kinase delta) (130 kDa diacylglycerol kinase) (Fragment)
*	TK010303_lung_E18_mito_3_step02.2705.2705.3	1.7559	0.099	3923.73	1	1380.0%	2	K.TLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDR.L
*	TK010303_lung_E18_mito_3_step11.2924.2924.3	2.8056	0.2602	3632.61	2	1720.0%	1	K.SIIFDEVDLTDASVAESSTKNVNNSFTVITPCR.K
*	TK010303_lung_E18_mito_3_step02.2669.2669.3	1.6975	0.0687	4590.85	34	910.0%	1	K.LDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDR.L
UGPI8_MOUSE74.4%4625.1%395449536.8(Q9CXY9) GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) (Phosphatidylinositol-glycan biosynthesis, class K protein) (PIG-K)
*	TK010303_lung_E18_mito_3_step12.3828.3828.3	2.777	0.269	4152.72	1	1510.0%	2	-.MAAPCFLTLRVATLAALALLSLGSSAAGHIEDQAEQFFR.S
	TK010303_lung_E18_mito_3_step12.3803.3803.3	1.7737	0.0018	4479.26	2	1380.0%	1	K.SNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQK.R
*	TK010303_lung_E18_mito_3_step02.4034.4034.2	0.9679	0.0855	2310.91	13	2250.0%	1	R.LGIPDSHIVLMLADDMACNAR.N
UQ9JLI274.1%447.0%17391719686.8(Q9JLI2) Collagen type V alpha 3 chain
*	TK010303_lung_E18_mito_3_step05.2649.2649.3	2.3413	0.3055	4149.22	1	1500.0%	1	R.IGPDGLPGIPGPVGEPGLLGPPGLIGPPGPLGPPGLPGLKGDAGPK.G
*	TK010303_lung_E18_mito_3_step08.4030.4030.2	1.4165	0.0703	2794.89	34	1380.0%	1	K.GDVGQNGSPGPPGEKGLPGLQGPPGFPGPK.G
*	TK010303_lung_E18_mito_3_step10.4013.4013.3	2.7695	0.2822	4121.05	1	1310.0%	1	K.GDQGLPGVQGPPGLQGDPGLPGPVGSLGHPGPPGVVGPLGQKGSK.G
*	TK010303_lung_E18_mito_3_step12.1909.1909.3	1.6842	0.0044	3847.15	13	1460.0%	1	K.GDQGLPGVQGPPGLQGDPGLPGPVGSLGHPGPPGVVGPLGQK.G
UHIR5_MOUSE74.1%4823.6%199221404.4(Q9QZ23) HIRA-interacting protein 5 (mHIRIP5)
	TK010303_lung_E18_mito_3_step01.2619.2619.1	1.8478	0.1412	1459.54	4	3750.0%	2	K.SVFFGPDFITVTK.E
*	TK010303_lung_E18_mito_3_step07.3065.3065.3	2.0355	0.0767	3835.86	153	1210.0%	2	K.SGIQNMLQFYIPEVEGVEQVMDDDESDEKEANSS.-
UQ6238374.1%7273.6%17261990544.9(Q62383) Supt6h
	TK010303_lung_E18_mito_3_step06.2159.2159.3	1.5152	0.0097	2609.28	58	1880.0%	1	K.GVEGYGNDQTYFEEIKQFYYR.D
	TK010303_lung_E18_mito_3_step08.2425.2425.2	2.09	0.2885	1779.12	1	4290.0%	5	R.LKDLDLDAFAEELER.Q
	TK010303_lung_E18_mito_3_step04.3938.3938.3	2.2639	0.036	3001.74	26	1600.0%	1	R.DHPVFCALVNGEGEVTDFLRLPHFTK.R
UQ6196574.0%2214.7%464508608.1(Q61965) Laminin, gamma 2 (Laminin-5 beta-1 chain) (Gamma 2 chain) (Nicein) (Kalinin) (Fragment)
*	TK010303_lung_E18_mito_3_step04.3931.3931.3	2.0489	0.1391	4366.76	22	1150.0%	1	R.ATYGEYSTGYIDNVTLVSARPVSGAPAPWVERCVCPAGYK.G
*	TK010303_lung_E18_mito_3_step04.4270.4270.2	1.9367	0.3308	2776.17	1	2410.0%	1	R.GGRQPSAYDVILEGAGLITSSSLMAPGK.T
UQ8VC1574.0%2212.1%479542588.0(Q8VC15) Similar to phosphatidylinositol 4-kinase type II
*	TK010303_lung_E18_mito_3_step07.3264.3264.3	1.7205	0.0783	3205.43	2	1640.0%	1	R.GAAAQGQTHTVAVQAQALAAQAAVAAHAVQTHR.E
*	TK010303_lung_E18_mito_3_step02.2290.2290.2	1.9367	0.3326	2555.71	2	2500.0%	1	R.AQPPEYTFPSGSGAHFPQVPGGAVR.V
UQ9HCE374.0%7199.2%13291449028.7(Q9HCE3) Hypothetical protein KIAA1629 (Zinc finger protein) (Fragment)
*	TK010303_lung_E18_mito_3_step04.2762.2762.2	2.3614	0.1496	2275.3	1	2830.0%	1	R.SISSENSSKGSPSSPAGSTPAIPK.V
*	TK010303_lung_E18_mito_3_step01.3164.3164.2	1.2154	0.0772	2880.56	4	1850.0%	1	K.QVTIKPVATAFLPVSAVKTAGSQVINLK.L
*	TK010303_lung_E18_mito_3_step04.4537.4537.3	1.7203	0.1578	3056.67	1	1920.0%	4	K.KPSEQTASVMASVTSLLSSPASAAVLSSPPR.A
*	TK010303_lung_E18_mito_3_step10.1939.1939.3	2.2091	0.065	3769.7	82	1120.0%	1	K.ATVISAASVQSASSAIIKAANAIQQQTVVVPASSLANAK.L
UROXN_HUMAN74.0%227.2%9931115787.2(Q9UGR2) Rotavirus 'X' associated non-structural protein (RoXaN)
*	TK010303_lung_E18_mito_3_step06.3994.3994.3	2.136	0.1728	4403.05	1	1370.0%	1	K.RPQELETFSLLSNGTAAGVADQGTSNGLGSIDDIETGNVPDTR.E
*	TK010303_lung_E18_mito_3_step09.4340.4340.2	2.3435	0.1773	2952.01	1	2960.0%	1	K.LAASVLDALDPPGPTLDPLDLLPYSETR.L
UQ8R2Q773.7%335.3%869990467.5(Q8R2Q7) Similar to hypothetical protein FLJ20318
*	TK010303_lung_E18_mito_3_step06.2479.2479.2	1.3321	0.0574	1922.06	7	2810.0%	1	K.AVNYSVEDMEPDLLAPR.Q
	TK010303_lung_E18_mito_3_step09.2170.2170.1	1.2955	0.0097	1188.63	30	3890.0%	1	R.HPLEGTHELR.Q
*	TK010303_lung_E18_mito_3_step12.2187.2187.2	2.3581	4.0E-4	2240.29	1	4170.0%	1	K.DHLIAPNDNDFGKYSFLFK.D
UTIE1_MOUSE73.7%338.3%11341246996.8(Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112)
	TK010303_lung_E18_mito_3_step02.2686.2686.2	2.3394	0.0368	2226.49	1	3570.0%	1	R.GFSKPSDLVGVFSCVGGAGARR.T
*	TK010303_lung_E18_mito_3_step07.3998.3998.3	1.5819	0.1056	4071.99	4	1470.0%	1	R.RPKPQPEPLSYPVLEWEDITFEDLIGEGNFGQVIR.A
*	TK010303_lung_E18_mito_3_step03.2125.2125.3	1.5346	0.0852	4278.54	8	1250.0%	1	K.LGHHPNIINLLGACENRGYLYIAIEYAPYGNLLDFLR.K
UQ8R3R773.7%245.9%256295438.5(Q8R3R7) Hypothetical 29.5 kDa protein
*	TK010303_lung_E18_mito_3_step02.2996.2996.2	2.1566	0.0384	1976.72	5	3570.0%	2	R.MFWIFLDYFQTSHLK.E
UQ9JJN273.7%885.2%35503923256.4(Q9JJN2) Zinc-finger homeodomain protein 4
*	TK010303_lung_E18_mito_3_step11.4163.4163.2	1.1663	0.0558	3108.89	4	1830.0%	1	R.HLPSGHSITAAVNSPGQGMLESMSLASVNSK.D
*	TK010303_lung_E18_mito_3_step12.2323.2323.3	1.5163	0.0387	3146.54	49	1400.0%	1	K.HLQKQEGAVNSESCCYYCAVCDYSSK.I
*	TK010303_lung_E18_mito_3_step12.2229.2229.2	1.5299	0.0111	2164.29	13	2780.0%	1	K.EDNNCSEKEGGNSGEDQHR.D
*	TK010303_lung_E18_mito_3_step08.3373.3373.2	2.3517	0.1491	2342.44	10	2110.0%	1	R.AYFDINNSPSEEQIQEMAEK.S
*	TK010303_lung_E18_mito_3_step11.4183.4183.2	1.3982	0.1722	3058.03	11	1600.0%	1	K.DDEIEQLSTVLNLPTRVIVVWFQNAR.Q
*	TK010303_lung_E18_mito_3_step06.3665.3665.3	1.8565	0.0859	3384.6	125	1340.0%	1	R.VLQDFFDTNAYPKDDEIEQLSTVLNLPTR.V
*	TK010303_lung_E18_mito_3_step09.3028.3028.3	2.0416	0.1049	3599.01	66	1290.0%	1	K.QIQHNLHLGLAPAEAELYQYYLAQNIGLTGMK.L
*	TK010303_lung_E18_mito_3_step12.2107.2107.2	1.3893	0.0701	2204.77	1	3060.0%	1	R.TPTMQECEMLGNEIGLPKR.V
UO8906473.7%2218.6%210244568.5(O89064) Putative RNA helicase (Fragment)
*	TK010303_lung_E18_mito_3_step05.3436.3436.2	2.3455	0.0456	2511.85	2	2750.0%	1	K.DIMXQQRMSLASCGTDWDIXR.K
	TK010303_lung_E18_mito_3_step11.2000.2000.3	1.5188	0.0053	2068.91	60	2350.0%	1	K.EEASAMEEEMALAEEQLR.A
UQ96L9173.7%10126.3%31243401469.2(Q96L91) P400 SWI2/SNF2-related protein
*	TK010303_lung_E18_mito_3_step12.3461.3461.2	1.4669	0.0857	2780.02	85	1430.0%	1	R.VAVNALAVGEPGTASKPASPIGGPTQEEK.T
*	TK010303_lung_E18_mito_3_step07.3969.3969.2	1.3182	0.0304	3168.58	1	1770.0%	1	R.GRPPIATFSANPEAKAAAAPFQTSQASASAPR.H
*	TK010303_lung_E18_mito_3_step03.4415.4415.2	0.9811	0.0061	2613.44	2	2390.0%	1	K.EAGPAHSYTSSSESPSELMLTLCR.C
*	TK010303_lung_E18_mito_3_step04.1941.1941.2	1.24	0.0207	1887.65	2	3330.0%	1	K.LMEEISTSAAPAARPAAAK.L
*	TK010303_lung_E18_mito_3_step09.3948.3948.2	1.9087	0.1346	2533.77	1	2310.0%	2	R.AGAPGPGLGLCSSSPTGGFVDASVLVR.Q
	TK010303_lung_E18_mito_3_step03.3179.3179.2	1.6829	0.0675	2883.03	3	2050.0%	1	K.EYLIELFFLQHFQGNMMDFLAFK.K
*	TK010303_lung_E18_mito_3_step12.1199.1199.3	2.5153	0.1213	2856.28	12	1900.0%	1	R.TTGINLVEADTVVFYDNDLNPVMDAK.A
*	TK010303_lung_E18_mito_3_step11.1619.1619.2	2.0049	0.324	2014.11	2	3440.0%	1	R.EHAAPYFQQLRQTTAPR.L
UCGD1_MOUSE73.6%3317.6%295334295.1(P25322) G1/S-specific cyclin D1
*	TK010303_lung_E18_mito_3_step12.3107.3107.2	1.5916	0.1584	2837.25	3	1800.0%	1	K.ATEEEGEVEEEAGLACTPTDVRDVDI.-
	TK010303_lung_E18_mito_3_step05.2840.2840.2	1.1079	0.0484	2159.77	462	1760.0%	1	K.WNLAAMTPHDFIEHFLSK.M
*	TK010303_lung_E18_mito_3_step05.3460.3460.3	2.7609	0.2966	3073.6	1	1900.0%	1	K.WNLAAMTPHDFIEHFLSKMPEADENK.Q
UT4S6_MOUSE73.1%2229.8%245273337.7(O70401) Transmembrane 4 superfamily, member 6 (Tetraspanin 6) (Tspan-6)
	TK010303_lung_E18_mito_3_step07.3044.3044.3	1.8753	0.1603	4364.28	3	1080.0%	1	K.SVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEK.A
*	TK010303_lung_E18_mito_3_step10.3201.3201.3	2.6283	0.332	3818.53	1	1620.0%	1	K.ATNVPFVLIGTGTVIILLGTFGCFATCRTSAWMLK.L
UMEM1_HUMAN73.1%5114.8%11271282156.9(P55160) Membrane-associated protein HEM-1 (Hematopoietic protein 1)
*	TK010303_lung_E18_mito_3_step01.0842.0842.1	1.3709	0.0333	967.53	10	5710.0%	1	R.EDVLQVHK.V
*	TK010303_lung_E18_mito_3_step06.2279.2279.1	1.528	0.0327	790.43	4	6670.0%	1	K.QVDNGEK.F
	TK010303_lung_E18_mito_3_step04.3953.3953.3	2.2239	0.1617	4261.5	39	990.0%	3	R.QASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMR.A
UUBIQ_HUMAN73.1%1111.8%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin
	TK010303_lung_E18_mito_3_step02.2065.2065.1	1.725	0.1593	1069.57	1	5000.0%	1	K.ESTLHLVLR.L
UZA70_MOUSE73.1%5714.7%618700427.8(P43404) Tyrosine-protein kinase ZAP-70 (EC 2.7.1.112) (70 kDa zeta-associated protein) (Syk-related tyrosine kinase)
*	TK010303_lung_E18_mito_3_step10.3903.3903.2	1.265	0.0508	2859.19	8	1880.0%	1	K.EEIPVSNVAELLHQVAMGMKYLEEK.N
*	TK010303_lung_E18_mito_3_step08.4292.4292.2	1.7723	0.1022	2584.6	6	2270.0%	2	R.QTWKLEGDALEQAIISQAPQVEK.L
	TK010303_lung_E18_mito_3_step01.2623.2623.1	1.7278	0.1599	1555.83	1	4090.0%	1	K.FDTLWQLVEYLK.L
*	TK010303_lung_E18_mito_3_step03.2033.2033.3	1.7356	0.1554	3236.06	4	1750.0%	1	R.LKEVCPNSSASAAVAAPTLPAHPSTFTQPQR.R
UGEFH_HUMAN73.1%558.8%8931011748.4(Q92974) GEF-H1 protein (Proliferating cell nucleolar antigen P40)
	TK010303_lung_E18_mito_3_step02.2168.2168.1	1.7268	0.1644	1382.87	5	4000.0%	1	R.KLIHDGCLLWK.T
	TK010303_lung_E18_mito_3_step08.3513.3513.3	1.655	0.1061	3334.03	7	1670.0%	1	K.VGLFAEMTHFQAEEDGGSGMALPTLPRGLFR.S
	TK010303_lung_E18_mito_3_step05.2918.2918.3	1.7472	0.061	3105.02	2	1920.0%	1	K.YIFPTLDKPSVVSLQNLIVRDIANQEK.G
	TK010303_lung_E18_mito_3_step06.3646.3646.2	1.1685	0.0243	2672.38	73	1590.0%	1	K.DQKYIFPTLDKPSVVSLQNLIVR.D
	TK010303_lung_E18_mito_3_step04.1851.1851.1	1.456	0.0243	896.52	24	5830.0%	1	R.RPVDPRR.R
UO1503273.1%111916.7%13101430735.2(O15032) Hypothetical protein KIAA0316 (Fragment)
*	TK010303_lung_E18_mito_3_step01.2412.2412.1	1.3371	0.1262	1446.87	1	3640.0%	2	R.DSQHLSTFNLER.T
*	TK010303_lung_E18_mito_3_step04.1987.1987.3	1.4254	0.0146	4311.52	30	1080.0%	1	R.VELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSR.R
*	TK010303_lung_E18_mito_3_step01.3840.3840.3	1.6155	0.0906	4689.99	4	1140.0%	1	R.MSSLQSEGHFSLQSSQGSSVDAGCGTGSSGSACATPVESPLCPSLGK.H
*	TK010303_lung_E18_mito_3_step06.2997.2997.1	1.8402	0.1328	1082.7	2	6250.0%	3	R.RSIFNMANK.K
*	TK010303_lung_E18_mito_3_step02.4340.4340.3	1.7952	0.1424	3940.09	4	1390.0%	1	R.AYSPESSSDSGNETNSSEMTESSELATAQKQSENLSR.M
*	TK010303_lung_E18_mito_3_step11.2603.2603.2	1.1463	0.0492	2780.09	2	2000.0%	1	K.GLDLTPEAEGIQFVENSVYANIGDVK.S
*	TK010303_lung_E18_mito_3_step06.3795.3795.2	1.7645	0.0063	2450.76	2	3330.0%	1	R.EAEGKEEGAPDGETSDGSGLGQGDR.F
*	TK010303_lung_E18_mito_3_step10.2935.2935.3	1.8476	0.0482	2784.43	11	1670.0%	1	R.YGISHVINTKTNLVALLADFSHVNR.I
UCML2_HUMAN73.0%4618.4%375422488.3(Q99527) Chemokine receptor-like 2 (IL8-related receptor DRY12) (Flow-induced endothelial G protein-coupled receptor) (FEG-1) (G protein-coupled receptor GPR30) (GPCR-BR)
*	TK010303_lung_E18_mito_3_step01.1350.1350.1	1.0804	0.1911	1066.47	2	5000.0%	1	R.YIALARAMR.C
*	TK010303_lung_E18_mito_3_step09.3232.3232.2	2.0019	0.3163	3138.2	1	1920.0%	2	R.EVQWLEVTLGFIVPFAIIGLCYSLIVR.V
*	TK010303_lung_E18_mito_3_step08.4357.4357.3	2.1623	0.2453	4786.71	1	1180.0%	1	R.YYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALAR.A
UQ9288473.0%1119.3%166180379.3(Q92884) Tissue plasminogen activator (Fragment)
	TK010303_lung_E18_mito_3_step06.3381.3381.3	2.7539	0.2819	3473.88	5	1610.0%	1	R.RGGLYHDGLELGLEVSLPGCWESPGGQEGCSR.L
UQ8TAA173.0%3915.1%199224276.5(Q8TAA1) Similar to ribonuclease pancreatic (RNase 1) (RNase A)
*	TK010303_lung_E18_mito_3_step11.3748.3748.3	1.9681	0.1743	3548.5	9	1550.0%	3	K.FVQNPGISCCESLELENTVCQFTTGKQFPR.C
UACM5_HUMAN73.0%3513.9%532600749.3(P08912) Muscarinic acetylcholine receptor M5
*	TK010303_lung_E18_mito_3_step01.3551.3551.3	2.7399	0.2679	4624.62	1	1470.0%	2	K.RTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCR.I
*	TK010303_lung_E18_mito_3_step09.2404.2404.3	1.3934	0.1042	3758.72	233	1210.0%	1	K.AEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGK.E
UQ9DBE872.7%113.9%415473718.0(Q9DBE8) 1300013N08Rik protein
	TK010303_lung_E18_mito_3_step05.2364.2364.2	1.9907	0.3227	2062.41	2	3330.0%	1	K.IWTAHYDPNHCFIETR.E
UDCC_HUMAN72.3%445.5%14471584566.8(P43146) Tumor suppressor protein DCC precursor (Colorectal cancer suppressor)
*	TK010303_lung_E18_mito_3_step08.1776.1776.1	1.5381	0.1296	1455.55	4	3750.0%	1	K.KDGIHLALGMDER.K
*	TK010303_lung_E18_mito_3_step08.2186.2186.3	1.1352	0.0221	3131.21	209	1250.0%	1	R.SSTWSMTAHATTYEAAPTSAPKDFTVITR.E
*	TK010303_lung_E18_mito_3_step02.3518.3518.3	1.7971	0.031	3935.75	4	1350.0%	1	R.GFGAGRSQSVSEGPTTQQPPMLPPSQPEHSSSEEAPSR.T
UO7512272.2%7711.0%13241443378.1(O75122) Hypothetical protein KIAA0627 (Fragment)
	TK010303_lung_E18_mito_3_step09.3911.3911.2	1.1394	0.0425	1673.73	18	2860.0%	1	R.SSRIPRPSVSQGCSR.E
	TK010303_lung_E18_mito_3_step12.2261.2261.2	2.1561	0.2986	2160.1	3	2620.0%	1	R.SGSPGRVLTTTALSTVSSGVQR.V
	TK010303_lung_E18_mito_3_step12.1895.1895.2	1.2582	0.0832	2123.77	2	2780.0%	1	K.QMDPGDFINSSETRLAVSR.V
*	TK010303_lung_E18_mito_3_step05.2408.2408.2	1.9028	0.1331	1922.81	1	4470.0%	1	K.VGGASKEGGAGAVDEDDFIK.A
	TK010303_lung_E18_mito_3_step03.3535.3535.2	1.4445	0.2336	3165.83	17	1480.0%	1	K.EAMFDDDADQFPDDLSLDHSDLVAELLK.E
	TK010303_lung_E18_mito_3_step02.4320.4320.2	1.5956	0.1431	2946.9	7	1730.0%	1	K.LLHNHLRNTGNGTQSSMGSPLTRPTPR.S
*	TK010303_lung_E18_mito_3_step04.2467.2467.2	1.7835	0.1994	2988.25	24	1480.0%	1	K.EGGAGAVDEDDFIKAFTDVPSIQIYSSR.E
UQ9ESV372.1%559.4%14391609967.2(Q9ESV3) Fanconi anemia group A
*	TK010303_lung_E18_mito_3_step11.3059.3059.2	1.3678	0.1344	2842.32	11	1880.0%	1	K.QCFSNMTELLAGRGDCDPEVSNALR.Q
*	TK010303_lung_E18_mito_3_step11.3185.3185.3	1.9619	0.0372	3250.69	2	1900.0%	1	K.VSLENVGLYEDLSSPGDIAERESQAVQDVK.K
*	TK010303_lung_E18_mito_3_step07.1962.1962.2	1.2529	0.2476	1807.9	1	2810.0%	1	R.LQGHSESQGSPVQLITK.A
*	TK010303_lung_E18_mito_3_step01.3035.3035.3	2.6066	0.3371	2691.67	1	2390.0%	1	R.EELLIALFFFSLMGLLSSYLTQR.D
*	TK010303_lung_E18_mito_3_step04.3001.3001.3	1.6038	0.0761	4547.36	228	830.0%	1	R.SQDPALVANQTLTECQTKCPVILTSALLWWSSLEPVLCGR.W
UCAZ3_MOUSE72.1%114.3%299349527.5(P70190) F-actin capping protein alpha-3 subunit (CapZ alpha-3) (Germ cell-specific protein 3)
*	TK010303_lung_E18_mito_3_step01.2875.2875.1	1.7135	0.1631	1557.88	2	3750.0%	1	R.CVNLHIEVSKDLK.E
UQ9D6Z272.0%41041.9%129145249.2(Q9D6Z2) 2310044E02Rik protein
*	TK010303_lung_E18_mito_3_step02.1902.1902.2	1.3989	0.1535	3142.87	4	1670.0%	3	K.DHPFPSFTGNLSLHPPASQPQNIFFNTK.S
*	TK010303_lung_E18_mito_3_step09.2107.2107.3	1.8782	0.0479	2722.81	62	1600.0%	1	K.VKPSGEGTAQRPIEISASPLAELEDK.I
UQ96M2672.0%227.2%5566239110.1(Q96M26) Hypothetical protein FLJ32880
*	TK010303_lung_E18_mito_3_step04.3503.3503.3	1.8349	0.0239	3152.04	1	1980.0%	1	K.GQISGEEASDEGEVQGQSQGSSPSFNNLRR.R
*	TK010303_lung_E18_mito_3_step01.2063.2063.1	1.5996	0.1725	1232.84	1	5560.0%	1	R.MEHSPQRPPR.T
UORP5_HUMAN72.0%337.3%879986177.5(Q9H0X9) Oxysterol binding protein-related protein 5 (OSBP-related protein 5) (ORP-5)
	TK010303_lung_E18_mito_3_step11.2639.2639.3	2.0616	0.0061	3001.92	65	1630.0%	1	K.NNFQAQLEFKLKPFFGGSTSINQISGK.I
	TK010303_lung_E18_mito_3_step08.1562.1562.2	1.0726	0.0088	1699.45	10	3460.0%	1	R.AEDYTLTMPYAHCK.G
	TK010303_lung_E18_mito_3_step02.3110.3110.2	2.1122	0.2917	2775.63	4	2050.0%	1	R.YEDHSPWDPLKDIAQFEQDGILR.T
UHEMZ_MOUSE72.0%229.0%420471308.9(P22315) Ferrochelatase, mitochondrial precursor (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme synthetase)
*	TK010303_lung_E18_mito_3_step12.3195.3195.2	2.1107	0.2985	2090.69	1	4060.0%	1	R.WPTHPLLIQCFADHILK.E
*	TK010303_lung_E18_mito_3_step05.4056.4056.2	1.3689	0.1184	2320.97	3	2500.0%	1	K.VGPVPWLGPQTDEAIKGLCER.G
UKR18_HUMAN71.9%225.1%818941719.3(Q9HCG1) Zinc finger protein Kr18 (HKr18)
*	TK010303_lung_E18_mito_3_step09.2696.2696.3	1.7755	0.0962	2387.46	2	2920.0%	1	K.CNECGKLFTQNSHLISHWR.I
*	TK010303_lung_E18_mito_3_step11.4153.4153.2	1.9896	0.3166	2740.61	1	2050.0%	1	R.SNLTIHQVIHTGEKPYKCHECGK.V
UQ9D0U371.9%118.4%119135988.0(Q9D0U3) 1190001G19Rik protein
	TK010303_lung_E18_mito_3_step01.2762.2762.1	1.8076	0.1467	1275.8	4	5560.0%	1	K.YIIELNHMIK.D
UQ96C4071.7%113.5%371426928.9(Q96C40) Hypothetical protein
*	TK010303_lung_E18_mito_3_step11.1345.1345.2	2.0932	0.3037	1490.54	2	4580.0%	1	K.GLNSSHELSIHHR.V
UQ9EQK071.6%4615.0%528568617.1(Q9EQK0) Spinster-like protein
*	TK010303_lung_E18_mito_3_step04.3986.3986.3	1.8239	0.2454	3854.11	12	1370.0%	1	K.YFMCGGIAFWSLVTLGSSFIPREHFWLLFLTR.G
*	TK010303_lung_E18_mito_3_step09.2927.2927.3	1.8717	0.1468	3093.57	29	1700.0%	1	R.FNPRADPLVCAAGLLGSAPFLFLALACAR.G
*	TK010303_lung_E18_mito_3_step04.2157.2157.2	2.0534	0.3118	1959.95	1	4710.0%	2	R.AQLHVQGLLHESGPSDDR.I
UAD20_HUMAN71.5%226.7%726817116.5(O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 20)
*	TK010303_lung_E18_mito_3_step03.2752.2752.3	1.8798	0.0592	4623.77	32	1080.0%	1	R.LVVFAITLGHELGHNLGMQHDTQWCVCELQWCIMHAYR.K
*	TK010303_lung_E18_mito_3_step01.1248.1248.1	1.7009	0.1617	1222.57	1	6000.0%	1	-.MAVGEPLVHIR.V
UQ9QXL071.5%7911.2%761887519.0(Q9QXL0) DBCCR1
	TK010303_lung_E18_mito_3_step12.1547.1547.1	1.4858	0.1116	1567.82	66	3330.0%	1	R.MDFIHMVIGMSMR.I
	TK010303_lung_E18_mito_3_step09.2834.2834.3	1.653	0.0633	3520.57	3	1610.0%	1	R.CEPQNVDSERSEQFISFETDLDFQDLELK.Y
	TK010303_lung_E18_mito_3_step08.1737.1737.2	0.9352	0.1222	1355.18	79	2780.0%	1	R.LDTFFDPRWR.K
	TK010303_lung_E18_mito_3_step11.1239.1239.2	2.0322	0.3083	2072.37	1	3440.0%	2	K.LHLQGLQIIFPQYLQEK.F
	TK010303_lung_E18_mito_3_step12.1375.1375.1	1.5144	0.0947	1182.68	5	5620.0%	1	K.EFDWLISDR.G
*	TK010303_lung_E18_mito_3_step01.0595.0595.1	0.9946	0.1556	856.48	27	5830.0%	1	R.TRLPTLR.N
UQ9CXD871.4%117.6%528582184.7(Q9CXD8) 6130401L20Rik protein
*	TK010303_lung_E18_mito_3_step01.4070.4070.3	2.6589	0.317	4607.43	1	1540.0%	1	K.ACEDINECAEELAPCAHHCVNSKGSFTCTCHPGFELGADR.K
UQ8VGP371.3%2217.4%304340018.8(Q8VGP3) Olfactory receptor MOR227-1
*	TK010303_lung_E18_mito_3_step12.3829.3829.2	1.206	0.1266	3176.72	5	1730.0%	1	K.GCLAQIFFFHFLGVAEIFLLVVMAYDR.Y
	TK010303_lung_E18_mito_3_step11.3399.3399.2	1.9334	0.3208	2983.4	2	1800.0%	1	K.LVAVFYTVITPMLNPIIYTLRNAEVK.N
URBL1_MOUSE71.2%4412.9%10631194997.6(Q64701) Retinoblastoma-like protein 1 (107 kDa retinoblastoma-associated protein) (PRB1) (P107)
*	TK010303_lung_E18_mito_3_step01.3606.3606.3	1.3866	0.0112	4420.03	17	1070.0%	1	K.SLMACCLEIVLFAYSSPRTFPWIIEVLDLQPFYFYK.V
*	TK010303_lung_E18_mito_3_step04.2645.2645.3	2.0574	0.3932	4775.89	1	1250.0%	1	K.VTVPLHGIANDAGEITLVPISMNPTQESTAESPVSLTAQSLIGTSPK.Q
*	TK010303_lung_E18_mito_3_step10.1958.1958.3	2.7122	0.2957	2328.26	1	3060.0%	1	K.LAEILYYKILETIMVQETR.R
*	TK010303_lung_E18_mito_3_step10.3082.3082.3	1.6526	0.073	3741.98	354	880.0%	1	K.SIPGGVVVYNGDCEMTDGDIEDATKTPNCSSEPVK.E
UIF16_HUMAN71.2%338.8%785882759.3(Q16666) Gamma-interferon-inducible protein Ifi-16 (Interferon-inducible myeloid differentiation transcriptional activator) (IFI 16)
*	TK010303_lung_E18_mito_3_step08.3252.3252.2	1.4798	0.0614	2811.6	1	2170.0%	1	K.LPQEQRQLPYPSEASTTFPESHLR.T
	TK010303_lung_E18_mito_3_step01.0663.0663.1	1.345	0.1625	992.59	175	5000.0%	1	K.YKNIVLLK.G
	TK010303_lung_E18_mito_3_step02.2804.2804.3	2.7107	0.2645	4188.2	3	1390.0%	1	K.KIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNK.I
UQ9D7A871.1%3523.0%282312475.6(Q9D7A8) 2310016N05Rik protein (RIKEN cDNA 2310016N05 gene)
	TK010303_lung_E18_mito_3_step04.4003.4003.3	1.9459	0.0171	4288.37	5	1350.0%	2	R.AIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECR.A
*	TK010303_lung_E18_mito_3_step01.3578.3578.2	2.3103	0.1413	3005.89	1	2500.0%	1	K.LLASEIYDILQSSNLADGDSFNEMNSR.R
UZ272_HUMAN70.9%1112.6%174196787.9(Q14592) Zinc finger protein 272 (Zinc finger protein HZF8) (Fragment)
*	TK010303_lung_E18_mito_3_step09.3467.3467.2	1.8307	0.3288	2718.69	1	2620.0%	1	K.DLIRHFNIHTGEKPYECLQCGK.A
UQ99JV670.9%113.8%630671985.3(Q99JV6) Hypothetical 67.2 kDa protein (Fragment)
*	TK010303_lung_E18_mito_3_step05.2018.2018.2	2.0684	0.3071	2588.49	1	2610.0%	1	K.EKQEAAQLDRPGQGIAVPMGEAHR.H
UQ9D2Q270.8%3310.5%713798847.4(Q9D2Q2) 2310079F23Rik protein
*	TK010303_lung_E18_mito_3_step11.3795.3795.2	2.3098	0.0273	3068.48	2	1960.0%	1	R.SLKPWNGGGSLSLAEVAAELNSETLQRLK.R
*	TK010303_lung_E18_mito_3_step11.3617.3617.3	2.266	0.1035	3321.45	9	1720.0%	1	R.VRLSDPDALLPAGFWAAVTVWLERPQVANK.R
*	TK010303_lung_E18_mito_3_step09.3639.3639.2	1.524	0.128	1951.6	3	3000.0%	1	K.SRTYPPSAEVWMDEQR.T
UQ9EP7270.7%1110.4%241263109.2(Q9EP72) Hypothetical 26.3 kDa protein
*	TK010303_lung_E18_mito_3_step02.2861.2861.2	2.2616	0.2453	2668.58	5	2290.0%	1	K.TDGSFVVHDIPSGSYVVEVISPAYK.F
UBAR1_HUMAN70.7%339.0%777866208.7(Q99728) BRCA1-associated RING domain protein 1 (BARD-1)
*	TK010303_lung_E18_mito_3_step08.4060.4060.2	1.3203	0.0608	2881.35	9	1920.0%	1	K.ALVNTTGYQNDSPLHDAAKNGHVDIVK.L
*	TK010303_lung_E18_mito_3_step12.2200.2200.3	1.9112	0.0894	2526.13	245	1710.0%	1	R.EQLLPKLFDGCYFYLWGTFK.H
*	TK010303_lung_E18_mito_3_step11.4135.4135.2	1.9591	0.3136	2729.59	4	2270.0%	1	K.VWKAPSSWFIDCVMSFELLPLDS.-
UQ9Z15170.7%116.2%388433118.2(Q9Z151) Class I MHC-restricted T cell associated molecule
*	TK010303_lung_E18_mito_3_step09.3999.3999.2	1.775	0.3469	2673.46	1	2170.0%	1	K.SSKYQLLHHSATQLSISVSNVTLR.E
UQ9D7W770.4%2215.7%127142379.6(Q9D7W7) 2210019G11Rik protein
*	TK010303_lung_E18_mito_3_step07.2669.2669.1	1.7729	0.1564	1398.61	3	5000.0%	1	R.FLVLYAATSTASR.D
*	TK010303_lung_E18_mito_3_step09.3755.3755.2	1.5351	0.1404	2238.11	1	2890.0%	1	R.ISWGTHRFLVLYAATSTASR.D
UFAS_MOUSE70.4%6126.6%838912137.7(P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment)
	TK010303_lung_E18_mito_3_step12.4249.4249.2	1.3264	0.0132	3035.55	208	1110.0%	1	R.DTSFEQHVLLHTGGKGVDLVLNSLAEEK.L
	TK010303_lung_E18_mito_3_step06.0253.0253.1	0.6533	0.0645	416.38	1	6670.0%	1	K.AGIR.D
	TK010303_lung_E18_mito_3_step01.2902.2902.1	1.3704	0.0706	1256.17	10	4550.0%	3	K.AGIRDGVVKPLK.C
*	TK010303_lung_E18_mito_3_step11.1636.1636.1	1.3316	0.0779	1492.78	92	2500.0%	1	K.LGPVGGVFNLGHGLR.D
UQ9CYH270.3%5919.9%216242069.2(Q9CYH2) 5730469M10Rik protein
*	TK010303_lung_E18_mito_3_step12.2208.2208.2	1.5323	0.045	2236.17	128	2350.0%	1	R.EVEDFQPYFKGEIFLDEK.K
*	TK010303_lung_E18_mito_3_step11.2611.2611.2	1.406	0.0097	2670.08	32	1670.0%	2	R.AEAADLMSLKPKLDELGVPLYAVVK.E
*	TK010303_lung_E18_mito_3_step01.2211.2211.1	1.8573	0.1254	1418.81	5	4170.0%	2	K.LDELGVPLYAVVK.E
UPSA2_MOUSE70.3%118.6%233257948.3(P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3)
	TK010303_lung_E18_mito_3_step07.3754.3754.2	2.1638	0.2792	2361.05	3	2890.0%	1	K.RYNEDLELEDAIHTAILTLK.E
UQ9BTZ170.3%112.4%375429528.9(Q9BTZ1) Hypothetical protein
*	TK010303_lung_E18_mito_3_step08.2132.2132.1	1.7626	0.1475	1126.39	3	5620.0%	1	R.RSNLTQHIR.T
URPOM_HUMAN70.2%8127.7%12301386849.0(O00411) DNA-directed RNA polymerase, mitochondrial precursor (EC 2.7.7.6) (MTRPOL)
*	TK010303_lung_E18_mito_3_step01.3723.3723.3	1.9095	0.0161	4386.26	68	1090.0%	1	R.TVEGATQHQELLETCPPTALHGALDALTQLGNCAWRVNGR.V
*	TK010303_lung_E18_mito_3_step09.2860.2860.3	1.9302	0.0812	3053.38	9	1800.0%	1	K.GLTFVSVHDCYWTHAADVSVMNQVCR.E
*	TK010303_lung_E18_mito_3_step11.2789.2789.2	1.1845	0.0189	2233.87	13	2780.0%	2	R.KYLCLLASDAEVPEPCLPR.Q
*	TK010303_lung_E18_mito_3_step08.1792.1792.1	1.7879	0.1402	1214.54	2	5000.0%	2	R.ELAHCQKVAR.E
*	TK010303_lung_E18_mito_3_step10.3222.3222.3	1.7347	0.0185	3963.72	53	1210.0%	1	R.TVEGATQHQELLETCPPTALHGALDALTQLGNCAWR.V
UQ96SE070.0%242.7%405452216.2(Q96SE0) Lung alpha/beta hydrolase protein 1
*	TK010303_lung_E18_mito_3_step03.2787.2787.1	1.8137	0.1254	1283.66	1	6000.0%	2	R.DGYQAVVFNNR.G
UQ9D5E469.8%111.7%523608284.8(Q9D5E4) 4930449E07Rik protein (RIKEN cDNA 4930449E07 gene)
*	TK010303_lung_E18_mito_3_step09.2030.2030.1	1.4932	0.2038	1142.66	1	6250.0%	1	K.HREAQLQMK.L
UTP2A_HUMAN69.8%447.0%15311743848.7(P11388) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3)
*	TK010303_lung_E18_mito_3_step12.2152.2152.2	1.5318	0.0524	2722.41	22	1600.0%	1	K.LDDANDAGGRNSTECTLILTEGDSAK.T
*	TK010303_lung_E18_mito_3_step08.2985.2985.3	1.9006	0.2511	4185.08	1	1500.0%	1	K.FLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCK.I
*	TK010303_lung_E18_mito_3_step12.1031.1031.1	1.7325	0.1544	1313.66	1	5000.0%	1	K.QDEQVGLPGKGGK.A
*	TK010303_lung_E18_mito_3_step07.2496.2496.3	2.5602	0.3688	3656.97	1	1850.0%	1	K.FTMDLDSDEDFSDFDEKTDDEDFVPSDASPPK.T
UQ9BWX769.8%223.3%697805547.7(Q9BWX7) BA342L8.1 (Novel protein similar to C21ORF13)
*	TK010303_lung_E18_mito_3_step07.1549.1549.2	0.8927	0.0675	1337.68	27	4000.0%	1	K.EISEARHLPER.D
*	TK010303_lung_E18_mito_3_step01.4023.4023.1	1.6595	0.1707	1593.86	1	5000.0%	1	K.LEDEWEREELDK.K
UQ96G7469.8%113.3%571606266.5(Q96G74) Hypothetical protein
*	TK010303_lung_E18_mito_3_step12.0983.0983.1	1.6587	0.1689	1529.56	2	3610.0%	1	R.RGGGVGVGGGGTGVGGGDR.D
UMEPB_HUMAN69.8%229.1%700794595.8(Q16820) Meprin A beta-subunit precursor (EC 3.4.24.18) (Endopeptidase-2) (N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase beta subunit) (PABA peptide hydrolase) (PPH beta)
*	TK010303_lung_E18_mito_3_step05.4010.4010.3	2.0073	0.097	4550.88	2	1320.0%	1	K.LNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQR.V
*	TK010303_lung_E18_mito_3_step12.3153.3153.2	1.9188	0.3172	2795.7	1	2290.0%	1	K.TAFQNGTEPTIVTRISDFEDVIGQR.M
UQ8R2V469.8%338.4%479544245.3(Q8R2V4) Similar to eukaryotic translation initiation factor 4 gamma, 1 (Fragment)
	TK010303_lung_E18_mito_3_step02.2074.2074.1	1.7737	0.1358	1298.49	3	5500.0%	1	R.ERPSQPEGLRK.A
*	TK010303_lung_E18_mito_3_step02.3548.3548.2	1.3276	0.0054	2394.56	80	1840.0%	1	K.SVTAFFNWLREAEDEESDHN.-
	TK010303_lung_E18_mito_3_step01.0907.0907.1	1.5384	0.1808	1111.68	4	5000.0%	1	R.SFSKEVEER.S
UCATL_MOUSE69.6%1110.2%334375476.8(P06797) Cathepsin L precursor (EC 3.4.22.15) (Major excreted protein) (MEP)
*	TK010303_lung_E18_mito_3_step02.3448.3448.3	2.9794	0.1879	3816.27	1	1970.0%	1	K.LISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIK.E
UIRX5_HUMAN69.6%248.6%417437196.5(P78411) Iroquois-class homeodomain protein IRX-5 (Iroquois homeobox protein 5) (IRX-2A)
*	TK010303_lung_E18_mito_3_step12.2187.2187.3	2.968	0.196	3359.93	5	1710.0%	2	K.DGGGGNEGSPCPPCPGPIAGQALGGSRASPAPAPSR.S
UQ9UIM069.4%240.8%11181238237.1(Q9UIM0) Hypothetical protein KIAA0453 (Fragment)
*	TK010303_lung_E18_mito_3_step01.1915.1915.1	1.9907	0.0824	1107.05	9	6250.0%	2	K.EFIINDILK.H
UACLY_HUMAN69.4%111.0%11011208257.3(P53396) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme)
