WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'D03H02.seq' (270 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 7 Sequences : less than 7 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1326 433 |============================================================= 6310 893 231 |================================= 3980 662 166 |======================= 2510 496 145 |==================== 1580 351 93 |============= 1000 258 75 |========== 631 183 37 |===== 398 146 28 |==== 251 118 13 |= 158 105 5 |: 100 100 7 |= 63.1 93 4 |: 39.8 89 3 |: 25.1 86 1 |: 15.8 85 0 | >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 85 <<<<<<<<<<<<<<<<< 10.0 85 4 |: 6.31 81 3 |: 3.98 78 1 |: 2.51 77 0 | 1.58 77 2 |: 1.00 75 0 | 0.63 75 2 |: 0.40 73 0 | 0.25 73 2 |: 0.16 71 0 | 0.10 71 0 | 0.063 71 0 | 0.040 71 1 |: 0.025 70 3 |: 0.016 67 2 |: 0.010 65 0 | 0.0063 65 1 |: 0.0040 64 2 |: 0.0025 62 1 |: 0.0016 61 2 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|11465937ref|NP_054479.1| ribosomal protein S16 [Ni... +2 323 4.4e-28 1 gi|1350878|sp|P32087|RR16_SOLTUCHLOROPLAST 30S RIBOSO... +2 310 1.1e-26 1 gi|6723716|emb|CAB67125.1|(AJ271079) ribosomal protei... +2 304 4.5e-26 1 gi|11497506ref|NP_054914.1| ribosomal protein S16 [Sp... +2 293 6.7e-25 1 gi|133812|sp|P10359|RR16_SINALCHLOROPLAST 30S RIBOSOM... +2 290 1.4e-24 1 gi|836625|emb|CAA77799.1|(Z11741) ribosomal protein S... +2 290 1.4e-24 1 gi|133806|sp|P25875|RR16_HORVUCHLOROPLAST 30S RIBOSOM... +2 280 1.6e-23 1 gi|11467173ref|NP_043006.1| ribosomal protein S16 [Ze... +2 279 2.0e-23 1 gi|7525015ref|NP_051041.1| ribosomal protein S16 [Ara... +2 251 1.9e-20 1 gi|11466392ref|NP_038395.1| ribosomal protein S16 [Me... +2 183 3.0e-13 1 gi|6692965|gb|AAF24924.1|(AF110598) 30S ribosomal pro... +2 172 4.4e-12 1 gi|6692966|gb|AAF24925.1|(AF110599) 30S ribosomal pro... +2 171 5.6e-12 1 gi|6692901|gb|AAF24860.1|(AF110534) 30S ribosomal pro... +2 167 1.5e-11 1 gi|11466766ref|NP_039362.1| ribosomal protein S16 [Or... +2 166 1.9e-11 1 gi|7688600|gb|AAF67441.1|(AF123753) ribosomal protein... +2 166 1.9e-11 1 gi|7688590|gb|AAF67436.1|(AF123748) ribosomal protein... +2 165 2.4e-11 1 gi|7688556|gb|AAF67419.1|(AF123731) ribosomal protein... +2 164 3.1e-11 1 gi|6692974|gb|AAF24933.1|(AF110607) 30S ribosomal pro... +2 163 4.0e-11 1 gi|7688554|gb|AAF67418.1|(AF123730) ribosomal protein... +2 163 4.0e-11 1 gi|2500468|sp|P74410|RS16_SYNY330S RIBOSOMAL PROTEIN ... +2 161 6.5e-11 1 gi|11465818ref|NP_053962.1| 30S ribosomal protein S16... +2 159 1.1e-10 1 gi|11467374ref|NP_043231.1| ribosomal protein S16 [Cy... +2 145 3.2e-09 1 gi|10120996|pdb|1EMW|AChain A, Solution Structure Of ... +2 141 8.5e-09 1 gi|7488723|pir||T06340ribosomal protein S16 - soybean... +3 140 1.1e-08 1 gi|7440449|pir||T05282ribosomal protein S16, organell... +2 140 1.1e-08 1 gi|7769072|gb|AAF69243.1|AF173880_6(AF173880) 30S rib... +2 138 1.8e-08 1 gi|6692969|gb|AAF24928.1|(AF110602) 30S ribosomal pro... +2 135 3.7e-08 1 gi|11357038|pir||E82874ribosomal protein S16 UU568 [i... +2 133 6.0e-08 1 gi|12056104|emb|CAC21226.1|(AJ224859) ribosomal prote... +2 133 6.0e-08 1 gi|11467622ref|NP_050674.1| ribosomal protein S16 [Gu... +2 132 7.7e-08 1 gi|6015979|gb|AAF01482.1|AF137263_1(AF137263) 30S rib... +2 128 2.0e-07 1 gi|11467477ref|NP_043623.1| 30S ribosomal protein S16... +2 127 2.6e-07 1 gi|7388144|sp|Q9Z965|RS16_CHLPN30S RIBOSOMAL PROTEIN ... +2 126 3.3e-07 1 gi|7388157|sp|Q9X1Q2|RS16_THEMA30S RIBOSOMAL PROTEIN ... +2 126 3.3e-07 1 gi|6094161|sp|O83875|RS16_TREPA30S RIBOSOMAL PROTEIN ... +2 123 6.9e-07 1 gi|6601576|gb|AAF19037.1|(L08896) 30S ribosomal prote... +2 123 6.9e-07 1 gi|12724572|gb|AAK05667.1|AE006387_10(AE006387) 30S r... +2 122 8.8e-07 1 gi|133804|sp|P28521|RR16_CYACACHLOROPLAST 30S RIBOSOM... +2 119 1.8e-06 1 gi|11276624|pir||E8118030S ribosomal protein S16 NMB0... +2 116 3.8e-06 1 gi|6094159|sp|O69879|RS16_STRCO30S RIBOSOMAL PROTEIN ... +2 115 4.8e-06 1 gi|6094160|sp|O86868|RS16_STRLI30S RIBOSOMAL PROTEIN ... +2 115 4.8e-06 1 gi|11360423|pir||H8284730S ribosomal protein S16 XF01... +2 115 4.8e-06 1 gi|7388142|sp|O84029|RS16_CHLTR30S RIBOSOMAL PROTEIN ... +2 113 7.9e-06 1 gi|8163190|gb|AAF73544.1|(AE002297) ribosomal protein... +2 113 7.9e-06 1 gi|585937|sp|P21474|RS16_BACSU30S RIBOSOMAL PROTEIN S... +2 111 1.3e-05 1 gi|3024578|sp|O07348|RS16_THEAQ30S RIBOSOMAL PROTEIN ... +2 110 1.6e-05 1 gi|8777434|dbj|BAA97024.1|(AB024035) 30S ribosomal pr... +2 110 1.6e-05 1 gi|7473841|pir||D75414ribosomal protein S16 - Deinoco... +2 109 2.1e-05 1 gi|10175103|dbj|BAB06202.1|(AP001515) 30S ribosomal p... +2 107 3.4e-05 1 gi|3914894|sp|P81290|RS16_BACST30S RIBOSOMAL PROTEIN ... +2 105 5.6e-05 1
Use the
and
icons to retrieve links to Entrez:
WARNING: Descriptions of 35 database sequences were not reported due to the limiting value of parameter V = 50.>gi|11465937 ref|NP_054479.1| ribosomal protein S16 [Nicotiana tabacum] >gi|133814|sp|P06374|RR16_TOBAC CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|71001|pir||R3NT16 ribosomal protein S16, chloroplast - common tobacco chloroplast >gi|11806|emb|CAA27149.1| (X03415) ribosomal protein S16 [Nicotiana tabacum] >gi|435266|emb|CAA77340.1| (Z00044) ribosomal protein S16 [Nicotiana tabacum] >gi|225241|prf||1211235C ribosomal protein S16 [Nicotiana tabacum] Length = 85 Frame 2 hits (HSPs): ____________________________________________ __________________________________________________ Database sequence: | | | | | | 85 0 20 40 60 80 Plus Strand HSPs: Score = 323 (113.7 bits), Expect = 4.4e-28, P = 4.4e-28 Identities = 63/75 (84%), Positives = 67/75 (89%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQRAVYRIVAIDVRSR EG+DLRKVGFYDPIKNQTYLN+P ILYFLE+GAQPTGTVQD Sbjct: 10 GRKQRAVYRIVAIDVRSRREGKDLRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQD 69 Query: 206 ILKRAGVFMXLSSNQ 250 ILK+A VF L NQ Sbjct: 70 ILKKAEVFKELRPNQ 84
>gi|1350878|sp|P32087|RR16_SOLTU CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|7440451|pir||T07057 ribosomal protein S16, chloroplast - potato >gi|516564|gb|AAA74421.1| (U11638) ribosomal protein S16 [Solanum tuberosum] Length = 88 Frame 2 hits (HSPs): ___________________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00732A: Ribosomal protein S16 proteins 1..36 BLOCKS BL00732B: Ribosomal protein S16 proteins 48..74 PFAM Ribosomal_S16: Ribosomal protein S16 8..64 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 8..63 PRODOM PD158799: RR16_SOLTU 65..87 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 2..11 __________________ Plus Strand HSPs: Score = 310 (109.1 bits), Expect = 1.1e-26, P = 1.1e-26 Identities = 61/75 (81%), Positives = 66/75 (88%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQRAVYRIVAIDVRSR EG+DL+KVGFYDPIKNQTYLN+P ILYFLE+GAQPT TVQD Sbjct: 10 GRKQRAVYRIVAIDVRSRREGKDLQKVGFYDPIKNQTYLNVPAILYFLEKGAQPTETVQD 69 Query: 206 ILKRAGVFMXLSSNQ 250 ILK+A VF L NQ Sbjct: 70 ILKKAEVFKELRLNQ 84