*	TK010303_lung_E18_mito_3_step01.2270.2270.1	2.0001	0.1504	1272.78	6	5500.0%	1	K.KHLLVHAPDDK.K
UO9484269.3%113.4%621661955.1(O94842) Hypothetical protein KIAA0737
*	TK010303_lung_E18_mito_3_step12.2447.2447.2	2.1541	0.2742	2334.83	3	2500.0%	1	R.LSTTPSPTSSLHEDGVEDFRR.Q
UP9739369.2%444.8%15011719266.4(P97393) P190-B
*	TK010303_lung_E18_mito_3_step04.2053.2053.2	1.2221	0.088	1507.91	2	4170.0%	1	R.GKPKIIPYLDAYK.T
	TK010303_lung_E18_mito_3_step01.2203.2203.1	1.934	0.0992	904.75	3	6430.0%	1	K.VNLFILGK.D
*	TK010303_lung_E18_mito_3_step03.3612.3612.2	1.5602	0.0653	2917.29	26	1740.0%	1	K.IQFISPGQPWEEVMCFVMEDEAFK.Y
	TK010303_lung_E18_mito_3_step02.2653.2653.2	1.0339	0.0356	3170.39	3	1920.0%	1	R.NWESNYFGMPLQDLVTAEKPIPLFVEK.C
UQ9DA0069.0%41624.8%145164207.4(Q9DA00) 1700024G10Rik protein
*	TK010303_lung_E18_mito_3_step04.4331.4331.3	2.5692	0.0269	3968.34	15	1210.0%	4	K.TQLALLSQLLSLMRPSSLRQCLGIETLPSSLGQHSK.A
UQ9H2M868.8%9656.6%561640449.6(Q9H2M8) DC28
	TK010303_lung_E18_mito_3_step10.3705.3705.2	1.2466	0.1015	2525.66	40	1750.0%	1	K.LEPEEQNRPNERVDTVSEKPR.E
*	TK010303_lung_E18_mito_3_step10.3539.3539.2	2.2012	0.0853	1893.96	2	4000.0%	8	K.EGSPSSSQYYLLFQQR.K
UQ96NJ968.6%227.1%546602036.7(Q96NJ9) Hypothetical protein FLJ30707
*	TK010303_lung_E18_mito_3_step01.0910.0910.1	1.3708	0.1146	955.7	7	5620.0%	1	R.EGPLPTVSR.V
*	TK010303_lung_E18_mito_3_step02.3420.3420.2	1.8402	0.3221	3129.62	1	2240.0%	1	K.SLFCLPTGGPSLASSAEPQWFSNTGAPGHR.A
UQ9C03368.6%3319.3%347400806.2(Q9C033) Tripartite motif protein TRIM5 isoform gamma
	TK010303_lung_E18_mito_3_step04.4013.4013.2	1.0176	0.0626	2653.46	29	1900.0%	1	R.SQEHRGHHTFLTEEVAQEYQVK.L
	TK010303_lung_E18_mito_3_step01.1247.1247.1	1.7709	0.1426	1034.61	1	6670.0%	1	-.MASGILVNVK.E
	TK010303_lung_E18_mito_3_step10.4006.4006.3	2.0418	0.1097	4132.2	57	1100.0%	1	K.EEVTCPICLELLTQPLSLDCGHSFCQACLTANHKK.S
UQ96K4768.3%115.6%594659575.6(Q96K47) Hypothetical protein FLJ14701
*	TK010303_lung_E18_mito_3_step09.3436.3436.3	2.7617	0.2505	3617.4	1	1880.0%	1	R.LITEMEACISVLPTVSGNTDIQVEIALAMQPLR.S
UQ96K4968.3%116.7%555635367.5(Q96K49) Hypothetical protein FLJ14681
*	TK010303_lung_E18_mito_3_step05.3864.3864.3	2.6618	0.3102	4059.36	1	1810.0%	1	R.VIGGSNHLAVVLDDIILAVIDSIFVWFIFISLAQTMK.T
UQ9H2I668.1%2418.8%138156088.5(Q9H2I6) DC44
*	TK010303_lung_E18_mito_3_step02.2720.2720.2	2.2574	0.2205	3106.54	1	2200.0%	2	R.LESWLQQLWEVDFFSFSLQTILGTSK.L
UOPSX_MOUSE68.0%61831.5%337372098.5(O35214) Visual pigment-like receptor peropsin
	TK010303_lung_E18_mito_3_step07.2757.2757.3	1.3676	0.0571	4582.03	27	1120.0%	1	R.DWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPK.K
*	TK010303_lung_E18_mito_3_step02.3641.3641.3	2.0014	0.1303	3434.46	11	1530.0%	4	R.TEHSVIAAYLIVAGITSILSNVVVLGIFIKYK.E
*	TK010303_lung_E18_mito_3_step08.3698.3698.3	1.5855	8.0E-4	3633.2	4	1540.0%	1	R.TPTNAVIINLAFTDIGVSSIGYPMSAASDLHGSWK.F
UQ9D7R067.9%41019.1%215249505.6(Q9D7R0) 1500031J01Rik protein
	TK010303_lung_E18_mito_3_step02.4426.4426.2	1.3707	0.1227	2214.11	12	2500.0%	1	K.ELRTSLEEHQSALELIMSK.Y
	TK010303_lung_E18_mito_3_step03.3320.3320.2	1.8042	0.1255	2555.42	14	2140.0%	3	K.EQHSKELQAHVDQITEMAAVMR.K
UQ1519867.8%115.6%375418618.5(Q15198) PDGF receptor beta-like tumor suppressor (Similar to platelet-derived growth factor receptor-like)
*	TK010303_lung_E18_mito_3_step10.2897.2897.2	2.2736	0.1415	2333.11	5	2500.0%	1	R.FQKPAATLSLLAGQTVELRCK.G
UGELS_MOUSE67.7%3313.6%730807465.8(P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin)
*	TK010303_lung_E18_mito_3_step09.1906.1906.3	1.7519	0.0040	3837.42	2	1430.0%	1	K.VSNGAGSMSVSLVADENPFAQGPLRSEDCFILDHGR.D
*	TK010303_lung_E18_mito_3_step02.2630.2630.2	2.0662	0.2983	2799.19	1	3330.0%	1	K.NWRDPDQTDGPGLGYLSSHIANVER.V
*	TK010303_lung_E18_mito_3_step12.1827.1827.3	1.4218	0.0854	4399.47	39	950.0%	1	R.ATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFER.L
UAPOH_MOUSE67.7%229.3%345386198.2(Q01339) Beta-2-glycoprotein I precursor (Apolipoprotein H) (Apo-H) (B2GPI) (Beta(2)GPI) (Activated protein C-binding protein) (APC inhibitor)
	TK010303_lung_E18_mito_3_step02.2216.2216.1	1.5071	0.1869	1106.77	1	5620.0%	1	K.EHSSLAFWK.T
*	TK010303_lung_E18_mito_3_step12.2080.2080.2	1.6814	0.1159	2721.67	1	2730.0%	1	K.CPFPPRPENGYVNYPAKPVLLYK.D
UDONS_HUMAN67.6%2210.2%566627478.7(Q9NYP3) Downstream of son gene protein (Protein C21orf60) (B17)
*	TK010303_lung_E18_mito_3_step07.4444.4444.2	1.83	0.317	2711.12	1	2830.0%	1	R.DQFSLEITGPIMPHSLHSLTMLLK.S
*	TK010303_lung_E18_mito_3_step06.3055.3055.3	2.0054	0.0332	3747.37	1	1670.0%	1	R.TTVTELPQTSHVSFSEPDIPSSKSTELPVDWSIK.T
UI12A_HUMAN67.6%4165.0%219248746.7(P29459) Interleukin-12 alpha chain precursor (IL-12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (NK cell stimulatory factor chain 1) (NKSF1)
*	TK010303_lung_E18_mito_3_step01.3384.3384.1	1.9367	0.0719	1264.68	1	5500.0%	4	K.TMNAKLLMDPK.R
UMAPB_MOUSE67.6%10107.6%24642704094.8(P14873) Microtubule-associated protein 1B (MAP 1B) (MAP1.2) (MAP1(X)) [Contains: MAP1 light chain LC1]
	TK010303_lung_E18_mito_3_step02.4117.4117.2	1.7182	0.2152	3142.27	1	2220.0%	1	K.QGVDDIEKFEDEGAGFEESSETGDYEEK.A
	TK010303_lung_E18_mito_3_step12.3871.3871.2	1.6253	0.2054	2969.38	1	2040.0%	1	K.TLEVVSPSQSVTGSAGHTPYYQSPTDEK.S
	TK010303_lung_E18_mito_3_step06.1818.1818.2	1.0593	0.0165	2276.5	78	1840.0%	1	K.EECPRPMSISPPDFSPKTAK.S
*	TK010303_lung_E18_mito_3_step01.1418.1418.1	1.2991	0.0222	1346.65	38	3640.0%	1	K.EVSSKEEQSPVK.A
*	TK010303_lung_E18_mito_3_step12.3473.3473.2	1.5609	0.1483	3043.64	12	1610.0%	1	K.VSAEGEARSVSPGVTQAVVEEHCASPEEK.T
*	TK010303_lung_E18_mito_3_step06.4098.4098.2	1.0145	0.0615	2257.47	171	1840.0%	1	R.ESPVSDLTSTGLYQDKQEEK.S
	TK010303_lung_E18_mito_3_step08.3017.3017.2	1.8624	0.0776	2185.94	6	2370.0%	1	R.VRSSYYVVSGNDPAAEEPSR.A
*	TK010303_lung_E18_mito_3_step10.2425.2425.2	1.3003	0.1796	2670.82	2	1830.0%	1	K.TTEAAATAVGTAATTAAVVAAAGIAASGPVK.E
UQ96RY567.6%222.4%15871698358.4(Q96RY5) Hypothetical protein
*	TK010303_lung_E18_mito_3_step01.3106.3106.1	1.7253	0.1399	1376.8	2	4550.0%	1	K.DFEAIQNNIALK.Y
*	TK010303_lung_E18_mito_3_step04.4291.4291.2	1.1962	0.0674	2847.03	236	1200.0%	1	K.VTLHLFPGENCTLTPLPGVARVVHSK.A
UQ9CS8567.4%41015.5%290316426.7(Q9CS85) 5730419I09Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step03.2800.2800.3	2.0379	0.2551	3212.48	15	1570.0%	1	K.QCVFMENPSKNQAQCLINVSGDAVVFVR.D
	TK010303_lung_E18_mito_3_step04.2925.2925.2	2.0675	0.145	1701.45	3	4060.0%	3	R.AHVAALGGNAVVSYIMK.Q
UQ9UPG267.3%333.2%20442312906.9(Q9UPG2) Phosphatidylinositol 4-kinase 230
*	TK010303_lung_E18_mito_3_step04.4525.4525.2	1.2184	0.0548	2497.93	56	2000.0%	1	R.MFNEHGMETALACWEWLLAGK.D
*	TK010303_lung_E18_mito_3_step01.0235.0235.1	1.5835	0.1647	902.62	2	7140.0%	1	K.IVEEAVLK.S
*	TK010303_lung_E18_mito_3_step04.3098.3098.3	2.5574	0.0674	4062.16	6	1430.0%	1	K.SLDAIVASVMEANPSADLYYTSFSDPLYLTMFKMLR.D
UCDK4_MOUSE67.3%4422.1%303337516.6(P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3)
*	TK010303_lung_E18_mito_3_step04.1862.1862.3	1.8176	0.0117	2347.02	10	2380.0%	1	-.MAATRYEPVAEIGVGAYGTVYK.A
	TK010303_lung_E18_mito_3_step11.4300.4300.3	2.2996	0.2132	3492.82	1	1750.0%	1	R.GPRPVQSVVPEMEESGAQLLLEMLTFNPHKR.I
	TK010303_lung_E18_mito_3_step11.2767.2767.3	1.5296	0.2151	3338.77	6	1640.0%	1	R.GPRPVQSVVPEMEESGAQLLLEMLTFNPHK.R
	TK010303_lung_E18_mito_3_step01.2731.2731.1	1.5822	0.1629	1553.64	4	3850.0%	1	R.DPHSGHFVALKSVR.V
UQ9D31767.1%112.2%638714137.0(Q9D317) 9030613J17Rik protein
	TK010303_lung_E18_mito_3_step01.1158.1158.1	1.5631	0.1628	1547.83	5	3850.0%	1	K.GISYYIGAQSNFTK.L
UQ8R0N567.0%3320.0%355383919.0(Q8R0N5) Similar to quinone reductase-like protein (Fragment)
*	TK010303_lung_E18_mito_3_step05.4268.4268.2	1.2099	0.1986	2114.24	24	2500.0%	1	K.QPLTIQEVAPRPVGPQEVR.V
*	TK010303_lung_E18_mito_3_step11.2161.2161.2	1.8594	0.31	2593.17	1	2270.0%	1	K.SMSTAMQYCQQGLIHPHTGAVFK.L
*	TK010303_lung_E18_mito_3_step08.4172.4172.2	1.8338	0.1562	2857.98	14	1610.0%	1	R.IQPGETVLVTAAAGATGLAVIDVATNVFR.A
UQ9JMB667.0%559.8%9711094889.0(Q9JMB6) MILI (Miwi like)
*	TK010303_lung_E18_mito_3_step05.3388.3388.2	1.1923	0.1049	2285.05	10	2370.0%	1	R.ISQNETASNELTRWGLSLHK.D
*	TK010303_lung_E18_mito_3_step07.1833.1833.2	1.4831	0.1147	1855.87	6	2780.0%	1	R.GSSEVSLLPLGRAASSIGR.G
	TK010303_lung_E18_mito_3_step02.2066.2066.2	1.1897	4.0E-4	2366.06	8	2780.0%	1	K.WYSRVVFQMPHQEIVDSLK.L
*	TK010303_lung_E18_mito_3_step01.3779.3779.1	1.9283	0.0757	1243.8	3	4550.0%	1	K.GTPQSLGLNLIK.I
*	TK010303_lung_E18_mito_3_step02.2710.2710.2	1.3215	0.0074	3039.61	249	1250.0%	1	R.NDSVLDVMHAIYQQNKEHFQDECSK.L
UQ8R0Z867.0%51343.7%126137939.0(Q8R0Z8) Hypothetical 13.8 kDa protein
*	TK010303_lung_E18_mito_3_step11.3924.3924.3	1.9613	0.1626	3876.48	83	1030.0%	3	R.GDLVCEVDLGHLAPDGRFIGLESVFQAVDYMYTGK.N
*	TK010303_lung_E18_mito_3_step08.4449.4449.2	2.0491	0.2969	2092.89	1	3420.0%	2	R.LIVIGFISGYQSPTGLSPIK.A
UGTA4_MOUSE66.9%114.1%222255647.4(P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4)
*	TK010303_lung_E18_mito_3_step01.2379.2379.1	1.6955	0.1511	1114.8	1	5620.0%	1	K.YNLYGKDLK.E
UGTA1_HUMAN66.9%2214.9%221255008.9(P08263) Glutathione S-transferase A1 (EC 2.5.1.18) (GTH1) (HA subunit 1) (GST-epsilon) (GSTA1-1) (GST class-alpha)
	TK010303_lung_E18_mito_3_step01.2379.2379.1	1.6955	0.1511	1114.8	1	5620.0%	1	K.YNLYGKDIK.E
	TK010303_lung_E18_mito_3_step12.1121.1121.3	1.4724	0.0601	2813.39	1	1960.0%	1	R.NDGYLMFQQVPMVEIDGMKLVQTR.A
UQ9D1P466.9%2212.7%331373517.9(Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene)
	TK010303_lung_E18_mito_3_step07.2209.2209.2	2.2565	0.1972	1850.01	1	5000.0%	1	K.FQEHIIQAPKPVEAIK.R
*	TK010303_lung_E18_mito_3_step11.3984.3984.2	1.7188	0.2046	2866.45	10	2000.0%	1	K.NSLPELSQVEANSTLLNVHIVFEGEK.E
UGSHP_MOUSE66.8%117.5%226253778.1(P46412) Plasma glutathione peroxidase precursor (EC 1.11.1.9) (GSHPx-P)
	TK010303_lung_E18_mito_3_step04.3133.3133.2	2.2611	0.156	1955.72	1	4060.0%	1	K.YVRPGGGFVPNFQLFEK.G
UQ8TEP466.6%5515.3%792883026.8(Q8TEP4) FLJ00149 protein (Fragment)
*	TK010303_lung_E18_mito_3_step10.3199.3199.3	2.1018	0.0517	3931.89	30	1320.0%	1	R.HLSEPCEPPDATEQGQLHDRCLAEAVADTLGVVCR.R
	TK010303_lung_E18_mito_3_step12.1729.1729.1	1.794	0.1186	1532.44	4	3930.0%	1	K.GGAQHGVSSCEGTQR.T
	TK010303_lung_E18_mito_3_step11.2983.2983.3	1.656	0.0403	4103.29	64	1060.0%	1	R.WLTWEITQTQYILEGYSILDNNAATMLQVFDLRR.I
*	TK010303_lung_E18_mito_3_step08.2864.2864.3	2.059	0.3118	3526.3	1	1810.0%	1	R.QHSGGNIEDVDGGGAPTTGGNNAPSGGSQESSAEQPR.K
UQ9JJA866.6%111.9%415474058.0(Q9JJA8) Brain cDNA, clone MNCb-5081
*	TK010303_lung_E18_mito_3_step12.1156.1156.1	1.921	0.0521	971.62	1	6430.0%	1	K.FIHKPSLK.A
UQ9P2D466.5%467.9%13991581245.8(Q9P2D4) Hypothetical protein KIAA1413 (Fragment)
*	TK010303_lung_E18_mito_3_step05.2737.2737.3	1.564	0.0478	4384.31	97	1000.0%	1	R.GTLENSNSPVPEFSHGIGISNADSQSTCDAERGNSEQAEMR.A
*	TK010303_lung_E18_mito_3_step02.2241.2241.3	2.5841	0.3521	3813.07	1	1820.0%	1	K.STFVEESELTSADESENLNILCKLFGSFSLEALK.D
*	TK010303_lung_E18_mito_3_step05.3296.3296.3	1.9762	0.0156	4080.38	5	1210.0%	2	K.TDTDSSMERVSPSTCCSENNQEDCDLANSGPLQNEK.S
UQ8TE9766.5%1117.5%1711871411.6(Q8TE97) Hypothetical protein FLJ23755
*	TK010303_lung_E18_mito_3_step12.2053.2053.3	2.5589	0.3964	3184.78	2	1810.0%	1	R.RGMLEVTSPPMALLWAGSVRPAPSCTLTSP.-
URB37_MOUSE66.4%1111.7%223247165.7(Q9JKM7) Ras-related protein Rab-37
*	TK010303_lung_E18_mito_3_step07.3657.3657.2	2.0884	0.2852	2819.62	1	2400.0%	1	R.EYGVPFMETSAKTGMNVELAFLAIAK.E
UQ921W866.4%2222.9%192214388.2(Q921W8) Similar to secreted and transmembrane 1
*	TK010303_lung_E18_mito_3_step04.2670.2670.2	2.2673	0.0883	1756.72	1	5330.0%	1	R.GWELQVQGGQAQLVIK.D
*	TK010303_lung_E18_mito_3_step09.4002.4002.3	1.9904	0.0844	2999.99	4	1760.0%	1	R.GNPAVMTCNISNTFTDVTIQLSANGKDK.T
UQ9D06166.4%2222.0%282308145.2(Q9D061) 2610100E10Rik protein
*	TK010303_lung_E18_mito_3_step12.2744.2744.3	2.5661	0.214	3921.9	13	1150.0%	1	-.MATPFLPSGATTGDSGGELSSGDDSGDMGSFQTPEAEGTR.S
*	TK010303_lung_E18_mito_3_step09.3499.3499.2	2.2598	0.0371	2324.42	3	2860.0%	1	R.SLAQLFEKAAAHVQGLVQVASR.E
UCLDH_HUMAN66.4%116.2%224246039.7(P56750) Claudin-17
*	TK010303_lung_E18_mito_3_step08.4180.4180.2	2.2634	0.0353	1835.93	4	4620.0%	1	R.LWEGLWMNCIRQAR.V
UQ9CZJ266.0%4411.1%685761198.5(Q9CZJ2) 2700081N06Rik protein (RIKEN cDNA 2700081N06 gene)
	TK010303_lung_E18_mito_3_step11.2601.2601.2	2.0832	0.2857	1390.71	4	4170.0%	1	R.VVVPHDVGLTILK.G
	TK010303_lung_E18_mito_3_step10.3543.3543.2	1.2974	0.1165	2645.03	90	1200.0%	1	R.VVVPHDVGLTILKGAVLFGQAPGVVR.V
*	TK010303_lung_E18_mito_3_step06.2487.2487.3	1.5851	0.0868	3360.31	5	1720.0%	1	R.YMVADCGGGTVDLTVHQLEQPHGTLKELYK.A
*	TK010303_lung_E18_mito_3_step12.2989.2989.2	1.5583	0.0337	2279.13	11	2370.0%	1	R.EDAEKLLIALEPEAASVYCR.K
UQ6087366.0%225.8%504576666.0(Q60873) P58
	TK010303_lung_E18_mito_3_step04.1834.1834.1	1.4884	0.1908	680.35	3	6000.0%	1	R.GHLLLK.Q
	TK010303_lung_E18_mito_3_step06.3655.3655.2	1.6154	0.0525	2445.59	14	2050.0%	1	K.FDDGEDPLDAESQQGGGGNPFHR.S
UATS9_HUMAN66.0%334.8%16291826497.7(Q9P2N4) ADAMTS-9 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase with thrombospondin motifs 9) (ADAM-TS 9) (ADAM-TS9)
*	TK010303_lung_E18_mito_3_step11.4356.4356.2	1.424	0.0182	2856.23	1	2400.0%	1	R.YVSCRDENGSVADESACATLPRPVAK.E
*	TK010303_lung_E18_mito_3_step04.3418.3418.2	1.7033	0.3818	2939.94	5	2170.0%	1	K.SPQHVMAPTLNFYTNPWMWSKCSR.K
*	TK010303_lung_E18_mito_3_step07.3601.3601.2	1.5589	0.0129	3111.21	119	1070.0%	1	K.TVAGTFNTVHYGYNTVVRIPAGATNIDVR.Q
UO7556065.9%445.1%15331744126.8(O75560) Melastatin 1
*	TK010303_lung_E18_mito_3_step03.3001.3001.2	1.3043	0.0513	2944.43	245	1200.0%	1	R.ASSECEATYLLRQSSINSADGYSLYR.Y
*	TK010303_lung_E18_mito_3_step12.3632.3632.2	2.2414	0.146	2622.48	3	2610.0%	1	K.AMAHESSESDLVDDISQDLDNNSK.D
*	TK010303_lung_E18_mito_3_step04.1846.1846.2	1.6463	0.1072	1585.21	6	4170.0%	1	K.NFRTLYNNLFGPK.R
*	TK010303_lung_E18_mito_3_step10.2194.2194.2	1.9342	0.0493	1607.5	18	4640.0%	1	K.EEENTDANADAGSRK.G
UQ9CXH365.9%2423.3%129145856.7(Q9CXH3) 3300002I08Rik protein
*	TK010303_lung_E18_mito_3_step07.2914.2914.3	2.2609	0.1193	3572.77	3	1380.0%	2	-.MGVVTYDDVHVNFTQEEWALLDPSQKNLYR.D
UIHBE_MOUSE65.7%353.4%350390579.5(O08717) Inhibin beta E chain precursor (Activin beta-E chain)
*	TK010303_lung_E18_mito_3_step12.1419.1419.1	1.8996	0.0574	1365.59	1	5000.0%	2	R.EKVISFATIIDK.S
UQ9EQU165.7%353.5%10801224608.8(Q9EQU1) Deubiquitinating enzyme UBPY
	TK010303_lung_E18_mito_3_step07.4161.4161.2	1.235	0.0418	1409.64	1	4290.0%	1	R.LSTQPALAGPGAAPR.A
	TK010303_lung_E18_mito_3_step02.3874.3874.2	1.7765	0.0081	2625.4	1	3180.0%	2	K.YNLFSVSNHYGGLDGGHYTAYCK.N
UZS11_HUMAN65.7%2415.0%313341894.9(Q9Y6I9) Putative secreted protein ZSIG11 precursor
*	TK010303_lung_E18_mito_3_step11.4235.4235.3	1.9649	0.0199	4597.11	4	1200.0%	2	R.GLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSR.G
UEZH2_MOUSE65.5%4103.8%746853366.8(Q61188) Enhancer of zeste homolog 2 (ENX-1)
*	TK010303_lung_E18_mito_3_step11.1288.1288.2	1.1313	0.0391	1724.29	39	2500.0%	1	R.RIQPVHIMTSVSSLR.G
	TK010303_lung_E18_mito_3_step05.2694.2694.2	1.9192	0.0012	1399.78	16	4580.0%	3	K.KDETSSSSEANSR.C
UQ8R1E565.3%112.2%411457268.8(Q8R1E5) Hypothetical 45.7 kDa protein
	TK010303_lung_E18_mito_3_step07.1973.1973.1	1.8905	0.068	1087.43	3	7500.0%	1	K.DQLIEVIEK.L
UMGL2_HUMAN65.3%112.1%529586708.0(Q9UJ55) MAGE-like protein 2 (Necdin-like protein 1) (Protein nM15)
*	TK010303_lung_E18_mito_3_step09.1930.1930.1	1.6681	0.1498	1208.68	2	5500.0%	1	R.ETNGLFGNTKK.L
UQ9H2F565.0%111.4%836934638.6(Q9H2F5) Enhancer of polycomb
*	TK010303_lung_E18_mito_3_step11.1924.1924.1	1.8691	0.0823	1390.65	3	5000.0%	1	K.SGFRLNIQGLER.T
UQ9NYU165.0%353.6%15161747606.9(Q9NYU1) UDP-glucose:glycoprotein glucosyltransferase 2 precursor
*	TK010303_lung_E18_mito_3_step10.2679.2679.2	1.5276	0.0714	2527.53	4	2860.0%	2	K.ENLPVVILYAEMGTRTFSAFHK.V
*	TK010303_lung_E18_mito_3_step11.2651.2651.3	2.9434	0.04	3552.27	5	1530.0%	1	K.SEDIYQIVGHEGTDSQADLEDIIVVLNSFKSK.I
UQ8R2V064.9%2210.6%660704875.8(Q8R2V0) Similar to KIAA0582 protein
*	TK010303_lung_E18_mito_3_step11.3319.3319.2	1.9504	0.2924	2572.04	3	2290.0%	1	R.GPLPSASVGTGEVLHSMGSQMEEDR.L
*	TK010303_lung_E18_mito_3_step12.2664.2664.3	1.8808	0.1479	4262.34	5	1020.0%	1	R.ASFANVSSPELTVPQAAHSVVGAGPPLQGSAQPLTSGSDATGLGK.R
UQ96NX964.8%3314.9%599653239.1(Q96NX9) Dachshund 2
*	TK010303_lung_E18_mito_3_step01.4246.4246.1	1.7308	0.1257	1406.86	1	4580.0%	1	K.QATTSDSGLRMLK.D
*	TK010303_lung_E18_mito_3_step07.4446.4446.3	2.2002	0.2104	3959.46	51	1150.0%	1	K.IQLTPGQALPAGFPGPFIFADSLSSVETLLTNIQGLLK.V
*	TK010303_lung_E18_mito_3_step09.3694.3694.3	1.8682	0.0522	4018.14	3	1420.0%	1	K.LMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDK.M
UQ9CQI264.7%7717.9%9241020426.7(Q9CQI2) Lipin 1
	TK010303_lung_E18_mito_3_step11.2457.2457.2	1.5446	0.0181	2556.55	46	1840.0%	1	K.RSHSCDFPCSDTFSNFTFWR.E
	TK010303_lung_E18_mito_3_step06.1709.1709.2	1.98	0.0991	1673.11	2	3930.0%	1	K.QVGVSLNRIFTVNPK.G
	TK010303_lung_E18_mito_3_step04.3055.3055.3	2.86	0.2322	3916.16	3	1500.0%	1	K.LGDNGEAFFVQETDNDQEIIPMYLATSPILSEGAAR.M
	TK010303_lung_E18_mito_3_step11.1433.1433.2	1.3454	0.0017	2287.86	65	1840.0%	1	-.MNYVGQLAGQVFVTVKELYK.G
*	TK010303_lung_E18_mito_3_step09.4556.4556.3	1.0405	0.0689	3505.36	1	1080.0%	1	K.RDDNVNTSEDEDMFPIEMSSDEDTAPMDGSR.T
	TK010303_lung_E18_mito_3_step07.2594.2594.3	1.6162	0.0764	3890.14	4	1410.0%	1	K.VQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYK.Q
	TK010303_lung_E18_mito_3_step08.1606.1606.1	1.1153	0.0129	1094.42	59	4440.0%	1	K.MKESSPLGSR.K
UQ8WVP064.7%112.0%9601100598.5(Q8WVP0) Kinesin-like 5 (Mitotic kinesin-like protein 1)
*	TK010303_lung_E18_mito_3_step05.3049.3049.2	1.9406	0.2983	2330.04	1	3060.0%	1	R.EVVPTFRNEIEIEEDHCGR.L
UQ0790064.7%222.8%11561253536.0(Q07900) M130 antigen cytoplasmic variant 2 precursor
*	TK010303_lung_E18_mito_3_step04.3475.3475.2	1.1637	0.0411	2326.59	123	1760.0%	1	K.ESRIWQCHSHGWGQQNCR.H
*	TK010303_lung_E18_mito_3_step01.4022.4022.1	1.6362	0.1509	1515.84	4	4230.0%	1	R.EPRLVGGDIPCSGR.V
UDHB3_HUMAN64.7%113.9%310345168.7(P37058) Estradiol 17 beta-dehydrogenase 3 (EC 1.1.1.62) (17-beta-HSD 3) (Testicular 17-beta-hydroxysteroid dehydrogenase)
*	TK010303_lung_E18_mito_3_step01.2642.2642.1	1.6398	0.1504	1536.75	2	4550.0%	1	R.CVLLNYWKVLPK.S
UO9566064.7%243.2%280316517.4(O95660) CD84
*	TK010303_lung_E18_mito_3_step01.0290.0290.1	0.8657	0.0096	1033.51	61	4380.0%	2	R.QGRIFPEGK.M
UQ9CWM764.7%338.7%412474359.5(Q9CWM7) 2410017I18Rik protein
*	TK010303_lung_E18_mito_3_step01.1422.1422.1	1.7929	0.1014	1566.69	1	5000.0%	1	R.LGFFQKELELNVK.K
*	TK010303_lung_E18_mito_3_step04.1827.1827.1	1.4087	0.1411	972.66	2	6430.0%	1	K.ELELNVKK.T
*	TK010303_lung_E18_mito_3_step11.2067.2067.3	1.8175	0.0061	2597.16	15	2020.0%	1	K.QILLFLKDLGLEDNQLDTYLTK.N
UP7033664.3%8206.0%13881605856.0(P70336) Rho-associated, coiled-coil forming protein kinase p160 ROCK-2
	TK010303_lung_E18_mito_3_step04.2359.2359.1	1.3651	0.0091	1171.47	2	6110.0%	1	R.LEGWLSLPVR.N
	TK010303_lung_E18_mito_3_step10.2450.2450.2	1.1321	0.0782	2593.09	28	1500.0%	1	K.ELQDQLEAEQYFSTLYKTQVR.E
*	TK010303_lung_E18_mito_3_step11.1857.1857.3	1.3711	0.0565	3258.96	27	1370.0%	1	R.SQLQALHIGMDSSSIGSGPGDAEPDDGFPESR.L
	TK010303_lung_E18_mito_3_step10.2842.2842.2	2.2134	0.1803	1892.83	1	4670.0%	4	K.ELNEMQAQIAEESQIR.I
	TK010303_lung_E18_mito_3_step10.2134.2134.2	1.5422	0.1372	1628.55	1	4230.0%	1	R.LEGWLSLPVRNNTK.K
UPARG_HUMAN64.2%243.6%331374855.5(Q9HBI0) Gamma-parvin
*	TK010303_lung_E18_mito_3_step01.2147.2147.1	1.6837	0.1365	1287.66	1	5000.0%	2	K.GVEPPAEEELSK.G
UMAPE_HUMAN64.2%2213.8%509578906.9(P78395) Melanoma antigen preferentially expressed in tumors (Preferentially expressed antigen of melanoma) (OPA-interacting protein 4) (OIP4)
*	TK010303_lung_E18_mito_3_step06.2698.2698.3	1.6158	0.0767	4453.29	17	980.0%	1	R.LSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLER.A
*	TK010303_lung_E18_mito_3_step02.3924.3924.2	2.0574	0.2818	3089.44	1	2040.0%	1	K.DEALAIAALELLPRELFPPLFMAAFDGR.H
UICE4_HUMAN64.2%62013.8%377432626.0(P49662) Caspase-4 precursor (EC 3.4.22.-) (CASP-4) (ICH-2 protease) (TX protease) (ICE(rel)-II)
	TK010303_lung_E18_mito_3_step11.3841.3841.2	1.7488	0.1333	2583.79	4	2620.0%	4	K.QRMAGQMLLQTFFNIDQISPNK.K
*	TK010303_lung_E18_mito_3_step08.2994.2994.3	2.7263	0.2418	3300.36	1	2500.0%	2	R.GELWVRDSPASLEVASSQSSENLEEDAVYK.T
UQ8VDN264.1%226.3%10231129825.5(Q8VDN2) ATPase, Na+K+ transporting, alpha 1 polypeptide (Hypothetical 113.0 kDa protein)
	TK010303_lung_E18_mito_3_step01.3722.3722.2	1.922	0.2923	2837.51	1	3120.0%	1	K.EQPLDEELKDAFQNAYLELGGLGER.V
*	TK010303_lung_E18_mito_3_step04.4118.4118.3	1.5437	0.0559	3965.82	84	990.0%	1	K.ADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGR.L
UWDRA_HUMAN64.1%9653.0%12421419696.5(Q9HBG6) WD-repeat protein 10
	TK010303_lung_E18_mito_3_step11.1961.1961.2	1.0835	0.0468	2642.55	2	2250.0%	1	K.HPEFKDDIYMPYAQWLAENDR.F
	TK010303_lung_E18_mito_3_step05.3501.3501.2	1.5564	0.0155	1857.26	13	2670.0%	8	K.MGDLKSLVQLHVETQR.W
UQ9BTZ264.1%2410.1%278295378.5(Q9BTZ2) Peroxisomal short-chain alcohol dehydrogenase
	TK010303_lung_E18_mito_3_step01.3347.3347.2	1.729	0.3554	2926.71	1	2220.0%	2	R.KQQNVDQAVATLQGEGLSVTGTVCHVGK.A
UQ8VEZ364.1%116.8%309345878.4(Q8VEZ3) Olfactory receptor MOR228-2
*	TK010303_lung_E18_mito_3_step03.4061.4061.2	1.7494	0.3532	2440.82	4	2500.0%	1	K.MIAVFYTVITPLLNPLIYSLR.N
UGTSE_HUMAN64.1%113.2%720766159.4(Q9NYZ3) G2 and S phase expressed protein 1 (B99 homolog)
*	TK010303_lung_E18_mito_3_step08.3672.3672.2	1.729	0.3435	2395.95	2	2270.0%	1	K.SSEFASIPANSSRPLSNISKSGR.M
UMET_HUMAN64.0%7713.2%13901555277.3(P08581) Hepatocyte growth factor receptor precursor (EC 2.7.1.112) (Met proto-oncogene tyrosine kinase) (c-met) (HGF receptor) (HGF-SF receptor)
*	TK010303_lung_E18_mito_3_step09.2674.2674.2	1.2725	0.1419	2311.75	10	2250.0%	1	R.VLLGNESCTLTLSESTMNTLK.C
*	TK010303_lung_E18_mito_3_step06.1738.1738.3	1.7189	0.2436	3010.81	324	1400.0%	1	R.FINFFVGNTINSSYFPDHPLHSISVR.R
*	TK010303_lung_E18_mito_3_step05.3458.3458.3	2.0634	0.0616	4201.79	106	990.0%	1	R.SGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGK.K
*	TK010303_lung_E18_mito_3_step03.2052.2052.3	2.2054	0.2477	2267.38	1	3090.0%	1	R.RLLQPEYCPDPLYEVMLK.C
*	TK010303_lung_E18_mito_3_step04.4122.4122.2	0.9442	0.0285	2277.79	32	1820.0%	1	K.SFISGGSTITGVGKNLNSVSVPR.M
*	TK010303_lung_E18_mito_3_step04.3367.3367.3	2.6605	0.2763	3819.61	1	2050.0%	1	R.ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLR.S
*	TK010303_lung_E18_mito_3_step09.4003.4003.2	1.1134	0.028	2546.75	85	1590.0%	1	K.SVSNSILECYTPAQTISTEFAVK.L
UTRM2_MOUSE63.9%226.0%744814457.0(Q9ESN6) Tripartite motif protein 2 (Neural activity-related ring finger protein)
	TK010303_lung_E18_mito_3_step11.3995.3995.2	1.3875	0.0886	3065.06	106	1250.0%	1	R.GRSPGQLQRPTGVAVHPSGDIIIADYDNK.W
	TK010303_lung_E18_mito_3_step07.3121.3121.2	1.79	0.3036	1816.62	2	3330.0%	1	K.ASIVDDIHSTFDELQK.T
UATX1_HUMAN63.9%223.4%816870518.4(P54253) Ataxin-1 (Spinocerebellar ataxia type 1 protein)
*	TK010303_lung_E18_mito_3_step04.2038.2038.2	1.2204	0.1007	2152.3	4	2370.0%	1	R.IEDSHSPGVAVIQFAVGEHR.A
*	TK010303_lung_E18_mito_3_step10.3794.3794.2	1.8987	0.2929	3034.43	1	2220.0%	1	K.IDSSTVERIEDSHSPGVAVIQFAVGEHR.A
UCOXE_MOUSE63.8%3342.3%1111235210.0(P43024) Cytochrome c oxidase polypeptide VIa-liver, mitochondrial precursor (EC 1.9.3.1)
	TK010303_lung_E18_mito_3_step12.2529.2529.3	2.3901	0.1363	3321.01	2	1880.0%	1	R.TKPFPWGDGNHTLFHNPHVNPLPTGYEDE.-
	TK010303_lung_E18_mito_3_step12.1743.1743.2	2.1488	0.2438	2013.88	4	3330.0%	1	R.HEEHERPPFVAYPHLR.I
	TK010303_lung_E18_mito_3_step11.1947.1947.2	1.1083	0.0311	2286.12	18	2350.0%	1	R.HEEHERPPFVAYPHLRIR.T
UQ91VF563.8%119.5%444456348.9(Q91VF5) Putative emu1 protein precursor
*	TK010303_lung_E18_mito_3_step04.3719.3719.3	2.8633	0.2108	4218.1	2	1460.0%	1	K.VAVLSVTEQTVPSVPATPEDSALLWGSPAARGSPGDGSLQDR.L
UKHL1_MOUSE63.8%81023.2%751829336.5(Q9JI74) Kelch-like protein 1
	TK010303_lung_E18_mito_3_step09.3690.3690.3	1.7531	0.0674	3417.06	9	1700.0%	1	K.EDTIENLLAAACLLQLPQVVEVCCHFLMK.L
*	TK010303_lung_E18_mito_3_step06.3587.3587.2	1.4269	0.044	2584.16	43	1670.0%	1	K.GLALKELQAEPASSIQATGEGCGHR.L
*	TK010303_lung_E18_mito_3_step08.4160.4160.2	2.1959	0.2114	2153.82	1	3240.0%	2	R.WDPQSQQWTYVASMSIAR.S
	TK010303_lung_E18_mito_3_step07.4220.4220.3	2.0834	0.0734	3228.16	6	1850.0%	1	R.AFADAQGCIELMKVAHSYTMENIMEVIR.N
	TK010303_lung_E18_mito_3_step01.2118.2118.3	2.0522	0.0327	3411.47	11	1610.0%	1	K.QEEIKMEGIDPNALWDLVQFAYTGCLELK.E
	TK010303_lung_E18_mito_3_step09.4372.4372.2	1.1765	0.0322	2329.22	13	2050.0%	1	K.STVGTLYAVGGMDNNKGATTIEK.Y
	TK010303_lung_E18_mito_3_step10.3530.3530.2	1.2929	0.0608	3069.28	12	1730.0%	1	R.LVLSSVSDYFAAMFTSDVCEAKQEEIK.M
UQ9JMB863.7%101621.3%10281137596.6(Q9JMB8) Neural recognition molecule NB-3
*	TK010303_lung_E18_mito_3_step08.2569.2569.2	1.3628	0.0122	2292.62	1	3060.0%	1	K.FQQEDEGFYECIAGNLRGR.N
*	TK010303_lung_E18_mito_3_step06.3557.3557.3	2.1872	0.0396	4229.34	4	1280.0%	1	R.TPFSVGWQAVATVPEILNGQTYNATVVGLSPWVEYEFR.V
*	TK010303_lung_E18_mito_3_step06.4294.4294.3	1.9869	0.131	4583.72	4	1310.0%	1	R.STVSVREGQGVVLLCGPPPHFGELSYAWTFNDSPLYVQEDK.R
*	TK010303_lung_E18_mito_3_step12.1441.1441.1	1.5265	0.169	1277.13	1	5000.0%	1	K.RVLFLEDGSLK.I
*	TK010303_lung_E18_mito_3_step08.2512.2512.3	1.7622	0.1156	3854.6	2	1590.0%	1	R.LNTEERIQIENGTLIITMLNISDSGIYQCAAENK.Y
*	TK010303_lung_E18_mito_3_step03.3463.3463.3	1.9851	0.0395	4106.19	1	1570.0%	1	R.EGQGVVLLCGPPPHFGELSYAWTFNDSPLYVQEDKR.R
*	TK010303_lung_E18_mito_3_step07.2912.2912.3	1.6208	0.2447	3592.99	1	1740.0%	1	R.LDGGSLAISSPRTDQDIGIYQCLATNPVGTILSR.K
*	TK010303_lung_E18_mito_3_step10.4390.4390.3	1.9426	0.0388	4486.1	1	1190.0%	3	R.GPPGPPEDVKVEHISSTTSQLSWRPGPDNNSPIQIFTIQTR.T
UCUG1_MOUSE63.7%2211.1%486521078.5(P28659) CUG triplet repeat RNA-binding protein 1 (CUG-BP1) (RNA-binding protein BRUNOL-2) (Deadenylation factor CUG-BP) (Deadenylation factor EDEN-BP) (Brain protein F41)
	TK010303_lung_E18_mito_3_step12.1497.1497.2	1.8657	0.2993	2014.65	4	3530.0%	1	K.VLPGMHHPIQMKPADSEK.N
	TK010303_lung_E18_mito_3_step03.4439.4439.3	1.6198	0.0153	4041.01	9	1290.0%	1	K.EGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAK.V
UQ9CX7463.6%226.4%823933068.0(Q9CX74) 4122402O22Rik protein
*	TK010303_lung_E18_mito_3_step06.3858.3858.3	1.463	0.1158	4410.89	16	1220.0%	1	R.LTVSSALHSPAQPSLQALHAYQESFTPTEEHVLVVRLLLK.H
	TK010303_lung_E18_mito_3_step01.2818.2818.1	1.6678	0.1471	1492.28	2	4170.0%	1	K.VFAQPNLAEMIQK.G
UQ9D9M263.6%2216.3%355412586.5(Q9D9M2) Ubiquitin hydrolyzing enzyme 1 (Deubiquitinating enzyme UBH1)
	TK010303_lung_E18_mito_3_step02.1998.1998.3	2.5444	0.3727	3864.94	3	1640.0%	1	K.SHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISK.N
	TK010303_lung_E18_mito_3_step06.3510.3510.2	1.2687	0.0775	2757.66	2	2290.0%	1	R.MYDLVAVVVHCGSGPNRGHYIAIVK.S
UQ8R59263.4%392.4%819933095.7(Q8R592) Similar to KIAA0095 gene product
*	TK010303_lung_E18_mito_3_step05.3954.3954.2	1.959	0.1566	2396.11	6	2890.0%	3	R.SSLDSIEMAYARQIYIYNEK.I
UDD24_MOUSE63.4%112.0%857964719.4(Q9ESV0) ATP-dependent RNA helicase DDX24 (DEAD-box protein 24)
*	TK010303_lung_E18_mito_3_step12.2936.2936.2	2.2096	0.0379	2031.24	6	3750.0%	1	K.TWMAEVHDQKADVSAWR.D
UQ9CTY563.4%1115.5%103120478.1(Q9CTY5) 2900075B16Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step10.3459.3459.2	2.2124	0.0492	1840.36	6	3670.0%	1	-.MTPYDFILAVTTDEPK.F
USOC4_HUMAN63.3%2212.7%440506237.1(Q8WXH5) Suppressor of cytokine signaling 4 (SOCS-4)
*	TK010303_lung_E18_mito_3_step07.3036.3036.2	1.6366	0.0511	2615.9	15	2050.0%	1	R.HTAPINSKSDEWVSTDLSQTELR.D
*	TK010303_lung_E18_mito_3_step12.3863.3863.3	2.5829	0.3256	3846.66	1	1720.0%	1	R.TFPFSLQHICRTVICNCTTYDGIDALPIPSSMK.L
UP11D_MOUSE63.1%4412.1%10431196477.3(O35904) Phosphatidylinositol 3-kinase catalytic subunit, delta isoform (EC 2.7.1.137) (PI3-kinase p110 subunit delta) (PtdIns-3-kinase p110) (PI3K) (p110delta)
*	TK010303_lung_E18_mito_3_step03.4527.4527.3	2.5094	0.4476	4320.82	1	1500.0%	1	K.GELLNPAGTVRGNPNTESAAALVIYLPEVAPHPVYFPALEK.I
*	TK010303_lung_E18_mito_3_step05.3682.3682.3	2.029	0.0831	4372.28	220	950.0%	1	-.MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSR.N
	TK010303_lung_E18_mito_3_step06.3341.3341.2	1.1907	0.0488	2493.94	85	1360.0%	1	R.DEQSNPAPQVQKPRAKPPPIPAK.K
	TK010303_lung_E18_mito_3_step06.4397.4397.2	1.392	0.0137	2683.89	5	2170.0%	1	R.HGLLFLHLFALMRAAGLPELSCSK.D
URM39_MOUSE63.1%2216.5%297345607.4(Q9JKF7) Mitochondrial 60s ribosomal protein L39 (L39mt) (MRP-L39) (Protein PRED22 homolog)
*	TK010303_lung_E18_mito_3_step02.2978.2978.3	1.5636	0.0058	4493.48	47	1080.0%	1	K.NISTPYSCAMHLSEWYCSKSILALVDGQPWDMYKPLTK.S
*	TK010303_lung_E18_mito_3_step03.2524.2524.1	1.7167	0.1265	1269.84	1	7000.0%	1	R.FQGLSLPTHLR.A
UQ9JLZ863.0%4429.1%409457085.3(Q9JLZ8) Toll/interleukin-1 receptor 8
*	TK010303_lung_E18_mito_3_step03.2961.2961.2	1.8427	0.2896	2723.56	1	2200.0%	1	-.MAGVCDMAPNFLSPSEDQALGLALGR.E
*	TK010303_lung_E18_mito_3_step11.3409.3409.3	1.6535	0.0115	4479.6	8	1050.0%	1	R.LIVVLSDAFLSRPWCSQSFREDCAAYWSSPADLSSSPLR.A
*	TK010303_lung_E18_mito_3_step09.2206.2206.3	1.972	0.0329	2883.0	12	1880.0%	1	R.AGPAGHVAAVLASLLVLVVLLLVALLYVK.C
*	TK010303_lung_E18_mito_3_step02.3045.3045.2	1.3772	0.1505	3006.05	1	2290.0%	1	R.EVALNCTAWVFSRPQCPQPSVQWLK.D
UO7034963.0%5511.4%12361366556.3(O70349) Hypothetical 136.7 kDa protein
	TK010303_lung_E18_mito_3_step12.4216.4216.3	1.8269	0.162	4513.1	44	940.0%	1	R.NTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIR.D
	TK010303_lung_E18_mito_3_step08.2354.2354.2	1.679	0.1074	2073.45	182	2500.0%	1	R.FLLSDQSLLLLPEYHQR.V
*	TK010303_lung_E18_mito_3_step11.1381.1381.1	1.662	0.1471	1224.56	1	5000.0%	1	R.HPTTGHILGYK.E
*	TK010303_lung_E18_mito_3_step06.3185.3185.3	1.5753	0.0756	3637.78	12	1460.0%	1	R.LLEPLDLSGGDEDEGEAAGGPRGDNASPSPSGTPLVR.A
	TK010303_lung_E18_mito_3_step03.2487.2487.3	1.869	0.054	4014.31	2	1400.0%	1	K.RIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWAR.G
UCPZ2_MOUSE63.0%358.4%490555137.4(P56654) Cytochrome P450 2C37 (EC 1.14.14.1) (CYPIIC37)
*	TK010303_lung_E18_mito_3_step04.3657.3657.3	1.7401	0.0471	3393.1	8	1580.0%	2	K.LPPGPTPLPIIGNILQIDVKDICQSFTNLSK.V
*	TK010303_lung_E18_mito_3_step08.2232.2232.1	1.6646	0.144	1319.52	1	5560.0%	1	K.QFFKNYACIK.N
UDMA1_MOUSE63.0%468.8%468531309.5(Q9JI44) DNA methyltransferase 1-associated protein 1 (DNMT1-associated protein 1) (DNMAP1) (MAT1-mediated transcriptional repressor)
	TK010303_lung_E18_mito_3_step02.2765.2765.3	1.9003	0.0817	4517.26	106	860.0%	2	K.ALEQMLLELGVELSPTPTEELVHMFNELRSDLVLLYELK.Q
	TK010303_lung_E18_mito_3_step08.4456.4456.3	1.4763	0.0726	3584.14	9	1420.0%	1	K.IKALEQMLLELGVELSPTPTEELVHMFNELR.S
	TK010303_lung_E18_mito_3_step08.2037.2037.3	1.6488	0.0421	3341.4	337	1070.0%	1	K.ALEQMLLELGVELSPTPTEELVHMFNELR.S
UQ9D7Y962.9%5521.8%413457369.4(Q9D7Y9) 2210009G21Rik protein
	TK010303_lung_E18_mito_3_step06.3239.3239.2	1.3197	0.1238	2491.26	7	2140.0%	1	K.SHQELPVQKLENVSQTQPGDTR.S
	TK010303_lung_E18_mito_3_step01.3058.3058.1	1.3053	0.0885	1599.41	47	3080.0%	1	K.AKEELHALENLSSR.H
	TK010303_lung_E18_mito_3_step08.3186.3186.2	1.2326	0.0129	2096.5	96	2110.0%	1	R.STAVRVLPALELSDPGLLLK.Q
*	TK010303_lung_E18_mito_3_step11.1903.1903.1	1.6688	0.1284	1308.73	4	5000.0%	1	K.QRKPSSAEFTR.S
	TK010303_lung_E18_mito_3_step05.3680.3680.2	1.2842	0.2664	2542.98	12	2050.0%	1	K.FAVKCGNFAVLVDLHVLPQGSNR.D
UQ9H9J262.9%112.7%332375358.4(Q9H9J2) Mitochondrial 39S ribosomal protein L45 (MRP-L45)
*	TK010303_lung_E18_mito_3_step07.1617.1617.1	1.8712	0.0212	1177.49	2	6250.0%	1	R.RPWNYSKPK.E
UQ99K3762.9%356.9%406457706.4(Q99K37) Similar to HNOEL-iso protein
	TK010303_lung_E18_mito_3_step12.1277.1277.1	1.2652	0.0547	958.65	10	5710.0%	1	R.RLAALEER.L
*	TK010303_lung_E18_mito_3_step10.2282.2282.2	1.9577	0.0905	1990.55	6	2890.0%	2	R.RPPGGPGGGGELENTLQLIK.F
UQ91YJ562.8%487.3%727813477.1(Q91YJ5) Similar to mitochondrial translational initiation factor 2
*	TK010303_lung_E18_mito_3_step02.4072.4072.2	1.0882	0.0901	2870.9	27	1480.0%	2	R.ETQVAAMEVGGITQHIGAFLVSLPSGEK.I
*	TK010303_lung_E18_mito_3_step06.3125.3125.3	1.9624	0.2029	2836.18	1	2190.0%	2	R.LIFDENGKILNEAYPSMPVGIIGWR.D
UQ91V6062.7%113.9%204227109.1(Q91V60) Thymus LIM protein TLP-A
	TK010303_lung_E18_mito_3_step09.1836.1836.1	1.5724	0.1564	1140.73	2	6430.0%	1	R.NWHRPCLR.C
UTNP2_HUMAN62.5%229.3%654726626.4(Q03169) Tumor necrosis factor, alpha-induced protein 2 (B94 protein)
*	TK010303_lung_E18_mito_3_step08.4238.4238.3	1.9825	0.0178	3630.89	38	1370.0%	1	R.WAEDVPPQRLDGHCHSELAIDIIQITSQAQAK.A
*	TK010303_lung_E18_mito_3_step04.3153.3153.2	1.7156	0.3345	2922.43	1	2140.0%	1	K.GQPSSAEPEDAAGSRQGLDGPPPTVEELK.A
UIRF3_HUMAN62.4%115.2%427472195.3(Q14653) Interferon regulatory factor 3 (IRF-3)
*	TK010303_lung_E18_mito_3_step05.3465.3465.2	1.7681	0.317	2477.44	1	2620.0%	1	R.ILPWLVSQLDLGQLEGVAWVNK.S
UNCR2_HUMAN62.4%889.5%25172740328.1(Q9Y618) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC) (CTG26)
*	TK010303_lung_E18_mito_3_step02.4357.4357.3	1.708	0.2004	4079.92	171	920.0%	1	R.LAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSER.E
	TK010303_lung_E18_mito_3_step12.4309.4309.2	1.4583	0.0408	2695.79	1	2310.0%	1	K.TSVLGGGEDGIEPVSPPEGMTEPGHSR.S
*	TK010303_lung_E18_mito_3_step10.4225.4225.2	1.1907	0.0553	3038.1	6	1850.0%	1	K.EAFAAEAQKLPGDPPCWTSGLPFPVPPR.E
*	TK010303_lung_E18_mito_3_step12.2673.2673.2	1.5156	0.0764	2497.8	2	2270.0%	1	R.GVSGVDLYRSHIPLAFDPTSIPR.G
*	TK010303_lung_E18_mito_3_step12.2041.2041.3	1.6912	0.0898	3292.2	54	1320.0%	1	R.GQAGPPESLGVPTAQEASVLRGTALGSVPGGSITK.G
*	TK010303_lung_E18_mito_3_step11.1801.1801.3	2.1239	0.1406	2380.44	11	2260.0%	1	R.QIGAISQGMSVQLHVPYSEHAK.A
	TK010303_lung_E18_mito_3_step05.3176.3176.3	1.5364	0.0316	3774.18	104	1070.0%	1	K.YDQWEESPPLSANAFNPLNASASLPAAMPITAADGR.S
*	TK010303_lung_E18_mito_3_step11.3969.3969.2	1.7602	0.3165	2981.75	1	2410.0%	1	R.LLSPRPSLLTPTGDPRANASPQKPLDLK.Q
UO9594462.4%118.7%276306558.0(O95944) NK cell activating receptor (NKp44)
	TK010303_lung_E18_mito_3_step12.2352.2352.2	1.9944	0.2763	2702.88	1	2830.0%	1	-.MAWRALHPLLLLLLLFPGSQAQSK.A
UIF4G_HUMAN62.3%242.5%13951533615.2(Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220)
*	TK010303_lung_E18_mito_3_step09.3672.3672.3	2.8228	0.2323	3602.76	2	1540.0%	2	R.GEELLPPESTPIPANLSQNLEAAAATQVAVSVPKR.R
UMAOX_MOUSE62.2%81227.6%572639997.4(P06801) NADP-dependent malic enzyme (EC 1.1.1.40) (NADP-ME) (Malic enzyme 1)
*	TK010303_lung_E18_mito_3_step08.2930.2930.2	1.2195	0.0292	2526.31	92	1740.0%	1	K.YCTFNDDIQGTASVAVAGLLAALR.I
	TK010303_lung_E18_mito_3_step08.3521.3521.3	1.7754	0.1608	4523.43	2	990.0%	1	R.AIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLR.H
*	TK010303_lung_E18_mito_3_step09.3955.3955.2	1.7968	0.2889	2902.0	2	2410.0%	2	K.LSDQTVLFQGAGEAALGIAHLVVMAMEK.E
*	TK010303_lung_E18_mito_3_step02.3426.3426.2	1.6301	0.2556	2264.74	1	2890.0%	2	R.VRGPEYDAFLDEFMEAASSK.Y
*	TK010303_lung_E18_mito_3_step12.2055.2055.3	1.9404	0.0395	2872.82	429	1350.0%	1	K.YCTFNDDIQGTASVAVAGLLAALRITK.N
*	TK010303_lung_E18_mito_3_step07.4346.4346.3	1.6498	0.1071	4344.13	9	1250.0%	1	K.LALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLR.H
USAL3_MOUSE62.2%5510.2%13231390717.5(Q62255) Sal-like protein 3 (Spalt-like protein 3) (MSal) (Fragment)
	TK010303_lung_E18_mito_3_step04.2861.2861.2	1.8014	0.2992	2528.43	1	3180.0%	1	R.LSVENPMALLGGDALKFSEMFQK.D
*	TK010303_lung_E18_mito_3_step07.2240.2240.1	1.1489	0.0043	1311.42	49	3640.0%	1	K.EASMDVEVSTDK.G
*	TK010303_lung_E18_mito_3_step06.3643.3643.3	1.5566	0.0070	4076.16	4	1310.0%	1	R.TGDAPVVGGQVSGLPTSAATAVTDSACTSLGSPGLPAVSDQFK.A
	TK010303_lung_E18_mito_3_step04.4441.4441.3	2.0322	0.0664	3225.1	17	1610.0%	1	K.AQFPFGGLLDSMQTSETSKLQQLVENIDK.K
	TK010303_lung_E18_mito_3_step08.3052.3052.2	1.4419	0.2289	3044.26	69	1110.0%	1	K.DLAARAMNVDPSFWNQYAAAITNGLAMK.N
UQ9CPY362.1%2211.4%264289919.6(Q9CPY3) 2610036L13Rik protein
*	TK010303_lung_E18_mito_3_step01.1942.1942.1	1.8758	0.0866	827.68	6	6670.0%	1	K.KVPEILK.S
*	TK010303_lung_E18_mito_3_step08.3168.3168.2	1.5641	0.0857	2515.96	61	1820.0%	1	K.SGSDLPNSFSEIWPRTTPAVPVR.K
USNXE_HUMAN62.1%336.2%8861029246.8(Q9Y5W7) Sorting nexin 14
*	TK010303_lung_E18_mito_3_step08.2454.2454.2	1.1628	0.0333	2149.14	9	2650.0%	1	K.LTELLFPYILPPKATDCR.S
*	TK010303_lung_E18_mito_3_step01.1812.1812.1	1.878	0.0090	1026.65	2	7140.0%	1	K.KLFNDLFK.N
*	TK010303_lung_E18_mito_3_step02.3004.3004.3	1.6076	0.0362	3213.54	1	1880.0%	1	K.LLQHPELSNSQLLADFLSPNGGETQFLDK.I
UKFP3_HUMAN62.1%111.6%792911905.1(Q92845) Kinesin-associated protein 3 (Smg GDS-associated protein)
*	TK010303_lung_E18_mito_3_step09.2684.2684.1	1.8666	0.0091	1518.6	1	5420.0%	1	K.AVDEDPENQTLRK.D
UPTPE_HUMAN62.1%4165.0%700806427.0(P23469) Protein-tyrosine phosphatase epsilon precursor (EC 3.1.3.48) (R-PTP-epsilon)
	TK010303_lung_E18_mito_3_step10.4093.4093.3	2.3298	0.1469	4014.13	1	1540.0%	4	R.YPNILPNDHSRVILSQLDGIPCSDYINASYIDGYK.E
UCNG1_HUMAN62.1%113.1%686791267.6(P29973) cGMP-gated cation channel alpha 1 (CNG channel alpha 1) (CNG-1) (CNG1) (Cyclic nucleotide gated channel alpha 1) (Cyclic nucleotide gated channel, photoreceptor) (Cyclic-nucleotide-gated cation channel 1) (Rod photoreceptor cGMP-gated channel alpha subunit)
*	TK010303_lung_E18_mito_3_step09.3352.3352.2	2.1942	0.1616	2469.28	4	2500.0%	1	K.SNLQFKLDVLSLIPTDLLYFK.L
UQ9D51162.1%3311.0%363426234.9(Q9D511) 4930528G09Rik protein
*	TK010303_lung_E18_mito_3_step01.0191.0191.1	1.0366	0.0187	573.46	5	7500.0%	1	K.SIILK.E
*	TK010303_lung_E18_mito_3_step01.1632.1632.1	1.6368	0.1398	1546.81	2	4580.0%	1	K.EFEKIPKPGEIEK.K
*	TK010303_lung_E18_mito_3_step03.3736.3736.2	1.3847	0.1404	2621.48	7	2140.0%	1	R.EERLINLAETPAFLCLHELHSK.G
UQ9BQQ762.1%115.6%232270318.6(Q9BQQ7) Transmembrane protein 7
*	TK010303_lung_E18_mito_3_step01.1928.1928.1	1.6503	0.1334	1561.62	1	4580.0%	1	R.GRFQLIEEVPMIK.D
UQ924W762.1%223.6%11341268619.1(Q924W7) Suppression of tumorigenicity 5
*	TK010303_lung_E18_mito_3_step01.1388.1388.1	1.7445	0.1162	1388.42	1	5450.0%	1	R.YPSHSKSQVLLK.D
*	TK010303_lung_E18_mito_3_step12.3589.3589.2	1.3191	0.0368	2845.45	5	1790.0%	1	K.TKPSNGLPPSPTPAAPPPLPSTPAPPVTR.R
UQ9WU5962.1%225.0%700784867.9(Q9WU59) Hedgehog-interacting protein
*	TK010303_lung_E18_mito_3_step12.2721.2721.2	1.5562	0.0867	2826.99	9	1960.0%	1	K.RPLMPEECRVTVQPAQPLTSDCSR.L
	TK010303_lung_E18_mito_3_step11.1925.1925.1	1.7508	0.1112	1315.59	3	5000.0%	1	R.WAIGPHDHILR.V
UQ8VFN861.9%2221.7%313349238.0(Q8VFN8) Olfactory receptor MOR219-1
*	TK010303_lung_E18_mito_3_step08.2570.2570.2	1.7283	0.332	2949.81	1	2400.0%	1	R.LFSVLYTVLPPALNPLIYSLRNTDVK.S
*	TK010303_lung_E18_mito_3_step01.4127.4127.3	1.8263	0.2309	4705.77	19	1040.0%	1	K.FVVNSLIHNNSISVLACAFQVFLMTSFSSGEVFVLTAMSYDR.Y
UKIR3_HUMAN61.9%116.2%503561257.6(P37023) Serine/threonine-protein kinase receptor R3 precursor (EC 2.7.1.37) (SKR3) (Activin receptor-like kinase 1) (ALK-1) (TGF-B superfamily receptor type I) (TSR-I)
*	TK010303_lung_E18_mito_3_step11.4101.4101.3	2.6307	0.2836	3317.65	4	1750.0%	1	R.LAVSAACGLAHLHVEIFGTQGKPAIAHRDFK.S
UQ9UBK361.9%1119.8%167197124.5(Q9UBK3) EVI1 (Fragment)
*	TK010303_lung_E18_mito_3_step09.2956.2956.3	2.6224	0.2832	3783.35	4	1410.0%	1	R.VVADIAPGEELLLFMKSEDYPHETMAPDIHEER.Q
UO3539261.9%3322.0%492489377.1(O35392) Forkhead 2
*	TK010303_lung_E18_mito_3_step12.3340.3340.3	2.0831	0.0651	4633.7	2	1060.0%	1	-.MTLGSCCCEIMSSESSPAALSEPDADIDVVGGGSGGGELTARSGPR.A
*	TK010303_lung_E18_mito_3_step11.4244.4244.3	2.6216	0.2832	4256.55	1	1450.0%	1	R.DVLPHGHEPPPEEAEADVAEDEEESGGCSDCEPRALAPR.G
	TK010303_lung_E18_mito_3_step03.2573.2573.3	2.0046	0.1797	2534.48	6	2160.0%	1	R.SPLVKPPYSYIALITMAILQSPK.K
UEPA1_MOUSE61.9%115.8%534590567.8(Q60750) Ephrin type-A receptor 1 (EC 2.7.1.112) (Tyrosine-protein kinase receptor ESK) (Fragment)
*	TK010303_lung_E18_mito_3_step05.3865.3865.3	2.6158	0.2546	3298.4	2	1830.0%	1	R.EGQLAPGQLVAMLLGIASGMNCLSGHNYVHR.D
UQ921C361.9%9117.4%23042590248.4(Q921C3) WDR9 protein, form A
	TK010303_lung_E18_mito_3_step03.4280.4280.3	1.9709	0.1003	4286.17	39	1150.0%	1	R.NADQCELSSGNESSGSVRHETSYDQSEGSCSSEDDEWR.N
*	TK010303_lung_E18_mito_3_step01.0523.0523.1	1.0098	0.0178	647.02	5	6670.0%	1	R.QASAAAK.K
	TK010303_lung_E18_mito_3_step10.1995.1995.3	0.9001	0.0149	2827.18	67	1150.0%	1	R.RMHPEVDGEDVPGQMGSSGCGPDTSPK.A
	TK010303_lung_E18_mito_3_step02.2157.2157.1	1.5531	0.0933	1467.33	12	4170.0%	1	R.LIFSNAKAYTPNK.R
	TK010303_lung_E18_mito_3_step11.4284.4284.3	1.6693	0.0438	3255.29	54	1290.0%	2	K.GSAFAALHRGRPPEMPVNYGPPPSLVEIHR.G
	TK010303_lung_E18_mito_3_step08.2034.2034.3	1.8024	0.0989	2825.24	1	2280.0%	1	R.RPVPLIESELYFLIARYLSAGPCR.R
	TK010303_lung_E18_mito_3_step01.2214.2214.1	1.4032	0.0243	1411.6	479	2500.0%	1	R.IGPMLDKEVPPSK.E
	TK010303_lung_E18_mito_3_step12.1763.1763.2	1.0096	0.0046	2128.78	11	2350.0%	1	R.AAQVLVQELEQYQLLPKR.L
UQ9CX0161.9%2218.8%303324598.3(Q9CX01) 2400003B18Rik protein
*	TK010303_lung_E18_mito_3_step07.3762.3762.3	2.6121	0.2901	4099.29	1	1810.0%	1	R.INCVAPGTIYSQTAVDNYGEMGQTLFEMAFDSIPAKR.L
	TK010303_lung_E18_mito_3_step12.1527.1527.2	1.0791	0.0181	2141.3	14	2370.0%	1	R.EGVYNLTKSMALAWASSGVR.I
UQ96K9161.9%118.3%314323264.2(Q96K91) Hypothetical protein FLJ14435
*	TK010303_lung_E18_mito_3_step05.2073.2073.3	2.6455	0.2812	2738.61	3	2200.0%	1	R.RSPPQGLPPCMGQGSPMPAGLPDCAR.G
UNRG2_MOUSE61.9%61813.4%756822139.1(P56974) Pro-neuregulin-2 precursor (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Divergent of neuregulin 1) (DON-1)]
	TK010303_lung_E18_mito_3_step05.2501.2501.3	2.0443	0.0899	4183.64	3	1320.0%	1	R.LSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYR.L
	TK010303_lung_E18_mito_3_step04.2990.2990.2	1.1923	0.067	1881.23	63	3000.0%	1	K.CEAAAGNPQPSYRWFK.D
*	TK010303_lung_E18_mito_3_step09.3856.3856.3	2.6515	0.263	4484.09	2	1280.0%	4	R.DSLSLSSGSGCGSASASDDDADDADGALAAESTPFLGLRAAHDALR.S
UTBG1_MOUSE61.9%2211.8%451511016.0(Q9Z310) Tubulin gamma-1 chain (Gamma-1 tubulin) (Gamma-tubulin complex component 1) (GCP-1)
	TK010303_lung_E18_mito_3_step08.3278.3278.3	2.6492	0.2845	2992.71	1	1920.0%	1	K.SPYLPSAHRVSGLMMANHTSISSLFER.T
	TK010303_lung_E18_mito_3_step12.3703.3703.2	1.2525	0.0262	3091.31	14	1600.0%	1	R.EIVQQLIDEYHAATRPDYISWGTQEQ.-
UATS1_HUMAN61.9%3310.3%9671053846.8(Q9UHI8) ADAMTS-1 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase with thrombospondin motifs 1) (ADAM-TS 1) (ADAM-TS1) (METH-1)
*	TK010303_lung_E18_mito_3_step12.2191.2191.3	2.6112	0.3038	4571.38	1	1410.0%	1	R.DINGQPASECAKEVKPASTRPCADHPCPQWQLGEWSSCSK.T
*	TK010303_lung_E18_mito_3_step01.3699.3699.3	2.0891	0.1543	4284.14	1	1420.0%	1	R.QCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTK.H
*	TK010303_lung_E18_mito_3_step05.4316.4316.2	1.4633	0.0707	2314.37	19	2140.0%	1	R.NRQGDVGGTCGVVDDEPRPTGK.A
UQ925L161.9%467.5%844930345.0(Q925L1) Protocadherin-betaT
*	TK010303_lung_E18_mito_3_step12.3912.3912.3	1.631	0.0077	4124.57	14	1150.0%	2	R.QVLVFFVFLGLSQASAESLRYSVAEETEIGSFVANLAK.D
*	TK010303_lung_E18_mito_3_step05.3358.3358.3	2.2265	0.0978	3129.78	1	2070.0%	1	R.YSVAEETEIGSFVANLAKDLGLGVAELSSR.E
	TK010303_lung_E18_mito_3_step12.1565.1565.2	1.2799	0.1626	1299.03	106	3750.0%	1	R.LTLTALDGGSPPR.S
UTFS2_MOUSE61.9%2213.3%301338808.4(P10712) Transcription elongation factor S-II (Transcription elongation factor A)
	TK010303_lung_E18_mito_3_step09.2747.2747.3	2.6272	0.2901	3703.16	5	1410.0%	1	R.TGDDYVAIGADEEELGSQIEEAIYQEIRNTDMK.Y
	TK010303_lung_E18_mito_3_step09.4656.4656.1	0.4938	0.0067	815.83	15	1670.0%	1	R.SRISNLK.D
UFCE2_MOUSE61.9%119.7%331376486.7(P20693) Low affinity immunoglobulin epsilon FC receptor (Lymphocyte IGE receptor) (FC-epsilon-RII) (CD23)
	TK010303_lung_E18_mito_3_step05.3093.3093.3	2.6341	0.2727	3651.01	1	1770.0%	1	R.RGTQLMLVGLLSTAMWAGLLALLLLWHWETEK.N
UTBX1_HUMAN61.9%2217.3%398431338.2(O43435) T-box transcription factor TBX1 (T-box protein 1) (Testis-specific T-box protein)
*	TK010303_lung_E18_mito_3_step09.3416.3416.3	1.7756	0.0811	2962.43	51	1570.0%	1	R.DAGGCVNLGLPCPAECQPFNTQGLVAGR.T
	TK010303_lung_E18_mito_3_step03.3755.3755.3	2.6291	0.2791	3985.33	3	1440.0%	1	R.DMEAFTASSLSSLGAAGGFPGAASPGADPYGPREPPPPPPR.Y
ULBC_HUMAN61.9%3315.3%424490538.9(Q12802) LBC oncogene (P47) (Lymphoid blast crisis oncogene)
*	TK010303_lung_E18_mito_3_step09.4090.4090.2	1.4345	0.09	2732.67	30	1590.0%	1	K.EERNSWIQIIQDTINTLSGNGWR.C
	TK010303_lung_E18_mito_3_step06.0360.0360.1	0.6725	0.0329	1266.2	61	1670.0%	1	R.ITKYPVLFQR.I
*	TK010303_lung_E18_mito_3_step12.2392.2392.3	2.6186	0.2937	3520.6	2	1690.0%	1	K.ISKVNESTESLTDEGTDMNEGQLLGDFEIESK.Q
UNTC3_MOUSE61.9%111311.1%23182442465.3(Q61982) Neurogenic locus notch homolog protein 3 precursor (Notch 3)
*	TK010303_lung_E18_mito_3_step08.2578.2578.2	1.622	0.0693	2003.17	252	2650.0%	1	R.GQAMVFPYHRPSPGSESR.V
*	TK010303_lung_E18_mito_3_step07.2712.2712.2	1.1961	0.1155	2868.15	17	1600.0%	1	R.CVCAPGWGGPRCETPSAAPEVPEEPR.C
	TK010303_lung_E18_mito_3_step03.4499.4499.2	1.249	0.1194	2153.84	5	2630.0%	1	R.TPLHTAVTADAQGVFQILIR.N
*	TK010303_lung_E18_mito_3_step02.4485.4485.3	2.1501	0.1152	4769.87	5	1250.0%	1	R.CNCPPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFR.C
*	TK010303_lung_E18_mito_3_step12.3536.3536.3	1.6273	0.0384	4790.51	8	1100.0%	1	R.EGFTGSQCQNPVDWCSQAPCQNGGRCVQTGAYCICPPGWSGR.L
*	TK010303_lung_E18_mito_3_step08.4464.4464.1	0.4471	0.083	447.42	5	3330.0%	1	R.QVMA.-
*	TK010303_lung_E18_mito_3_step09.4436.4436.3	1.549	0.0016	3754.87	12	1290.0%	1	K.YLCRCPPGTTGVNCEVNIDDCASNPCTFGVCR.D
*	TK010303_lung_E18_mito_3_step08.3237.3237.3	2.1929	0.0040	3512.42	1	1810.0%	1	R.GDQNCDRECNTPGCGWDGGDCSLNVDDPWR.Q
*	TK010303_lung_E18_mito_3_step04.2378.2378.1	1.3084	0.0118	1269.81	13	4500.0%	2	R.YGGKCLDLVDK.Y
	TK010303_lung_E18_mito_3_step01.0010.0010.3	1.3771	0.1508	3622.75	23	1410.0%	1	R.AICTCPPGFTGGACDQDVDECSIGANPCEHLGR.C
UQ9ERC761.8%391.0%10661142797.2(Q9ERC7) Pumilio 2
	TK010303_lung_E18_mito_3_step02.2712.2712.1	1.8778	0.1918	1080.39	13	5000.0%	3	R.YISAAPGAEAK.Y
UAA1R_HUMAN61.7%1113.8%326365128.6(P30542) Adenosine A1 receptor
*	TK010303_lung_E18_mito_3_step05.3614.3614.3	2.5119	0.3956	4763.83	3	1080.0%	1	R.AAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIK.C
UQ8R2V961.6%112.8%436488146.7(Q8R2V9) Similar to SEC24 related gene family, member C (S. cerevisiae) (Fragment)
*	TK010303_lung_E18_mito_3_step08.2524.2524.1	1.5168	0.1696	1364.47	3	4550.0%	1	K.FAYRAVLNSPVK.T
UDNL1_HUMAN61.6%465.4%9191017365.6(P18858) DNA ligase I (EC 6.5.1.1) (Polydeoxyribonucleotide synthase [ATP])
*	TK010303_lung_E18_mito_3_step05.3644.3644.2	1.2581	0.0769	2056.7	63	2630.0%	1	K.AARVLGSEGEEEDEALSPAK.G
*	TK010303_lung_E18_mito_3_step08.3730.3730.2	1.6819	0.0991	2280.89	5	2370.0%	1	K.LPSVTSFILDTEAVAWDREK.K
*	TK010303_lung_E18_mito_3_step08.1917.1917.1	1.5738	0.0547	1248.65	6	5000.0%	2	K.KEEEEEETPK.E
UCYGD_HUMAN61.6%448.0%11031200587.4(Q02846) Retinal guanylyl cyclase 1 precursor (EC 4.6.1.2) (Guanylate cyclase 2D, retinal) (RETGC-1) (Rod outer segment membrane guanylate cyclase) (ROS-GC)
*	TK010303_lung_E18_mito_3_step02.2433.2433.2	1.6998	0.1482	2371.64	102	1820.0%	1	R.GLPVASVTSMEPLDLSGAREALR.K
*	TK010303_lung_E18_mito_3_step10.3082.3082.2	1.4242	0.0632	2494.99	14	2050.0%	1	R.DGPRVTAVIMVMHSVLLGGEEQR.Y
*	TK010303_lung_E18_mito_3_step04.2494.2494.2	1.3113	0.0926	3176.43	17	1480.0%	1	R.RELPSDLNLQQVSPLFGTIYDAVFLLAR.G
*	TK010303_lung_E18_mito_3_step11.1157.1157.2	1.9315	0.2857	1550.02	1	4620.0%	1	K.FPGDQHIAIRPATK.T
UQ9D5Y061.6%3313.1%588676618.2(Q9D5Y0) 4921507P07Rik protein
*	TK010303_lung_E18_mito_3_step01.2722.2722.1	1.5087	0.1691	1340.84	4	4090.0%	1	R.TQQPFPPTVPTK.A
*	TK010303_lung_E18_mito_3_step04.4043.4043.3	1.1902	0.0492	3386.11	2	1790.0%	1	K.EICSPYPIEHPYHTHISRGSVFPTFTSPK.D
*	TK010303_lung_E18_mito_3_step12.3187.3187.3	2.1998	0.1791	4073.02	17	1210.0%	1	R.VLCAFHTFIPTSAEIMAMNNNLLSGITHKNQDVEEK.I
UMLH1_HUMAN61.6%244.8%756846015.7(P40692) DNA mismatch repair protein Mlh1 (MutL protein homolog 1)
*	TK010303_lung_E18_mito_3_step06.3437.3437.3	2.8053	0.2292	3654.23	4	1360.0%	2	R.MYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDK.V
UQ9CYP461.5%116.4%109124219.8(Q9CYP4) 5630401D24Rik protein
	TK010303_lung_E18_mito_3_step01.1579.1579.1	1.6144	0.1284	908.65	1	8330.0%	1	K.YIKPKEK.V
UQ9WTM561.3%4419.7%463511135.6(Q9WTM5) DNA helicase
	TK010303_lung_E18_mito_3_step09.2462.2462.2	2.1964	0.0337	2078.51	9	2650.0%	1	R.KEVVHTVSLHEIDVINSR.T
	TK010303_lung_E18_mito_3_step02.3802.3802.2	1.4021	0.0145	3006.72	38	1400.0%	1	K.AEIIPGVLFIDEVHMLDIESFSFLNR.A
	TK010303_lung_E18_mito_3_step06.4490.4490.3	1.6728	0.0433	2945.81	11	1830.0%	1	R.IKEETEIIEGEVVEIQIDRPATGTGSK.V
	TK010303_lung_E18_mito_3_step03.2236.2236.2	1.6425	0.1985	2307.68	1	2630.0%	1	K.TTEMETIYDLGTKMIESLTK.D
UO8831361.3%114.6%348383207.0(O88313) G-protein coupled receptor
	TK010303_lung_E18_mito_3_step12.1936.1936.2	1.906	0.2776	1855.08	1	4670.0%	1	R.FHVATSTLPKVRPIER.C
UQ6116161.2%4412.9%821912656.5(Q61161) Rab8-interacting protein
*	TK010303_lung_E18_mito_3_step08.3724.3724.2	1.7631	0.0749	2523.42	5	2380.0%	1	R.LLQHPFTTQHLPPALLTQLLDK.A
*	TK010303_lung_E18_mito_3_step05.1913.1913.3	1.1766	0.0382	3504.59	146	1250.0%	1	R.VVRNPYTGSTFLLAALPASLLLLQWYEPLQK.F
	TK010303_lung_E18_mito_3_step03.2977.2977.2	1.3263	0.0899	1908.98	16	2670.0%	1	K.STHIWAHDLPGLFEQR.R
*	TK010303_lung_E18_mito_3_step07.2637.2637.3	2.9036	0.149	4111.36	2	1600.0%	1	K.ASDPHLGTLSPEDSELETHDMFPDTIHSRSHHGPAER.T
UQ8VGT761.2%119.6%314351348.1(Q8VGT7) Olfactory receptor MOR264-2
*	TK010303_lung_E18_mito_3_step04.3425.3425.3	2.9007	0.1302	3431.26	3	1900.0%	1	K.SIHSVGTDELLSLFYTIVTPMFNPLIYSLR.N
UPA24_MOUSE61.2%223.5%748852225.4(P47713) Cytosolic phospholipase A2 (CPLA2) [Includes: Phospholipase A2 (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase); Lysophospholipase (EC 3.1.1.5)]
	TK010303_lung_E18_mito_3_step10.2003.2003.2	1.3931	0.0188	2376.41	108	2220.0%	1	-.MSFIDPYQHIIVEHQYSHK.F
	TK010303_lung_E18_mito_3_step02.3533.3533.2	1.8784	0.2873	3189.42	1	2000.0%	1	-.MSFIDPYQHIIVEHQYSHKFTVVVLR.A
UQ9C0C461.2%112.3%9631067358.0(Q9C0C4) Hypothetical protein KIAA1739 (Fragment)
*	TK010303_lung_E18_mito_3_step12.2348.2348.2	1.8683	0.2866	2745.41	1	2860.0%	1	K.LWLRYPSFLPAAWICLLPGWER.L
UCP11_MOUSE61.1%113.6%524592308.1(P00184) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1) (P450-P1)
	TK010303_lung_E18_mito_3_step12.2303.2303.2	1.8708	0.2854	2310.68	4	3060.0%	1	R.LSDRPQLPYLEAFILETFR.H
UGLP1_MOUSE61.1%3310.6%489558788.4(O35659) Glucagon-like peptide 1 receptor precursor (GLP-1 receptor) (GLP-1-R) (GLP-1R)
*	TK010303_lung_E18_mito_3_step08.3029.3029.3	1.4499	0.0017	3503.64	60	1380.0%	1	K.DAALKWMYSTAAQQHQWDGLLSYQDSLGCR.L
*	TK010303_lung_E18_mito_3_step12.3017.3017.2	1.4658	0.144	3004.09	19	1670.0%	1	K.WMYSTAAQQHQWDGLLSYQDSLGCR.L
*	TK010303_lung_E18_mito_3_step10.2207.2207.2	2.14	0.2348	2208.76	1	3570.0%	1	K.CPTSSVSSGATVAAACMQPPAR.V
UQ9D41861.1%3315.3%393458108.9(Q9D418) 4930560E09Rik protein
	TK010303_lung_E18_mito_3_step11.3969.3969.3	2.056	0.0609	4472.12	126	940.0%	1	K.LQECIITQNEWKQVHHLCYWELMWCHIFLQNWK.Q
	TK010303_lung_E18_mito_3_step09.4330.4330.3	1.5596	0.0617	3183.74	85	1440.0%	1	K.SQRYGTTTGWFTAQPLLEFIYAWSGFR.V
	TK010303_lung_E18_mito_3_step02.4474.4474.2	1.8611	0.2803	2814.59	1	2390.0%	1	R.YGTTTGWFTAQPLLEFIYAWSGFR.V
UO8884261.1%7921.1%733806245.8(O88842) Faciogenital dysplasia protein 3
*	TK010303_lung_E18_mito_3_step09.3406.3406.3	1.8304	0.1035	3838.74	24	1360.0%	1	R.LHLLDQVFCTKLTEAGIPLEVTTGIFSNISSIYR.F
*	TK010303_lung_E18_mito_3_step11.2500.2500.3	1.9619	0.1917	4524.65	2	1190.0%	1	R.AFGGACSQDEEPTLSPDQPVMSTSSVEPAGVADSNGGTPGIESRK.S
*	TK010303_lung_E18_mito_3_step01.2318.2318.3	1.7787	0.0184	3798.72	19	1180.0%	2	R.SSSTPQEEAISPLGVLGTGPSSSPLGKLQALPIGPGAHR.G
*	TK010303_lung_E18_mito_3_step10.2155.2155.3	1.8138	0.0342	3062.48	11	1830.0%	1	R.EKMDISDLQVQDIVKPNAACTFIITGR.K
	TK010303_lung_E18_mito_3_step07.1864.1864.1	1.8517	0.0266	1300.73	1	6110.0%	1	R.YELLLKDYLK.R
*	TK010303_lung_E18_mito_3_step06.3919.3919.2	1.3288	0.1324	2483.42	2	2500.0%	1	K.LTEAGIPLEVTTGIFSNISSIYR.F
UQ99NC461.1%112.5%521573077.9(Q99NC4) Drctnnb1a
	TK010303_lung_E18_mito_3_step11.2043.2043.1	1.8524	0.015	1502.31	1	5000.0%	1	R.AQSENLELLSLKR.L
UCASL_HUMAN61.1%225.8%834928616.7(Q14511) Enhancer of filmentation 1 (HEF1) (CRK-associated substrate-related protein) (CAS-L) (PP105) (Neural precursor cell expressed developmentally down-regulated 9)
*	TK010303_lung_E18_mito_3_step02.1848.1848.1	1.8582	0.0275	1376.49	1	5830.0%	1	K.ESSLSASPAQDKR.L
*	TK010303_lung_E18_mito_3_step11.3260.3260.3	1.8512	0.0819	4163.58	99	960.0%	1	R.QLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPR.I
UQ9D8Z461.0%118.7%312336025.5(Q9D8Z4) 1810015E19Rik protein
*	TK010303_lung_E18_mito_3_step11.4192.4192.2	1.7699	0.2972	2792.23	5	1730.0%	1	R.VGHGEPDGIPDVVVEMAEADLQALLSK.E
UALK1_MOUSE61.0%1122.9%131143088.8(P97430) Antileukoproteinase 1 precursor (ALP) (Secretory leukocyte protease inhibitor)