>gi|6723716|emb|CAB67125.1| (AJ271079) ribosomal protein S16 [Oenothera elata subsp. hookeri] Length = 88 Frame 2 hits (HSPs): ___________________________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 Plus Strand HSPs: Score = 304 (107.0 bits), Expect = 4.5e-26, P = 4.5e-26 Identities = 61/75 (81%), Positives = 65/75 (86%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQRAVYRIVAIDVRSR EGRDL KVGFYDPI N+TYL+IP ILYFLE+GAQPTGTV D Sbjct: 10 GKKQRAVYRIVAIDVRSRREGRDLWKVGFYDPINNKTYLDIPGILYFLEKGAQPTGTVYD 69 Query: 206 ILKRAGVFMXLSSNQ 250 ILK+AGVF S NQ Sbjct: 70 ILKKAGVFTEFSLNQ 84
>gi|11497506 ref|NP_054914.1| ribosomal protein S16 [Spinacia oleracea] >gi|7636087|emb|CAB88707.1| (AJ400848) ribosomal protein S16 [Spinacia oleracea] Length = 88 Frame 2 hits (HSPs): _____________________________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 Plus Strand HSPs: Score = 293 (103.1 bits), Expect = 6.7e-25, P = 6.7e-25 Identities = 61/80 (76%), Positives = 66/80 (82%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQRAVYRIVAIDVRSR EGRDL+KVGFYDPIK+QTYLN+P IL FLE+GAQPT TV D Sbjct: 10 GRKQRAVYRIVAIDVRSRREGRDLQKVGFYDPIKSQTYLNVPAILDFLEKGAQPTETVYD 69 Query: 206 ILKRAGVFMXLSSNQQTXFH 265 ILKRA VF NQ T F+ Sbjct: 70 ILKRAEVFKEFRLNQ-TKFN 88
>gi|133812|sp|P10359|RR16_SINAL CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|71000|pir||R3IS16 ribosomal protein S16, chloroplast - white mustard chloroplast >gi|12217|emb|CAA31944.1| (X13609) 16S ribosomal protein [Sinapis alba] Length = 88 Frame 2 hits (HSPs): ___________________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00732A: Ribosomal protein S16 proteins 1..36 BLOCKS BL00732B: Ribosomal protein S16 proteins 48..74 DOMO DM00778: ESCHERICHIACOLIRIBOSOMALPROTEIN 1..39 DOMO DM01106: ESCHERICHIACOLIRIBOSOMALPROTEIN 41..82 PFAM Ribosomal_S16: Ribosomal protein S16 8..64 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 8..63 PRODOM PD158798: RR16_SINAL 65..87 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 2..11 __________________ Plus Strand HSPs: Score = 290 (102.1 bits), Expect = 1.4e-24, P = 1.4e-24 Identities = 57/75 (76%), Positives = 64/75 (85%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQRAVYRIVAIDVRSR EGRDLRKVGFYDPI NQTYLN+P IL FL++GAQPT TV D Sbjct: 10 GRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPITNQTYLNLPAILDFLKKGAQPTRTVHD 69 Query: 206 ILKRAGVFMXLSSNQ 250 I K+AG+F L+ N+ Sbjct: 70 ISKKAGIFTELNLNK 84
>gi|836625|emb|CAA77799.1| (Z11741) ribosomal protein S16 [Solanum tuberosum] Length = 74 Frame 2 hits (HSPs): _______________________________________________ __________________________________________________ Database sequence: | | | | | 74 0 20 40 60 Plus Strand HSPs: Score = 290 (102.1 bits), Expect = 1.4e-24, P = 1.4e-24 Identities = 57/70 (81%), Positives = 62/70 (88%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQDILKRA 220 AVYRIVAIDVRSR EG+DL+KVGFYDPIKNQTYLN+P ILYFLE+GAQPT TVQDILK+A Sbjct: 1 AVYRIVAIDVRSRREGKDLQKVGFYDPIKNQTYLNVPAILYFLEKGAQPTETVQDILKKA 60 Query: 221 GVFMXLSSNQ 250 VF L NQ Sbjct: 61 EVFKELRLNQ 70