*	TK010303_lung_E18_mito_3_step08.3057.3057.2	1.7851	0.2968	3156.47	1	1900.0%	1	K.SCGLLPFTVLLALGILAPWTVEGGKNDAIK.I
URAN_HUMAN61.0%2219.4%216244237.5(P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24)
	TK010303_lung_E18_mito_3_step08.1560.1560.3	2.0549	0.1192	2984.86	6	1850.0%	1	K.NLQYYDISAKSNYNFEKPFLWLAR.K
	TK010303_lung_E18_mito_3_step10.2715.2715.2	1.788	0.2923	2054.29	1	2940.0%	1	K.YVATLGVEVHPLVFHTNR.G
UQ9CSU061.0%397.4%269306235.6(Q9CSU0) 2610304G08Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step07.4245.4245.2	1.9126	0.1526	2423.29	5	2890.0%	3	R.LLNIWQERSVYGGEFIQQLK.L
UQ9H70561.0%118.6%1391576011.3(Q9H705) Hypothetical protein FLJ21611
*	TK010303_lung_E18_mito_3_step01.2674.2674.1	1.6371	0.1349	1560.75	1	4550.0%	1	K.YPSYAFMYQLFK.E
UQ8VFU760.8%118.8%320359428.5(Q8VFU7) Olfactory receptor MOR210-1
*	TK010303_lung_E18_mito_3_step05.4313.4313.2	1.7214	0.321	3128.35	1	2220.0%	1	K.AFSTCSSHLGVVSVLYGAVFFMYLTPDR.F
UNR61_HUMAN60.8%116.7%480543836.3(Q15406) Orphan nuclear receptor NR6A1 (Germ cell nuclear factor) (GCNF) (Retinoid receptor-related testis specific receptor) (RTR)
*	TK010303_lung_E18_mito_3_step05.3258.3258.2	1.735	0.3186	3054.87	1	2260.0%	1	-.MERDEPPPSGGGGGGGSAGFLEPPAALPPPPR.N
UMN1_HUMAN60.8%7717.7%13191359438.0(Q10571) Probable tumor suppressor protein MN1
	TK010303_lung_E18_mito_3_step10.2675.2675.3	2.2398	0.0101	3032.78	1	1740.0%	1	K.YSAAPDSGGAPGVSPGQQQASGAAVGGSSAGETR.G
*	TK010303_lung_E18_mito_3_step06.2867.2867.2	1.2618	0.0456	3162.6	19	1360.0%	1	R.AAFTGLQFGGSLGGLGQLQSPGAGVGLPSAASER.R
*	TK010303_lung_E18_mito_3_step03.3576.3576.3	1.8586	0.0648	3871.52	6	1280.0%	1	R.VSHPPAGEPEHAPLFRACFQHAASSSAAGAQPAAAAFR.R
	TK010303_lung_E18_mito_3_step02.4057.4057.3	1.684	0.0818	3772.81	1	1760.0%	1	K.DNLFGQSCLAALSTACQNMIASLGAPNLNVTFNKK.N
*	TK010303_lung_E18_mito_3_step03.3695.3695.3	2.3737	0.1104	3670.61	14	1320.0%	1	R.VPAPCLPLDQSPNRAASFHGLPSSSGSDSHSLEPR.R
	TK010303_lung_E18_mito_3_step08.4202.4202.3	2.2984	0.0608	3380.32	7	1670.0%	1	R.LGTFEQQAPHLAQESAWFSGPHPPPGDLLPR.R
	TK010303_lung_E18_mito_3_step03.3227.3227.2	1.728	0.3225	2602.2	2	2000.0%	1	K.GECAVGASGAQNGDSELGSCCSEAVK.S
UQ8VEG560.7%117.4%242268725.6(Q8VEG5) Hypothetical 26.9 kDa protein
*	TK010303_lung_E18_mito_3_step12.2212.2212.2	2.0086	0.2721	1913.21	1	4710.0%	1	K.GHSNIAYTPDVIVASVLR.L
UDPOE_HUMAN60.7%221.5%22862615296.4(Q07864) DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7) (DNA polymerase II subunit A)
*	TK010303_lung_E18_mito_3_step04.2753.2753.2	2.1632	0.2283	2024.43	1	2940.0%	1	R.VEDAIAYVEYITSSIHSK.E
*	TK010303_lung_E18_mito_3_step09.2278.2278.2	0.9103	0.0206	2087.96	169	2810.0%	1	R.HYLNLDTCLSQAFEMSR.Y
UY176_HUMAN60.7%119.1%265288015.6(Q14681) Hypothetical protein KIAA0176 (Fragment)
*	TK010303_lung_E18_mito_3_step11.2045.2045.2	1.6978	0.3738	2724.42	1	2170.0%	1	K.ELAEEGVLEEAEFYNIASLVRLVK.E
UQ9CT8560.6%5728.3%191217238.4(Q9CT85) 2310034D06Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step06.0352.0352.1	0.383	0.159	541.17	5	2500.0%	1	K.VPSIK.A
	TK010303_lung_E18_mito_3_step07.1938.1938.1	1.4931	0.16	1203.63	2	5560.0%	2	R.KHTLSYVDIK.T
	TK010303_lung_E18_mito_3_step11.1339.1339.1	1.5916	0.1306	1056.79	1	7860.0%	1	K.KPFGEHWR.K
	TK010303_lung_E18_mito_3_step09.2900.2900.3	1.8388	0.094	3552.82	33	1250.0%	1	R.GMVWNTDLVETLELQNLMLCALQTIYGAEAR.K
UMASP_MOUSE60.5%116.9%375421115.8(P70124) Maspin precursor (Protease inhibitor 5)
*	TK010303_lung_E18_mito_3_step01.4224.4224.2	1.8254	0.2752	2764.09	3	1800.0%	1	K.ASLESLGLKSLFNESTSDFSGMSETK.G
UQ9C0F760.5%227.0%573629608.5(Q9C0F7) Hypothetical protein KIAA1706 (Hypothetical protein FLJ14480) (Fragment)
*	TK010303_lung_E18_mito_3_step01.1363.1363.1	1.8208	0.0305	1404.58	3	5000.0%	1	K.SLDNIWISKSLK.K
*	TK010303_lung_E18_mito_3_step07.2869.2869.2	1.4208	0.0995	2973.92	12	1850.0%	1	R.FKVGSHDLTLVNLHLAALTLLGSENPSK.N
UQ9CWS060.3%115.6%285313816.0(Q9CWS0) 2410006N07Rik protein
*	TK010303_lung_E18_mito_3_step05.2442.2442.2	1.9943	0.2708	1854.38	1	4670.0%	1	K.LKDHLLIPVSNSEMEK.V
UQ9D10760.3%2219.9%186209177.0(Q9D107) 2010015D08Rik protein
	TK010303_lung_E18_mito_3_step12.4072.4072.2	1.9825	0.2702	2525.87	1	2730.0%	1	K.IGLIHGHQVIPWGDMASLALLQR.Q
	TK010303_lung_E18_mito_3_step12.3713.3713.3	2.0505	0.1139	4120.14	4	1390.0%	1	K.IGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHK.F
UQ8VIB460.3%119.0%155179988.9(Q8VIB4) Dystrophin-like protein (Fragment)
*	TK010303_lung_E18_mito_3_step01.3195.3195.1	1.4734	0.1709	1497.1	1	4620.0%	1	R.QGLPSDPTEGHLSR.K
UQ8VGA260.3%1111.4%315352248.0(Q8VGA2) Olfactory receptor MOR206-2
*	TK010303_lung_E18_mito_3_step08.3928.3928.3	2.9029	0.2149	4015.12	9	1500.0%	1	K.HKAFSTCASHLIGVTVFYGTMIFTYLKPSTSYSLGK.D
UAD19_MOUSE60.2%336.5%9201008608.1(O35674) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 19) (Meltrin beta)
*	TK010303_lung_E18_mito_3_step01.2871.2871.1	1.5832	0.1431	1540.5	1	4230.0%	1	R.IALVGLEVWTHGDK.C
*	TK010303_lung_E18_mito_3_step05.4282.4282.2	1.2564	0.0796	2295.13	19	1900.0%	1	R.GPEEEEGEGDMLDPGLVMTGTK.C
*	TK010303_lung_E18_mito_3_step11.2489.2489.2	1.7357	0.1802	2684.17	1	2830.0%	1	R.IYRSEHLTLPPGNCGFEHSGPTSK.D
UQ9UJX360.1%225.7%565631775.8(Q9UJX3) Anaphase-promoting complex subunit 7
*	TK010303_lung_E18_mito_3_step11.1848.1848.1	1.5459	0.154	1204.51	1	6110.0%	1	K.ALTQRPDYIK.A
*	TK010303_lung_E18_mito_3_step02.2965.2965.2	1.6156	0.1822	2444.22	225	1670.0%	1	K.AYAFVHTGDNSRAISTICSLEK.K
UO1471260.1%3510.4%375443209.4(O14712) Cell cycle progression restoration 8 protein
*	TK010303_lung_E18_mito_3_step06.2143.2143.2	1.4529	0.0016	2755.99	14	1900.0%	1	R.WNELDQFINKFFLNGVFIHDQK.L
*	TK010303_lung_E18_mito_3_step07.1969.1969.2	1.6323	0.0124	1968.48	11	3120.0%	2	K.LFTDFVNDVKIILGNMK.E
UITB3_MOUSE60.1%5714.4%787866945.3(O54890) Integrin beta-3 precursor (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD61 antigen)
*	TK010303_lung_E18_mito_3_step09.3924.3924.2	1.2253	0.0501	2449.73	70	2000.0%	1	K.NACLPMFGYKHVLTLTDQVSR.F
*	TK010303_lung_E18_mito_3_step11.2477.2477.2	1.5015	0.156	2628.19	50	1740.0%	2	R.IGFGAFVDKPVSPYMYISPPQAIK.N
*	TK010303_lung_E18_mito_3_step04.2397.2397.3	1.6506	0.0823	3224.74	3	1750.0%	1	R.AQWPGQLWAALLALGALAGVVVGESNICTTR.G
*	TK010303_lung_E18_mito_3_step05.3053.3053.3	2.8382	0.213	4019.77	1	1740.0%	1	R.LAGIVLPNDGHCHIGTDNHYSASTTMDYPSLGLMTEK.L
UQ9H7P860.1%4613.0%732764078.1(Q9H7P8) FLJ00019 protein (Fragment)
*	TK010303_lung_E18_mito_3_step05.3738.3738.3	2.0085	0.1263	4246.76	1	1520.0%	1	K.MAAAKPTLTDSLSFCLAQLAAAAGEALGGEKDPATNETPLSR.A
	TK010303_lung_E18_mito_3_step12.3301.3301.3	2.8372	0.2207	3699.9	3	1390.0%	2	R.FSQAPDPSGALVTGPALYGLLTYVTGAPGPPSPRALR.I
	TK010303_lung_E18_mito_3_step11.1448.1448.2	1.7671	0.0765	1724.11	1	4000.0%	1	R.RDPNGASPTSQQPLVR.A
UKPCT_MOUSE59.9%224.4%707815737.7(Q02111) Protein kinase C, theta type (EC 2.7.1.-) (nPKC-theta)
	TK010303_lung_E18_mito_3_step11.4220.4220.2	1.1808	0.1395	2592.33	3	2250.0%	1	R.VLSLAWEHPFLTHMFCTFQTK.E
	TK010303_lung_E18_mito_3_step11.1212.1212.1	1.4617	0.1751	1241.65	3	4440.0%	1	R.GDIRQHPLFR.E
UQ9Y2H359.9%445.4%15781734625.2(Q9Y2H3) Hypothetical protein KIAA0967
*	TK010303_lung_E18_mito_3_step05.4082.4082.3	1.5194	0.0012	4406.14	2	1350.0%	1	R.STFFHFGSPGLAESIDSDSQEERSGIETSGFLCLLDLAQR.A
*	TK010303_lung_E18_mito_3_step02.4361.4361.3	1.4925	0.0243	3986.67	13	1330.0%	1	R.SIEYFALALEEQYSISRLHLLHEEELIQQVVER.E
*	TK010303_lung_E18_mito_3_step11.2248.2248.1	1.3574	0.0421	1413.47	1	3640.0%	1	K.LYLENGQTKAFK.F
UCD22_HUMAN59.7%5511.8%847953486.7(P20273) B-cell receptor CD22 precursor (Leu-14) (B-lymphocyte cell adhesion molecule) (BL-CAM)
	TK010303_lung_E18_mito_3_step03.2369.2369.2	1.7902	0.2816	2201.03	1	3250.0%	1	R.RVAVGLGSCLAILILAICGLK.L
	TK010303_lung_E18_mito_3_step11.2287.2287.2	1.6145	0.1287	2437.69	1	2500.0%	1	R.VAVGLGSCLAILILAICGLKLQR.R
*	TK010303_lung_E18_mito_3_step10.2077.2077.3	1.9726	0.0856	3746.47	39	1290.0%	1	K.VTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLK.D
	TK010303_lung_E18_mito_3_step07.2956.2956.3	2.2579	0.186	4692.71	6	1160.0%	1	K.ESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPR.R
*	TK010303_lung_E18_mito_3_step04.2058.2058.2	1.2212	0.1305	2807.34	12	1670.0%	1	R.EGDSVTMTCEVSSSNPEYTTVSWLK.D
UQ8WXX059.7%774.0%40244611476.0(Q8WXX0) Ciliary dynein heavy chain 7
*	TK010303_lung_E18_mito_3_step04.4087.4087.3	1.6779	0.0496	4403.52	2	1250.0%	1	K.LESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSVR.A
*	TK010303_lung_E18_mito_3_step08.4424.4424.2	1.3201	0.1299	2579.23	62	1670.0%	1	R.CYRTLFGALHLHLGGAPEGPAGTGK.T
*	TK010303_lung_E18_mito_3_step08.3706.3706.2	1.7932	0.2783	2582.34	1	2620.0%	1	R.DHLNAMNPTMLAVLDLWHTNFK.K
*	TK010303_lung_E18_mito_3_step11.1849.1849.3	1.5988	0.1704	1781.61	10	3090.0%	1	R.SHALLVGVGGSGRQSVTR.L
*	TK010303_lung_E18_mito_3_step08.4150.4150.2	1.2568	0.0149	3048.01	4	1880.0%	1	K.SFFVELQRYNYVTPTSYLELISTFK.L
	TK010303_lung_E18_mito_3_step01.1251.1251.1	1.0971	0.0227	1144.65	1	5000.0%	1	K.FADDQGYGGSK.L
*	TK010303_lung_E18_mito_3_step06.4511.4511.2	0.8703	0.1292	2407.37	3	1840.0%	1	R.SLMNLIDCFMDDFADEVKLK.E
UQ9BV9759.7%1125.1%1912061010.8(Q9BV97) Hypothetical protein
*	TK010303_lung_E18_mito_3_step12.3897.3897.3	2.6051	0.2999	4522.54	1	1330.0%	1	R.ETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQR.G
ULMA2_HUMAN59.7%886.6%31103427726.4(P24043) Laminin alpha-2 chain precursor (Laminin M chain) (Merosin heavy chain)
*	TK010303_lung_E18_mito_3_step03.3631.3631.3	2.5984	0.3012	4634.22	3	1220.0%	1	K.NGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILER.S
*	TK010303_lung_E18_mito_3_step03.4173.4173.3	2.1245	0.247	4699.62	10	1120.0%	1	K.CAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPK.F
*	TK010303_lung_E18_mito_3_step09.2070.2070.1	1.3276	0.0016	1335.54	6	5000.0%	1	K.KGSYNNIVVNVK.T
*	TK010303_lung_E18_mito_3_step12.3004.3004.2	1.5068	0.1368	2482.87	16	2250.0%	1	K.CDCPLGYSGLSCEACLPGFYR.L
*	TK010303_lung_E18_mito_3_step11.2692.2692.3	1.4289	0.0387	3204.35	5	1790.0%	1	R.NLHMAEAPADLEQPTSSFHVGTCFANAQR.G
*	TK010303_lung_E18_mito_3_step03.3788.3788.3	1.7334	0.0117	4553.95	89	910.0%	1	R.LSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPR.H
*	TK010303_lung_E18_mito_3_step08.3882.3882.3	1.8688	0.0136	3517.98	187	1170.0%	1	K.ACNCSTVGSLDFQCNVNTGQCNCHPKFSGAK.C
*	TK010303_lung_E18_mito_3_step04.1990.1990.2	1.6925	0.1806	1877.87	2	4000.0%	1	R.VLLQITYSFGMDAIFR.L
UAD07_HUMAN59.6%354.9%754855836.6(Q9H2U9) ADAM 7 precursor (A disintegrin and metalloproteinase domain 7) (Sperm maturation-related glycoprotein GP-83)
*	TK010303_lung_E18_mito_3_step07.3230.3230.3	1.8533	0.0651	4236.34	13	1320.0%	1	K.DFDHVVLLSGKWLYSHVQGISYPGGMCLPYYSTSIIK.D
*	TK010303_lung_E18_mito_3_step11.3280.3280.3	1.9479	0.1109	3025.44	19	1600.0%	2	K.WLYSHVQGISYPGGMCLPYYSTSIIK.D
UO8857659.5%229.8%615692297.1(O88576) Sodium- and chloride-dependent transporter XTRP2
*	TK010303_lung_E18_mito_3_step06.3309.3309.3	2.8498	0.192	4386.47	1	1670.0%	1	R.RPGLYWQVTWRVVSPMLLFGIFLSYIVLLIQTPPSYK.A
*	TK010303_lung_E18_mito_3_step10.2187.2187.3	1.5704	0.0093	2726.52	6	2160.0%	1	K.WDNKLQYLLSCIGFAVGLGNIWR.F
UAMBP_MOUSE59.5%3310.6%349390706.3(Q07456) AMBP protein precursor [Contains: Alpha-1-microglobulin; Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (HI-30)]
	TK010303_lung_E18_mito_3_step12.1129.1129.1	1.6508	0.1263	1289.61	1	5000.0%	1	K.SSHHHGLTITAK.L
	TK010303_lung_E18_mito_3_step04.3071.3071.3	1.8453	0.0328	3034.23	1	1980.0%	1	K.SKWNITLESYVVHTNYDEYAIFLTK.K
	TK010303_lung_E18_mito_3_step12.1841.1841.2	1.4164	0.142	2824.06	3	2050.0%	1	K.WNITLESYVVHTNYDEYAIFLTK.K
UIP3T_HUMAN59.5%10108.9%26713040376.5(Q14573) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3 inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3)
*	TK010303_lung_E18_mito_3_step12.1141.1141.2	1.1049	0.0392	1826.23	10	3210.0%	1	K.FEENEDIVVMETKLK.I
*	TK010303_lung_E18_mito_3_step11.2608.2608.2	1.9335	0.0314	2019.27	7	3330.0%	1	K.ILEILQFILNVRLDYR.I
*	TK010303_lung_E18_mito_3_step01.4011.4011.1	1.6513	0.1254	1514.02	3	4580.0%	1	K.DYDSNLNASRDDK.K
*	TK010303_lung_E18_mito_3_step06.3227.3227.3	1.8167	0.0886	3773.79	11	1330.0%	1	R.FVIQLLEDLVFFVSDVPNNGQNVLDIMVTKPNR.E
*	TK010303_lung_E18_mito_3_step12.4227.4227.3	1.8483	0.0847	4651.8	1	1220.0%	1	K.EFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGEQAEAMFGVGK.T
*	TK010303_lung_E18_mito_3_step02.2206.2206.2	1.4294	0.1943	1751.96	8	2860.0%	1	K.QVQLLISAQDVENYK.V
*	TK010303_lung_E18_mito_3_step02.3217.3217.3	1.9131	0.0293	3866.34	1	1530.0%	1	R.LFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQR.N
*	TK010303_lung_E18_mito_3_step01.2434.2434.1	1.1643	0.1181	1040.68	5	5710.0%	1	R.YQLKLFAR.M
*	TK010303_lung_E18_mito_3_step08.4254.4254.3	1.5426	0.0459	3866.64	60	1110.0%	1	R.SNGDNVVVGDKVILNPVNAGQPLHASNYELSDNAGCK.E
*	TK010303_lung_E18_mito_3_step12.3299.3299.2	1.3007	0.0201	2751.66	26	1740.0%	1	K.MDCVSGVSVPEVLEEDRELDSTER.A
URL2A_MOUSE59.5%117.5%1471645811.1(P14115) 60S ribosomal protein L27a (L29)
	TK010303_lung_E18_mito_3_step01.1680.1680.1	1.5933	0.1301	1139.7	1	6000.0%	1	K.TGVAPIIDVVR.S
UMYBB_MOUSE59.4%5511.4%704791037.0(P48972) Myb-related protein B (B-Myb)
*	TK010303_lung_E18_mito_3_step05.2536.2536.3	1.9422	0.0566	2986.12	88	1340.0%	1	K.LMSSTMPKPLSLPTSVTPSSCGFTSPGSK.E
*	TK010303_lung_E18_mito_3_step05.1970.1970.1	1.2662	0.0464	857.46	14	5830.0%	1	R.QLLSRLK.S
*	TK010303_lung_E18_mito_3_step11.3405.3405.3	1.7088	0.1023	2597.29	3	2100.0%	1	R.GELIPISPSTEFGGSGIGTPPSVLKR.Q
	TK010303_lung_E18_mito_3_step08.1580.1580.2	1.2062	0.01	2078.13	2	2650.0%	1	K.YGPLKPLPQTPHLEEDLK.E
URL24_HUMAN59.4%2213.4%1571777911.3(P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30)
	TK010303_lung_E18_mito_3_step01.1676.1676.1	1.7308	0.0096	966.43	4	7140.0%	1	K.VFQFLNAK.C
	TK010303_lung_E18_mito_3_step01.1834.1834.1	1.6382	0.1203	1264.52	1	4580.0%	1	R.AITGASLADIMAK.R
UO6030359.4%335.1%16251816345.8(O60303) Hypothetical protein KIAA0556 (Fragment)
*	TK010303_lung_E18_mito_3_step01.3771.3771.2	1.3849	0.0862	3098.31	2	1610.0%	1	K.DVHGEQETEGRSSPGPDTLVVLEFNPASK.S
*	TK010303_lung_E18_mito_3_step09.2856.2856.3	2.6292	0.2498	3452.85	3	1640.0%	1	K.LIDGTNITMEDEHMWLIPFSPGLDHVVTIR.L
*	TK010303_lung_E18_mito_3_step11.2857.2857.2	1.1561	0.1049	2661.37	10	2170.0%	1	R.LEHLEQGFSVYVNGANSELKSSPR.K
UQ9CS6159.3%228.3%533585465.4(Q9CS61) 5730521P14Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step08.2490.2490.2	1.9284	0.2696	2481.75	1	2730.0%	1	R.FDDSDSPSESEDAIEVEPAPSVR.V
*	TK010303_lung_E18_mito_3_step10.3218.3218.2	1.4585	0.0062	2276.61	28	2250.0%	1	R.LQRSENSNPVDNGSEDGSLTR.S
UQ9D5S759.3%111.1%820931906.3(Q9D5S7) 4921528H16Rik protein
*	TK010303_lung_E18_mito_3_step01.2414.2414.1	1.6989	0.1067	1080.96	1	5620.0%	1	R.YILVVPMDK.E
UTRX2_HUMAN59.3%10107.7%27152935138.2(Q9UMN6) Trithorax homolog 2 (Mixed lineage leukemia gene homolog 2 protein)
*	TK010303_lung_E18_mito_3_step08.2538.2538.2	1.4651	0.0338	2421.74	74	1960.0%	1	R.LDEDGEASEDTPQVPGLGSGGFSR.V
*	TK010303_lung_E18_mito_3_step12.2319.2319.2	1.1798	0.0544	2359.73	19	2140.0%	1	K.TLLPWDSDESPEASPGPPGPRR.G
*	TK010303_lung_E18_mito_3_step11.1364.1364.1	0.8599	0.1096	1493.28	168	2690.0%	1	R.ERPSGPESPVQGPR.I
*	TK010303_lung_E18_mito_3_step04.2002.2002.2	1.5571	0.0966	2078.04	37	2350.0%	1	R.RPLLLRAPQFTPSEAHLK.I
*	TK010303_lung_E18_mito_3_step10.3791.3791.2	1.6221	0.0544	2405.75	138	1520.0%	1	R.YIHFPVTVVSAPGLAPSATPGAPR.I
*	TK010303_lung_E18_mito_3_step09.1734.1734.1	1.0603	0.0139	768.49	4	6670.0%	1	R.LSALPLR.D
*	TK010303_lung_E18_mito_3_step02.3992.3992.2	1.7504	0.3095	2946.97	2	2000.0%	1	R.YHQQGEGQEEPPLNPHGAARAEVYLR.K
*	TK010303_lung_E18_mito_3_step01.0156.0156.1	1.2737	0.0743	720.59	172	5000.0%	1	K.FGGPNTK.K
*	TK010303_lung_E18_mito_3_step11.1885.1885.3	2.3519	0.3866	4140.92	1	1440.0%	1	R.EESLPPAPPLANGSQPSQGLTASPADPTRTFAWLPGAPGVR.V
*	TK010303_lung_E18_mito_3_step11.3388.3388.2	1.4929	0.0083	2655.35	2	2400.0%	1	R.GAGAGGPREEVVAHPGPEEQDSLLQR.K
UQ9CXZ259.1%245.5%163174037.1(Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence
	TK010303_lung_E18_mito_3_step01.1276.1276.1	1.0659	0.0013	888.67	15	5000.0%	2	K.AAVSGLWGK.V
USOX5_MOUSE59.1%115.4%392432036.9(P35710) Transcription factor SOX-5
	TK010303_lung_E18_mito_3_step10.2962.2962.2	1.8673	0.2698	2257.62	5	2750.0%	1	R.EQQALDGKVAVVNSIGLSNCR.T
UQ9CXL759.1%1130.6%121121754.3(Q9CXL7) 3110079O15Rik protein
*	TK010303_lung_E18_mito_3_step11.3308.3308.3	2.8278	0.2142	3617.16	1	1740.0%	1	R.VDQDGGSLGPGAIAAIVIAALLATCVVLALVVVALRK.F
UDCT2_MOUSE59.0%243.5%402441175.3(Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2)
	TK010303_lung_E18_mito_3_step11.2051.2051.1	1.7949	0.0859	1584.55	1	3850.0%	2	R.WSPVASTLPELVQR.L
UP7069659.0%1110.2%1271423710.3(P70696) Histone H2B
*	TK010303_lung_E18_mito_3_step09.1966.1966.1	1.5554	0.1472	1330.57	2	4170.0%	1	-.MPEVAVKGATISK.K
UQ9CZS158.8%226.6%519575537.0(Q9CZS1) 2700007F14Rik protein (Aldehyde dehydrogenase 1 family, member B1)
	TK010303_lung_E18_mito_3_step04.2274.2274.2	2.0858	0.2547	2325.47	1	2620.0%	1	K.KTFPTVNPTTGEVIGHVAEGDR.A
	TK010303_lung_E18_mito_3_step01.2332.2332.1	1.8067	0.1146	1404.82	13	3640.0%	1	K.EEIFGPVQPLFK.F
UO0026158.7%82215.2%755786365.8(O00261) Collagen type XIV (Fragment)
	TK010303_lung_E18_mito_3_step01.2654.2654.1	1.5815	0.1375	1216.7	2	5000.0%	4	K.MMEMFGLVEK.D
	TK010303_lung_E18_mito_3_step02.4022.4022.3	1.5321	0.1187	3539.61	59	1360.0%	2	R.DDESCPDLPHSCSCSETNEVALGPAGPPGGPGLR.G
*	TK010303_lung_E18_mito_3_step09.3556.3556.3	1.9828	0.215	4312.5	8	1180.0%	1	K.NSDPLVGVILDNGGKTLTYFNYDQSGDFQTVTFEGPEIR.K
	TK010303_lung_E18_mito_3_step03.4524.4524.2	1.2493	0.0062	3197.9	82	970.0%	1	R.GPPGHLGVPGPQGPSGQPGYCDPSSCSAYGVR.D
UQ9H3L858.7%228.9%450511394.8(Q9H3L8) My001 protein
	TK010303_lung_E18_mito_3_step01.2274.2274.1	1.6419	0.1189	1217.72	1	6500.0%	1	R.NELAETLALLK.A
*	TK010303_lung_E18_mito_3_step01.4106.4106.2	1.5431	0.1419	3099.92	1	1960.0%	1	K.SSMEKPVAQEPEGSELGGNIKSSHEITEK.S
UBAI2_HUMAN58.7%102210.4%15721711417.3(O60241) Brain-specific angiogenesis inhibitor 2 precursor
*	TK010303_lung_E18_mito_3_step03.1964.1964.3	1.6205	0.0243	3992.4	224	970.0%	1	K.DLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWR.F
*	TK010303_lung_E18_mito_3_step03.3469.3469.3	1.6484	0.0635	4406.32	6	1190.0%	1	K.GYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNK.L
*	TK010303_lung_E18_mito_3_step10.2977.2977.2	1.7401	0.152	2296.51	12	2370.0%	4	R.SVCTDKPSPGERPSLSQHRR.H
*	TK010303_lung_E18_mito_3_step08.3434.3434.2	1.6507	0.1837	2677.25	2	2500.0%	1	R.QLDLTWLRPTEPGSEGDYMVLPR.R
*	TK010303_lung_E18_mito_3_step12.3164.3164.2	1.5465	0.3265	3032.89	6	1730.0%	1	K.SERSIILLNFCLSILASNILILVGQSR.V
*	TK010303_lung_E18_mito_3_step01.2150.2150.1	1.4584	0.0693	1364.61	1	6110.0%	1	K.RCPAFHEMCR.D
*	TK010303_lung_E18_mito_3_step01.1498.1498.1	1.3094	0.0538	747.54	4	7000.0%	1	R.SRTMPR.T
UMAP4_MOUSE58.6%335.8%11251176755.0(P27546) Microtubule-associated protein 4 (MAP 4)
*	TK010303_lung_E18_mito_3_step02.3652.3652.2	1.3251	0.1041	3023.39	10	1610.0%	1	K.NADLHSGTELIVDNSMAPASDLALPLETK.V
*	TK010303_lung_E18_mito_3_step11.4233.4233.2	1.7818	0.2767	2856.79	1	2140.0%	1	K.TEGGGSEALPCPGPPAGEEPVIPEAAPDR.G
*	TK010303_lung_E18_mito_3_step03.3404.3404.3	2.6819	0.0943	3735.75	2	1500.0%	1	K.NADLHSGTELIVDNSMAPASDLALPLETKVATVPIK.D
UO4365658.6%2211.1%359387046.9(O43656) Hepatitis A virus cellular receptor 1
	TK010303_lung_E18_mito_3_step12.1523.1523.2	1.5255	0.0051	1787.74	19	2500.0%	1	K.VTTTPIVTTVPTVTTVR.T
	TK010303_lung_E18_mito_3_step12.2424.2424.2	1.7707	0.2832	2546.55	1	2730.0%	1	K.EVQQLSVSFSSLQIKALQNAVEK.E
UQ9JJ2658.6%111.2%767862657.4(Q9JJ26) Pyrin
*	TK010303_lung_E18_mito_3_step01.1902.1902.1	1.8099	0.1612	1103.7	7	6250.0%	1	K.QKISCPLEK.L
UO1508358.6%111.1%808948826.5(O15083) Hypothetical protein KIAA0378 (Fragment)
*	TK010303_lung_E18_mito_3_step01.1568.1568.1	1.8115	0.0031	1152.41	10	6250.0%	1	R.LEEIESFRK.E
UQ99LI058.6%227.9%547626545.4(Q99LI0) Similar to thyroid hormone receptor interactor 10
	TK010303_lung_E18_mito_3_step07.4180.4180.3	1.5169	0.0082	4052.83	9	1110.0%	1	K.SGFARPGDLEFEDFSQVINRVPSDSSLGTPDGRPELR.A
	TK010303_lung_E18_mito_3_step01.1164.1164.1	1.8109	0.0415	785.53	8	7000.0%	1	K.YVKFVK.E
UQ9Y6A858.6%468.4%640724806.4(Q9Y6A8) Vesicle transport-related protein
	TK010303_lung_E18_mito_3_step12.1392.1392.3	1.5382	0.124	3279.46	5	1700.0%	1	K.NPFQEAIVFVVGGGNYIEYQNLVDYIKGK.Q
	TK010303_lung_E18_mito_3_step09.3192.3192.2	1.7231	0.0893	2041.22	51	3120.0%	2	K.HILYGCSELFNATQFIK.Q
	TK010303_lung_E18_mito_3_step10.4257.4257.2	1.3069	0.0452	2927.83	15	1460.0%	1	K.HILYGCSELFNATQFIKQLSQLGQK.-
UQ9CW4658.5%5519.8%756801948.9(Q9CW46) 1300006N24Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step05.1938.1938.2	1.3404	0.0031	2470.27	204	1400.0%	1	R.GRRPAEPPLPSPAVPGGGSGSNNGNK.A
*	TK010303_lung_E18_mito_3_step01.3068.3068.3	1.7269	0.0503	3615.76	31	1210.0%	1	R.SGGGSGGPLSHFYSGSPTSYFTSGLQAGLKQSHLNK.A
*	TK010303_lung_E18_mito_3_step11.2689.2689.3	1.9425	0.0684	4335.66	31	1080.0%	1	R.TLYVHWTDAGQLTPALLHSRCLCVDHLPPGFSDVDALR.R
*	TK010303_lung_E18_mito_3_step08.3910.3910.2	1.2284	0.0533	2196.0	1	2860.0%	1	R.EPMGLGPPATQLTPPPAPVGLR.G
*	TK010303_lung_E18_mito_3_step02.2917.2917.3	2.7078	0.2354	3368.04	5	1590.0%	1	K.QSHLNKAVGSSPMGSSEGLLGLGPGPNGHSHLLK.T
UDJB4_HUMAN58.5%114.5%337378078.5(Q9UDY4) DnaJ homolog subfamily B member 4 (Heat shock 40 kDa protein 1 homolog) (Heat shock protein 40 homolog) (HSP40 homolog)
*	TK010303_lung_E18_mito_3_step09.2335.2335.2	1.826	0.27	1670.07	1	4640.0%	1	R.NIPMSVNDIVKPGMR.R
UO1503358.5%228.3%823942237.3(O15033) Hypothetical protein KIAA0317
*	TK010303_lung_E18_mito_3_step03.2635.2635.2	1.8319	0.2705	2975.69	1	2200.0%	1	R.DEHNYTLSIHELGPQEEESTGVSFEK.S
*	TK010303_lung_E18_mito_3_step04.2810.2810.3	2.1359	0.2678	4634.41	1	1340.0%	1	K.NGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQEPNSNVVK.V
UQ9NVZ458.3%5525.1%342373897.8(Q9NVZ4) Hypothetical protein FLJ10415
	TK010303_lung_E18_mito_3_step12.2720.2720.2	1.0828	0.0442	2399.8	8	2270.0%	1	R.GPRDCVVLMAAAGHFAGAIFQGR.E
	TK010303_lung_E18_mito_3_step01.2770.2770.1	1.5755	0.1343	1373.67	1	5000.0%	1	R.YNEATLYKDVR.D
*	TK010303_lung_E18_mito_3_step05.3521.3521.2	1.1826	0.0578	2401.97	68	1740.0%	1	K.GAPLQRGIPDFGISPSPPADPPSK.S
	TK010303_lung_E18_mito_3_step11.3268.3268.3	1.5713	0.0264	3413.63	138	1300.0%	1	K.LLQGPMDISEKLFCSTCDQTFQNHQEQR.E
	TK010303_lung_E18_mito_3_step10.2597.2597.2	1.3011	0.0178	2091.36	1	3420.0%	1	R.DCVVLMAAAGHFAGAIFQGR.E
UABB1_MOUSE58.2%114.7%708771395.0(Q9QXJ1) Amyloid beta A4 precursor protein-binding family B member 1 (Fe65 protein)
*	TK010303_lung_E18_mito_3_step10.3519.3519.3	2.5065	0.354	3684.41	4	1480.0%	1	R.ASPSQGSSPQEESQLTWTGFAHQEGFEDGEFWK.D
UTP2A_MOUSE58.2%7117.9%15281728768.7(Q01320) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3)
*	TK010303_lung_E18_mito_3_step02.3638.3638.3	1.6571	0.0906	4190.55	2	1360.0%	1	R.FLYDDNQRVEPEWYNPINTMVLINGAEGIGTGWSCK.I
*	TK010303_lung_E18_mito_3_step03.2361.2361.3	1.3892	0.0063	4501.67	7	1220.0%	2	K.GTIEELASNQYVINGEVAILDSTTIEISELPIRTWTQTYK.E
*	TK010303_lung_E18_mito_3_step07.2096.2096.1	1.572	0.1397	1123.68	1	6250.0%	1	K.FVIKMTEEK.L
*	TK010303_lung_E18_mito_3_step03.2420.2420.3	2.1061	0.3279	2931.1	38	1670.0%	1	K.LLGLPEDYLYGQSTSYLTYNDFINK.E
*	TK010303_lung_E18_mito_3_step01.4174.4174.1	1.753	0.0511	1233.94	5	5560.0%	2	K.EQELNTLKQK.S
UEPA8_HUMAN58.1%5116.4%10051110038.1(P29322) Ephrin type-A receptor 8 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor EEK) (EPH-and ELK-related kinase) (HEK3)
*	TK010303_lung_E18_mito_3_step01.1878.1878.1	1.7931	0.0723	1401.71	4	4170.0%	1	K.LNTEVRSVGPLSK.R
*	TK010303_lung_E18_mito_3_step10.2547.2547.3	1.9481	0.1255	3714.96	16	1330.0%	3	K.SAPGDQLCARCPPHSHSAAPAAQACHCDLSYYR.A
*	TK010303_lung_E18_mito_3_step06.3398.3398.2	1.4394	0.0273	2068.01	174	2060.0%	1	R.AQRPRFSQIVSVLDALIR.S
UCMC2_MOUSE58.1%338.6%676744678.6(Q9QXX4) Calcium-binding mitochondrial carrier protein Aralar2 (Solute carrier family 25, member 13) (Citrin)
*	TK010303_lung_E18_mito_3_step07.4076.4076.3	1.9463	0.0523	4261.09	17	1290.0%	1	K.GEVTFEDVKQIFGQTTIHQHIPFNWDSEFVQLHFGK.E
	TK010303_lung_E18_mito_3_step02.2586.2586.2	1.6463	0.1003	2470.3	14	2140.0%	1	R.YEGFFGLYRGLLPQLLGVAPEK.A
	TK010303_lung_E18_mito_3_step01.2470.2470.1	1.7732	0.0982	1335.7	4	4580.0%	1	R.GLLPQLLGVAPEK.A
UCMC1_HUMAN58.1%449.6%678747568.4(O75746) Calcium-binding mitochondrial carrier protein Aralar1 (Solute carrier family 25, member 12)
*	TK010303_lung_E18_mito_3_step11.3544.3544.3	2.1857	0.0392	4024.77	20	1210.0%	1	R.SSPQFGVTLAHYEVLQRWFYIDFGGLKPAGSEPTPK.S
	TK010303_lung_E18_mito_3_step12.1123.1123.1	1.1973	0.1242	880.59	3	6670.0%	1	R.LHFGHNR.K
	TK010303_lung_E18_mito_3_step02.2586.2586.2	1.6463	0.1003	2470.3	14	2140.0%	1	R.YEGFFGLYRGLIPQLIGVAPEK.A
	TK010303_lung_E18_mito_3_step01.2470.2470.1	1.7732	0.0982	1335.7	4	4580.0%	1	R.GLIPQLIGVAPEK.A
UZ147_MOUSE58.0%5516.9%634717728.3(Q61510) Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp)
*	TK010303_lung_E18_mito_3_step12.2411.2411.2	1.268	0.0259	2812.08	56	1670.0%	1	K.VDFTEALYPAFWVFSAGTTLSICSK.-
*	TK010303_lung_E18_mito_3_step01.1068.1068.1	1.5068	0.1558	858.56	3	6250.0%	1	K.ATSPDAAPK.A
*	TK010303_lung_E18_mito_3_step06.3581.3581.2	1.2301	0.0285	2257.13	74	1820.0%	1	K.LPTFGAPGQSLDSKATSPDAAPK.A
*	TK010303_lung_E18_mito_3_step09.2974.2974.2	1.3793	0.0972	3038.54	3	2000.0%	1	R.VGVLLNCDHGFVIFFAVTEKVHLMYK.F
*	TK010303_lung_E18_mito_3_step11.3704.3704.3	2.3557	0.133	3604.72	8	1410.0%	1	R.TPVDDWTPPARFSASSAATQVACDHCLTEIAVK.T
UENP5_HUMAN57.9%359.8%428475176.3(O75356) Ectonucleoside triphosphate diphosphohydrolase 5 precursor (EC 3.6.1.6) (NTPDase5) (Nucleoside diphosphatase) (CD39 antigen-like 4) (ER-UDPase)
*	TK010303_lung_E18_mito_3_step03.2143.2143.1	1.6659	0.1519	1308.76	7	4550.0%	2	K.ATAGLRLLPEHK.A
*	TK010303_lung_E18_mito_3_step09.2674.2674.3	2.1041	0.085	3467.13	3	1550.0%	1	K.AREVCDNLENFTSGSPFLCMDLSYITALLK.D
UCADN_MOUSE57.8%775.6%33543696364.6(Q99PF4) Cadherin 23 precursor (Otocadherin)
*	TK010303_lung_E18_mito_3_step10.3014.3014.3	2.1565	0.1274	2783.8	2	2170.0%	1	K.TTGNRDWEYFTIDPISGLIQTAQR.L
	TK010303_lung_E18_mito_3_step02.2306.2306.1	1.765	0.0912	1542.67	5	4170.0%	1	R.ENEPSVTQLVRLR.A
*	TK010303_lung_E18_mito_3_step08.3148.3148.3	1.8171	0.0839	4360.42	2	1280.0%	1	R.VWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLR.V
*	TK010303_lung_E18_mito_3_step07.3708.3708.3	1.5035	0.0431	3918.79	6	1320.0%	1	R.NLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYR.M
	TK010303_lung_E18_mito_3_step04.1931.1931.3	1.4429	0.1291	2396.46	211	1880.0%	1	R.ETKSEFTVEFSVSDHQGVITR.K