>gi|133806|sp|P25875|RR16_HORVU CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|282999|pir||S28766 ribosomal protein S16, chloroplast - barley chloroplast >gi|11603|emb|CAA36973.1| (X52765) ribosomal protein rps16 [Hordeum vulgare] Length = 85 Frame 2 hits (HSPs): ________________________________________ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | 85 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00732A: Ribosomal protein S16 proteins 1..36 BLOCKS BL00732B: Ribosomal protein S16 proteins 48..74 DOMO DM00778: ESCHERICHIACOLIRIBOSOMALPROTEIN 1..39 DOMO DM01106: ESCHERICHIACOLIRIBOSOMALPROTEIN 41..82 PFAM Ribosomal_S16: Ribosomal protein S16 8..64 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 8..63 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 2..11 __________________ Plus Strand HSPs: Score = 280 (98.6 bits), Expect = 1.6e-23, P = 1.6e-23 Identities = 55/68 (80%), Positives = 60/68 (88%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQ+AVYRIVAIDVRSR EGRDLRKVGFYDPIKNQT LN+P ILYFLE+GAQPT TV D Sbjct: 10 GRKQQAVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYD 69 Query: 206 ILKRAGVF 229 IL++A F Sbjct: 70 ILRKAEFF 77
>gi|11467173 ref|NP_043006.1| ribosomal protein S16 [Zea mays] >gi|133809|sp|P27723|RR16_MAIZE CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|71002|pir||R3ZM16 ribosomal protein S16, chloroplast - maize chloroplast >gi|14292|emb|CAA43215.1| (X60823) ribosomal protein S16 [Zea mays] >gi|902203|emb|CAA60267.1| (X86563) ribosomal protein S16 [Zea mays] Length = 85 Frame 2 hits (HSPs): ________________________________________ __________________________________________________ Database sequence: | | | | | | 85 0 20 40 60 80 Plus Strand HSPs: Score = 279 (98.2 bits), Expect = 2.0e-23, P = 2.0e-23 Identities = 54/68 (79%), Positives = 60/68 (88%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQ+A+YRIVAIDVRSR EGRDLRKVGFYDPIKNQT LN+P ILYFLE+GAQPT TV D Sbjct: 10 GRKQQAIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYD 69 Query: 206 ILKRAGVF 229 IL++A F Sbjct: 70 ILRKAEFF 77
>gi|7525015 ref|NP_051041.1| ribosomal protein S16 [Arabidopsis thaliana] >gi|6685910|sp|P56806|RR16_ARATH CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|5881676|dbj|BAA84367.1| (AP000423) ribosomal protein S16 [Arabidopsis thaliana] Length = 79 Frame 2 hits (HSPs): ____________________________________________ __________________________________________________ Database sequence: | | | | | 79 0 20 40 60 Plus Strand HSPs: Score = 251 (88.4 bits), Expect = 1.9e-20, P = 1.9e-20 Identities = 49/68 (72%), Positives = 56/68 (82%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQRAVYRI+AIDVR R EGRDL KVGFYDPI NQT+LN+ IL FL++GAQPT T D Sbjct: 10 GRKQRAVYRILAIDVRYRREGRDLSKVGFYDPITNQTFLNLSAILDFLKKGAQPTRTAHD 69 Query: 206 ILKRAGVF 229 I K+AG+F Sbjct: 70 ISKKAGIF 77
>gi|11466392 ref|NP_038395.1| ribosomal protein S16 [Mesostigma viride] >gi|7259535|gb|AAF43836.1|AF166114_48 (AF166114) ribosomal protein S16 [Mesostigma viride] Length = 84 Frame 2 hits (HSPs): ___________________________________________ __________________________________________________ Database sequence: | | | | | | 84 0 20 40 60 80 Plus Strand HSPs: Score = 183 (64.4 bits), Expect = 3.0e-13, P = 3.0e-13 Identities = 34/72 (47%), Positives = 54/72 (75%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G K+R YR++AID R R +G+ L+++GFYDPI +T L++P I+++L+ GAQ + TV + Sbjct: 10 GRKKRPFYRVIAIDSRCRRDGKALKELGFYDPIAGKTQLDVPNIIFYLKAGAQTSETVGN 69 Query: 206 ILKRAGVFMXLS 241 +L++A VF LS Sbjct: 70 LLQKAKVFNQLS 81