*	TK010303_lung_E18_mito_3_step03.2631.2631.2	1.3789	0.121	2959.2	7	1920.0%	1	R.MQVGMPRMDFVINSTSGVVTTTAELDR.E
*	TK010303_lung_E18_mito_3_step12.2703.2703.2	1.4262	0.099	3054.54	25	1600.0%	1	R.SSVRVIVYVEDVNDEAPVFTQQQYNR.L
UCD9_MOUSE57.8%1111.1%225251277.2(P40240) CD9 antigen
*	TK010303_lung_E18_mito_3_step02.3494.3494.2	2.0847	0.2443	2808.17	1	1880.0%	1	K.AIHMALDCCGIAGPLEQFISDTCPK.K
UPGCB_MOUSE57.8%223.5%883960134.9(Q61361) Brevican core protein precursor
*	TK010303_lung_E18_mito_3_step05.2824.2824.1	1.6679	0.1076	1284.68	3	5000.0%	1	R.SWEEAESQCR.A
*	TK010303_lung_E18_mito_3_step03.3728.3728.3	1.8071	0.0057	3640.76	12	1420.0%	1	R.SWEEAESQCRALGAHLTSICTPEEQDFVNDR.Y
UQ9WVQ157.7%4411.7%11121225995.9(Q9WVQ1) Activin receptor interacting protein 1
*	TK010303_lung_E18_mito_3_step06.2737.2737.2	2.1743	0.0799	2033.72	1	3610.0%	1	K.DTTNPTPGVLPLPPPQACR.K
*	TK010303_lung_E18_mito_3_step07.4221.4221.3	1.8412	0.0841	4630.3	52	910.0%	1	K.SGALLESGTYEDNYYGTPKPPAEPAPLLNVTDQILPGATPSAEGK.R
	TK010303_lung_E18_mito_3_step11.4327.4327.3	1.9019	0.0794	4302.7	2	1350.0%	1	K.QILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILK.D
*	TK010303_lung_E18_mito_3_step03.3652.3652.3	2.0091	0.0351	3044.01	7	1760.0%	1	R.WENQGSPQTSLSAPAVPQNLPFPPALHR.S
UQ8TEG957.6%72722.4%393422466.5(Q8TEG9) FLJ00228 protein (Fragment)
*	TK010303_lung_E18_mito_3_step03.4204.4204.3	2.5025	0.3517	4486.66	1	1340.0%	5	R.AMLPSPLNVRLEAPAGMGEQLTETFALDTNTGSFLHTLEGPR.F
*	TK010303_lung_E18_mito_3_step08.1965.1965.2	1.0601	0.0318	1305.71	110	3750.0%	1	R.LAPGSGPITLLLR.S
	TK010303_lung_E18_mito_3_step11.1433.1433.3	1.5946	0.1387	3431.29	5	1480.0%	1	R.GSLYYLLSALPQPKAPGYICHGLSPGGLSNGSR.E
UQ99JQ157.6%1141.9%6274008.3(Q99JQ1) Hypothetical 7.4 kDa protein
*	TK010303_lung_E18_mito_3_step03.4356.4356.2	1.677	0.3745	3070.12	1	2200.0%	1	R.EGHFQACKLLTPVAEMVSWYQTLDSR.S
UQ8R36557.4%1115.8%202233127.8(Q8R365) Similar to hypothetical protein FLJ21140 (Fragment)
*	TK010303_lung_E18_mito_3_step10.4402.4402.3	2.6881	0.2373	3623.32	4	1610.0%	1	K.SLDREGGISLEDWLCAQYLAFATTDSLSYIVK.I
UQ9CWV257.3%5714.9%657725267.3(Q9CWV2) 2410003J24Rik protein
	TK010303_lung_E18_mito_3_step01.2122.2122.1	1.6148	0.0215	1316.7	2	4550.0%	2	K.WLASAADDHTVK.L
*	TK010303_lung_E18_mito_3_step08.3853.3853.3	1.3826	0.0627	3598.21	24	1210.0%	1	R.AVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQK.A
	TK010303_lung_E18_mito_3_step04.2713.2713.2	1.6	0.133	2495.43	31	2000.0%	1	R.FWDLEKFQVVSCIEGEPGPVR.S
	TK010303_lung_E18_mito_3_step07.3726.3726.3	1.6971	0.0123	3437.72	17	1420.0%	1	R.TLMGHKANICSLDFHPYGEFVASGSQDTNIK.L
UFRT1_HUMAN57.3%113.6%279290567.2(Q92837) Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas)
	TK010303_lung_E18_mito_3_step01.0166.0166.1	1.504	0.157	902.62	5	5560.0%	1	R.TGDGVLVPGS.-
UQ9DB8757.3%225.4%559631309.5(Q9DB87) 1500003N10Rik protein
*	TK010303_lung_E18_mito_3_step11.1577.1577.2	1.283	0.0221	1848.4	3	3240.0%	1	K.ATKNVTGQAALFQGPSMK.N
*	TK010303_lung_E18_mito_3_step06.2689.2689.1	1.7332	0.0956	1400.66	5	4550.0%	1	R.VMEELHRALATK.H
UP9749957.2%445.2%26292914587.2(P97499) Telomerase protein-1
*	TK010303_lung_E18_mito_3_step05.3897.3897.2	1.3808	0.0172	2408.21	4	2270.0%	1	R.GHEGPVCCCSFSPDGGILATAGR.D
*	TK010303_lung_E18_mito_3_step04.4422.4422.3	2.1819	0.2285	4297.92	11	1130.0%	1	R.SSVAITAVAWAPDGSMVVSGNEAGELTLWQQAKAVATAQAPGR.V
*	TK010303_lung_E18_mito_3_step11.3868.3868.3	2.373	0.2951	4073.6	39	1110.0%	1	R.IDGTVELWAWQEGARLAAFPAQCGCVSAVLFLHAGDR.F
*	TK010303_lung_E18_mito_3_step09.3794.3794.3	2.8508	0.0174	3724.68	2	1690.0%	1	K.SLNCVAFHPEGQVVATGSWAGSITFFQADGLKVTK.E
UQ1347857.2%114.3%541623047.9(Q13478) IL-1Rrp precursor
*	TK010303_lung_E18_mito_3_step09.3972.3972.2	1.7186	0.2916	2755.27	3	2050.0%	1	K.ECRPENGEEHTFAVEILPRVLEK.H
UEP42_MOUSE57.2%4413.5%690766097.3(P49222) Erythrocyte membrane protein band 4.2 (P4.2) (Pallidin)
*	TK010303_lung_E18_mito_3_step05.3150.3150.2	1.7449	0.2916	3080.35	1	2880.0%	1	R.YSHTSLSCFAQENMAIGKPDLIIEMPK.R
*	TK010303_lung_E18_mito_3_step12.1920.1920.3	1.6106	0.0373	3855.32	12	1450.0%	1	R.GHIWVFQTSVECWMNRPDLSQGYGGWQILHPR.A
*	TK010303_lung_E18_mito_3_step07.1632.1632.2	1.25	0.09	1609.96	4	4290.0%	1	K.DVGNCISTKVVGSDR.C
*	TK010303_lung_E18_mito_3_step12.2209.2209.2	1.4982	0.0199	2017.64	11	2500.0%	1	K.SVLPISQTQAAQEGALLYK.R
UQ8TDD157.2%112.8%8829866610.0(Q8TDD1) ATP-dependent RNA helicase
*	TK010303_lung_E18_mito_3_step01.2992.2992.2	1.7549	0.2986	2760.97	3	1880.0%	1	R.KLGPGRPLPTFPTSECTSDVEPDTR.E
UQ9R07057.1%5518.6%902998677.1(Q9R070) Ca(2+)-sensitive chloride channel 2
*	TK010303_lung_E18_mito_3_step12.3105.3105.3	1.7064	0.0462	4162.66	2	1350.0%	1	R.VSQGFLPVLGADVTAIIEAEHGHQVTLELWDNGAGADTVK.N
*	TK010303_lung_E18_mito_3_step08.3522.3522.3	1.6503	0.0505	4617.22	1	1280.0%	1	K.IVLNPPRPDVQEEAIEATVEDFNRVTSGGSLTVSGAPPDGDHAR.V
*	TK010303_lung_E18_mito_3_step11.3456.3456.3	2.2115	0.116	3557.91	19	1360.0%	1	K.FTSLEDSISALGADISAISMTVWGLAVIFNSILN.-
*	TK010303_lung_E18_mito_3_step02.2814.2814.3	2.6938	0.2288	4204.26	4	1420.0%	1	R.AGAWINSTVLVDSTVGNDTFFVITWTVQKPEIILQDPK.G
	TK010303_lung_E18_mito_3_step11.3000.3000.3	2.4125	0.1031	4076.72	188	860.0%	1	K.SLYIPGYVENGKIVLNPPRPDVQEEAIEATVEDFNR.V
UQ9D3P657.1%2218.9%228259197.5(Q9D3P6) DNA segment, human D0S6743E
	TK010303_lung_E18_mito_3_step08.4370.4370.3	2.7682	0.2125	2627.19	1	2740.0%	1	R.KAVVPGPAEHPLQYNYTFWYSR.R
	TK010303_lung_E18_mito_3_step05.1852.1852.3	1.5704	0.0887	2393.8	3	2250.0%	1	R.FQEDIISIWNKTASDQATTAR.I
UQ8VCD557.0%226.3%649724627.3(Q8VCD5) Similar to cofactor required for Sp1 transcriptional activation, subunit 6 (77 kDa)
	TK010303_lung_E18_mito_3_step08.3334.3334.2	1.381	0.1039	2622.71	2	2270.0%	1	K.IPEDYCPLDVQIPSDLEGSAYIK.V
*	TK010303_lung_E18_mito_3_step04.1979.1979.2	2.1019	0.2283	2087.99	1	4120.0%	1	K.SIQLQLNIGVEQVRVVHR.D
UQ96M4957.0%338.1%669730735.4(Q96M49) Hypothetical protein FLJ32827 (Fragment)
*	TK010303_lung_E18_mito_3_step01.3240.3240.1	1.6422	0.1042	1377.37	4	4550.0%	1	K.SEYPVIQLLALK.T
*	TK010303_lung_E18_mito_3_step11.2091.2091.2	1.7536	0.0293	1865.49	6	3120.0%	1	R.RNATMIFGILASNNDVK.K
*	TK010303_lung_E18_mito_3_step05.2773.2773.2	1.239	0.0932	2767.94	195	1880.0%	1	K.AATVVLMLNSPEEEILAKACEAIYK.F
UP531_HUMAN57.0%555.6%19722135734.7(Q12888) Tumor suppressor p53-binding protein 1 (p53-binding protein 1) (53BP1)
*	TK010303_lung_E18_mito_3_step12.3176.3176.3	1.6511	0.0346	4511.15	1	1280.0%	1	K.QYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCR.T
*	TK010303_lung_E18_mito_3_step11.1404.1404.3	1.2086	0.0158	3151.91	126	1390.0%	1	R.HLPNLQTHKENPVLDVVSNPEQTAGEER.G
*	TK010303_lung_E18_mito_3_step03.2064.2064.3	1.5516	0.1956	3415.19	81	1420.0%	1	K.ENKVADPVDSSNLDTCGSISQVIEQLPQPNR.T
*	TK010303_lung_E18_mito_3_step08.2110.2110.1	1.6422	0.1123	1471.63	2	4580.0%	1	R.QSQQPMKPISPVK.D
UITN1_HUMAN57.0%557.7%17211955317.7(Q15811) Intersectin 1 (SH3 domain-containing protein 1A) (SH3P17)
*	TK010303_lung_E18_mito_3_step11.3647.3647.3	2.0776	0.153	4565.18	3	1160.0%	1	K.RVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTK.K
*	TK010303_lung_E18_mito_3_step04.1901.1901.1	1.6593	0.1024	1186.63	2	5500.0%	1	R.QLNGAALIQQK.T
*	TK010303_lung_E18_mito_3_step10.3971.3971.3	1.8384	0.0808	3612.0	139	1210.0%	1	K.TGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPK.L
*	TK010303_lung_E18_mito_3_step04.2658.2658.3	1.6393	0.154	4795.22	6	1100.0%	1	K.GEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTER.K
*	TK010303_lung_E18_mito_3_step04.3090.3090.2	1.1638	0.0352	2799.69	187	1350.0%	1	K.IPENEVPAPVKPVTDSTSAPAPKLALR.E
UQ8TF3957.0%3310.5%746853138.6(Q8TF39) Hypothetical protein KIAA1962 (Fragment)
*	TK010303_lung_E18_mito_3_step03.4141.4141.3	1.7204	0.027	4506.77	2	1350.0%	1	K.SQHPESSEEVVTLIEDLTQMLEEKDPVSQDSTVSQEENSK.E
*	TK010303_lung_E18_mito_3_step01.2895.2895.1	1.655	0.1044	1538.07	5	3750.0%	1	K.FDPDKSPFGHNFK.E
*	TK010303_lung_E18_mito_3_step11.4159.4159.2	1.5266	0.042	3030.46	16	1670.0%	1	K.EQILELLVFEQFLTILPGEIRIWVK.S
UQ9H4G657.0%7713.6%10421129168.5(Q9H4G6) DJ885L7.9.1 (Death associated transcription factor 1 (Contains KIAA0333), isoform 1) (Fragment)
	TK010303_lung_E18_mito_3_step01.1471.1471.1	1.6588	0.1085	804.66	1	7140.0%	1	K.CGAQAGIK.I
	TK010303_lung_E18_mito_3_step03.3627.3627.2	1.5923	0.1154	2680.03	29	1740.0%	1	K.EAACESSTPSWASDHNYNAVKPEK.T
	TK010303_lung_E18_mito_3_step10.2770.2770.2	1.1437	0.0153	2318.39	52	1670.0%	1	K.IALHIEKEMFNLFQVTDNR.Y
	TK010303_lung_E18_mito_3_step12.3871.3871.3	2.2163	0.1825	4453.56	2	1310.0%	1	R.TYFPGPPGDGHPEPSPLEDLSPCPASCGSGVVTTVTVSGRDPR.T
	TK010303_lung_E18_mito_3_step01.4399.4399.3	1.8287	0.158	3855.07	4	1490.0%	1	R.EEGPAETVGSEASDTVEGVLPSKQEPENDQGVVSQAGK.D
	TK010303_lung_E18_mito_3_step02.1824.1824.1	1.2795	0.0105	1120.54	144	3890.0%	1	K.QPAPRNLVPK.K
	TK010303_lung_E18_mito_3_step07.4156.4156.3	2.2855	0.0797	4082.66	11	1150.0%	1	R.TYFPGPPGDGHPEPSPLEDLSPCPASCGSGVVTTVTVSGR.D
UCFAH_MOUSE57.0%335.4%12341390826.9(P06909) Complement factor H precursor (Protein beta-1-H)
	TK010303_lung_E18_mito_3_step12.2868.2868.3	1.6674	0.0315	3183.89	26	1430.0%	1	K.QGYVTNTGEISGSITCLQNGWSPQPSCIK.S
*	TK010303_lung_E18_mito_3_step04.2297.2297.2	2.1312	0.2006	1613.77	5	3850.0%	1	R.VGDLLEFSCHSGHR.V
*	TK010303_lung_E18_mito_3_step07.4382.4382.2	1.2404	0.0389	2759.98	47	1520.0%	1	R.CVEILCTPPRVENGDGINVKPVYK.E
UCLH2_HUMAN57.0%7711.6%16401870295.8(P53675) Clathrin heavy chain 2 (CLH-22)
*	TK010303_lung_E18_mito_3_step04.4235.4235.3	1.7661	0.0963	3718.76	62	1290.0%	1	K.WVSVNTVALVTETAVYHWSMEGDSQPMKMFDR.H
*	TK010303_lung_E18_mito_3_step02.4392.4392.2	1.4867	0.0925	3005.91	2	2080.0%	1	K.YEEYDNAVLTMMSHPTEAWKEGQFK.D
*	TK010303_lung_E18_mito_3_step04.3119.3119.3	1.9789	0.225	3984.25	1	1840.0%	1	R.VMEYISRLDNYDALDIASIAVSSALYEEAFTVFHK.F
*	TK010303_lung_E18_mito_3_step11.1916.1916.2	2.1265	0.2032	2122.59	5	3120.0%	1	K.MFDRHTSLVGCQVIHYR.T
*	TK010303_lung_E18_mito_3_step04.2199.2199.3	1.4055	0.0462	4558.71	212	790.0%	1	K.LLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLR.E
*	TK010303_lung_E18_mito_3_step04.2521.2521.2	1.0762	0.0279	1721.35	119	3080.0%	1	K.GNNWWAQSVELCKK.D
*	TK010303_lung_E18_mito_3_step03.4219.4219.3	1.9994	0.083	3742.89	10	1410.0%	1	R.GYFEELILLLEAALGLERAHMGMFTELAILYSK.F
UQ9H99156.9%5117.5%835936716.9(Q9H991) Hypothetical protein FLJ12916
*	TK010303_lung_E18_mito_3_step11.1520.1520.3	1.7337	0.0301	4550.55	13	1030.0%	1	R.IPEENSIQLDGFTEAYESGQNQAYSLELFSPVCPKTENSR.I
*	TK010303_lung_E18_mito_3_step09.3795.3795.2	1.6042	0.0106	1732.09	1	4000.0%	3	K.VPLATVTVIDQSETKK.K
*	TK010303_lung_E18_mito_3_step11.2748.2748.3	2.2915	0.2333	4739.98	3	1160.0%	1	K.ASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLELFSPVCPK.T
UQ8R0E556.8%113.4%292345369.9(Q8R0E5) RIKEN cDNA 1700022C21 gene
*	TK010303_lung_E18_mito_3_step08.1996.1996.1	1.5476	0.1377	1216.68	2	5000.0%	1	R.RFLAVPPFLR.T
UQ8R2T756.8%113.6%591658017.4(Q8R2T7) Similar to oxysterol binding protein-like 10
*	TK010303_lung_E18_mito_3_step11.1417.1417.2	1.9832	0.264	2340.25	5	3000.0%	1	K.WTSPHPPISAHEHPMADDPSK.S
UQ1422156.7%7136.2%14101624965.6(Q14221) Endosome-associated protein
	TK010303_lung_E18_mito_3_step01.0927.0927.1	1.3883	0.0628	873.54	42	5830.0%	3	K.QLLIQQK.L
	TK010303_lung_E18_mito_3_step11.1947.1947.3	1.2554	0.0424	3428.68	121	1250.0%	1	K.SLGSADELFKHYEAVHDAGNDSGHGGESNLALK.R
	TK010303_lung_E18_mito_3_step08.3525.3525.2	1.2798	0.0466	2551.13	6	2050.0%	1	R.EDLYAKIQAGEGETAVLNQLQEK.N
	TK010303_lung_E18_mito_3_step04.3793.3793.2	1.1201	0.133	2171.86	25	2940.0%	1	K.QAQENLHDQVQEQKAHLR.A
	TK010303_lung_E18_mito_3_step03.1956.1956.3	1.9894	0.02	2505.81	4	2380.0%	1	K.NQSESHKQAQENLHDQVQEQK.A
UVGR2_HUMAN56.7%445.6%13561515265.9(P35968) Vascular endothelial growth factor receptor 2 precursor (EC 2.7.1.112) (VEGFR-2) (Kinase insert domain receptor) (Protein-tyrosine kinase receptor Flk-1)
*	TK010303_lung_E18_mito_3_step07.4353.4353.2	1.3157	5.0E-4	2288.28	31	2220.0%	1	R.GQRDLDWLWPNNQSGSEQR.V
*	TK010303_lung_E18_mito_3_step05.2794.2794.2	1.2596	0.0628	1974.54	3	3820.0%	1	K.DNETLVEDSGIVLKDGNR.N
*	TK010303_lung_E18_mito_3_step05.2392.2392.3	1.5051	0.1064	2973.33	16	1730.0%	1	R.IYDVVLSPSHGIELSVGEKLVLNCTAR.T
*	TK010303_lung_E18_mito_3_step11.1012.1012.1	1.6318	0.1058	1324.5	1	5450.0%	1	K.NGIPLESNHTIK.A
UQ9Z0T656.7%779.0%21262413888.9(Q9Z0T6) Polycystic kidney disease and receptor for egg jelly related protein
*	TK010303_lung_E18_mito_3_step07.2720.2720.3	1.8448	0.2412	3756.19	2	1610.0%	1	K.APISMMFCEFADDPFPWLTYPENISVDVVGFR.M
*	TK010303_lung_E18_mito_3_step11.4372.4372.3	1.7668	0.0427	4589.26	8	1090.0%	1	R.YYSGNYVLVINQAVCHPEQDSLNWPWAVGSVLTIPPKTLR.G
*	TK010303_lung_E18_mito_3_step05.2388.2388.3	1.4421	0.0862	3495.52	116	1170.0%	1	R.WGSGTRANVFIQLMGTEGTSDVHCLSHPYFK.T
*	TK010303_lung_E18_mito_3_step12.3340.3340.2	1.6705	0.3454	3089.47	2	1800.0%	1	K.MVQLYLADPEAFIPFHAVSRVDHFMR.I
*	TK010303_lung_E18_mito_3_step03.3609.3609.2	1.0654	0.069	3054.49	1	2000.0%	1	K.GFSLHIPKYALPYGVYVFNFTLSIFR.W
*	TK010303_lung_E18_mito_3_step03.3084.3084.2	1.4292	0.024	2629.46	1	2500.0%	1	K.NHMWISIFTEIVPKPFNRLQR.L
*	TK010303_lung_E18_mito_3_step12.1824.1824.3	1.2329	0.0703	1858.7	30	2330.0%	1	K.VIEITPDIAEVYLVRK.D
UTAU_HUMAN56.7%5520.7%757787466.7(P10636) Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)
*	TK010303_lung_E18_mito_3_step07.2637.2637.2	1.7796	0.272	2741.24	1	2500.0%	1	K.LPTPGSSDPLIQPSSPAVCPEPPSSPK.H
*	TK010303_lung_E18_mito_3_step02.1950.1950.3	1.5287	0.0124	4038.07	74	1090.0%	1	R.EATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGR.A
*	TK010303_lung_E18_mito_3_step03.3913.3913.3	1.8219	0.0034	4331.8	41	950.0%	1	K.ESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGK.Q
*	TK010303_lung_E18_mito_3_step08.3470.3470.2	1.2841	0.119	2621.58	2	2200.0%	1	R.EPGPPGLSHQLMSGMPGAPLLPEGPR.E
*	TK010303_lung_E18_mito_3_step02.3348.3348.2	1.3072	0.0494	2176.33	1	3250.0%	1	R.QPSGTGPEDTEGGRHAPELLK.H
UQ8WZ4256.7%91995.9%3435038161116.3(Q8WZ42) Titin
	TK010303_lung_E18_mito_3_step09.3326.3326.2	1.3465	0.1136	2291.19	51	1900.0%	1	R.VKAENEIGIGEPSLPSRPVVAK.D
	TK010303_lung_E18_mito_3_step04.3862.3862.3	1.5619	0.0272	2882.83	27	1770.0%	1	K.DDQILDEDDNVYISFVDSVATLQIR.S
	TK010303_lung_E18_mito_3_step11.3332.3332.2	1.139	0.0986	2851.35	30	1670.0%	1	K.DCIFVAWDRPDSDGGSPIIGYLIER.K
	TK010303_lung_E18_mito_3_step11.3504.3504.3	1.8623	0.0364	3618.89	5	1580.0%	1	K.KPHPIETLKGADVHLECELQGTPPFHVSWYK.D
	TK010303_lung_E18_mito_3_step01.1131.1131.3	1.5684	0.1928	2708.77	6	2080.0%	1	K.GSMLVSWTPPLDNGGSPITGYWLEK.R
	TK010303_lung_E18_mito_3_step05.3364.3364.2	1.2619	0.0531	2591.34	2	2140.0%	1	R.CVAFNEHGEIESNVNLQVDERK.K
	TK010303_lung_E18_mito_3_step02.3397.3397.2	1.6578	0.0904	2784.92	55	1400.0%	1	R.VEPPPKVPELPEKPAPEEVAPVPIPK.K
	TK010303_lung_E18_mito_3_step05.1906.1906.2	1.3051	0.0836	1483.6	1	4230.0%	1	K.IELPATVTGKPEPK.I
	TK010303_lung_E18_mito_3_step11.1057.1057.2	0.9979	0.0021	1113.7	356	3330.0%	1	K.DGTKHSMVIK.S
	TK010303_lung_E18_mito_3_step11.1303.1303.1	1.0555	0.0342	1149.59	250	3330.0%	1	R.KEEEVPPPPK.V
	TK010303_lung_E18_mito_3_step07.3700.3700.3	1.9489	0.0468	3669.04	17	1530.0%	1	K.VEKPLYGVEVFVGETAHFEIELSEPDVHGQWK.L
	TK010303_lung_E18_mito_3_step11.4095.4095.2	1.3527	0.0267	3158.2	4	1720.0%	1	R.ATGLVEGLDYQFRVYAENSAGLSSPSDPSK.F
	TK010303_lung_E18_mito_3_step07.3645.3645.2	1.1877	0.1062	3034.78	1	2140.0%	1	R.VYAENAAGVGKPSHPSEPVLAIDACEPPR.N
	TK010303_lung_E18_mito_3_step08.3996.3996.2	1.233	0.0070	2815.56	19	1540.0%	1	R.AELIQVTAGDPATLEYTVAGTPELKPK.W
	TK010303_lung_E18_mito_3_step05.3320.3320.2	1.6236	0.2666	2193.95	21	2500.0%	1	K.HYPKDILIPPEGELDADLR.K
	TK010303_lung_E18_mito_3_step03.4029.4029.3	1.6358	0.0627	3911.78	54	1120.0%	1	R.AMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDK.T
	TK010303_lung_E18_mito_3_step01.1540.1540.3	1.7738	0.0672	2933.92	1	2410.0%	1	K.SFPVNVKVLDRPGPPEGPVQVTGVTSEK.C
	TK010303_lung_E18_mito_3_step03.3756.3756.3	1.9063	0.1651	4348.34	8	1250.0%	1	K.LIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGK.W
	TK010303_lung_E18_mito_3_step06.4219.4219.3	1.7618	0.0526	4240.42	2	1320.0%	1	K.SVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSR.E
	TK010303_lung_E18_mito_3_step05.4232.4232.2	1.2914	0.2138	2526.03	1	2270.0%	1	K.STEPILIKDPIDPPWPPGKPTVK.D
	TK010303_lung_E18_mito_3_step10.2746.2746.3	1.831	0.0463	3415.88	2	1670.0%	1	R.AMFECEVSEPDITVQWMKDDQELQITDR.I
	TK010303_lung_E18_mito_3_step10.3337.3337.3	1.8292	0.1004	3025.85	12	1640.0%	1	R.VMAENEFGVGVPVETVDAVKAAEPPSPPGK.V
	TK010303_lung_E18_mito_3_step05.3484.3484.3	1.9189	0.0908	3271.93	11	1480.0%	2	K.EYDVMLLAEVAGTPPFEITWFKDNTILR.S
	TK010303_lung_E18_mito_3_step04.2209.2209.3	1.8153	0.0781	3848.85	46	1250.0%	1	K.IQWFFNGVLLTPSADYKFVFDGDDHSLIILFTK.L
	TK010303_lung_E18_mito_3_step02.2384.2384.1	1.213	0.0207	1445.15	6	4090.0%	1	K.FHKVTNDNLLSR.K
	TK010303_lung_E18_mito_3_step07.4166.4166.2	1.2836	0.1817	3022.74	1	2400.0%	1	R.NSMTVNWEEPEYDGGSPVTGYWLEMK.D
	TK010303_lung_E18_mito_3_step12.4163.4163.2	1.2869	0.0116	2863.53	101	1460.0%	1	K.ESMTLCWSRPESDGGSEISGYIIER.R
	TK010303_lung_E18_mito_3_step08.1836.1836.1	1.1261	0.0015	1045.47	58	5710.0%	1	K.DAKMHTWR.Q
	TK010303_lung_E18_mito_3_step04.3227.3227.3	1.8418	0.0623	3994.18	27	1220.0%	1	R.NAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVK.Y
	TK010303_lung_E18_mito_3_step09.2094.2094.3	2.1049	0.2014	2851.71	1	2190.0%	1	K.DSALVTWNKPHDGGKPITNYILEKR.E
	TK010303_lung_E18_mito_3_step09.3395.3395.2	1.6331	0.0566	2680.1	44	1600.0%	1	K.NVTGTTSETIKVIILDKPGPPTGPIK.I
	TK010303_lung_E18_mito_3_step11.3707.3707.2	1.8223	0.2014	3096.6	1	2240.0%	1	K.AGVSDPSEILGPLTADDAFVEPTMDLSAFK.D
	TK010303_lung_E18_mito_3_step12.1079.1079.1	0.986	0.0025	1176.27	113	4000.0%	1	R.FGISEPLTSPK.M
	TK010303_lung_E18_mito_3_step12.1485.1485.2	1.6334	0.2494	1637.5	1	4230.0%	1	K.TTLEELLEEDGEEK.M
	TK010303_lung_E18_mito_3_step10.2991.2991.2	1.4542	0.0217	3012.84	62	1730.0%	1	K.ADSVILSWDVPEDNGGGEITCYSIEKR.E
	TK010303_lung_E18_mito_3_step03.2908.2908.2	1.5963	0.1131	2914.07	4	1800.0%	1	K.DSMTISWHEPLSDGGSPILGYHVERK.E
	TK010303_lung_E18_mito_3_step10.2342.2342.2	1.1305	0.0381	2512.8	2	1820.0%	2	K.ANELSSQLPLGAQELQSILEQDK.L
	TK010303_lung_E18_mito_3_step08.1561.1561.3	1.9661	0.2102	2643.13	70	1560.0%	1	K.AVSPTETKPTPTEKVQHLPVSAPPK.I
	TK010303_lung_E18_mito_3_step03.2491.2491.3	1.741	0.095	4209.87	20	1180.0%	1	K.HSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWK.R
	TK010303_lung_E18_mito_3_step08.3832.3832.3	1.8768	0.0325	4051.87	39	1040.0%	1	K.CTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAK.D
	TK010303_lung_E18_mito_3_step04.2679.2679.2	1.3479	0.157	2282.02	2	2620.0%	1	K.MSFSNGVAVLIIPDVQISFGGK.Y
	TK010303_lung_E18_mito_3_step04.4265.4265.3	1.4943	0.1715	3460.86	36	1170.0%	2	K.EDAGNYSFTIPALGLSTSGRVSVYSVDVITPLK.D
	TK010303_lung_E18_mito_3_step10.3790.3790.3	1.5827	0.0711	3793.35	1	1570.0%	1	K.EDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIR.I
	TK010303_lung_E18_mito_3_step01.2946.2946.1	1.2917	0.0406	1386.84	3	4580.0%	1	R.DEIDAPNASLDPK.Y
	TK010303_lung_E18_mito_3_step12.1076.1076.1	1.1196	0.0356	1110.52	38	4380.0%	1	K.MPVKDTTYR.V
	TK010303_lung_E18_mito_3_step12.4245.4245.2	1.2155	0.0415	2659.63	45	1840.0%	1	K.KEVHEEWEEDFEEGQEYYER.E
	TK010303_lung_E18_mito_3_step10.2377.2377.3	1.8066	0.0079	2606.83	10	1740.0%	1	R.AVLTVQEPPSFVKEPEPLEVLPGK.N
	TK010303_lung_E18_mito_3_step05.3793.3793.2	1.3155	0.0887	2792.05	3	1740.0%	1	K.MELRDALCAIIYEEIDILTAEGPR.I
	TK010303_lung_E18_mito_3_step10.2697.2697.2	1.3757	0.0107	2000.3	23	2810.0%	1	K.IQWFFNGVLLTPSADYK.F
	TK010303_lung_E18_mito_3_step05.4068.4068.3	2.0491	0.0586	4499.01	16	1280.0%	1	R.IVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVK.V
*	TK010303_lung_E18_mito_3_step07.4122.4122.2	1.3307	0.0056	1990.28	146	2190.0%	1	K.EGQTCTMTCQFSVPNVK.S
	TK010303_lung_E18_mito_3_step07.4342.4342.3	1.7243	0.0287	3721.87	1	1570.0%	1	R.VSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFK.D
	TK010303_lung_E18_mito_3_step05.2757.2757.2	1.4189	0.1247	2502.88	2	2390.0%	1	R.VSAVNIAGIGEPGEVTDVIEMKDR.L
	TK010303_lung_E18_mito_3_step12.3541.3541.2	1.308	0.0213	2582.37	129	1520.0%	1	K.GQVDLVDTMAFLVIPNSTRDDSGK.Y
	TK010303_lung_E18_mito_3_step07.2922.2922.2	1.4385	0.2547	2208.06	9	2140.0%	1	K.VTVLDVPGPPGPVEISNVSAEK.A
	TK010303_lung_E18_mito_3_step01.0535.0535.2	1.0117	0.0152	1958.03	230	1760.0%	1	K.MAVDISESEAVESGFDLR.I
	TK010303_lung_E18_mito_3_step09.3042.3042.2	1.1563	0.0032	2804.5	105	1250.0%	1	K.VTTGDTCTLECTVAGTPELSTKWFK.D
	TK010303_lung_E18_mito_3_step10.3451.3451.2	1.1805	0.1151	2836.29	29	1520.0%	1	K.VMDFVTDLEFTVPDLVQGKEYLFK.V
	TK010303_lung_E18_mito_3_step02.2465.2465.2	1.2922	0.1369	3184.48	2	1730.0%	1	K.NIEVPETKTASFECEVSHFNVPSMWLK.N
	TK010303_lung_E18_mito_3_step01.4394.4394.3	1.4384	0.0417	3391.13	38	1290.0%	1	R.VAAENMYGVGEPVQASPITAKYQFDPPGPPTR.L
	TK010303_lung_E18_mito_3_step12.1176.1176.2	1.0389	0.0284	2282.09	349	2000.0%	1	R.ICAENKYGVGDPVFTEPAIAK.N
	TK010303_lung_E18_mito_3_step06.3915.3915.2	1.3332	0.0201	3080.41	133	1150.0%	1	K.MDSIKGSFIDLECIVAGSHPISIQWFK.D
	TK010303_lung_E18_mito_3_step09.3664.3664.2	1.0714	0.0783	2061.96	9	2500.0%	1	R.QIFKVNDLAEGVPYYFR.V
	TK010303_lung_E18_mito_3_step11.1831.1831.1	1.0987	0.0415	1294.39	50	4000.0%	1	K.GVPFPTLTWFK.A
	TK010303_lung_E18_mito_3_step07.2598.2598.2	2.1113	0.1818	1912.06	1	4060.0%	1	R.ARTEIISTDNHTLLTVK.D
	TK010303_lung_E18_mito_3_step04.4410.4410.2	1.6338	0.0659	2555.69	1	2620.0%	1	K.NAEVSLECELSGTPPFEVVWYK.D
	TK010303_lung_E18_mito_3_step01.4095.4095.3	1.8257	0.0144	4163.55	8	1430.0%	1	K.QLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICK.A
	TK010303_lung_E18_mito_3_step06.3865.3865.2	1.1402	0.0312	2779.47	10	1670.0%	1	K.KHILILHNCQLGMTGEVSFQAANAK.S
	TK010303_lung_E18_mito_3_step03.4443.4443.2	1.0055	0.0166	2396.23	9	2500.0%	1	K.EAIKPKEILEPPEIDLDASMR.K
	TK010303_lung_E18_mito_3_step01.3248.3248.1	1.2209	0.0171	1405.98	44	3330.0%	1	K.AVPEEKVPVPIPK.K
	TK010303_lung_E18_mito_3_step06.4354.4354.2	1.2256	0.0966	2665.85	5	2080.0%	1	K.AGKDIRPSDITQITSTPTSSMLTIK.Y
	TK010303_lung_E18_mito_3_step11.3976.3976.3	2.019	0.0429	3917.76	25	1290.0%	1	K.AFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPK.Y
	TK010303_lung_E18_mito_3_step12.1175.1175.1	1.5111	0.1493	1021.49	2	5000.0%	1	K.EEEVPPPPK.V
	TK010303_lung_E18_mito_3_step02.3658.3658.3	1.6758	0.0214	3748.56	5	1480.0%	1	K.IDQLQEGCSYYFRVTAENEYGIGLPAQTADPIK.V
	TK010303_lung_E18_mito_3_step03.2953.2953.3	1.9722	0.1367	4079.11	1	1550.0%	1	K.APPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVK.D
	TK010303_lung_E18_mito_3_step05.4077.4077.2	1.7886	0.1399	2575.28	6	1960.0%	2	R.VSVESSAVNTTLIVYDCQKSDAGK.Y
	TK010303_lung_E18_mito_3_step09.2754.2754.3	1.7451	0.0602	3968.22	28	1180.0%	1	K.VTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIK.S
	TK010303_lung_E18_mito_3_step10.3259.3259.3	1.8281	0.1259	3881.78	22	1210.0%	1	K.FYSAELHDSGQYTFEISNEVGSSSCETTFTVLDR.D
	TK010303_lung_E18_mito_3_step06.4003.4003.3	2.0127	0.0144	3792.07	6	1590.0%	1	K.DDQILDEDDNVYISFVDSVATLQIRSVDNGHSGR.Y
	TK010303_lung_E18_mito_3_step04.2639.2639.3	1.4006	0.0325	3911.26	10	1360.0%	1	K.VEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLK.G
	TK010303_lung_E18_mito_3_step09.2814.2814.2	1.1448	0.0117	2472.91	2	2860.0%	1	R.EIKPSDRCSFSFASGTAVLELR.D
	TK010303_lung_E18_mito_3_step08.4010.4010.3	1.9567	0.097	4426.08	2	1140.0%	1	R.VSAVNAAGEGPPGETQPVTVAEPQEPPAVELDVSVKGGIQIMAGK.T
	TK010303_lung_E18_mito_3_step02.2985.2985.3	1.8985	0.0852	3805.78	12	1390.0%	1	K.DDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVR.F
	TK010303_lung_E18_mito_3_step01.1554.1554.1	1.1744	0.0176	860.68	68	5830.0%	1	K.EQALIRK.K
	TK010303_lung_E18_mito_3_step10.3838.3838.2	1.64	0.0624	3159.12	5	1550.0%	1	K.VDDLIALGGQTVTLQAAVRGSEPISVTWMK.G
UMCCB_HUMAN56.6%4414.0%563613337.7(Q9HCC0) Methylcrotonyl-CoA carboxylase beta chain, mitochondrial precursor (EC 6.4.1.4) (3-Methylcrotonyl-CoA carboxylase 2) (MCCase beta subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase beta subunit)
*	TK010303_lung_E18_mito_3_step06.3959.3959.2	1.6495	0.2402	3093.9	9	1550.0%	1	K.NIAQIAVVMGSCTAGGAYVPAMADENIIVR.K
*	TK010303_lung_E18_mito_3_step11.0999.0999.1	1.6186	0.1017	1343.56	5	4580.0%	1	K.QGTIFLAGPPLVK.A
*	TK010303_lung_E18_mito_3_step10.3710.3710.2	1.6036	0.0686	2835.74	2	2080.0%	1	R.AQEIAMQNRLPCIYLVDSGGAYLPR.Q
*	TK010303_lung_E18_mito_3_step12.3809.3809.3	2.0166	0.0946	4365.36	4	1120.0%	1	R.TFYNQAIMSSKNIAQIAVVMGSCTAGGAYVPAMADENIIVR.K
UABF1_MOUSE56.6%885.9%37264065736.2(Q61329) Alpha-fetoprotein enhancer binding protein (AT motif-binding factor) (AT-binding transcription factor 1)
*	TK010303_lung_E18_mito_3_step07.4000.4000.2	1.4042	0.1749	2611.01	167	1250.0%	1	K.NILPPASMEHGGDLKPTSADPSCGR.E
	TK010303_lung_E18_mito_3_step08.4322.4322.3	2.0678	0.0197	3729.31	190	1070.0%	1	K.GDIFDGTSFSHLPPSSSDGQGVPLSPVSKTMELSPR.T
*	TK010303_lung_E18_mito_3_step05.4090.4090.2	1.3459	0.1296	1989.39	1	3240.0%	1	R.ELSPLLPKPPEEPEAESK.S
	TK010303_lung_E18_mito_3_step11.2263.2263.2	1.9977	0.2609	2151.91	2	3060.0%	1	K.HPEPGGSCVYCKSGQPHPR.L
*	TK010303_lung_E18_mito_3_step12.3252.3252.3	1.6662	0.06	4193.46	4	1280.0%	1	K.MDSTASDAQFMMSGFQLDPTGPMAAMTPALVGGEIPLDMR.L
	TK010303_lung_E18_mito_3_step04.3707.3707.3	1.8689	0.0405	3590.24	7	1610.0%	1	K.LYKHLQQHESGVEGESCYYHCVLCNYSTK.A
*	TK010303_lung_E18_mito_3_step01.2680.2680.2	1.0943	0.0698	2747.56	125	1200.0%	1	K.QGDPSCAAPVYPQIINTSHIASSFGK.W
	TK010303_lung_E18_mito_3_step01.3356.3356.2	1.6442	0.12	3068.96	114	1400.0%	1	K.CNTCNVAYSQSSTLEIHMRSVLHQTK.A
UMY9B_MOUSE56.5%11258.3%21142388328.6(Q9QY06) Myosin IXb (Unconventional myosin-9b)
	TK010303_lung_E18_mito_3_step10.3038.3038.2	1.9949	0.259	2561.41	5	2380.0%	4	K.NMDYMRPDIVALLRGSDSSYVR.Q
*	TK010303_lung_E18_mito_3_step07.4240.4240.2	1.3321	0.0587	2711.59	7	2000.0%	1	K.SPRTPVVQDLELGALSEEAAGGDEDR.E
*	TK010303_lung_E18_mito_3_step10.4455.4455.2	1.1328	0.049	1946.24	32	2350.0%	1	K.TSAEIDGDFSSKKPSIHK.K
*	TK010303_lung_E18_mito_3_step10.4262.4262.3	1.8057	0.0572	4333.54	21	1040.0%	1	R.EAAGGKLSEGEPGPVAAGEQLSEHPVEDPESLGVEAETWMNK.S
*	TK010303_lung_E18_mito_3_step10.4399.4399.3	1.9583	0.0525	4468.41	23	1070.0%	1	R.EDGLEAWTETTAPSSSKQAQVVGDPPGSPSPVQRPTTLALDSR.V
*	TK010303_lung_E18_mito_3_step02.4036.4036.2	1.6325	0.124	2735.92	9	1740.0%	2	K.ESGGEEWVLDASDSPVHRVLLWPR.R
UQ8VIM656.5%447.4%18091964035.4(Q8VIM6) Stereocilin
*	TK010303_lung_E18_mito_3_step01.3123.3123.2	1.5356	0.0832	2936.68	7	1670.0%	1	R.TVGEYLQREEPTPPGLDSSLSLGSGMSK.M
*	TK010303_lung_E18_mito_3_step01.3262.3262.2	1.7922	0.0489	2670.64	5	2400.0%	1	K.AALVAGIVHPAAEGLQEPVPNCADIR.G