>gi|6692965|gb|AAF24924.1| (AF110598) 30S ribosomal protein S16 [Eremocharis fruticosa] >gi|6692967|gb|AAF24926.1| (AF110600) 30S ribosomal protein S16 [Bolax gummifera] >gi|6692968|gb|AAF24927.1| (AF110601) 30S ribosomal protein S16 [Klotzschia rhizophylla] >gi|6692973|gb|AAF24932.1| (AF110606) 30S ribosomal protein S16 [Xanthosia atkinsoniana] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 172 (60.5 bits), Expect = 4.4e-12, P = 4.4e-12 Identities = 33/36 (91%), Positives = 35/36 (97%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRIVAIDVRSR EGRDLRKVGFYDPIKNQ+YLN+ Sbjct: 1 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQSYLNV 36
>gi|6692966|gb|AAF24925.1| (AF110599) 30S ribosomal protein S16 [Azorella trifurcata] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 171 (60.2 bits), Expect = 5.6e-12, P = 5.6e-12 Identities = 32/36 (88%), Positives = 35/36 (97%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRI+AIDVRSR EGRDLRKVGFYDPIKNQ+YLN+ Sbjct: 1 AVYRIIAIDVRSRREGRDLRKVGFYDPIKNQSYLNV 36
>gi|6692901|gb|AAF24860.1| (AF110534) 30S ribosomal protein S16 [Cymopterus montanus] >gi|6692902|gb|AAF24861.1| (AF110535) 30S ribosomal protein S16 [Zizia aurea] >gi|6692903|gb|AAF24862.1| (AF110536) 30S ribosomal protein S16 [Angelica archangelica] >gi|6692904|gb|AAF24863.1| (AF110537) 30S ribosomal protein S16 [Heracleum lanatum] >gi|6692905|gb|AAF24864.1| (AF110538) 30S ribosomal protein S16 [Pastinaca sativa] >gi|6692906|gb|AAF24865.1| (AF110539) 30S ribosomal protein S16 [Aethusa cynapium] >gi|6692907|gb|AAF24866.1| (AF110540) 30S ribosomal protein S16 [Crithmum maritimum] >gi|6692908|gb|AAF24867.1| (AF110541) 30S ribosomal protein S16 [Aegokeras caespitosum] >gi|6692909|gb|AAF24868.1| (AF110542) 30S ribosomal protein S16 [Anethum graveolens] >gi|6692910|gb|AAF24869.1| (AF110543) 30S ribosomal protein S16 [Foeniculum vulgare] >gi|6692911|gb|AAF24870.1| (AF110544) 30S ribosomal protein S16 [Petroselinum crispum] >gi|6692912|gb|AAF24871.1| (AF110545) 30S ribosomal protein S16 [Apium graveolens] >gi|6692913|gb|AAF24872.1| (AF110546) 30S ribosomal protein S16 [Conium maculatum] >gi|6692914|gb|AAF24873.1| (AF110547) 30S ribosomal protein S16 [Daucus carota] >gi|6692915|gb|AAF24874.1| (AF110548) 30S ribosomal protein S16 [Torilis arvensis] >gi|6692916|gb|AAF24875.1| (AF110549) 30S ribosomal protein S16 [Anthriscus caucalis] >gi|6692917|gb|AAF24876.1| (AF110550) 30S ribosomal protein S16 [Anisotome aromatica] >gi|6692918|gb|AAF24877.1| (AF110551) 30S ribosomal protein S16 [Smyrnium olusatrum] >gi|6692919|gb|AAF24878.1| (AF110552) 30S ribosomal protein S16 [Sium latifolium] >gi|6692920|gb|AAF24879.1| (AF110553) 30S ribosomal protein S16 [Oenanthe pimpinelloides] >gi|6692921|gb|AAF24880.1| (AF110554) 30S ribosomal protein S16 [Erigenia bulbosa] >gi|6692922|gb|AAF24881.1| (AF110555) 30S ribosomal protein S16 [Komarovia anisosperma] >gi|6692923|gb|AAF24882.1| (AF110556) 30S ribosomal protein S16 [Physospermum cornubiense] >gi|6692924|gb|AAF24883.1| (AF110557) 30S ribosomal protein S16 [Aulacospermum simplex] >gi|6692925|gb|AAF24884.1| (AF110558) 30S ribosomal protein S16 [Aulacospermum anomalum] >gi|6692926|gb|AAF24885.1| (AF110559) 30S ribosomal protein S16 [Pleurospermum foetens] >gi|6692927|gb|AAF24886.1| (AF110560) 30S ribosomal protein S16 [Pleurospermum uralense] >gi|6692928|gb|AAF24887.1| (AF110561) 30S ribosomal protein S16 [Eleutherospermum cicutarium] >gi|6692929|gb|AAF24888.1| (AF110562) 30S ribosomal protein S16 [Diplolophium somaliense] >gi|6692930|gb|AAF24889.1| (AF110563) 30S ribosomal protein S16 [Bupleurum americanum] >gi|6692931|gb|AAF24890.1| (AF110564) 30S ribosomal protein S16 [Bupleurum ranunculoides] >gi|6692932|gb|AAF24891.1| (AF110565) 30S ribosomal protein S16 [Bupleurum