*	TK010303_lung_E18_mito_3_step09.4270.4270.3	1.88	0.0956	4282.54	83	990.0%	1	R.LTSQLFIDMSPLIPFLAVPDLMRFPPSLLANDSVLAAIR.D
*	TK010303_lung_E18_mito_3_step08.2922.2922.3	2.545	0.3195	4576.92	3	1410.0%	1	R.VGPCGERCPDGGSFLLMVCANDTLYEALVPFWAWLAGQCR.I
UCBX2_MOUSE56.5%117.5%519548909.9(P30658) Chromobox protein homolog 2 (Modifier 3 protein) (M33)
*	TK010303_lung_E18_mito_3_step08.4181.4181.3	2.5642	0.3098	3913.1	4	1380.0%	1	R.GNHSGSPGAQLAPTQELSLQVLDLQSVKNGVPGVGLLAR.H
UQ9BZF956.4%576.1%14161625797.3(Q9BZF9) Uveal autoantigen
*	TK010303_lung_E18_mito_3_step07.1698.1698.1	1.8067	0.1346	1248.73	7	5000.0%	2	K.ELDTIQECIK.V
*	TK010303_lung_E18_mito_3_step07.1522.1522.2	1.1512	0.0748	1670.54	15	3850.0%	1	K.LAQHVKPEEHEQVK.S
*	TK010303_lung_E18_mito_3_step05.2804.2804.3	1.8686	0.1867	4189.72	3	1500.0%	1	R.QHQEVIAIYRTHLLSAAQGHMDEDVQEALLQIIQMR.Q
*	TK010303_lung_E18_mito_3_step11.1277.1277.2	1.4688	0.0296	3083.68	16	1350.0%	1	R.ILLDKVNGLQLQLNEEVMVADDLESER.E
UQ9997456.3%222.9%802922518.2(Q99974) POMBE CDC5-related protein (KIAA0432) (CDC5 (Cell division cycle 5, S. POMBE, homolog)-like)
*	TK010303_lung_E18_mito_3_step11.2380.2380.1	1.5067	0.0843	1515.85	42	4170.0%	1	K.NDFEIVLPENAEK.E
*	TK010303_lung_E18_mito_3_step01.0831.0831.1	1.4838	0.1564	979.59	1	6670.0%	1	R.LGLLGLPAPK.N
UQ9CXG256.1%115.2%194218037.8(Q9CXG2) 3732413A17Rik protein
	TK010303_lung_E18_mito_3_step01.1114.1114.1	1.533	0.1286	1261.46	2	5000.0%	1	K.TVQYQNELHK.F
UOSTC_HUMAN56.1%3532.0%100109637.1(P02818) Osteocalcin precursor (Gamma-carboxyglutamic acid-containing protein) (Bone Gla-protein) (BGP)
*	TK010303_lung_E18_mito_3_step11.3392.3392.2	2.0501	0.2427	3153.56	3	1770.0%	2	-.MRALTLLALLALAALCIAGQAGAKPSGAESSK.G
*	TK010303_lung_E18_mito_3_step09.2460.2460.3	1.8369	0.1837	2869.62	1	1980.0%	1	R.ALTLLALLALAALCIAGQAGAKPSGAESSK.G
USP24_HUMAN56.1%1116.1%211243388.3(Q13103) Secreted phosphoprotein 24 precursor (SPP-24)
*	TK010303_lung_E18_mito_3_step05.3080.3080.3	2.5042	0.3396	4059.57	1	1590.0%	1	K.MTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLR.D
UO3559656.1%469.5%10021133778.2(O35596) Transcription factor
	TK010303_lung_E18_mito_3_step09.4186.4186.3	2.1774	0.0687	3680.97	3	1560.0%	1	R.NDLYYNTITNFSVKERPENVHGGILADDMGLGK.T
	TK010303_lung_E18_mito_3_step07.3856.3856.2	1.6333	0.0774	2723.45	34	1670.0%	2	K.AAIGRYFTEGTVLAHYADVLGLLLR.L
	TK010303_lung_E18_mito_3_step12.3411.3411.3	1.8585	0.1599	4368.18	95	970.0%	1	R.LSYSTFLPHFEFQDIIPPDDFLTSDEEQDLVLFGTMR.G
UP9785856.0%3523.9%322358839.4(P97858) UGTREL1 (Solute carrier family 35 (UDP-galactose transporter), member 2)
*	TK010303_lung_E18_mito_3_step09.2550.2550.3	1.9132	0.1861	4765.76	3	1100.0%	2	R.YPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRK.F
*	TK010303_lung_E18_mito_3_step07.3126.3126.3	1.846	0.022	3799.5	3	1620.0%	1	K.KVVGIEEHTVGFGELLLLMSLTLDGLTGVSQDHMR.A
UQ9H70356.0%3312.7%526603826.2(Q9H703) Hypothetical protein FLJ21613
*	TK010303_lung_E18_mito_3_step07.1776.1776.1	1.0103	0.0724	738.24	23	6000.0%	1	R.YAKIIK.R
*	TK010303_lung_E18_mito_3_step05.4260.4260.3	2.6477	0.2496	4014.47	2	1560.0%	1	R.IKTVCEVVNLTNLHCILDFFCEFSEQSPCVLSR.S
*	TK010303_lung_E18_mito_3_step08.2025.2025.3	1.2937	0.012	3137.18	45	1570.0%	1	K.LGHILEEFATLQDEAEKVDAALHTMLLK.Q
UCGBP_MOUSE55.8%111.7%660761678.3(Q9CWW7) CpG binding protein (Protein containing PHD finger and CXXC domain 1)
	TK010303_lung_E18_mito_3_step06.2042.2042.1	1.7846	0.0661	1396.65	1	5000.0%	1	K.RLQVLCPEHSR.D
UCOMP_HUMAN55.8%228.5%757828324.6(P49747) Cartilage oligomeric matrix protein precursor (COMP)
*	TK010303_lung_E18_mito_3_step01.4062.4062.3	1.5872	0.2464	4745.98	1	1460.0%	1	K.IDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGR.E
*	TK010303_lung_E18_mito_3_step05.3022.3022.2	1.9286	0.2657	2618.81	2	2380.0%	1	R.EITFLKNTVMECDACGMQQSVR.T
UO7511855.8%559.8%12891416039.3(O75118) Hypothetical protein KIAA0622 (Fragment)
*	TK010303_lung_E18_mito_3_step04.2103.2103.3	1.9098	0.1093	2810.93	6	2080.0%	1	R.SLLLAGAAEYDNFFQHLRLLDGAFK.L
*	TK010303_lung_E18_mito_3_step07.3690.3690.3	2.6433	0.2278	3640.55	4	1610.0%	1	R.SYSPSMLDYDTENLNSEEIYSSLRGVTEAIEK.F
*	TK010303_lung_E18_mito_3_step04.2154.2154.2	2.0932	0.2359	1757.96	4	3440.0%	1	R.FGLGQPGRIPGSVNAMR.V
*	TK010303_lung_E18_mito_3_step08.1568.1568.2	1.2096	0.0871	3183.83	3	1430.0%	1	R.IAKESLLQLLVDIIPGLLQGYDNTESSVR.K
*	TK010303_lung_E18_mito_3_step11.3749.3749.2	1.9857	0.2945	2622.11	77	1820.0%	1	R.YEPYGMYSDDDANSDASSVCSER.S
ULGMN_MOUSE55.7%4617.5%435493736.4(O89017) Legumain precursor (EC 3.4.22.34) (Asparaginyl endopeptidase) (Protease, cysteine 1)
*	TK010303_lung_E18_mito_3_step03.4012.4012.2	1.5041	0.2071	2725.73	8	2270.0%	2	R.GTYLGDWYSVNWMEDSDVEDLTK.E
*	TK010303_lung_E18_mito_3_step08.2358.2358.3	1.3315	0.0059	4121.64	70	1250.0%	1	R.TMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALR.Y
*	TK010303_lung_E18_mito_3_step07.1732.1732.3	1.531	0.0901	2255.18	6	2240.0%	1	K.SHTNTSHVMQYGNKSISTMK.V
UQ1344355.7%355.5%819905567.5(Q13443) Cellular disintegrin-related protein precursor (EC 3.4.24.-) (Metalloprotease/disintegrin/cysteine-rich protein 9) (MDC9) (MYELOMA cell metalloproteinase) (MCMP)
*	TK010303_lung_E18_mito_3_step03.3541.3541.3	2.4552	0.239	3879.21	2	1470.0%	1	R.WLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWR.L
*	TK010303_lung_E18_mito_3_step09.1888.1888.1	1.608	0.0969	1291.92	1	6110.0%	2	K.EHIIHLERNK.D
UQ9JKZ955.6%1116.3%98107209.5(Q9JKZ9) Acupuncture induced gene 1
*	TK010303_lung_E18_mito_3_step02.2073.2073.2	2.1603	0.1812	1915.42	2	4000.0%	1	K.NEMKSFSTLYILLLIK.Q
UQ8TEY755.6%223.4%9421067536.0(Q8TEY7) PVHL-interacting deubiquitinating enzyme 1 type I
	TK010303_lung_E18_mito_3_step03.4528.4528.2	1.6859	0.3294	2774.69	5	1670.0%	1	K.FKTFAEPGPISNNDFLCIHGGVPPR.K
	TK010303_lung_E18_mito_3_step01.0094.0094.1	1.2572	0.0085	691.69	161	5000.0%	1	K.AQSASPK.R
UQ9H0R555.6%336.0%563641275.6(Q9H0R5) Hypothetical protein
	TK010303_lung_E18_mito_3_step11.3396.3396.3	2.8366	0.0783	2979.16	4	2100.0%	1	K.QNQEASSDRCSALLQVIFSPLEEEVK.A
	TK010303_lung_E18_mito_3_step07.1782.1782.1	1.6465	0.0478	1089.41	3	5710.0%	1	K.YQQMMEEK.E
UCIK4_MOUSE55.6%228.7%654734745.3(Q61423) Voltage-gated potassium channel protein Kv1.4
*	TK010303_lung_E18_mito_3_step03.3271.3271.2	1.9365	0.0713	2790.78	2	2000.0%	1	R.AAAAAAVAAATAAVEGTGGSGGGPHHHHQTR.G
	TK010303_lung_E18_mito_3_step06.3479.3479.3	2.8495	0.0277	3009.8	7	2000.0%	1	R.ETENEEQTQLTQNAVSCPYLPSNLLK.K
UAF6_HUMAN55.6%333.9%18162056046.8(P55196) AF-6 protein
	TK010303_lung_E18_mito_3_step01.0499.0499.2	1.0902	0.0497	1662.1	12	2670.0%	1	K.ERADGSGYGSTLPPEK.L
	TK010303_lung_E18_mito_3_step11.2024.2024.1	1.6304	0.0998	1577.21	5	4170.0%	1	R.EYFTFPASKSQDR.M
	TK010303_lung_E18_mito_3_step06.4177.4177.3	1.8474	0.1861	4546.71	19	1100.0%	1	K.SAYASGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTR.E
UQ920I555.6%1113.8%239276547.3(Q920I5) F-LANa
*	TK010303_lung_E18_mito_3_step12.2991.2991.3	2.4687	0.4145	3650.07	1	1640.0%	1	R.TIFDTPDEDPNYNPLPEERPGAFAWGEGQRLGG.-
UQ9NPB855.3%223.5%677766345.7(Q9NPB8) Hypothetical protein KIAA1434 (DJ1022P6.2) (Fragment)
*	TK010303_lung_E18_mito_3_step08.2388.2388.2	1.3911	0.0153	1825.39	55	3000.0%	1	K.MSNSLEISLISDNEFK.C
*	TK010303_lung_E18_mito_3_step12.3509.3509.2	1.8706	0.2593	2692.57	2	2170.0%	1	R.VSPTVLHKMSNSLEISLISDNEFK.C
UO7047155.1%4614.2%612654205.2(O70471) Channel interacting PDZ domain protein
	TK010303_lung_E18_mito_3_step07.1633.1633.2	1.6741	0.2477	2145.78	7	2500.0%	2	R.SRMSIFVVGINPEGPAAADGR.M
*	TK010303_lung_E18_mito_3_step09.2503.2503.3	1.9941	0.0435	3797.57	117	1030.0%	1	K.TSQNSQGDQHSAHSSCRPSFAPVITSLQNLVGTKR.S
*	TK010303_lung_E18_mito_3_step08.3045.3045.2	1.7225	0.1959	3138.61	6	1670.0%	1	R.SGLGLSIVGGKDTPLDAIVIHEVYEEGAAAR.D
UQ96BZ455.1%118.2%489537458.0(Q96BZ4) Hypothetical protein
*	TK010303_lung_E18_mito_3_step10.3547.3547.3	2.6857	0.2217	4368.96	2	1410.0%	1	R.EAGTLQVLGALAVLWLGSVALICLLWQVPRPPTWGQVQPK.D
UQ922W255.0%4425.2%416475106.1(Q922W2) Unknown (Protein for MGC:7055)
	TK010303_lung_E18_mito_3_step01.3984.3984.2	1.7557	0.2746	2876.22	4	1880.0%	1	K.QLGAHSPSTLLTTLMFFNTKYFLLK.T
	TK010303_lung_E18_mito_3_step05.2934.2934.3	1.3878	0.0348	3414.13	243	1300.0%	1	R.NGEGEPYDPDVLYYIFLCIQKYLFENGR.V
	TK010303_lung_E18_mito_3_step12.2836.2836.2	1.3273	0.0637	3041.17	33	1400.0%	1	R.QLLRFQEDLISSAVAELNYGLCLMTR.E
	TK010303_lung_E18_mito_3_step04.2279.2279.3	1.6821	0.0356	3086.21	185	1400.0%	1	K.DVQPRVTPLGYVLPSHVTEEMLWECK.Q
UQ9Y6X755.0%7914.2%12181369615.2(Q9Y6X7) Hypothetical protein KIAA0864 (Fragment)
*	TK010303_lung_E18_mito_3_step10.3686.3686.3	1.5713	0.0736	3665.33	24	1250.0%	1	R.SPSEESMSSEPAPSVLPATGDSDTYLSIIHSLETK.L
*	TK010303_lung_E18_mito_3_step03.2393.2393.3	1.9083	0.0445	3572.89	52	1290.0%	2	R.KHLGTLGGEAVGASGDGQQSIPQGLAPILANATWVR.A
*	TK010303_lung_E18_mito_3_step11.3407.3407.3	2.097	0.094	4734.41	21	1040.0%	1	K.LLQVSQSLSYNTCLGGLGQYSSLLVQDAIIQAQVCYASCRIR.L
*	TK010303_lung_E18_mito_3_step01.0836.0836.1	1.3039	0.1029	1041.53	68	5000.0%	1	R.FSTIQCQR.Y
*	TK010303_lung_E18_mito_3_step03.2409.2409.2	1.7164	0.284	3089.69	5	1790.0%	1	R.LLSDQIALEASLISQIADSLKNTTSDVSR.M
*	TK010303_lung_E18_mito_3_step11.2860.2860.2	1.5063	0.1248	2598.96	33	2050.0%	1	R.YIHPEGSEKTWTSSTSSDTSQDR.S
UQ9ER9755.0%1112.6%151170375.9(Q9ER97) Neuroglobin
	TK010303_lung_E18_mito_3_step03.3249.3249.2	1.7312	0.2787	2265.12	4	2780.0%	1	R.QFSSPEDCLSSPEFLDHIR.K
UFOLC_MOUSE55.0%6626.4%587649078.3(P48760) Folylpolyglutamate synthase, mitochondrial precursor (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (FPGS)
*	TK010303_lung_E18_mito_3_step11.3383.3383.3	1.8002	0.1806	4714.58	22	970.0%	1	K.VDLAVVEVGIGGAFDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEK.I
*	TK010303_lung_E18_mito_3_step12.3561.3561.2	1.7298	0.2775	2615.64	3	1880.0%	1	R.TDGGSEVHILLFNSTGDRDSAALLK.L
*	TK010303_lung_E18_mito_3_step02.2044.2044.3	1.5701	0.0562	3089.68	3	2000.0%	1	R.SNAALALQLAHCWLERQDHQDIQELK.V
*	TK010303_lung_E18_mito_3_step12.4184.4184.3	1.6455	0.0756	4003.43	48	1210.0%	1	R.DRAQQIGCPLYLCPPLEALEEVGLPLSLGLEGAHQR.S
*	TK010303_lung_E18_mito_3_step06.3013.3013.3	1.7728	0.0037	2743.4	136	1480.0%	1	K.VSRPSIRWQLPLAPVFRPTPHMR.R
UQ9UFX955.0%223.7%867967087.4(Q9UFX9) Hypothetical protein (Fragment)
*	TK010303_lung_E18_mito_3_step04.3439.3439.2	1.7325	0.2777	3059.02	2	1730.0%	1	K.MTFHIHAVNNQGRIVPLDSEDSLSFVK.T
*	TK010303_lung_E18_mito_3_step01.1343.1343.1	1.0697	0.0114	651.51	13	7500.0%	1	R.FLFPK.C
UQ91ZS255.0%131511.9%27803028774.6(Q91ZS2) MASS1
	TK010303_lung_E18_mito_3_step06.3782.3782.2	1.5143	0.0224	2399.12	6	2750.0%	1	K.SFIVAARDDSEEEGEELFLLK.L
	TK010303_lung_E18_mito_3_step01.3664.3664.3	1.412	0.0203	4592.6	51	880.0%	1	R.GALGYVHVFYTISQIESEGINYLVDDFANASGTITFLPWQR.S
	TK010303_lung_E18_mito_3_step01.3984.3984.3	2.035	0.2719	4313.82	1	1490.0%	1	R.TRGNFGAVNVSWMVSPDFTQDVFPVQGTVCFGDQEFFK.N
	TK010303_lung_E18_mito_3_step03.3796.3796.3	2.2742	0.0014	3706.08	96	1060.0%	1	R.IQKSDNANGLFGFTGACIPEMTEEGSTVSCVVER.T
*	TK010303_lung_E18_mito_3_step07.1526.1526.3	2.2676	0.1444	2074.64	3	2650.0%	1	R.LGMGLSFMNLLTNCESQR.T
	TK010303_lung_E18_mito_3_step03.3060.3060.3	1.5132	0.0284	4296.66	54	940.0%	1	K.VETVAHLVIVANDDAFGTVQLSATSVHVAENHVGPIINVTR.T
	TK010303_lung_E18_mito_3_step12.3319.3319.3	1.7448	0.1366	4690.85	7	1140.0%	1	R.LGPKVETVAHLVIVANDDAFGTVQLSATSVHVAENHVGPIINVTR.T
	TK010303_lung_E18_mito_3_step02.2400.2400.3	1.4097	0.0515	3591.4	6	1720.0%	1	K.SDNANGLFGFTGACIPEMTEEGSTVSCVVERTR.G
	TK010303_lung_E18_mito_3_step03.2753.2753.2	1.4485	0.0529	3130.38	9	1480.0%	2	R.HHSGTDVLYFSGLEGAFGTVDPKYQPFR.N
	TK010303_lung_E18_mito_3_step11.1256.1256.3	1.4046	0.0303	2969.74	35	1700.0%	1	K.IQTNETHVTLSLHYKTFGSNVTYIAK.S
	TK010303_lung_E18_mito_3_step06.4195.4195.3	2.2918	0.1692	4512.5	1	1280.0%	1	R.LLLCYGTSDIDVVARAVEEGEDVLSYYESPTQGVPDPLWR.T
*	TK010303_lung_E18_mito_3_step02.2242.2242.3	1.7351	0.0596	4030.89	11	1580.0%	1	K.ALTVSILNVSSGSMGVLTNATLTILASDDPYGVFIFPNK.T
UQ9BY8954.9%225.2%364408445.8(Q9BY89) Hypothetical protein KIAA1671 (Fragment)
*	TK010303_lung_E18_mito_3_step01.3179.3179.1	1.5023	0.0058	1385.16	415	2730.0%	1	R.KEESDEEETASK.A
*	TK010303_lung_E18_mito_3_step01.2678.2678.1	1.7331	0.0864	966.84	4	6670.0%	1	R.YLWDQLK.Q
URT17_MOUSE54.9%1116.7%120133829.9(Q9CQE3) 28S ribosomal protein S17, mitochondrial precursor (MRP-S17)
*	TK010303_lung_E18_mito_3_step02.2874.2874.2	1.8433	0.2673	2309.31	1	3160.0%	1	K.TYFAHDALQQCSVGDIVLLR.A
UUBAY_MOUSE54.9%3320.6%442500336.0(P31254) Ubiquitin-activating enzyme E1 Y (Fragment)
	TK010303_lung_E18_mito_3_step11.2863.2863.3	1.5005	0.0819	3119.45	19	1700.0%	1	K.SLVFELCCNSDSGDDIEVPYVRYIIR.-
	TK010303_lung_E18_mito_3_step03.1980.1980.3	2.4594	0.4156	4746.36	1	1490.0%	1	K.RCPHPLTFDINNPLHLDYVMAAANLFAQTYGLGGSQDCAVVAK.L
	TK010303_lung_E18_mito_3_step04.4523.4523.2	1.4293	0.0233	2434.67	5	2380.0%	1	K.LEVIMLSQGVSMLYSVFMPASK.L
UAS12_HUMAN54.9%113.2%308338305.9(Q8WXK4) Ankyrin repeat and SOCS box containing protein 12 (ASB-12)
*	TK010303_lung_E18_mito_3_step01.0239.0239.1	1.796	0.0064	1224.75	5	5560.0%	1	K.EEEDTDTEEK.Q
UMOT4_MOUSE54.9%5913.4%470503737.9(P57787) Monocarboxylate transporter 4 (MCT 4)
*	TK010303_lung_E18_mito_3_step06.4445.4445.2	1.3616	0.0602	2971.45	5	1480.0%	2	R.GFLIYAVAASIMVLGLFVPPVFVVSYAK.D
*	TK010303_lung_E18_mito_3_step02.4305.4305.3	1.5507	0.0473	3818.05	3	1570.0%	1	R.GFLIYAVAASIMVLGLFVPPVFVVSYAKDMGVPDTK.A
*	TK010303_lung_E18_mito_3_step06.3031.3031.2	1.3354	0.0256	2944.48	67	1350.0%	2	K.YVFILAGAEVLTSSLVLLLGNFFCIGK.R
UCO7S_HUMAN54.9%1133.0%106118419.6(O60397) Cytochrome c oxidase subunit VIIa-L related protein, mitochondrial precursor
*	TK010303_lung_E18_mito_3_step05.3630.3630.3	2.7335	0.1757	3607.21	3	1620.0%	1	K.GGIADALLHRATMILTVGGTAYAIYQLAVASFPNK.G
UO3561554.8%7714.9%9951059846.9(O35615) FOG
*	TK010303_lung_E18_mito_3_step11.3877.3877.2	1.1604	0.0223	2308.41	40	1820.0%	1	R.SPSPAPENTPSDPADQGARTPSK.G
*	TK010303_lung_E18_mito_3_step07.2533.2533.2	1.0739	0.0273	2526.15	218	1190.0%	1	K.YSCPAAPLRTTALCPYCPPNGR.V
*	TK010303_lung_E18_mito_3_step12.2940.2940.3	2.6277	0.1963	3765.77	3	1620.0%	1	R.EEEASGTTTPEAEAAGRGSEGSQSPGSSVDDAEDDPSR.T
*	TK010303_lung_E18_mito_3_step10.3071.3071.3	2.0134	0.136	3904.6	192	960.0%	1	R.EDVSPPAVPAPPESPEDPEDMEGQELEMRPQDEEK.E
*	TK010303_lung_E18_mito_3_step02.1942.1942.1	0.9462	0.0086	1163.35	8	4440.0%	1	K.KYSCPAAPLR.T
*	TK010303_lung_E18_mito_3_step07.1774.1774.3	2.4851	0.4046	1764.78	5	2630.0%	1	R.TPSKGPPAPAPAPGGGGGHR.Y
*	TK010303_lung_E18_mito_3_step12.2031.2031.2	1.4253	0.0769	1477.35	8	4170.0%	1	K.SCPSASSLEIHMR.S
URFL3_HUMAN54.8%248.7%288321716.9(O75679) Ret finger protein-like 3
*	TK010303_lung_E18_mito_3_step07.3894.3894.2	1.6588	0.3199	3049.54	1	2290.0%	2	R.HYWEVDVGTSTEWDLGVCRESVHCK.G
UASB3_HUMAN54.8%115.2%518577456.3(Q9Y575) Ankyrin repeat and SOCS box containing protein 3 (ASB-3)
*	TK010303_lung_E18_mito_3_step05.4121.4121.2	1.8264	0.2602	3073.73	1	2120.0%	1	R.MLSARASNAWILQQHIATVPSLTHLCR.L
UO8820754.8%669.2%18381836925.0(O88207) Collagen a1(V)
*	TK010303_lung_E18_mito_3_step03.2300.2300.2	1.8229	0.2617	2560.58	1	2310.0%	1	K.GDEGSRGFPGPPGPVGLQGLPGPPGEK.G
	TK010303_lung_E18_mito_3_step03.2428.2428.2	1.3323	0.0885	2468.07	1	2270.0%	1	K.GPMVSAQESQAQAILQQARLALR.G
	TK010303_lung_E18_mito_3_step01.2036.2036.1	1.3425	0.0098	1556.78	19	3210.0%	1	K.GEDGFPGFKGDMGIK.G
	TK010303_lung_E18_mito_3_step12.3708.3708.3	2.0972	0.0767	3987.68	12	1080.0%	1	K.GETGDVGQMGPPGPPGPRGPSGAPGADGPQGPPGGIGNPGAVGEK.G
*	TK010303_lung_E18_mito_3_step07.3090.3090.2	1.2924	0.132	3188.43	45	1430.0%	1	R.WKAARPGALLLSSPLLLFLLLLWAPPSSR.A
*	TK010303_lung_E18_mito_3_step10.2282.2282.3	2.0982	0.172	2985.33	115	1380.0%	1	K.GEAGHPGLPGPPGPPGEVIQPLPIQASRTR.R
UQ96ID754.8%2430.1%8393479.2(Q96ID7) Similar to hypothetical protein PRO1722
*	TK010303_lung_E18_mito_3_step03.1923.1923.3	2.5476	0.31	2722.91	1	2400.0%	2	-.MESRSVAQAGVQWPDLGSLQPLPPR.F
UQ9NXW754.8%2230.1%163188478.8(Q9NXW7) Hypothetical protein FLJ20015
*	TK010303_lung_E18_mito_3_step08.3393.3393.2	1.2947	0.0526	2774.85	9	1880.0%	1	K.RLLLLASNFALSVLALPLANPIHYR.E
*	TK010303_lung_E18_mito_3_step11.3089.3089.3	2.7751	0.1356	2874.34	4	2080.0%	1	K.ACEDLTVGFPLYSVYAFFFGALVKR.L
UQ91V9354.8%229.9%728826636.9(Q91V93) DBC2 protein
*	TK010303_lung_E18_mito_3_step02.4489.4489.2	1.509	0.1637	2884.48	5	1790.0%	1	R.RWLFWNSPSSPSSSAAGSASPSSSSSAVV.-
*	TK010303_lung_E18_mito_3_step01.3828.3828.3	2.7869	0.1435	4635.97	2	1190.0%	1	K.GTFSDVAFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTR.E
UQ9CQC854.7%5538.0%308349526.3(Q9CQC8) DNA segment, Chr 9, Wayne state University 18, expressed
	TK010303_lung_E18_mito_3_step02.4206.4206.2	1.6898	0.295	2860.17	1	2710.0%	1	R.DIPVTIMDVFDQSALSTEAKEEMYK.L
*	TK010303_lung_E18_mito_3_step11.4104.4104.3	2.098	0.1421	4122.73	47	1180.0%	1	R.VHSLILCNAFSDTSIFNQTWTANSFWLMPAFMLKK.I
	TK010303_lung_E18_mito_3_step10.3614.3614.2	1.4036	0.0711	2698.71	5	1880.0%	1	K.IVLGNFSSGPVDPMMADAIDFMVDR.L
*	TK010303_lung_E18_mito_3_step11.1292.1292.3	1.7853	0.0030	3267.47	43	1610.0%	1	R.CPLIFLPPVSGTADVFFQQILALTGWGYR.V
*	TK010303_lung_E18_mito_3_step04.3159.3159.3	1.2691	0.0348	4333.5	71	900.0%	1	K.SPRVHSLILCNAFSDTSIFNQTWTANSFWLMPAFMLK.K
UCPZ5_MOUSE54.5%225.3%491557807.5(P56657) Cytochrome P450 2C40 (EC 1.14.14.1) (CYPIIC40)
	TK010303_lung_E18_mito_3_step04.2215.2215.1	1.4445	0.1617	1202.58	2	4500.0%	1	K.GIGFSHGNVWK.A
	TK010303_lung_E18_mito_3_step07.1957.1957.2	1.3805	0.105	1825.95	55	2860.0%	1	R.NHMPYTNAMVHEVQR.Y
UGPV_MOUSE54.5%116.3%567634689.0(O08742) Platelet glycoprotein V precursor (GPV) (CD42D)
*	TK010303_lung_E18_mito_3_step11.4325.4325.3	2.8316	0.3321	3878.2	7	1570.0%	1	R.DAAQCSGGSVAHIAELGLPTNLTHILLFRMDQGILR.N
UTRL3_HUMAN54.5%224.7%10171166816.1(Q9HCF6) Long transient receptor potential channel 3 (LTrpC3) (Fragment)
*	TK010303_lung_E18_mito_3_step09.3879.3879.2	1.4828	0.1427	2704.27	1	3180.0%	1	-.QELNHNSRDFGQLAVELLDQSYK.Q
*	TK010303_lung_E18_mito_3_step04.3419.3419.2	2.1336	0.1605	2646.36	3	2290.0%	1	R.ATIAISSQEGDNSERTLSNNITVPK.I
UQ9R0L654.4%442.8%20252288315.0(Q9R0L6) Pericentriolar material-1
	TK010303_lung_E18_mito_3_step07.3974.3974.2	1.4475	0.03	2521.33	89	1500.0%	1	K.CVIDPEDSSVVDNELWSDMRR.H
	TK010303_lung_E18_mito_3_step03.2896.2896.2	1.2614	0.0575	2785.27	1	2000.0%	1	R.LHVAHGEDEEEEVEEEGVSGASLSSR.R
	TK010303_lung_E18_mito_3_step07.2092.2092.1	1.5829	0.1071	1103.77	1	6250.0%	1	R.LTHLIEHLK.E
UQ9BR0954.4%3320.0%285316907.9(Q9BR09) DJ337O18.6 (Novel protein similar to Drosophila neuralized (Neu)) (Hypothetical protein FLJ30259)
*	TK010303_lung_E18_mito_3_step11.2532.2532.3	1.7953	0.1544	3180.76	3	1850.0%	1	R.LVGRSRPGLYSHLLDQLYELNVLPPTAR.R
*	TK010303_lung_E18_mito_3_step02.3542.3542.2	1.4415	0.1403	2618.14	4	2170.0%	1	R.EGRPEAEAAAPSRPPTLLVEPYLR.I
*	TK010303_lung_E18_mito_3_step07.3112.3112.3	2.5245	0.3123	3295.36	1	1790.0%	1	R.EGRPEAEAAAPSRPPTLLVEPYLRIEQFR.I
UO7543354.4%359.0%591682867.0(O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog)
*	TK010303_lung_E18_mito_3_step05.2080.2080.2	1.0154	0.0718	1497.77	109	3080.0%	1	R.AYAVGDVEKMALVK.L
*	TK010303_lung_E18_mito_3_step12.3616.3616.3	1.9526	0.1411	4693.05	60	1050.0%	2	K.LHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFR.Y
UQ9D2Q354.4%117.9%444487436.5(Q9D2Q3) 2310057M21Rik protein
*	TK010303_lung_E18_mito_3_step10.3389.3389.3	2.5237	0.314	3755.82	2	1620.0%	1	-.METAIEDAGLDRGPTLTSSWDAACGALTQSLFLTR.T
UO1508054.2%8228.2%15401638536.7(O15080) Hypothetical protein KIAA0375 (Fragment)
*	TK010303_lung_E18_mito_3_step03.2453.2453.3	2.0581	0.0656	2824.12	7	1880.0%	1	R.TQQPAPLAAPAAQVSVPAPSGEPQASTPR.A
*	TK010303_lung_E18_mito_3_step06.3421.3421.2	1.2106	0.0484	2955.86	17	1480.0%	4	K.LVTCDLSSQSSPSPAGSSITSCSEEHTK.I
*	TK010303_lung_E18_mito_3_step01.3083.3083.3	1.8121	0.1082	4158.68	10	1120.0%	2	R.CSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNK.M
*	TK010303_lung_E18_mito_3_step12.2944.2944.2	1.6203	0.1005	3056.61	93	1210.0%	1	R.CSRGPDSGLVPLAYVTLTPTPSPTPGSSQN.-
UQ9BW1854.2%244.1%588634717.7(Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit
	TK010303_lung_E18_mito_3_step10.2293.2293.2	1.7943	0.2598	2584.38	4	2390.0%	2	R.GPPPTDPYGRPPPYDRGDYGPPGR.E
UQ9CR1654.2%4419.5%370407437.4(Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D)
*	TK010303_lung_E18_mito_3_step08.2189.2189.2	1.5163	0.1291	1967.88	6	3440.0%	1	K.ILLISEDLKNIGNTFFK.S
*	TK010303_lung_E18_mito_3_step08.2025.2025.2	1.2989	0.1439	2091.79	4	2890.0%	1	R.ALCTGEKGTGSTTGKPLHFK.G
*	TK010303_lung_E18_mito_3_step05.3100.3100.2	1.79	0.2677	2840.59	4	2080.0%	1	K.LKMSNWQGAIDSCLEALEMDPSNTK.A
*	TK010303_lung_E18_mito_3_step09.2336.2336.1	1.3646	0.0814	1057.62	13	5000.0%	1	K.KAQEIAPGDK.A
UNOX1_HUMAN54.0%5521.6%564648718.5(Q9Y5S8) NADPH oxidase homolog 1 (NOX-1) (NOH-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (Mitogenic oxidase 1) (MOX1)
*	TK010303_lung_E18_mito_3_step07.3226.3226.3	1.5964	0.0591	2842.15	41	1700.0%	1	K.FEGHPPESWKWILAPVILYICER.I
*	TK010303_lung_E18_mito_3_step06.2798.2798.2	1.2784	0.067	2565.42	1	2380.0%	1	R.AAGDWTENLIRAFEQQYSPIPR.I
*	TK010303_lung_E18_mito_3_step12.2849.2849.3	1.6667	0.0524	4231.15	1	1470.0%	1	-.MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEK.A
*	TK010303_lung_E18_mito_3_step07.2814.2814.2	1.5465	0.0257	2411.39	4	2500.0%	1	K.TSFGRPMWDNEFSTIATSHPK.S
*	TK010303_lung_E18_mito_3_step08.2873.2873.2	2.164	0.0958	2203.42	3	3500.0%	1	R.SRQATDGSLASILSSLSHDEK.K
UTISR_HUMAN54.0%2436.4%4453219.8(Q9Y5M6) Oculomedin (Trabecular meshwork inducible stretch response protein) (TISR)
*	TK010303_lung_E18_mito_3_step08.2617.2617.2	2.1531	0.1049	1913.22	2	4330.0%	2	K.SGIIWLSWYSFILLVL.-
UQ8R0T254.0%111.6%568627118.2(Q8R0T2) Similar to hypothetical protein FLJ23436
	TK010303_lung_E18_mito_3_step11.1187.1187.1	1.5799	0.1141	1042.49	2	6880.0%	1	R.GSTLIQHQR.I
UQ8VGM554.0%112.9%310349568.7(Q8VGM5) Olfactory receptor MOR233-2
	TK010303_lung_E18_mito_3_step01.0071.0071.1	1.5659	0.1077	1191.56	2	6250.0%	1	K.MIVDFFYEK.K
UIF34_HUMAN53.9%114.4%320356966.4(O75821) Eukaryotic translation initiation factor 3 subunit 4 (eIF-3 delta) (eIF3 p44) (eIF-3 RNA-binding subunit) (eIF3 p42)
*	TK010303_lung_E18_mito_3_step02.2689.2689.1	1.5607	0.1017	1526.73	2	4230.0%	1	K.LPGELEPVQATQNK.T
UQ8WXF653.9%223.2%11391311995.5(Q8WXF6) Myocyte inner nuclear membrane protein
	TK010303_lung_E18_mito_3_step01.1718.1718.1	1.5176	0.1303	1251.74	1	6000.0%	1	K.CEKGIADSLEK.L
	TK010303_lung_E18_mito_3_step02.4482.4482.2	1.6919	0.0206	2760.67	36	1460.0%	1	K.EEEESLPGFVNLHSTETQTAGVIDR.W
UO5480253.9%112.8%544613774.8(O54802) Nucleosome assembly protein 1-like 3 (MB20)
*	TK010303_lung_E18_mito_3_step04.2623.2623.2	2.1492	0.1169	1775.39	9	3930.0%	1	K.EDPKGIPDYWLTVLK.N
UQ96SY553.9%5713.6%674753815.1(Q96SY5) Hypothetical protein FLJ14564 (Fragment)
	TK010303_lung_E18_mito_3_step02.2924.2924.3	1.4613	0.1447	2967.29	21	1600.0%	1	K.STSLEPVERSLETSSYLNVLVNSQWK.S
	TK010303_lung_E18_mito_3_step09.3208.3208.3	1.9264	0.176	3658.7	105	1090.0%	1	K.DQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQR.F
	TK010303_lung_E18_mito_3_step09.3450.3450.2	1.9007	0.101	1840.93	10	3670.0%	2	K.FSEPNTYIDGLPSQDR.Q
	TK010303_lung_E18_mito_3_step11.3004.3004.2	1.2717	0.0163	2057.38	8	2500.0%	1	R.LYTKSSSSDEEYIYMNK.V
UQ8WXD953.9%687.9%14311498139.1(Q8WXD9) Cask-interacting protein 1
*	TK010303_lung_E18_mito_3_step12.3715.3715.2	1.8167	0.1346	2782.59	33	1670.0%	1	R.SSSALASANLADEPVPDAEPEDGLLGVR.A
*	TK010303_lung_E18_mito_3_step08.2121.2121.1	1.3617	0.032	1517.66	13	3330.0%	1	K.SIAAMLELSSIGGGGR.A
*	TK010303_lung_E18_mito_3_step10.2106.2106.2	2.1557	0.0143	1922.62	4	2370.0%	1	K.GEAGVEGPPLAKVEASATLK.R
*	TK010303_lung_E18_mito_3_step10.2095.2095.2	1.3298	0.1174	2232.31	6	2250.0%	1	R.AARRPPEGHPTPRPASPEPGR.V
*	TK010303_lung_E18_mito_3_step08.3030.3030.2	1.1859	0.1805	2443.73	54	1480.0%	2	R.AAAAAAAAAAAPPAPPEGASPGDSARQK.L
UQ9CSF953.8%357.3%368413859.9(Q9CSF9) 2410005K20Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step04.2983.2983.2	1.5327	0.0252	2723.39	9	2290.0%	1	K.VTEEGEEAIPQLVPIGETPDKENVK.M
*	TK010303_lung_E18_mito_3_step05.3560.3560.2	1.343	0.0422	2507.78	69	1590.0%	2	K.QKVTEEGEEAIPQLVPIGETPDK.E
URFXK_MOUSE53.8%63614.5%269292324.7(Q9Z205) DNA-binding protein RFXANK (Regulatory factor X subunit B) (RFX-B) (Regulatory factor X-associated ankyrin-containing protein) (Ankyrin repeat-containing adapter protein Tvl-1)
*	TK010303_lung_E18_mito_3_step03.3735.3735.3	1.8839	0.1527	4099.36	12	1250.0%	6	R.DESPENSDTVVLSLFPCTPDAVNPEADASASSLQGSFLK.H
UTSC2_MOUSE53.8%446.4%18142020707.0(Q61037) Tuberin (Tuberous sclerosis 2 homolog protein)
*	TK010303_lung_E18_mito_3_step05.4116.4116.3	2.2667	0.2149	4134.48	203	880.0%	1	R.EMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIK.A
*	TK010303_lung_E18_mito_3_step12.1115.1115.2	1.0925	0.0232	2387.08	14	2050.0%	1	R.ITVPPEGPLPSSSPRSPSGLRPR.G
*	TK010303_lung_E18_mito_3_step06.3011.3011.3	1.4718	0.068	4110.15	139	1000.0%	1	R.LYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITR.L
*	TK010303_lung_E18_mito_3_step10.2581.2581.3	2.7973	0.2686	2554.86	7	1930.0%	1	K.AVSDLLQPERPPEARHAVLTLLK.A
UUROM_HUMAN53.8%339.8%640697615.2(P07911) Uromodulin precursor (Tamm-Horsfall urinary glycoprotein) (THP)
*	TK010303_lung_E18_mito_3_step08.2432.2432.3	2.8016	0.2288	2720.94	10	1820.0%	1	K.QDFNITDISLLEHRLECGANDMK.V
*	TK010303_lung_E18_mito_3_step03.3319.3319.2	1.8157	0.1227	2504.56	9	2500.0%	1	R.CNTAAPMWLNGTHPSSDEGIVSR.K
*	TK010303_lung_E18_mito_3_step12.1987.1987.2	1.3526	0.016	1840.29	2	3750.0%	1	K.VSLKTALQPMVSALNIR.V
UQ9NYV653.7%353.5%651741075.6(Q9NYV6) RRN3
	TK010303_lung_E18_mito_3_step11.1731.1731.1	1.7857	0.0239	1145.72	10	5000.0%	2	R.IVMSQLNPLK.I
	TK010303_lung_E18_mito_3_step08.1842.1842.2	1.2833	0.1199	1591.98	66	3330.0%	1	R.HEILELIIEKLLK.L
UBFS2_HUMAN53.7%4423.4%415458805.6(Q13515) Phakinin (Beaded filament structural protein 2) (Lens fiber cell beaded filament protein CP 49) (CP49) (49 kDa cytoskeletal protein) (CP 47) (CP47) (Lens intermediate filament like-light) (LIFL-L)
*	TK010303_lung_E18_mito_3_step11.4169.4169.3	1.8522	0.1078	3829.62	204	1060.0%	1	R.DHGAVEDLGGCLVEYMAKVHALEQVSQELETQLR.M
*	TK010303_lung_E18_mito_3_step02.2804.2804.2	1.2169	0.0214	2792.47	119	1250.0%	1	R.TNAMSGLVRAPGVYVGTAPSGCIGGLGAR.V
*	TK010303_lung_E18_mito_3_step10.2701.2701.2	1.8714	0.2554	2219.65	1	3410.0%	1	R.APGVYVGTAPSGCIGGLGARVTR.R
*	TK010303_lung_E18_mito_3_step12.1365.1365.3	1.6755	0.0156	3570.73	4	1920.0%	1	K.QLAGCELEQMDAPIGTGLDDILETIRIQWER.D