chinense] >gi|6692933|gb|AAF24892.1| (AF110566) 30S ribosomal protein S16 [Bupleurum falcatum] >gi|6692934|gb|AAF24893.1| (AF110567) 30S ribosomal protein S16 [Bupleurum rotundifolium] >gi|6692935|gb|AAF24894.1| (AF110568) 30S ribosomal protein S16 [Bupleurum angulosum] >gi|6692936|gb|AAF24895.1| (AF110569) 30S ribosomal protein S16 [Bupleurum fruticosum] >gi|6692937|gb|AAF24896.1| (AF110570) 30S ribosomal protein S16 [Polemannia montana] >gi|6692938|gb|AAF24897.1| (AF110571) 30S ribosomal protein S16 [Polemannia simplicior] >gi|6692939|gb|AAF24898.1| (AF110572) 30S ribosomal protein S16 [Glia prolifera] >gi|6692940|gb|AAF24899.1| (AF110573) 30S ribosomal protein S16 [Anginon rugosum] >gi|6692941|gb|AAF24900.1| (AF110574) 30S ribosomal protein S16 [Anginon verticillatum] >gi|6692942|gb|AAF24901.1| (AF110575) 30S ribosomal protein S16 [Heteromorpha arborescens var. arborescens] >gi|6692943|gb|AAF24902.1| (AF110576) 30S ribosomal protein S16 [Heteromorpha involucrata] >gi|6692944|gb|AAF24903.1| (AF110577) 30S ribosomal protein S16 [Heteromorpha involucrata] >gi|6692945|gb|AAF24904.1| (AF110578) 30S ribosomal protein S16 [Heteromorpha arborescens var. abyssinica] >gi|6692946|gb|AAF24905.1| (AF110579) 30S ribosomal protein S16 [Heteromorpha stenophylla var. transvaalensis] >gi|6692947|gb|AAF24906.1| (AF110580) 30S ribosomal protein S16 [Heteromorpha pubescens] >gi|6692948|gb|AAF24907.1| (AF110581) 30S ribosomal protein S16 [Dracosciadium italae] >gi|6692949|gb|AAF24908.1| (AF110582) 30S ribosomal protein S16 [Annesorhiza altiscapa] >gi|6692950|gb|AAF24909.1| (AF110583) 30S ribosomal protein S16 [Eryngium alpinum] >gi|6692951|gb|AAF24910.1| (AF110584) 30S ribosomal protein S16 [Eryngium planum] >gi|6692952|gb|AAF24911.1| (AF110585) 30S ribosomal protein S16 [Eryngium proteaflorum] >gi|6692953|gb|AAF24912.1| (AF110586) 30S ribosomal protein S16 [Eryngium coronatum] >gi|6692954|gb|AAF24913.1| (AF110587) 30S ribosomal protein S16 [Eryngium yuccifolium] >gi|6692955|gb|AAF24914.1| (AF110588) 30S ribosomal protein S16 [Eryngium spiculosum] >gi|6692956|gb|AAF24915.1| (AF110589) 30S ribosomal protein S16 [Eryngium mexiae] >gi|6692957|gb|AAF24916.1| (AF110590) 30S ribosomal protein S16 [Eryngium alternatum] >gi|6692958|gb|AAF24917.1| (AF110591) 30S ribosomal protein S16 [Hacquetia epipactis] >gi|6692959|gb|AAF24918.1| (AF110592) 30S ribosomal protein S16 [Sanicula canadensis] >gi|6692960|gb|AAF24919.1| (AF110593) 30S ribosomal protein S16 [Petagnaea saniculifolia] >gi|6692961|gb|AAF24920.1| (AF110594) 30S ribosomal protein S16 [Astrantia major] >gi|6692962|gb|AAF24921.1| (AF110595) 30S ribosomal protein S16 [Steganotaenia araliacea] >gi|6692963|gb|AAF24922.1| (AF110596) 30S ribosomal protein S16 [Steganotaenia araliacea] >gi|6692964|gb|AAF24923.1| (AF110597) 30S ribosomal protein S16 [Polemanniopsis marlothii] >gi|7688550|gb|AAF67416.1| (AF123728) ribosomal protein S16 [Pseudorlaya pumila] >gi|7688552|gb|AAF67417.1| (AF123729) ribosomal protein S16 [Daucus pusillus] >gi|7688560|gb|AAF67421.1| (AF123733) ribosomal protein S16 [Orlaya kochii] >gi|7688564|gb|AAF67423.1| (AF123735) ribosomal protein S16 [Laser trilobum] >gi|7688566|gb|AAF67424.1| (AF123736) ribosomal protein S16 [Polylophium panjutinii] >gi|7688576|gb|AAF67429.1| (AF123741) ribosomal protein S16 [Torilis japonica] >gi|7688578|gb|AAF67430.1| (AF123742) ribosomal protein S16 [Yabea microcarpa] >gi|7688582|gb|AAF67432.1| (AF123744) ribosomal protein S16 [Lisaea papyracea] >gi|7688594|gb|AAF67438.1| (AF123750) ribosomal protein S16 [Ferula olivacea] >gi|7688596|gb|AAF67439.1| (AF123751) ribosomal protein S16 [Ferula kokanica] >gi|7688598|gb|AAF67440.1| (AF123752) ribosomal protein S16 [Ferula tenuisecta] >gi|7688604|gb|AAF67443.1| (AF123755) ribosomal protein S16 [Myrrhis odorata] >gi|7688606|gb|AAF67444.1| (AF123756) ribosomal protein S16 [Ligusticum scoticum] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 167 (58.8 bits), Expect = 1.5e-11, P = 1.5e-11 Identities = 32/36 (88%), Positives = 34/36 (94%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRIVAIDVRSR EGRDLR VGFYDPIKNQ+YLN+ Sbjct: 1 AVYRIVAIDVRSRREGRDLRNVGFYDPIKNQSYLNV 36
>gi|11466766 ref|NP_039362.1| ribosomal protein S16 [Oryza sativa] >gi|133811|sp|P12151|RR16_ORYSA CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|71003|pir||R3RZ16 ribosomal protein S16 - rice chloroplast >gi|669079|emb|CAA34009.1| (X15901) ribosomal protein S16 [Oryza sativa] >gi|226649|prf||1603356C ribosomal protein S16 [Oryza sativa] Length = 62 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | 62 0 20 40 60 Plus Strand HSPs: Score = 166 (58.4 bits), Expect = 1.9e-11, P = 1.9e-11 Identities = 32/44 (72%), Positives = 36/44 (81%), Frame = +2 Query: 98 RKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQDILKRAGVF 229 RK FYDPIKNQT LN+P ILYFLE+GAQPT TV DIL++A F Sbjct: 11 RKQRFYDPIKNQTCLNVPAILYFLEKGAQPTRTVSDILRKAEFF 54
>gi|7688600|gb|AAF67441.1| (AF123753) ribosomal protein S16 [Scandix pecten-veneris] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 166 (58.4 bits), Expect = 1.9e-11, P = 1.9e-11 Identities = 32/36 (88%), Positives = 34/36 (94%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRIVAIDVRSR EGRDLR VGFYDPIKNQ+YLN+ Sbjct: 1 AVYRIVAIDVRSRREGRDLRNVGFYDPIKNQSYLNL 36
>gi|7688590|gb|AAF67436.1| (AF123748) ribosomal protein S16 [Astrodaucus orientalis] >gi|7688592|gb|AAF67437.1| (AF123749) ribosomal protein S16 [Szovitsia callicarpa] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 165 (58.1 bits), Expect = 2.4e-11, P = 2.4e-11 Identities = 31/36 (86%), Positives = 34/36 (94%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRIVAIDVRSR EGRD+R VGFYDPIKNQ+YLN+ Sbjct: 1 AVYRIVAIDVRSRREGRDIRNVGFYDPIKNQSYLNV 36
>gi|7688556|gb|AAF67419.1| (AF123731) ribosomal protein S16 [Laserpitium hispidum] >gi|7688558|gb|AAF67420.1| (AF123732) ribosomal protein S16 [Laserpitium hispidum] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 164 (57.7 bits), Expect = 3.1e-11, P = 3.1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRIVA+DVRSR EGRDLR VGFYDPIKNQ+YLN+ Sbjct: 1 AVYRIVAMDVRSRREGRDLRNVGFYDPIKNQSYLNV 36
>gi|6692974|gb|AAF24933.1| (AF110607) 30S ribosomal protein S16 [Hydrocotyle rotundifolia] >gi|6692975|gb|AAF24934.1| (AF110608) 30S ribosomal protein S16 [Hydrocotyle pusilla] >gi|6692976|gb|AAF24935.1| (AF110609) 30S ribosomal protein S16 [Aralia chinensis] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 163 (57.4 bits), Expect = 4.0e-11, P = 4.0e-11 Identities = 32/36 (88%), Positives = 34/36 (94%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRIVAIDVRSR EGRDLRKVGFYDPIKNQ+ LN+ Sbjct: 1 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQSCLNV 36