UIL22_HUMAN53.6%2222.9%179200117.7(Q9GZX6) Interleukin-22 precursor (IL-22) (IL-10-related T-cell-derived inducible factor) (IL-TIF)
*	TK010303_lung_E18_mito_3_step12.3917.3917.3	2.5843	0.2637	4249.78	3	1250.0%	1	-.MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCR.L
*	TK010303_lung_E18_mito_3_step08.2770.2770.3	1.8355	0.1694	3605.14	1	1540.0%	1	K.SVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCR.L
UOSB2_HUMAN53.6%5513.7%878976666.3(Q969R2) Oxysterol-binding protein 2 (Oxysterol binding protein-related protein 4) (OSBP-related protein 4) (ORP-4)
*	TK010303_lung_E18_mito_3_step02.4685.4685.3	0.6152	0.0274	4066.43	26	410.0%	1	K.TPLGVPMSGTGTTSSAPLALLPLDSFEGWLLKWTNYLK.G
*	TK010303_lung_E18_mito_3_step09.3804.3804.2	1.4602	0.0394	3118.5	7	1670.0%	1	K.AVHCTSSVEQMCLVAAFSVSSYSTTVHR.I
*	TK010303_lung_E18_mito_3_step11.1389.1389.1	1.4032	0.2057	1383.85	4	3750.0%	1	R.KSTSTVHNIIVGK.L
*	TK010303_lung_E18_mito_3_step05.2877.2877.2	1.3857	0.0202	3076.44	81	1210.0%	1	R.AVGSATFLRPESGSLPALKPLPLLRPGQAK.T
*	TK010303_lung_E18_mito_3_step07.1641.1641.1	1.4889	0.0016	1302.44	2	4500.0%	1	R.QQWITALELAK.A
UPPCE_HUMAN53.5%112.8%710807645.8(P48147) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE)
	TK010303_lung_E18_mito_3_step11.2277.2277.2	1.7827	0.2662	2373.46	1	2890.0%	1	K.FHKYTIGHAWTTDYGCSDSK.Q
UDMC1_MOUSE53.5%3326.2%340378216.0(Q61880) Meiotic recombination protein DMC1/LIM15 homolog
*	TK010303_lung_E18_mito_3_step10.3239.3239.3	1.8172	0.1253	4162.55	2	1430.0%	1	K.EDQVVQEESGFQDDEESLFQDIDLLQKHGINMADIK.K
	TK010303_lung_E18_mito_3_step08.1478.1478.3	1.5043	0.0207	3645.07	8	1480.0%	1	R.LQKISEEYNVAVFVTNQMTADPGATMTFQADPK.K
*	TK010303_lung_E18_mito_3_step10.3703.3703.2	2.138	0.0922	2286.74	3	2890.0%	1	K.EAANKLIEPGFLTAFQYSER.R
UGATB_HUMAN53.5%4416.9%557618648.6(O75879) Probable glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial precursor (EC 6.3.5.-) (Glu-ADT subunit B) (Cytochrome oxidase assembly factor PET112 homolog)
*	TK010303_lung_E18_mito_3_step10.2422.2422.2	1.1136	0.1293	2768.53	8	1800.0%	1	K.QQNLAVSESPVTPSALAELLDLLDSR.T
*	TK010303_lung_E18_mito_3_step02.2638.2638.3	2.3011	0.0401	3737.81	3	1590.0%	1	R.FMPEPNLPPLVLYDATSLPAGADPQQVINIDQIR.E
*	TK010303_lung_E18_mito_3_step01.2911.2911.1	1.4252	0.181	1501.94	1	4170.0%	1	R.ETLPELPSVTREK.L
*	TK010303_lung_E18_mito_3_step09.4404.4404.2	1.8096	0.1868	2468.31	2	3000.0%	1	R.QINELENGGEILNETRSFHHK.L
UDPG2_MOUSE53.5%5517.0%459514338.4(Q9QZM2) DNA polymerase gamma subunit 2, mitochondrial precursor (EC 2.7.7.7) (Mitochondrial DNA polymerase accessory subunit) (PolG-beta) (MtPolB) (DNA polymerase gamma accessory 55 kDa subunit) (p55)
*	TK010303_lung_E18_mito_3_step05.3730.3730.2	1.3967	0.2067	3114.61	71	1350.0%	1	K.YDEMSVLFSVLVTETTLENGLIQLRSR.D
*	TK010303_lung_E18_mito_3_step06.2001.2001.3	1.8193	0.0599	3321.2	3	1580.0%	1	R.HFLSGTPQQLSTAALLSGCHARFGPLGVELR.K
*	TK010303_lung_E18_mito_3_step11.2515.2515.2	2.0453	0.1895	2353.79	1	3330.0%	1	R.HFLSGTPQQLSTAALLSGCHAR.F
*	TK010303_lung_E18_mito_3_step08.3353.3353.2	2.1244	0.0998	2308.76	3	2630.0%	1	R.ATLLHGALEHYVNCLDLVNR.K
*	TK010303_lung_E18_mito_3_step09.2794.2794.2	1.1199	0.0156	2871.32	51	1040.0%	1	K.YDEMSVLFSVLVTETTLENGLIQLR.S
UASAH_MOUSE53.3%8408.1%394446708.5(Q9WV54) Acid ceramidase precursor (EC 3.5.1.23) (Acylsphingosine deacylase) (N-acylsphingosine amidohydrolase) (AC)
*	TK010303_lung_E18_mito_3_step02.3776.3776.2	1.9877	0.0597	2401.25	1	3640.0%	6	K.APALRILVNSITSLVNTFVPSGK.L
*	TK010303_lung_E18_mito_3_step11.1657.1657.1	1.7724	0.0516	1182.63	1	7500.0%	2	K.RWHELLAQK.A
UQ9DCK553.3%2228.3%127147038.4(Q9DCK5) 0610030G03Rik protein
*	TK010303_lung_E18_mito_3_step06.2206.2206.2	1.7299	0.0143	1915.37	1	4670.0%	1	R.LPQPAHVQTDPLRTWR.W
*	TK010303_lung_E18_mito_3_step05.3068.3068.2	2.1441	0.0677	2298.47	2	3420.0%	1	-.MPLLFHPAWPLLLGATLTFR.A
UTTLL_HUMAN53.3%51311.8%423489888.7(O95922) Tubulin tyrosine ligase-like protein 1
	TK010303_lung_E18_mito_3_step03.2736.2736.2	2.1311	0.0677	2007.6	3	3530.0%	3	K.EAYVISLYINNPLLIGGR.K
	TK010303_lung_E18_mito_3_step02.2766.2766.3	1.947	0.024	3914.79	2	1530.0%	2	R.GWVQVTENEDWNFYWMSVQTIRNVFSVEAGYR.L
UQ9UI0753.3%358.6%509547785.6(Q9UI07) Heat shock protein hsp70-related protein
	TK010303_lung_E18_mito_3_step11.2041.2041.2	1.8605	0.2806	2432.08	6	2270.0%	1	R.VTPAVVAYSENEEIVGLAAKQSR.I
	TK010303_lung_E18_mito_3_step04.3825.3825.2	2.1475	0.0774	2451.41	1	3500.0%	2	K.ENLLVEDSLMIECSARDILVK.G
UO8873853.3%11116.2%48455284296.1(O88738) Ubiquitin-conjugating enzyme
	TK010303_lung_E18_mito_3_step12.3567.3567.2	1.2546	0.04	3043.55	55	1480.0%	1	R.TQGESISEQGSTDNESCTNSELNSPLVR.R
	TK010303_lung_E18_mito_3_step03.4329.4329.2	1.5183	0.0105	2401.31	1	2780.0%	1	R.CAMLQFSEFHEKLLNTLCR.R
	TK010303_lung_E18_mito_3_step12.1468.1468.1	1.0568	0.0172	1181.25	3	5560.0%	1	R.FNPNLYNDGK.V
*	TK010303_lung_E18_mito_3_step06.3242.3242.3	2.0714	0.2369	4619.19	1	1280.0%	1	K.DLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACIEK.I
	TK010303_lung_E18_mito_3_step04.3550.3550.3	2.7722	0.2944	3652.75	9	1470.0%	1	K.INQNVAALPVASSVMDRLSYLLPSARPELGVGPGR.S
*	TK010303_lung_E18_mito_3_step12.2631.2631.2	1.2978	0.0617	2613.52	45	1460.0%	1	K.IGSASSSADAASKIITVPVFHLFHR.L
*	TK010303_lung_E18_mito_3_step02.2897.2897.2	1.4414	0.1428	2831.26	12	1850.0%	1	K.GEHTQNVPLSVTLATSPAQLPSADGADR.I
	TK010303_lung_E18_mito_3_step01.0351.0351.1	1.1821	0.0691	687.64	1	8000.0%	1	R.IQALLK.W
*	TK010303_lung_E18_mito_3_step12.2241.2241.3	1.5186	0.0858	4601.61	8	1040.0%	1	R.AIASCTSMVPLLLPLSTENGEEEEDEQSECQTSVGTLLAKMK.T
*	TK010303_lung_E18_mito_3_step10.3298.3298.3	1.8511	0.0933	3802.9	14	1100.0%	1	R.LEEEHVTCLLQVLASYINPMSGAVNGEAQASPESR.A
*	TK010303_lung_E18_mito_3_step08.2958.2958.3	1.8316	0.0284	3001.62	2	1850.0%	1	R.ENVKAGVKPDAPDQEPEGLALLVPDIQR.T
UQ9EP9153.3%469.1%901958215.3(Q9EP91) Transcription complex subunit NF-ATc4
*	TK010303_lung_E18_mito_3_step04.2721.2721.3	1.7973	0.1815	3367.36	17	1420.0%	1	K.LVFGEEKEPPPLGPGGPGEELDSEDTPPCCR.L
*	TK010303_lung_E18_mito_3_step08.2394.2394.2	1.0732	0.0383	2759.76	7	1540.0%	1	R.APEDSWLLLSAPGPVPASPRPASPCGK.R
*	TK010303_lung_E18_mito_3_step12.3487.3487.2	1.9786	0.2469	2547.1	5	2170.0%	2	R.DPSSPGPFDYVGAPPTESIPQKTR.R
UQ9JJE453.3%247.0%273292158.8(Q9JJE4) Brain cDNA, clone MNCb-0914 (1500004C10Rik protein) (RIKEN cDNA 1500004C10 gene)
	TK010303_lung_E18_mito_3_step05.2772.2772.2	2.1453	0.0241	2008.41	2	3890.0%	2	R.MDALALLGGLVNVARLPER.W
UQ9C0K753.3%3515.1%418470267.0(Q9C0K7) Amyotrophic lateral sclerosis 2 (Hypothetical protein FLJ14731) (Amyotrophic lateral sclerosis 2 (Juvenile) chromosome region, candidate 2)
*	TK010303_lung_E18_mito_3_step09.4299.4299.3	2.1104	0.1454	3929.02	4	1440.0%	1	R.HPNITTYWTVFTVGSWLWVISPFMAYGSASQLLR.T
*	TK010303_lung_E18_mito_3_step08.4245.4245.2	1.4228	0.0397	2950.86	24	1430.0%	2	R.MKNSQSGVDSGIGESVLVSSGTHTVNSDR.L
UQ9NTT553.3%221.9%19712218336.3(Q9NTT5) DJ202D23.2 (Novel protein similar to C21ORF5 (KIAA0933)) (Fragment)
	TK010303_lung_E18_mito_3_step09.1890.1890.2	2.1394	0.2543	1289.99	8	5000.0%	1	R.AIMDNLMTHDK.T
	TK010303_lung_E18_mito_3_step12.3376.3376.2	1.633	0.1222	2943.68	97	1400.0%	1	R.NMQMMSIEILTLLFTELAKVIESSAK.G
ULMP2_MOUSE53.2%359.6%415456477.4(P17047) Lysosome-associated membrane glycoprotein 2 precursor (LAMP-2) (Lysosomal membrane glycoprotein-type B) (LGP-B) (CD107B)
*	TK010303_lung_E18_mito_3_step01.1855.1855.1	1.5011	0.133	1371.88	4	4090.0%	2	K.GVHTVKNPENFK.V
*	TK010303_lung_E18_mito_3_step10.2743.2743.3	1.5121	0.067	3630.29	37	1290.0%	1	K.EASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVK.N
UO8874153.2%2218.2%358413118.4(O88741) Ganglioside-induced differentiation associated protein 1
	TK010303_lung_E18_mito_3_step01.4203.4203.3	2.5629	0.3066	4515.62	3	1320.0%	1	R.VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTR.I
*	TK010303_lung_E18_mito_3_step12.2144.2144.2	1.3038	0.0382	2788.43	1	2000.0%	1	R.APKVLGSTLVVGLLVGMGYFAFMLFR.R
UC2TA_MOUSE53.2%224.0%10781187895.6(P79621) MHC class II transactivator CIITA
	TK010303_lung_E18_mito_3_step04.3599.3599.3	2.3261	0.2319	4190.99	3	1380.0%	1	K.LEFALGPILGPQAFPTLAKILPAFSSLQHLDLDSLSENK.I
	TK010303_lung_E18_mito_3_step03.2893.2893.2	1.6239	0.3442	2641.92	1	2610.0%	1	K.ILPAFSSLQHLDLDSLSENKIGDK.G
UQ9BSR953.1%3317.2%396424845.9(Q9BSR9) Hypothetical protein (Fragment)
	TK010303_lung_E18_mito_3_step03.4352.4352.2	1.4678	0.0516	2308.28	19	1900.0%	1	R.DPLAIAVQAANADIVTLLRLAR.M
	TK010303_lung_E18_mito_3_step06.3313.3313.2	1.6918	0.179	1995.6	174	1940.0%	1	R.LEPVLPCVAALSSVGTLDR.K
	TK010303_lung_E18_mito_3_step11.3156.3156.2	1.7545	0.2704	2763.3	2	1920.0%	1	R.ARDLPALAAALAHGAEVNWADAEDEGK.T
URL39_HUMAN53.1%1120.0%50627512.6(P02404) 60S ribosomal protein L39
*	TK010303_lung_E18_mito_3_step07.2221.2221.2	1.7444	0.2724	1307.66	2	5560.0%	1	K.QNRPIPQWIR.M
UDJA1_MOUSE53.1%5720.9%397448687.1(P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2)
	TK010303_lung_E18_mito_3_step11.2976.2976.2	1.227	0.1204	2145.72	163	1670.0%	1	K.VNFPENGFLSPDKLSLLEK.L
	TK010303_lung_E18_mito_3_step07.1982.1982.1	0.6761	0.2077	838.26	7	3570.0%	1	R.GGVQCQTS.-
	TK010303_lung_E18_mito_3_step04.3311.3311.2	1.7223	0.2693	2724.54	1	2500.0%	2	K.ITFHGEGDQEPGLEPGDIIIVLDQK.D
	TK010303_lung_E18_mito_3_step11.3645.3645.2	1.2356	0.0328	3008.32	8	1500.0%	1	K.GGEQAIKEGGAGGGFGSPMDIFDMFFGGGGR.M
UQ8R15353.0%225.8%572632716.8(Q8R153) Similar to hypothetical protein FLJ11078
*	TK010303_lung_E18_mito_3_step07.2469.2469.2	1.5014	0.1375	2240.71	24	2500.0%	1	R.ESRVQFQLTALGGLLYATGGR.N
*	TK010303_lung_E18_mito_3_step07.1954.1954.1	1.5087	0.1356	1425.79	2	4550.0%	1	R.QHDMQSPRTAVR.S
UQ9Y4C153.0%111.0%12361375698.1(Q9Y4C1) Hypothetical protein KIAA0742 (Fragment)
*	TK010303_lung_E18_mito_3_step01.2246.2246.1	1.5092	0.1347	1266.67	3	5000.0%	1	R.KSSENNGTLVSK.Q
UQ9QWV253.0%111.5%721818195.7(Q9QWV2) Sacm21
	TK010303_lung_E18_mito_3_step01.3570.3570.1	1.5405	0.104	1336.63	5	5500.0%	1	R.FLEQLQELDAK.A
UQ9QXV253.0%91314.4%12491373288.5(Q9QXV2) REV1 protein
	TK010303_lung_E18_mito_3_step07.3696.3696.3	2.2257	0.0756	4254.2	34	1050.0%	1	K.WNGLHSPVSGQSRLNLSIEVPSPSQIDQSVLEALPLDLR.E
	TK010303_lung_E18_mito_3_step05.3084.3084.2	1.4444	0.0074	1928.48	3	3120.0%	1	R.EQIEQVCAAQQGEPRGK.K
	TK010303_lung_E18_mito_3_step05.3792.3792.3	2.0837	0.058	4118.24	5	1220.0%	2	K.AADIPDSSVWENQDSTQTNGIDSVLSKAEIASCSYEAR.Q
	TK010303_lung_E18_mito_3_step07.1854.1854.3	1.821	0.0429	2792.82	45	1700.0%	1	K.QNGVMHPRDTAVIFNGHTHSSNGALK.T
	TK010303_lung_E18_mito_3_step12.3999.3999.2	1.6866	0.2961	2845.84	1	2200.0%	1	R.LNLSIEVPSPSQIDQSVLEALPLDLR.E
	TK010303_lung_E18_mito_3_step06.4081.4081.2	1.3341	0.0571	2742.85	14	1800.0%	2	K.ISVIALPAFSQVDPDVFAALPAELQK.E
	TK010303_lung_E18_mito_3_step02.2537.2537.3	2.2171	0.1808	3644.23	7	1290.0%	1	K.EPVNGCSSGVLPHPVGTVLLQIPEPQEPCNSDSK.I
UQ9DAH653.0%114.5%532617518.1(Q9DAH6) 1700010I14Rik protein
*	TK010303_lung_E18_mito_3_step09.4088.4088.2	1.6798	0.2923	2879.56	1	2170.0%	1	K.EIKDEYELYMAALLDSQPTAQYQR.L
UCO1A_MOUSE53.0%114.1%461509756.5(O89053) Coronin-like protein p57 (Coronin 1A)
	TK010303_lung_E18_mito_3_step12.1231.1231.2	2.0366	0.2315	2118.69	2	3060.0%	1	K.DRPHEGTRPVHAVFVSEGK.I
UTRUA_MOUSE52.9%112.5%393440938.2(Q9WU56) tRNA pseudouridine synthase A (EC 4.2.1.70) (Pseudouridylate synthase I) (Pseudouridine synthase I) (Uracil hydrolyase)
	TK010303_lung_E18_mito_3_step11.1169.1169.1	1.5712	0.1	1174.76	3	5000.0%	1	K.INSHLPSHIR.I
UQ9CVW252.9%118.2%243263738.1(Q9CVW2) 2310005D06Rik protein (Fragment)
*	TK010303_lung_E18_mito_3_step02.2220.2220.2	2.1054	0.2017	2247.89	1	3680.0%	1	R.NRPNVQVGDLIYGQCVVANK.D
UQ9DC4952.9%115.1%2352510410.3(Q9DC49) Repeat family 3 gene
	TK010303_lung_E18_mito_3_step01.1692.1692.1	1.4647	0.1523	1463.78	1	4550.0%	1	K.SPYQEFTDHLVK.T
UVATC_HUMAN52.8%244.7%382439427.5(P21283) Vacuolar ATP synthase subunit C (EC 3.6.3.14) (V-ATPase C subunit) (Vacuolar proton pump C subunit)
*	TK010303_lung_E18_mito_3_step11.2720.2720.2	1.5223	0.0438	2021.73	58	2350.0%	2	K.VQENLLANGVDLVTYITR.F
UQ9Y6R552.8%4411.2%8841001347.4(Q9Y6R5) Germinal center kinase related protein kinase
*	TK010303_lung_E18_mito_3_step04.1903.1903.2	1.3586	0.099	3040.18	328	1200.0%	1	K.ETEPHHELPDSDGFLDSSEEIYYTAR.S
*	TK010303_lung_E18_mito_3_step11.1571.1571.2	1.434	0.0586	1547.31	220	2730.0%	1	K.MKWSNSFHHFVK.M
*	TK010303_lung_E18_mito_3_step06.2502.2502.2	1.649	0.31	2952.5	1	2120.0%	1	R.SNLDLQLEYGQGHQGGYFLGADKSLLK.S
*	TK010303_lung_E18_mito_3_step06.3889.3889.3	2.0547	0.0877	3993.98	4	1520.0%	1	R.CTWLYVMNNCLLSISGKASQLYSHNLPGLFDYAR.Q
UQ8R12352.8%227.3%492547676.6(Q8R123) Hypothetical 54.8 kDa protein
*	TK010303_lung_E18_mito_3_step01.1467.1467.1	1.2266	0.158	815.74	13	6670.0%	1	R.RVLEGLK.G
*	TK010303_lung_E18_mito_3_step06.3626.3626.2	1.6033	0.381	3075.81	1	1790.0%	1	K.KVAGALQTIETALAQYHLSQLCVGFNGGK.D
UQ96BP352.7%112.9%646735757.1(Q96BP3) Hypothetical protein KIAA0073
*	TK010303_lung_E18_mito_3_step06.3119.3119.2	1.9712	0.2528	2330.65	1	2780.0%	1	R.VYLDNLPSASMYERSYMHR.D
UQ9GZT152.7%115.7%424438698.4(Q9GZT1) RNA binding protein MCG10
	TK010303_lung_E18_mito_3_step01.3463.3463.2	1.9711	0.2509	2724.35	1	2610.0%	1	R.CPALILYLQSSARITISEGSCPER.I
UCTN1_MOUSE52.7%355.8%9061001066.2(P26231) Alpha-1 catenin (102 kDa cadherin-associated protein) (CAP102) (Alpha E-catenin)
	TK010303_lung_E18_mito_3_step02.3340.3340.2	1.6977	0.2322	2814.35	1	1920.0%	2	R.MSASQLEALCPQVINAALALAAKPQSK.L
	TK010303_lung_E18_mito_3_step02.3630.3630.2	1.2133	0.0027	2589.97	16	1800.0%	1	K.AEVQNLGGELVVSGVDSAMSLIQAAK.N
UEVI1_MOUSE52.6%225.6%10421168486.7(P14404) Ecotropic virus integration 1 site protein
	TK010303_lung_E18_mito_3_step02.2517.2517.3	1.6971	0.0768	3590.54	104	1170.0%	1	K.VGALPYPSMFPLPFFPAFSQSMYPFPDRDLR.S
*	TK010303_lung_E18_mito_3_step02.3694.3694.3	2.5516	0.3045	3099.22	1	2120.0%	1	K.ELGVTRLDEEIPEDDYEEAGALEMSCK.A
UQ9JHW952.6%228.0%512561576.6(Q9JHW9) Retinaldehyde dehydrogenase 3 (EC 1.2.1.3)
	TK010303_lung_E18_mito_3_step09.4255.4255.2	1.751	0.023	3090.18	4	1830.0%	1	K.EVGFPPGVVNIVPGFGPTVGAAISSHPQINK.I
	TK010303_lung_E18_mito_3_step01.2724.2724.1	1.5143	0.1264	1131.88	4	5560.0%	1	K.ILELIESGKK.E
UQ96AM352.6%115.4%280313099.8(Q96AM3) Hypothetical protein
	TK010303_lung_E18_mito_3_step01.3360.3360.1	1.5152	0.127	1576.89	1	4640.0%	1	K.EIFLTVPVGGGESLR.L
UADML_HUMAN52.6%247.0%1852042010.8(P35318) ADM precursor [Contains: Adrenomedullin (AM); Proadrenomedullin N-20 terminal peptide (ProAM-N20) (ProAM N-terminal 20 peptide) (PAMP)]
*	TK010303_lung_E18_mito_3_step01.0706.0706.1	1.2669	0.0632	1356.47	5	3750.0%	2	R.MSSSYPTGLADVK.A
UQ9H1Q552.6%226.8%839946946.8(Q9H1Q5) BA12M19.2.1 (Vacuolar protein sorting protein 16 (VPS16))
*	TK010303_lung_E18_mito_3_step04.3687.3687.3	2.6802	0.2005	3690.23	1	1740.0%	1	K.SGPVVSLGWSAEEELLCVQEDGAVLVYGLHGDFR.R
	TK010303_lung_E18_mito_3_step07.3610.3610.2	1.1293	0.034	2360.17	33	1820.0%	1	R.NEAELSLVLSHCTGATDGATADK.I
UQ9DBU452.5%227.6%635720124.6(Q9DBU4) RAD21 homolog (S. pombe)
	TK010303_lung_E18_mito_3_step12.3225.3225.2	1.6946	0.2821	2965.37	1	2000.0%	1	K.QQAIELTQEEPYSDIIATPGPRFHII.-
	TK010303_lung_E18_mito_3_step09.4254.4254.2	1.4025	0.1418	2613.62	44	1900.0%	1	K.EEEEEEEDEDASGGDQDQEERR.W
UDDC_MOUSE52.5%2212.7%480538746.6(O88533) Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28) (AADC) (DOPA decarboxylase) (DDC)
*	TK010303_lung_E18_mito_3_step04.3449.3449.3	2.4512	0.2523	3506.88	3	1610.0%	1	R.QLQAASPEFTQAAIMEKLVAYTSDQAHSSVER.A
*	TK010303_lung_E18_mito_3_step11.2851.2851.3	2.7431	0.059	3254.38	3	1880.0%	1	R.FAVCARTVESAHVQLAWEHISDLASSVLR.A
UARVC_MOUSE52.5%227.4%9691053826.9(P98203) Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog (Fragment)
	TK010303_lung_E18_mito_3_step06.3590.3590.3	2.7478	0.1058	4109.5	2	1450.0%	1	R.AFEDTADDAGELIEERPPFPAATAPLAQPERGSLGSLDR.V
	TK010303_lung_E18_mito_3_step06.2473.2473.3	1.3331	0.0158	3593.91	2	1720.0%	1	R.EAFPMGSESGPPSGRSLPEHFQAEPYGLEDDTR.S
UOTC_MOUSE52.5%119.9%354397658.7(P11725) Ornithine carbamoyltransferase, mitochondrial precursor (EC 2.1.3.3) (OTCase) (Ornithine transcarbamylase)
*	TK010303_lung_E18_mito_3_step06.2663.2663.3	2.7473	0.2094	3702.72	7	1540.0%	1	R.LSTETGFALLGGHPSFLTTQDIHLGVNESLTDTAR.V
UCP2B_MOUSE52.5%247.9%507562258.3(O35084) 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (EC 1.14.-.-) (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha)
*	TK010303_lung_E18_mito_3_step09.4083.4083.3	2.7281	0.0354	4483.9	1	1470.0%	2	R.LAELELQMALSQILTHFEVLPEPGALPIKPMTRTVLVPER.S
UQ96MC452.5%4413.2%621698399.6(Q96MC4) Hypothetical protein FLJ32655
*	TK010303_lung_E18_mito_3_step03.3320.3320.3	2.7366	0.2475	3832.63	7	1470.0%	1	K.EDSLLYSTESGQETPKLGTLAEGSLQLHLQDQADR.V
*	TK010303_lung_E18_mito_3_step05.3309.3309.2	1.2188	0.0018	2423.92	56	2110.0%	1	-.MCSGWSSSVIWRHTQFAVER.C
*	TK010303_lung_E18_mito_3_step01.1204.1204.1	1.2395	0.0553	832.95	5	5830.0%	1	R.ADAKLWK.N
*	TK010303_lung_E18_mito_3_step10.4434.4434.2	1.4114	0.0249	2456.92	15	2110.0%	1	K.QLESLEQMEHPDMSLEIHYK.A
UQ9DCS352.5%4425.7%373403429.3(Q9DCS3) Nuclear receptor binding factor 1
*	TK010303_lung_E18_mito_3_step01.1571.1571.1	1.5232	0.0864	1244.56	4	5000.0%	1	R.ALVYGNHGDPAK.V
*	TK010303_lung_E18_mito_3_step07.3006.3006.3	1.7925	0.0365	3657.37	23	1180.0%	1	R.MLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALR.L
*	TK010303_lung_E18_mito_3_step10.3362.3362.3	2.74	0.2972	3903.28	10	1410.0%	1	K.LPAVGGNEGVGQVIAVGSSVSALKPGDWVIPANAGLGTWR.T
*	TK010303_lung_E18_mito_3_step11.1457.1457.1	1.4717	0.0479	1104.67	18	5000.0%	1	K.KNHSPDEFK.E
UFBL1_MOUSE52.4%392.6%705780575.2(Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90)
*	TK010303_lung_E18_mito_3_step05.3238.3238.2	1.9663	0.0108	1892.65	4	3820.0%	3	R.LVPLPLLLLSSLSLLAAR.A
UQ91XX052.4%6613.6%9411012165.3(Q91XX0) Protocadherin gamma C4
*	TK010303_lung_E18_mito_3_step06.3561.3561.2	1.4398	0.14	2664.89	1	3100.0%	1	K.LTLQGPLDFESENYYEFDVRAR.D
	TK010303_lung_E18_mito_3_step09.4424.4424.3	1.4373	0.0204	4620.89	1	1280.0%	1	R.SDSFMMVKSPSAPMAGEPVRPSCPPSDLLYGLEQAPPNTDWR.F
	TK010303_lung_E18_mito_3_step09.3456.3456.3	1.6831	0.026	3695.32	1	1670.0%	1	K.SPSAPMAGEPVRPSCPPSDLLYGLEQAPPNTDWR.F
	TK010303_lung_E18_mito_3_step10.2982.2982.2	2.1166	0.0327	2338.02	4	3250.0%	1	R.QQLDLEIGEAAPPGQRFPLEK.A
*	TK010303_lung_E18_mito_3_step08.4086.4086.3	2.2569	0.0457	4096.64	4	1350.0%	1	R.ISVLESAPAGMVLIQLNASDPDLGPSGNVTFSFSGHTPDR.V
	TK010303_lung_E18_mito_3_step12.1521.1521.2	1.2869	0.0642	2124.46	17	2220.0%	1	R.FPRQQLDLEIGEAAPPGQR.F
UEPLI_MOUSE52.4%4411.0%753840906.6(Q9ERG0) Epithelial protein lost in neoplasm (mEPLIN)
*	TK010303_lung_E18_mito_3_step11.1011.1011.1	0.9684	0.0277	1245.39	72	3890.0%	1	K.SRWQGEEVPR.S
*	TK010303_lung_E18_mito_3_step05.2738.2738.3	1.3946	0.0147	4734.68	5	1080.0%	1	K.WENPVAGAEFHTDSLPNSSSEGGHTADYPPAEVTDKPAPGVRADR.E
*	TK010303_lung_E18_mito_3_step12.3635.3635.3	2.4906	0.1312	4391.25	7	1160.0%	1	K.WENPVAGAEFHTDSLPNSSSEGGHTADYPPAEVTDKPAPGVR.A
*	TK010303_lung_E18_mito_3_step12.2569.2569.2	2.1131	0.0413	2992.65	1	2410.0%	1	K.SEAQQPMHPKPLSPDARTSSLPESSPSK.T
UNCR2_MOUSE52.4%888.7%24722708568.4(Q9WU42) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC)
*	TK010303_lung_E18_mito_3_step05.3417.3417.3	1.718	0.0482	2900.24	41	1730.0%	1	R.SIIGSPGRPFPALHPLDIMADARALER.A
*	TK010303_lung_E18_mito_3_step04.4406.4406.2	1.3598	0.1533	2795.04	2	1920.0%	1	R.SLAGKLEPVSPPSPPHADPELELAPSR.L
	TK010303_lung_E18_mito_3_step10.2190.2190.2	2.1175	0.028	1753.69	1	5000.0%	1	R.KTVAECVLYYYLTK.K
	TK010303_lung_E18_mito_3_step04.1978.1978.3	2.104	0.1898	2836.69	73	1390.0%	1	K.AKSPAPGLASGDRPPSVSSVHSEGDCNR.R
*	TK010303_lung_E18_mito_3_step10.2011.2011.3	1.7678	0.043	3671.29	77	1560.0%	1	R.ITRSMANEANHEETATPQQSSELASMEMNESSR.W
*	TK010303_lung_E18_mito_3_step05.4174.4174.3	1.9566	0.1018	4374.65	30	1040.0%	1	R.GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSR.H
*	TK010303_lung_E18_mito_3_step04.4203.4203.3	2.0457	0.0464	4701.84	12	1050.0%	1	K.TQSKPFSIQELELRSLGYHSGAGYSPDGVEPISPVSSPSLTHDK.G
*	TK010303_lung_E18_mito_3_step03.3640.3640.2	1.3059	0.0906	3040.31	4	1720.0%	1	R.SLGYHSGAGYSPDGVEPISPVSSPSLTHDK.G
UATS2_HUMAN52.2%448.0%12111347237.1(O95450) ADAMTS-2 precursor (EC 3.4.24.14) (A disintegrin and metalloproteinase with thrombospondin motifs 2) (ADAM-TS 2) (ADAM-TS2) (Procollagen I/II amino-propeptide processing enzyme) (Procollagen I N-proteinase) (PC I-NP) (Procollagen N-endopeptidase) (pNPI) (Procollagen I/II amino-propeptide processing enzyme)
*	TK010303_lung_E18_mito_3_step12.1181.1181.1	1.5118	0.1178	1580.66	1	3210.0%	1	K.VGCDGVIGSSKQEDK.C
*	TK010303_lung_E18_mito_3_step05.3652.3652.2	1.4088	0.0115	2740.79	10	1670.0%	1	R.TPSFPGGNEEEPGSHLFYNVTVFGR.D
*	TK010303_lung_E18_mito_3_step11.2788.2788.3	1.4319	0.0041	4416.4	30	960.0%	1	R.SCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVR.L
*	TK010303_lung_E18_mito_3_step07.4329.4329.2	1.1966	0.0037	2017.07	18	2810.0%	1	K.SYVVQWLSRPDPDSPIR.K
USR68_HUMAN52.2%226.6%619702428.7(Q9UHB9) Signal recognition particle 68 kDa protein (SRP68)
*	TK010303_lung_E18_mito_3_step10.2714.2714.2	1.718	0.1718	2072.87	18	2200.0%	1	K.QVPGGGGGGGGSGGGGGRGAGGEENK.E
	TK010303_lung_E18_mito_3_step03.3012.3012.2	1.9017	0.2521	1841.48	4	3930.0%	1	K.VSNLQYLHSYLTYIK.L
UQ9D1B952.2%2417.1%129150645.6(Q9D1B9) 1110015G04Rik protein (RIKEN cDNA 1110015G04 gene) (Similar to melanoma-associated antigen recognised by cytotoxic T lymphocytes)
*	TK010303_lung_E18_mito_3_step10.3707.3707.2	1.4581	0.1189	2462.02	9	2140.0%	2	R.SFVIPEAEAEWVGLTLEEALEK.Q
UQ9NTU652.2%3323.4%428454448.9(Q9NTU6) Hypothetical protein
*	TK010303_lung_E18_mito_3_step04.4439.4439.2	1.9056	0.2497	2915.15	1	2040.0%	1	K.AADIAPGQTLTLRNDSSTSEASRPSTHK.F
*	TK010303_lung_E18_mito_3_step02.2448.2448.2	1.0734	0.0624	2671.53	2	1920.0%	1	K.SQDCLGLLDPLASAAGVPSTAPMSGKK.H
*	TK010303_lung_E18_mito_3_step11.3612.3612.3	2.1791	0.2548	4595.5	2	1250.0%	1	K.HRPPGPLFSSSDPLPATSSDSQDSAQVTSLIPAPFPAASMDAGMR.R
UQ9Y3T652.2%2210.9%450500186.0(Q9Y3T6) Hypothetical protein (Fragment)
*	TK010303_lung_E18_mito_3_step02.3557.3557.3	1.4427	0.0026	3430.15	7	1500.0%	1	R.IQWVDDTHALGIFPCLASAAEALTREFSALK.I
*	TK010303_lung_E18_mito_3_step08.1560.1560.2	1.9031	0.2482	1990.24	3	3530.0%	1	R.TAENFDLLSSFSVGEGWK.R
UCP4Y_HUMAN52.2%3314.3%519593488.8(Q02928) Cytochrome P450 4A11 precursor (EC 1.14.15.3) (CYPIVA11) (Fatty acid omega-hydroxylase) (P-450 HK omega) (Lauric acid omega-hydroxylase) (CYP4AII) (P450-HL-omega)
*	TK010303_lung_E18_mito_3_step04.4321.4321.2	1.473	0.1255	2639.4	1	2270.0%	1	R.MLTPAFHYDILKPYVGLMADSVR.V
*	TK010303_lung_E18_mito_3_step05.2414.2414.3	1.6544	0.045	3656.32	15	1450.0%	1	K.CAFSHQGSIQVDRNSQSYIQAISDLNNLVFSR.V
*	TK010303_lung_E18_mito_3_step04.3490.3490.2	1.9106	0.2465	2153.38	2	3330.0%	1	R.VRNAFHQNDTIYSLTSAGR.W
UITK_HUMAN52.2%113.7%620718317.6(Q08881) Tyrosine-protein kinase ITK/TSK (EC 2.7.1.112) (T-cell-specific kinase) (Tyrosine-protein kinase Lyk) (Kinase EMT)
*	TK010303_lung_E18_mito_3_step11.3229.3229.2	2.0597	0.2226	2612.05	1	2730.0%	1	K.YVFDSIPLLINYHQHNGGGLVTR.L
UCONT_MOUSE52.2%4611.2%10201133886.2(P12960) Contactin precursor (Neural cell surface protein F3)
*	TK010303_lung_E18_mito_3_step11.4295.4295.3	2.4889	0.3268	4548.01	1	1280.0%	2	K.DAGVYYCLASNNYGMVRSTEATLSFGYLDPFPPEERPEVK.V
*	TK010303_lung_E18_mito_3_step12.2292.2292.3	1.7545	0.0231	3776.26	127	1170.0%	1	R.YIITWDHVVALSNESTVTGYKILYRPDGQHDGK.L
*	TK010303_lung_E18_mito_3_step02.3973.3973.3	1.7419	0.0374	4167.41	1	1440.0%	1	R.AHSDGGDGVVSQVKISGVSTLSSSLLSLLLPSLGFLVYSEF.-
UQ1467452.1%687.2%17951976097.3(Q14674) Hypothetical protein KIAA0165
*	TK010303_lung_E18_mito_3_step04.3541.3541.3	1.471	0.0765	3920.32	204	1030.0%	1	R.ASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIK.S
*	TK010303_lung_E18_mito_3_step08.3021.3021.3	1.5835	0.061	3469.66	13	1500.0%	2	K.LYAEACAISEPLCQHLGLVKPGTYPEVPPEK.L
*	TK010303_lung_E18_mito_3_step12.1847.1847.2	1.2797	0.0492	2425.86	12	2250.0%	1	K.LPWESMPSLQALPVTRLPSFR.F
*	TK010303_lung_E18_mito_3_step12.3725.3725.2	1.2896	0.0086	2502.34	15	1900.0%	1	R.FNIICDLLELSPEETPAGAWAR.A
*	TK010303_lung_E18_mito_3_step11.2299.2299.2	1.6361	0.3136	2392.92	2	2630.0%	1	K.HLDQTTDTYLLLSLTCDLLR.S
UACH7_HUMAN52.0%228.8%502564496.5(P36544) Neuronal acetylcholine receptor protein, alpha-7 chain precursor
*	TK010303_lung_E18_mito_3_step05.2085.2085.3	1.9656	0.0936	3650.77	70	1290.0%	1	K.NQVLTTNIWLQMSWTDHYLQWNVSEYPGVK.T
*	TK010303_lung_E18_mito_3_step07.3001.3001.2	1.7644	0.2633	1713.29	1	4620.0%	1	K.EPYPDVTFTVTMRR.R
UQ9D3N052.0%1113.5%1481637710.3(Q9D3N0) 5430405H02Rik protein
*	TK010303_lung_E18_mito_3_step06.3610.3610.2	1.7567	0.2587	2401.62	1	2890.0%	1	K.FHGHMCTCRGEKPLELGLQK.A
UGLUC_MOUSE52.0%1111.1%180209065.6(P55095) Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP); Glucagon; Glucagon-like peptide 1 (GLP1); Glucagon-like peptide 2 (GLP2)]
*	TK010303_lung_E18_mito_3_step04.3411.3411.2	1.8775	0.2498	2278.07	2	2890.0%	1	R.SFPASQTEAHEDPDEMNEDK.R
UQ9WVB452.0%81012.3%15231677117.7(Q9WVB4) SLIT3 (Fragment)
*	TK010303_lung_E18_mito_3_step10.4198.4198.3	2.0643	0.0437	4741.04	2	1120.0%	2	K.CHHGQCHISDRGEPYCLCQPGFSGHHCEQENPCMGEIVR.E
	TK010303_lung_E18_mito_3_step02.4248.4248.3	1.4861	0.1593	4352.69	1	1540.0%	1	R.VLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLR.W
*	TK010303_lung_E18_mito_3_step02.2940.2940.2	1.707	0.0765	2608.41	6	2170.0%	1	K.ITEIPKGLFDGLVSLQLLLLNANK.I
*	TK010303_lung_E18_mito_3_step07.2890.2890.3	2.159	0.1141	4026.09	4	1430.0%	1	R.ITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGR.W
*	TK010303_lung_E18_mito_3_step01.0422.0422.2	1.3406	0.1462	2658.24	40	1740.0%	1	R.GVTGVKNLQLDNNHISCIEDGAFR.A
*	TK010303_lung_E18_mito_3_step09.2695.2695.3	1.6364	0.1245	4476.49	4	1320.0%	1	R.ITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLR.K
	TK010303_lung_E18_mito_3_step06.4369.4369.2	1.4645	0.1096	2881.63	15	1900.0%	1	R.LHSNHLYCDCHLAWLSDWLRQR.R
UQ9C09351.9%223.3%13071485555.1(Q9C093) Hypothetical protein KIAA1770 (Fragment)
*	TK010303_lung_E18_mito_3_step04.2709.2709.2	1.5942	0.353	2107.61	2	2630.0%	1	R.AESTTPELPSFAVKGCLLGK.T
*	TK010303_lung_E18_mito_3_step08.2134.2134.2	1.2486	0.0127	2320.05	33	2050.0%	1	K.AAVSLAELPLPTPPPAPPPEPEK.E
UQ9JMA451.7%61030.0%273317947.6(Q9JMA4) NK receptor Ly-49Q
*	TK010303_lung_E18_mito_3_step11.3817.3817.3	2.3291	0.0275	4025.49	2	1690.0%	1	K.ECSIPWHLIVIAFGILCVLLLVIVAVLVTNILQYK.Q
*	TK010303_lung_E18_mito_3_step06.1987.1987.2	0.9106	0.0213	2620.12	4	2050.0%	2	K.SVLNSSKHPGGSLEIHWFCYGIK.C
*	TK010303_lung_E18_mito_3_step06.3555.3555.2	1.6292	0.1219	2508.17	1	3000.0%	2	K.WTWIENGTSKYALNMSTYNVK.S
*	TK010303_lung_E18_mito_3_step02.3248.3248.3	2.1546	0.1967	4409.36	4	1420.0%	1	K.ECSIPWHLIVIAFGILCVLLLVIVAVLVTNILQYKQEK.H
UQ9NWH451.7%1114.2%1481690311.1(Q9NWH4) Hypothetical protein
*	TK010303_lung_E18_mito_3_step09.1875.1875.2	1.8383	0.243	2076.39	1	3250.0%	1	R.TVSVDPGHPPASALAAPAFLR.R
UQ9BX5751.7%2417.8%1181271611.7(Q9BX57) DJ823N20.1.3 (V-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog, isoform 3) (Fragment)
*	TK010303_lung_E18_mito_3_step05.3546.3546.2	1.8018	0.0892	2315.19	2	2500.0%	2	R.SAQDRQATSPATTWRPPTPSR.L
UQ8TDG451.7%8168.2%11011241756.5(Q8TDG4) DNA helicase HEL308
*	TK010303_lung_E18_mito_3_step12.0988.0988.2	2.0265	0.1043	1530.71	8	5420.0%	1	K.AEALQEEVEELLR.L
*	TK010303_lung_E18_mito_3_step02.1993.1993.3	2.5612	0.2601	3159.17	3	1900.0%	3	R.IDSLGLVVVDELHMIGEGSRGATLEMTLAK.I
*	TK010303_lung_E18_mito_3_step01.0682.0682.1	1.0437	0.056	800.59	24	5000.0%	1	K.GRFPPTK.R
	TK010303_lung_E18_mito_3_step02.2180.2180.3	1.6595	0.1147	4286.76	10	1030.0%	2	K.TAGVLPVEVQPLLLSDSPECLVLGGGDTNPDLLRHMPTDR.G
UQ969I651.6%2210.4%547607646.5(Q969I6) Amino acid transporter hNAT3 (Amino acid transporter system A3) (System A amino acid transporter 3)
*	TK010303_lung_E18_mito_3_step11.2587.2587.3	2.0312	0.0678	3133.3	6	1700.0%	1	R.LAVLVAVTLTVPIVLFPIRTSVITLLFPK.R
*	TK010303_lung_E18_mito_3_step12.3809.3809.2	1.6342	0.3114	2910.58	1	2040.0%	1	R.NVNIEPDDESSSGESAPDSYIGIGNSEK.A
UPTGI_MOUSE51.6%242.2%501570476.7(O35074) Prostacyclin synthase (EC 5.3.99.4) (Prostaglandin I2 synthase)
	TK010303_lung_E18_mito_3_step06.2210.2210.1	1.3335	0.0846	1317.64	3	4000.0%	2	R.VHSADVFHTFR.Q
UQ8VHA751.6%111.9%643732587.3(Q8VHA7) Myotubularin-related protein 2
	TK010303_lung_E18_mito_3_step01.2754.2754.1	1.4286	0.1597	1252.79	2	4550.0%	1	K.LILAGALRIADK.V
UAPP1_MOUSE51.4%4419.0%653727515.7(Q03157) Amyloid-like protein 1 precursor (APLP)
*	TK010303_lung_E18_mito_3_step11.1291.1291.2	1.1091	0.0851	3176.11	15	1790.0%	1	R.VTPTPRPTDGVDVYFGMPGEIGEHEGFLR.A
*	TK010303_lung_E18_mito_3_step10.3770.3770.3	2.6547	0.2314	4327.68	1	1740.0%	1	R.AEGGEDEEEVESFPQPVDDYFVEPPQAEEEEEEEEER.A
*	TK010303_lung_E18_mito_3_step01.2219.2219.3	1.9897	0.2124	3441.61	1	1720.0%	1	R.GVEYVCCPPPATPNPSGMAAGDPSTRSWPLGGR.A
*	TK010303_lung_E18_mito_3_step05.3685.3685.2	1.8397	0.0852	2637.29	1	2920.0%	1	R.AALEGFLAALQGDPPQAERVLMALR.R
UQ9CU5151.4%4422.2%535604096.2(Q9CU51) 6330403N15Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step07.2973.2973.3	1.8916	0.0529	2999.07	2	1880.0%	1	K.ILHIPQVTKLCVQFLNDQISVQNYK.Q
*	TK010303_lung_E18_mito_3_step06.3438.3438.2	1.7516	0.0023	3111.04	3	2120.0%	1	K.HLYVIGGRNETGDLSSVECYNLDTNER.R
	TK010303_lung_E18_mito_3_step05.3022.3022.3	2.6609	0.2305	3927.71	2	1690.0%	1	R.LVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTK.L
	TK010303_lung_E18_mito_3_step03.2293.2293.3	1.2734	0.118	4477.25	33	1060.0%	1	K.GDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYK.S
UHRG_HUMAN51.4%116.5%525595787.5(P04196) Histidine-rich glycoprotein precursor (Histidine-proline rich glycoprotein) (HPRG)
*	TK010303_lung_E18_mito_3_step12.3028.3028.3	2.6636	0.2327	3860.89	1	1820.0%	1	R.SSTTKPPFKPHGSRDHHHPHKPHEHGPPPPPDER.D
UQ8WYK151.4%334.4%13061456226.3(Q8WYK1) Caspr5
*	TK010303_lung_E18_mito_3_step03.2712.2712.3	1.7292	0.0832	3580.54	15	1610.0%	1	R.SDSAVIGGVIAVVIFIIFCIIGIMTRFLYQHK.Q
*	TK010303_lung_E18_mito_3_step11.2567.2567.2	1.1519	0.0038	2765.17	21	1800.0%	1	R.SDSAVIGGVIAVVIFIIFCIIGIMTR.F
	TK010303_lung_E18_mito_3_step05.3492.3492.2	2.0584	0.2258	2645.41	1	2200.0%	1	K.DGLLLSTELSEGSGTLLLSLEGGILR.L
UO9519651.4%4614.3%539570254.4(O95196) Neuroglycan C
*	TK010303_lung_E18_mito_3_step06.4249.4249.3	1.9758	0.063	3516.58	3	1430.0%	1	R.GPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVK.G
*	TK010303_lung_E18_mito_3_step10.2362.2362.2	1.9474	0.0017	2202.62	17	2270.0%	2	R.GPPPLLLFLGAALVLASGAVPAR.E
*	TK010303_lung_E18_mito_3_step06.3145.3145.3	1.9313	9.0E-4	4379.93	20	1060.0%	1	R.WHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSENGTECR.S
UPEXE_MOUSE51.3%2215.7%376412085.1(Q9R0A0) Peroxisomal membrane protein PEX14 (Peroxin-14) (Peroxisomal membrane anchor protein PEX14) (PTS1 receptor docking protein)
	TK010303_lung_E18_mito_3_step11.3389.3389.2	1.2821	0.0321	2644.89	50	1820.0%	1	R.WRDYGALAIIMAGIAFGFHQLYK.R
*	TK010303_lung_E18_mito_3_step06.3706.3706.3	2.6266	0.2357	3875.8	3	1430.0%	1	R.MAASLSELSGTVAQTVTQVQTTLASVQELLRQQQQK.V
UY197_MOUSE51.3%224.1%14021582315.5(Q9Z0W3) Protein KIAA0197 (GTL-13)
*	TK010303_lung_E18_mito_3_step04.3347.3347.3	2.5274	0.2715	3657.27	3	1530.0%	1	K.FQNYNILPGGVHVSETQNHVIILILTNQTVHR.L
*	TK010303_lung_E18_mito_3_step10.3061.3061.3	2.6189	0.2367	2844.24	2	2290.0%	1	R.LYLNYDLLEEAVDLVSEYVDAVLGK.G
UQ1293751.3%114.9%426448195.5(Q12937) BS-84
*	TK010303_lung_E18_mito_3_step10.2354.2354.2	1.6022	0.3299	2528.08	1	2750.0%	1	R.QEQPETFWIQRAPQLPVCEGD.-
UDLP1_MOUSE51.3%1110.0%150171219.7(Q9D415) Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (SAP90/PSD-95-associated protein 1) (SAPAP1) (PSD-95/SAP90 binding protein 1) (Fragment)
	TK010303_lung_E18_mito_3_step01.3087.3087.1	1.4265	0.1671	1590.77	1	3930.0%	1	K.IRTAVGSAQLLMAQK.F
UAATM_HUMAN51.3%119.8%430474769.0(P00505) Aspartate aminotransferase, mitochondrial precursor (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-2)
*	TK010303_lung_E18_mito_3_step12.3605.3605.3	2.7273	0.0919	4722.17	2	1280.0%	1	K.TCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWK.E
UQ9BW2951.3%358.2%473538448.2(Q9BW29) Similar to hyaluronoglucosaminidase 2
	TK010303_lung_E18_mito_3_step06.3217.3217.2	1.6807	0.0252	1936.57	1	3440.0%	1	R.RNPSASTFLHLSTNSFR.L
	TK010303_lung_E18_mito_3_step09.2350.2350.2	1.03	0.0237	2376.35	32	1670.0%	2	R.FDSAGRSVHGGVPQNVSLWAHR.K
UQ8VG8351.2%117.5%308343268.2(Q8VG83) Olfactory receptor MOR209-1
*	TK010303_lung_E18_mito_3_step10.2671.2671.2	1.8119	0.2539	2696.02	1	2500.0%	1	K.VVSIFYTIVIPMLNPLIYSLRNK.D
UQ8VFC451.2%2215.2%323351678.8(Q8VFC4) Olfactory receptor MOR208-3
*	TK010303_lung_E18_mito_3_step06.2195.2195.3	1.3873	0.024	2802.87	419	1400.0%	1	K.NLSFVDLCYSSAIAPNALANFLSTSK.V
*	TK010303_lung_E18_mito_3_step10.2671.2671.2	1.8119	0.2539	2696.02	1	2500.0%	1	K.VISVFYTLVIPMLNPLIYSLRNK.D
UCAML_MOUSE51.2%6612.0%12601409686.0(P11627) Neural cell adhesion molecule L1 precursor (N-CAM L1)
	TK010303_lung_E18_mito_3_step09.3275.3275.3	1.5259	0.0117	3703.83	4	1410.0%	1	K.EELGVVVHEAPYSGSFTIEGNNSFAQRFQGIYR.C
*	TK010303_lung_E18_mito_3_step06.4022.4022.3	1.689	0.0888	4035.89	9	1290.0%	1	R.LVALQGQSLILECIAEGFPTPTIKWLHPSDPMPTDR.V
*	TK010303_lung_E18_mito_3_step12.2588.2588.3	1.8858	0.0897	4088.1	10	1250.0%	1	R.HIHKSHIVVPANTTSAILSGLRPYSSYHVEVQAFNGR.G
	TK010303_lung_E18_mito_3_step01.2467.2467.1	1.7288	0.0445	1545.08	2	4170.0%	1	R.VKPTNSMIDRKPR.L
*	TK010303_lung_E18_mito_3_step05.3742.3742.2	1.4736	0.0215	2689.87	51	1520.0%	1	R.IEQGSLILSNVQPTDTMVTQCEAR.N
*	TK010303_lung_E18_mito_3_step03.2711.2711.2	1.1458	0.017	2450.23	4	2370.0%	1	K.WLHPSDPMPTDRVIYQNHNK.T
UBIR1_HUMAN51.1%6611.4%14031596136.0(Q13075) Baculoviral IAP repeat-containing protein 1 (Neuronal apoptosis inhibitory protein)
	TK010303_lung_E18_mito_3_step10.3206.3206.3	1.9044	0.1253	2811.58	6	1800.0%	1	R.HMSLLDISSDLATDHLLGCDLSIASK.H
	TK010303_lung_E18_mito_3_step01.2071.2071.1	1.7282	0.0241	1503.74	5	4230.0%	1	K.VAISGGFQKLENLK.L
	TK010303_lung_E18_mito_3_step03.2584.2584.2	1.2793	0.1367	2653.92	7	2170.0%	1	K.FAYILGSLSNLEELILPTGDGIYR.V
	TK010303_lung_E18_mito_3_step09.4559.4559.2	0.9968	0.1279	1964.1	30	2500.0%	1	K.ATAEILKATVSSCGELALK.G
	TK010303_lung_E18_mito_3_step05.2036.2036.3	2.3141	0.0749	4378.93	3	1320.0%	1	K.HQPEISLQMQLLRGLWQICPQAYFSMVSEHLLVLALK.T
	TK010303_lung_E18_mito_3_step07.4288.4288.3	1.3822	0.0212	4611.37	5	1030.0%	1	K.IPCLEVDVNDIDVVGQDMLEILMTVFSASQRIELHLNHSR.G
UU520_HUMAN51.1%5113.1%17011944786.7(O75643) U5 small nuclear ribonucleoprotein 200 kDa helicase (U5 snRNP-specific 200 kDa protein) (U5-200KD) (Fragment)
	TK010303_lung_E18_mito_3_step01.2088.2088.1	1.7679	0.0129	1489.64	2	4580.0%	1	K.INVLLQAFISQLK.L
	TK010303_lung_E18_mito_3_step01.3870.3870.2	1.2898	0.0519	2400.46	1	2500.0%	3	K.NLELKDLLPYGFAIHHAGMTR.V
	TK010303_lung_E18_mito_3_step09.3496.3496.2	1.5361	0.1834	2289.4	19	2220.0%	1	K.YVHLFPKLELSVHLQPITR.S
UQ9ERQ951.1%112.1%559615096.4(Q9ERQ9) WAVE-1
	TK010303_lung_E18_mito_3_step08.1985.1985.1	1.7753	0.1238	1493.84	7	4550.0%	1	K.QKNLDRPHEPEK.V
UK1CR_HUMAN51.1%3316.3%429479275.5(P05783) Keratin, type I cytoskeletal 18 (Cytokeratin 18) (K18) (CK 18)
*	TK010303_lung_E18_mito_3_step06.3723.3723.3	2.1496	0.1518	3203.07	8	1610.0%	1	R.LLEDGEDFNLGDALDSSNSMQTIQKTTTR.R
*	TK010303_lung_E18_mito_3_step08.1660.1660.3	2.5517	0.2734	3214.86	3	1940.0%	1	R.YALQMEQLNGILLHLESELAQTRAEGQR.Q
*	TK010303_lung_E18_mito_3_step05.1980.1980.2	1.1976	0.0373	1570.76	50	4170.0%	1	-.SFTTRSTFSTNYR.S
URB35_HUMAN51.0%115.5%201230258.3(Q15286) Ras-related protein Rab-35 (RAB-1C) (GTP-binding protein RAY)
*	TK010303_lung_E18_mito_3_step01.1746.1746.1	1.4668	0.1403	1071.65	1	5500.0%	1	K.LLIIGDSGVGK.S
UQ91V1851.0%3318.6%397458839.2(Q91V18) Beta-1,3-N-acetylglucosaminyltransferase (Beta-1,3-N-acetylglucosaminyltransferase 1)
	TK010303_lung_E18_mito_3_step08.3974.3974.2	1.3261	0.0983	2788.92	1	2170.0%	1	R.VHLYPIDDVYTGMCLQKLGLVPEK.H
	TK010303_lung_E18_mito_3_step01.2562.2562.1	1.6107	0.0977	1219.6	5	5000.0%	1	R.ETNVGNQTVVR.V
	TK010303_lung_E18_mito_3_step04.3754.3754.3	1.8253	0.0341	4255.03	170	920.0%	1	R.VANQTGELATSPNTSHLSYCEPDSTVMTAVTDFNNLPDR.F
UQ9DB9951.0%4421.5%381445767.8(Q9DB99) 1500001J14Rik protein
	TK010303_lung_E18_mito_3_step01.0228.0228.1	1.4699	0.1321	1449.74	2	3750.0%	1	K.VMTDVAGNPEEER.R
	TK010303_lung_E18_mito_3_step12.3468.3468.3	1.9471	0.0357	3764.04	2	1670.0%	1	K.GQMSSFLLSTANQQEISALDSKIHETIESINQLK.I
	TK010303_lung_E18_mito_3_step01.4300.4300.3	1.373	0.0231	4119.14	7	1460.0%	1	K.TACYDIDVEVEEPLKGQMSSFLLSTANQQEISALDSK.I
	TK010303_lung_E18_mito_3_step07.1506.1506.2	0.8639	0.0487	2597.57	4	2110.0%	1	R.AEFYHQPWSQEAVSRYFYCK.I
UQ8R2X051.0%228.1%443500256.4(Q8R2X0) Similar to EH-domain containing 2
	TK010303_lung_E18_mito_3_step01.1116.1116.1	1.7431	0.0324	832.5	2	8330.0%	1	R.KLNDLVK.R
	TK010303_lung_E18_mito_3_step03.2379.2379.3	1.3992	0.0238	3191.62	13	1610.0%	1	R.FMCAQLPNQVLESISIIDTPGILSGAKQR.V
USM4G_MOUSE51.0%339.3%837923787.9(Q9WUH7) Semaphorin 4G precursor
*	TK010303_lung_E18_mito_3_step01.1108.1108.1	1.2072	0.0935	910.41	14	5620.0%	1	K.TSAVGDDDK.I
*	TK010303_lung_E18_mito_3_step09.4500.4500.3	1.5828	0.0198	3527.55	9	1580.0%	1	K.TLEASAICRYDLAEIQAVFTGPFMEYQDGAR.R
*	TK010303_lung_E18_mito_3_step05.3401.3401.3	2.7094	0.0474	4286.24	1	1690.0%	1	R.LNATHFYACGTHAFQPLCAAIDAETFILPTSFEEGKEK.C
UQ9CXB051.0%229.0%624670175.0(Q9CXB0) 8430419L09Rik protein
*	TK010303_lung_E18_mito_3_step09.3875.3875.2	1.5276	0.0253	2727.96	54	1520.0%	1	K.HRSVNLSELIDVYSDGVELLQLVK.A
*	TK010303_lung_E18_mito_3_step12.1953.1953.3	2.7247	0.0641	3405.79	5	1770.0%	1	R.DLVVLAIGELQPDLCFLLVSGRTGSPVGRPVK.Y
UQ9CX9951.0%114.1%217252777.0(Q9CX99) 8430435N19Rik protein
*	TK010303_lung_E18_mito_3_step12.1099.1099.1	1.6527	0.0936	1018.68	1	6880.0%	1	R.GDIVEVVER.E
UQ9QZT551.0%1113.4%179204689.4(Q9QZT5) Prion protein-like protein Dpl
	TK010303_lung_E18_mito_3_step04.2691.2691.3	2.7042	0.2726	2497.98	9	2170.0%	1	K.VLPSSGGQITEARVAENRPGAFIK.Q
UQ9HA9051.0%2419.3%161176696.0(Q9HA90) Hypothetical protein
*	TK010303_lung_E18_mito_3_step10.3074.3074.3	2.7237	0.0423	3475.29	3	1830.0%	2	-.MTYFGHFGGANHAHTLGELEACIAMLVEQLR.T
UQ96M0351.0%2210.0%639717289.0(Q96M03) Hypothetical protein FLJ32934
*	TK010303_lung_E18_mito_3_step11.2324.2324.3	2.7204	0.063	2870.06	2	2080.0%	1	R.EALALMGFTTPLLLVLLYLQALFYR.Y
*	TK010303_lung_E18_mito_3_step02.4497.4497.3	2.1195	0.2454	4573.85	9	1320.0%	1	K.DSCMMVIPQAYHLCYVLMPFKLALCGLASLVQVFCVIPK.Y
UCDN7_MOUSE51.0%3362.0%166178946.4(Q60773) Cyclin-dependent kinase 4 inhibitor D (p19-INK4d)
*	TK010303_lung_E18_mito_3_step04.3291.3291.2	1.3291	0.0483	2187.53	6	2780.0%	1	R.QRGAQNLMDILQGHMMIPM.-
*	TK010303_lung_E18_mito_3_step09.2132.2132.3	1.6727	0.1378	4684.18	5	1100.0%	1	K.VLVEHGADVNALDSTGSLPIHLAIREGHSSVVSFLAPESDLHHR.D
*	TK010303_lung_E18_mito_3_step11.4208.4208.3	2.7136	0.3377	4066.27	10	1220.0%	1	K.TALQVMMFGSPAVALELLKQGASPNVQDASGTSPVHDAAR.T
UQ9D4W651.0%115.2%540600735.3(Q9D4W6) 4930571B16Rik protein
*	TK010303_lung_E18_mito_3_step08.3305.3305.3	2.709	0.2202	3053.07	10	1850.0%	1	K.ARVPSLQEVKPVLIDPQGGEDTLLSCVK.L
UHFE_HUMAN51.0%2210.3%348401086.6(Q30201) Hereditary hemochromatosis protein precursor (HLA-H)
	TK010303_lung_E18_mito_3_step08.1514.1514.1	1.4922	0.1241	1332.97	2	4550.0%	1	R.GAMGHYVLAERE.-
	TK010303_lung_E18_mito_3_step06.3667.3667.2	1.0216	0.0441	2914.93	52	1520.0%	1	K.YGYDGQDHLEFCPDTLDWRAAEPR.A
UQ9BQU750.9%6615.3%12071280867.7(Q9BQU7) BA261N11.4.1 (KIAA1510, isoform 1)
	TK010303_lung_E18_mito_3_step04.3265.3265.3	1.439	0.096	4566.25	4	1280.0%	1	K.KAPSPSQLSMTELPGDAVQLAWVAAAPSGVLVYQITWTPLGEGK.A
*	TK010303_lung_E18_mito_3_step03.4080.4080.3	2.1859	0.2422	4043.82	1	1410.0%	1	R.LVRVTYVSSEGGHSGQTEAPGNATSATLGPLSSSTTYTVR.V
	TK010303_lung_E18_mito_3_step04.4062.4062.2	1.1371	0.0147	2344.45	14	2050.0%	1	R.KVAERPLGEMGSPPAAGFVTLGR.L
*	TK010303_lung_E18_mito_3_step06.4227.4227.3	1.3954	0.022	3493.72	6	1690.0%	1	R.AWQGPGALVESEDLQGPWGPQDCQGPKGNEER.R
	TK010303_lung_E18_mito_3_step03.3572.3572.2	1.7946	0.2506	2696.19	2	1960.0%	1	K.GEEEEREVQVGRPEVLLDGLEPGR.D
	TK010303_lung_E18_mito_3_step08.2782.2782.3	2.3407	0.1448	2337.94	1	2980.0%	1	R.DITVHSVLDFLQLGALAGLLSR.L
UQ91YK050.9%111.6%686788768.1(Q91YK0) Similar to hypothetical protein FLJ20156
*	TK010303_lung_E18_mito_3_step11.1948.1948.1	1.491	0.1209	1465.79	4	4500.0%	1	R.EFYHEKLEEIK.D
UQ9DBN850.9%244.9%550629276.9(Q9DBN8) Cell division cycle 25 homolog B (S. cerevisiae)
*	TK010303_lung_E18_mito_3_step03.3105.3105.2	1.6761	0.2877	3108.98	2	1920.0%	2	R.CLTTEWKMEVEELSPVAQSSSLTPVER.A
UQ8TE7850.9%4414.4%535589206.8(Q8TE78) Hypothetical protein FLJ23843
*	TK010303_lung_E18_mito_3_step01.2788.2788.1	1.3979	0.1973	1285.93	1	5500.0%	1	R.YIMAGFPVCPK.L
*	TK010303_lung_E18_mito_3_step04.2838.2838.2	1.5084	0.0335	2159.77	1	3000.0%	1	K.LSWAEAGSQTAAGAMERAVVR.C
*	TK010303_lung_E18_mito_3_step04.2438.2438.3	1.7713	0.0238	3191.75	1	1920.0%	1	K.FSLLSQHDISFYEALESDPLHKELLEK.L
*	TK010303_lung_E18_mito_3_step02.2005.2005.2	1.4192	0.0567	2184.08	5	2940.0%	1	R.ICVANTHLYWHPKGGYIR.L
UQ9D2G250.9%223.1%454489959.0(Q9D2G2) 4930529O08Rik protein (RIKEN cDNA 4930529O08 gene)
	TK010303_lung_E18_mito_3_step01.1555.1555.1	1.4435	0.1489	852.72	5	5710.0%	1	R.GLVVPVIR.N
	TK010303_lung_E18_mito_3_step01.2763.2763.1	1.3141	0.2131	685.46	1	7000.0%	1	R.VLLLDL.-
UO3505350.8%81015.2%11361143548.4(O35053) Collagen a1 XIX chain
*	TK010303_lung_E18_mito_3_step12.2728.2728.2	1.469	0.0027	2369.72	2	2400.0%	1	K.GDAGPPGISLPGKPGLDGNPGSPGPR.E
*	TK010303_lung_E18_mito_3_step05.3354.3354.2	1.5314	0.1373	1980.13	3	3120.0%	1	K.IFPKGLPEEYAIAVMFR.V
*	TK010303_lung_E18_mito_3_step03.2743.2743.3	2.2694	0.1281	2969.49	2	2000.0%	1	K.GSTGPPGHQGPPGNPGIPGTPADAVSFEEIK.H
*	TK010303_lung_E18_mito_3_step08.4066.4066.2	1.614	0.3029	1995.36	2	2620.0%	1	R.GLPGLHGSPGDTGPPGVGIPGR.T
*	TK010303_lung_E18_mito_3_step08.4373.4373.3	2.28	0.0502	4124.42	2	1350.0%	1	K.GSTGPPGHQGPPGNPGIPGTPADAVSFEEIKHYINQEVLR.I
*	TK010303_lung_E18_mito_3_step11.1585.1585.2	1.1806	0.082	2359.37	102	2000.0%	1	K.GDEGLQGIPGLSGAPGPTGPPGLTGR.T
*	TK010303_lung_E18_mito_3_step11.2623.2623.3	2.1583	0.1158	4009.64	10	1160.0%	2	K.TGPPGNPGPPGPPGPPGLQGLQQPFGGYFNKGTGEHGASGPK.G
UFUCO_HUMAN50.8%4422.1%461531766.7(P04066) Tissue alpha-L-fucosidase precursor (EC 3.2.1.51) (Alpha-L-fucosidase I) (Alpha-L-fucoside fucohydrolase)
*	TK010303_lung_E18_mito_3_step01.3382.3382.3	1.5644	0.2527	4318.72	43	1120.0%	1	K.NTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK.I
*	TK010303_lung_E18_mito_3_step10.3570.3570.2	1.3607	0.0114	2564.36	1	2500.0%	1	K.WLSINGEAIYASKPWRVQWEK.N
*	TK010303_lung_E18_mito_3_step08.4021.4021.3	1.8324	0.047	3896.96	10	1290.0%	1	R.RDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTK.D
*	TK010303_lung_E18_mito_3_step03.2021.2021.2	1.7226	0.2642	2475.67	1	2380.0%	1	R.LLAVGKWLSINGEAIYASKPWR.V
UQ9CSI050.8%244.0%528601369.6(Q9CSI0) 2810021H22Rik protein (Fragment)
	TK010303_lung_E18_mito_3_step02.4293.4293.2	1.3802	0.0333	2290.46	8	2250.0%	2	R.TGLFSATQTQEVENLVRAGLR.N
UQ99JU650.8%2210.1%237262454.5(Q99JU6) Similar to hypothetical protein FLJ12443
*	TK010303_lung_E18_mito_3_step03.3785.3785.2	1.7145	0.2462	2608.7	2	2390.0%	1	K.TALGVSELTVTDLFQAIDQEDKGR.I
*	TK010303_lung_E18_mito_3_step02.3770.3770.2	1.7452	0.2621	2393.34	1	2860.0%	1	K.TALGVSELTVTDLFQAIDQEDK.G
USPH2_HUMAN50.8%4415.4%654692176.9(Q9NRA0) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2)
*	TK010303_lung_E18_mito_3_step04.3074.3074.2	1.1629	0.0175	2406.87	11	2050.0%	1	R.LSYLPATVEPASPTPAHSLPRAK.S
*	TK010303_lung_E18_mito_3_step03.4065.4065.3	1.9908	0.2427	4171.67	5	1180.0%	1	R.GGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSER.F
*	TK010303_lung_E18_mito_3_step11.4213.4213.2	1.7277	0.2589	2230.31	1	3060.0%	1	R.LLLLVNPFGGRGLAWQWCK.N
*	TK010303_lung_E18_mito_3_step12.4316.4316.2	0.9891	0.0414	2370.2	100	1670.0%	1	R.AKSELTLTPDPAPPMAHSPLHR.S
URGL2_HUMAN50.7%4410.7%777835496.2(O15211) Ral guanine nucleotide dissociation stimulator-like 2 (RalGDS-like factor) (RAS-associated protein RAB2L)
*	TK010303_lung_E18_mito_3_step09.3586.3586.3	1.9538	0.1725	3246.31	1	1690.0%	1	R.RSASCGSPLSGGAEEASGGTGYGGEGSGPGASDCR.I
*	TK010303_lung_E18_mito_3_step11.1760.1760.2	1.2733	0.0309	2748.8	17	1550.0%	1	R.RSSTATPGVTSGPSASGTPPSEGGGGSFPR.I
	TK010303_lung_E18_mito_3_step01.0288.0288.1	1.405	0.0767	1138.55	79	3890.0%	1	K.LQSPLEPHSK.K
	TK010303_lung_E18_mito_3_step01.0983.0983.1	1.5059	0.1119	958.6	4	5710.0%	1	R.ELLVQEVK.L
UNUDM_HUMAN50.7%112.8%355407518.5(O95299) NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-42KD) (CI-42KD)
	TK010303_lung_E18_mito_3_step01.2298.2298.1	1.7657	0.0049	1210.88	10	5000.0%	1	K.KTFLPEMSEK.C
UTUB_MOUSE50.7%114.8%505553628.7(P50586) Tubby protein
	TK010303_lung_E18_mito_3_step09.2847.2847.2	1.6218	0.2985	2572.89	1	2390.0%	1	K.FTVYDNGVNPQKASSSTLESGTLR.Q
UCA2B_MOUSE50.7%8813.0%16501620728.1(Q64739) Collagen alpha 2(XI) chain precursor
*	TK010303_lung_E18_mito_3_step01.2092.2092.1	1.3781	0.22	1517.06	1	4000.0%	1	R.TGPTGDPGPTGLMGEK.G
	TK010303_lung_E18_mito_3_step09.4116.4116.2	1.3472	0.0063	2746.28	1	1920.0%	1	R.LLLFLPLVLGLSAAPGWAGAPSVDVLR.A
*	TK010303_lung_E18_mito_3_step09.1900.1900.3	1.3976	0.0108	3315.28	3	1570.0%	1	K.GSLGPQGEPGPPGQQGTPGAQGLPGPQGAIGPHGEK.G
	TK010303_lung_E18_mito_3_step02.4312.4312.3	1.7289	0.0776	4373.07	12	1170.0%	1	K.GEKGEPAVLEPGMFVEGPPGPEGPAGLAGPPGIQGNPGPVGDPGER.G
*	TK010303_lung_E18_mito_3_step07.2517.2517.2	1.6745	0.2124	1761.88	2	3240.0%	1	K.GHPGLIGLIGPTGEQGEK.G
	TK010303_lung_E18_mito_3_step10.2558.2558.2	1.5797	0.1329	1739.15	1	3530.0%	1	K.GNQGPSGPQGPLGYPGPR.G
	TK010303_lung_E18_mito_3_step07.3073.3073.3	1.6808	0.1423	3110.1	1	1670.0%	1	R.DGVQGPVGLPGPAGPPGVAGEDGDKGEVGDPGQK.G
*	TK010303_lung_E18_mito_3_step08.2150.2150.2	1.4357	0.0447	1715.32	20	2220.0%	1	K.TGPVGPAGLAGKPGPDGLR.G
UQ8R4G650.7%4416.1%740845518.2(Q8R4G6) N-acetylglucosaminyltransferase V
*	TK010303_lung_E18_mito_3_step09.3316.3316.3	2.6413	0.2339	4081.64	4	1220.0%	1	K.VDNLVNGTGANSTNSTTAVPSLVSLEKINVADIINGVQEK.C
	TK010303_lung_E18_mito_3_step02.1866.1866.3	1.7161	0.1114	2834.89	29	1590.0%	1	K.AILNQKIEPYMPYEFTCEGMLQR.I
*	TK010303_lung_E18_mito_3_step11.4192.4192.3	1.7381	0.1832	4187.83	20	1440.0%	1	K.DMWRSDPCYADYGVDGTSCSFFIYLSEVENWCPR.L
*	TK010303_lung_E18_mito_3_step12.2856.2856.3	1.8325	0.0194	2752.98	10	2020.0%	1	K.QVCQESQLICEPSFFQHLNKEK.D
UO1502350.7%6185.1%15391688484.8(O15023) Hypothetical protein KIAA0305 (Endofin)
*	TK010303_lung_E18_mito_3_step10.3723.3723.3	2.0345	0.0412	3712.96	1	1540.0%	3	K.GLTSIQNEKNVTGLDLLSSVDGGTSDEIQPLYMGR.C
*	TK010303_lung_E18_mito_3_step05.3658.3658.3	1.9919	0.0053	4785.05	21	990.0%	3	K.SNADSLIGLDLSSVSDTPCVSSTDHDSDTVREQQNDTSSELQNR.E
URYR3_HUMAN50.7%16287.8%48705519395.7(Q15413) Ryanodine receptor 3 (Brain-type ryanodine receptor) (RyR3) (RYR-3) (Brain ryanodine receptor-calcium release channel)
*	TK010303_lung_E18_mito_3_step02.3538.3538.2	1.4381	0.2117	3023.16	10	1730.0%	1	R.VGWARPGCRPDVELGADDQAFVFEGNR.G
*	TK010303_lung_E18_mito_3_step09.3812.3812.3	2.1271	0.1026	3549.54	4	1700.0%	4	K.EFRSPPQEQINMLLNFQLGENCPCPEEIR.E
*	TK010303_lung_E18_mito_3_step03.2577.2577.3	2.1712	0.0258	2487.9	7	2380.0%	1	K.ILGDMPDPTQFGIHDDTMEAER.A
*	TK010303_lung_E18_mito_3_step11.2925.2925.2	1.217	0.0563	2610.42	11	1900.0%	1	R.LFHGHDECLTIPSTDQNDSQHR.R
*	TK010303_lung_E18_mito_3_step08.1925.1925.3	1.9259	0.1042	4398.01	3	1290.0%	1	K.EINDLAESGARYTEMPHVIEVILPMLCNYLSYWWER.G
*	TK010303_lung_E18_mito_3_step02.3385.3385.2	1.7926	0.2241	2753.72	3	2170.0%	1	R.CAPLFAGTEHCTSLIDSTLQTIYR.L
*	TK010303_lung_E18_mito_3_step01.2524.2524.1	1.7014	0.0745	1245.65	5	5000.0%	1	K.FLQVNGIIVSR.G
*	TK010303_lung_E18_mito_3_step08.1930.1930.3	1.4427	0.0555	4350.43	31	1080.0%	1	K.FFAKVLLPLVDQYFTSHCLYFLSSPLKPLSSSGYASHK.E
*	TK010303_lung_E18_mito_3_step07.3061.3061.3	1.8524	0.0080	3483.34	108	1210.0%	1	K.VLDILCSLCLCNGVAVRANQNLICDNLLPR.R
*	TK010303_lung_E18_mito_3_step07.3785.3785.3	1.5611	0.0083	4283.56	102	990.0%	1	K.GSELAFADYEIENGFVPICCLGLSQIGRMNLGTDASTFK.F
*	TK010303_lung_E18_mito_3_step05.4013.4013.3	1.786	0.102	4164.62	1	1350.0%	1	R.SNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPNTK.V
*	TK010303_lung_E18_mito_3_step03.3056.3056.2	1.4241	0.1305	1980.32	21	2190.0%	1	R.EHATGEACWWTIHPASK.Q
*	TK010303_lung_E18_mito_3_step09.4608.4608.3	1.0089	0.0332	4672.48	12	680.0%	1	R.VGWASSSGYAPCPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPR.A
UQ8VCT450.6%241.8%565617886.6(Q8VCT4) Carboxylesterase 3
	TK010303_lung_E18_mito_3_step01.0287.0287.1	1.4748	0.1196	1084.54	3	4440.0%	2	K.YLGGTDDLTK.K
UQ9Y4K250.6%112.4%373410239.4(Q9Y4K2) Hypothetical protein (Fragment)
*	TK010303_lung_E18_mito_3_step06.1949.1949.1	1.4763	0.1214	1100.54	2	6250.0%	1	R.ENLKLEILK.N
UMXI1_MOUSE50.6%229.2%228259787.3(P50540) MAX interacting protein 1 (MXI1 protein)
	TK010303_lung_E18_mito_3_step11.1321.1321.1	1.4271	0.0399	1191.64	2	5560.0%	1	R.LLEAAEFLER.R
	TK010303_lung_E18_mito_3_step01.2015.2015.1	1.4903	0.1174	1196.68	2	5000.0%	1	R.HTTLGLLNKAK.A
UICEE_MOUSE50.6%114.3%257294584.8(O89094) Caspase-14 precursor (EC 3.4.22.-) (CASP-14) (Mini-ICE) (MICE)
*	TK010303_lung_E18_mito_3_step01.3434.3434.1	1.4541	0.1452	1336.81	1	5000.0%	1	R.LEDLFEVLNNK.N
UQ6445350.6%114.6%455505738.4(Q64453) Mino levulinate synthase (EC 2.3.1.37) (Fragment)
	TK010303_lung_E18_mito_3_step12.2548.2548.2	1.7868	0.2536	2386.05	4	2250.0%	1	R.QMLMDAGLPVIHCPSHIIPVR.V
UQ9JMD450.4%555.1%17652013058.3(Q9JMD4) Voltage-gated sodium channel alpha subunit NaT/Scn11a
	TK010303_lung_E18_mito_3_step11.3449.3449.2	1.7028	0.0142	3012.57	4	1960.0%	1	K.IIGHSVGALGNLTVVLTIVVFIFSVVGMR.L
	TK010303_lung_E18_mito_3_step10.2430.2430.2	1.6999	0.2666	2823.91	1	2200.0%	1	R.QNSPKPNEATESFAGESRDTATLDTR.S
	TK010303_lung_E18_mito_3_step02.3822.3822.2	0.9086	0.0405	2258.36	56	1940.0%	1	R.LSQNLPVELFDEHVDPLHR.Q
	TK010303_lung_E18_mito_3_step01.3802.3802.1	1.0611	0.0469	1009.72	7	4380.0%	1	R.ALSQFEGMK.V
	TK010303_lung_E18_mito_3_step01.1671.1671.1	1.1469	0.0324	912.63	16	5830.0%	1	K.TCYQIVK.H
UQ9H4Q450.4%2216.6%367404038.3(Q9H4Q4) PR-domain containing protein 12
*	TK010303_lung_E18_mito_3_step02.4274.4274.2	1.7093	0.2624	2656.34	1	2710.0%	1	K.SHHASPKTAFTAEVLAQSFSGEVQK.L
*	TK010303_lung_E18_mito_3_step08.3566.3566.3	1.5965	0.1159	4009.75	1	1640.0%	1	K.AIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEDQK.K
UTBD_MOUSE50.3%225.7%455510237.1(Q9R1K7) Tubulin delta chain (Delta tubulin)
*	TK010303_lung_E18_mito_3_step01.0826.0826.1	1.3707	0.2095	1368.51	5	4500.0%	1	K.RDNEAYQASCR.E
*	TK010303_lung_E18_mito_3_step11.2285.2285.2	1.6805	0.2107	1752.5	1	4290.0%	1	K.EHHFNTSLANLVVLR.G
UQ9D4X750.3%398.0%314359668.5(Q9D4X7) 2610020H15Rik protein
	TK010303_lung_E18_mito_3_step08.3760.3760.2	1.9824	0.231	2697.66	1	2290.0%	3	-.MSSTAAFCLLSTLGGYLVTSFLLLK.Y
UQ9CX8350.2%241.5%456506439.3(Q9CX83) 3010033I09Rik protein (RIKEN cDNA 3010033I09 gene)
	TK010303_lung_E18_mito_3_step01.0558.0558.1	1.1396	0.183	802.44	17	5000.0%	2	K.VLKVLTK.L
UQ9D69350.2%4414.7%551626855.7(Q9D693) 4631423C22Rik protein
	TK010303_lung_E18_mito_3_step01.1704.1704.1	1.6846	0.0771	1163.71	5	6110.0%	1	-.MEEAELVKGR.L
	TK010303_lung_E18_mito_3_step08.2796.2796.2	1.1515	0.0072	2563.84	33	1750.0%	1	K.QNQQDQHQTQVLEQSILRLEK.E
	TK010303_lung_E18_mito_3_step06.3622.3622.2	1.1282	0.0672	2649.0	7	1900.0%	1	K.SPTEYHEPVYANPFCRPVTPQR.E
	TK010303_lung_E18_mito_3_step10.2414.2414.3	2.1691	0.056	2830.08	54	1760.0%	1	R.LGSPARHSPLDVPVAGDGTEDPSLTALR.I
UQ96N4150.2%1119.7%137155144.5(Q96N41) Hypothetical protein FLJ31438
*	TK010303_lung_E18_mito_3_step03.3005.3005.2	1.6102	0.2889	3025.8	1	2310.0%	1	K.LLQEINKGGIDAVESLMINDSFCSIEK.W
UO0878450.1%335.9%13201350019.3(O08784) Treacle protein (Treacher collins syndrome protein) (Putative nucleolar trafficking phosphoprotein)
*	TK010303_lung_E18_mito_3_step01.1910.1910.1	1.7512	0.0601	1520.52	7	3440.0%	1	K.AGAVTSSASLSSPALAK.G
*	TK010303_lung_E18_mito_3_step07.2474.2474.3	2.3546	0.3725	4359.2	3	1310.0%	1	K.ASGTTAQSSSSESEDGDEDLIPATQPSTYALRTSVTTPAALSR.A
*	TK010303_lung_E18_mito_3_step08.3833.3833.2	1.0696	0.0549	1770.56	31	2650.0%	1	K.ATPRPDSNSLASSAPATK.D
URIP3_MOUSE50.1%446.6%10241163636.2(P97434) Rho-interacting protein 3 (p116RIP) (RIP3)
*	TK010303_lung_E18_mito_3_step02.3261.3261.3	1.675	0.09	4352.7	56	880.0%	1	R.DSVAEEAADLDGEINLSTCYDVTEYPVQRNYGFQIHTK.E
*	TK010303_lung_E18_mito_3_step01.4200.4200.1	1.7365	0.031	1109.69	7	5620.0%	1	R.KFQANIFNK.S
*	TK010303_lung_E18_mito_3_step08.1574.1574.1	1.0842	0.0628	1192.47	37	3890.0%	1	K.FSLCILTPDK.E
	TK010303_lung_E18_mito_3_step04.2177.2177.1	1.6115	0.042	1392.57	3	4500.0%	1	R.QYLEELQSVQR.E
UO6026750.0%226.8%632656848.5(O60267) Hypothetical protein KIAA0512 (Armadillo repeat protein ALEX2) (Similar to armadillo repeat protein ALEX2)
*	TK010303_lung_E18_mito_3_step10.3757.3757.2	2.087	0.2039	2517.56	1	3250.0%	1	R.RPVAMQKRPFPYEIDEILGVR.D
*	TK010303_lung_E18_mito_3_step11.2855.2855.2	1.7131	0.0642	2006.25	38	2380.0%	1	K.ATPGAHTGAIPKATSATGAVPK.G
ProteinsPeptide IDsCopies
Unfiltered205204648646691
Filtered157510406122508