>gi|7688554|gb|AAF67418.1| (AF123730) ribosomal protein S16 [Agrocharis incognita] >gi|7688562|gb|AAF67422.1| (AF123734) ribosomal protein S16 [Laserpitium siler] >gi|7688568|gb|AAF67425.1| (AF123737) ribosomal protein S16 [Melanoselinum decipiens] >gi|7688570|gb|AAF67426.1| (AF123738) ribosomal protein S16 [Melanoselinum decipiens] >gi|7688572|gb|AAF67427.1| (AF123739) ribosomal protein S16 [Monizia edulis] >gi|7688574|gb|AAF67428.1| (AF123740) ribosomal protein S16 [Chaetosciadium trichospermum] >gi|7688580|gb|AAF67431.1| (AF123743) ribosomal protein S16 [Turgenia latifolia] >gi|7688584|gb|AAF67433.1| (AF123745) ribosomal protein S16 [Caucalis platycarpos] >gi|7688586|gb|AAF67434.1| (AF123746) ribosomal protein S16 [Glochidotheca foeniculacea] >gi|7688588|gb|AAF67435.1| (AF123747) ribosomal protein S16 [Artedia squamata] >gi|7688602|gb|AAF67442.1| (AF123754) ribosomal protein S16 [Osmorhiza longistylis] Length = 36 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 36 0 20 Plus Strand HSPs: Score = 163 (57.4 bits), Expect = 4.0e-11, P = 4.0e-11 Identities = 31/36 (86%), Positives = 33/36 (91%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNI 148 AVYRIVAIDVRSR EGRD R VGFYDPIKNQ+YLN+ Sbjct: 1 AVYRIVAIDVRSRREGRDFRNVGFYDPIKNQSYLNV 36
>gi|2500468|sp|P74410|RS16_SYNY3 30S RIBOSOMAL PROTEIN S16 >gi|7440452|pir||S76249 ribosomal protein S16 - Synechocystis sp. (strain PCC 6803) >gi|1653595|dbj|BAA18508.1| (D90914) 30S ribosomal protein S16 [Synechocystis sp.] Length = 82 Frame 2 hits (HSPs): _____________________________________________ Annotated Domains: _____________________________________________ __________________________________________________ Database sequence: | | | | | | 82 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00732A: Ribosomal protein S16 proteins 1..36 BLOCKS BL00732B: Ribosomal protein S16 proteins 48..74 PFAM Ribosomal_S16: Ribosomal protein S16 8..64 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 8..63 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 2..11 __________________ Plus Strand HSPs: Score = 161 (56.7 bits), Expect = 6.5e-11, P = 6.5e-11 Identities = 33/73 (45%), Positives = 49/73 (67%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G K+ YRIVA+ +R +GR L ++GFY+P ++T L++P I+ L+ GAQPT TV+ Sbjct: 10 GKKREVSYRIVAMHSTTRRDGRPLEELGFYNPRTDETRLDVPAIVKRLKEGAQPTDTVRS 69 Query: 206 ILKRAGVFMXLSS 244 IL +A VF L + Sbjct: 70 ILTKAQVFEQLKA 82
>gi|11465818 ref|NP_053962.1| 30S ribosomal protein S16 [Porphyra purpurea] >gi|1710695|sp|P51352|RR16_PORPU CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|2147028|pir||S73273 ribosomal protein S16, chloroplast - red alga (Porphyra purpurea) chloroplast >gi|1276818|gb|AAC08238.1| (U38804) 30S ribosomal protein S16 [Porphyra purpurea] Length = 82 Frame 2 hits (HSPs): _________________________________________ __________________________________________________ Database sequence: | | | | | | 82 0 20 40 60 80 Plus Strand HSPs: Score = 159 (56.0 bits), Expect = 1.1e-10, P = 1.1e-10 Identities = 32/67 (47%), Positives = 49/67 (73%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G KQ+ YRIVA+D RS+ +G+ + ++GFY+PI N+T ++I IL L++GAQ T TV++ Sbjct: 10 GRKQQPSYRIVAMDSRSKRDGKAIEELGFYNPITNETRIDIAKILKRLKQGAQTTRTVKN 69 Query: 206 ILKRAGV 226 IL A + Sbjct: 70 ILNEAQI 76
>gi|11467374 ref|NP_043231.1| ribosomal protein S16 [Cyanophora paradoxa] >gi|1350876|sp|P48139|RR16_CYAPA CYANELLE 30S RIBOSOMAL PROTEIN S16 >gi|7440454|pir||T06919 ribosomal protein S16 - Cyanophora paradoxa cyanelle >gi|1016175|gb|AAA81262.1| (U30821) ribosomal protein S16 [Cyanophora paradoxa] Length = 77 Frame 2 hits (HSPs): ____________________________________________ __________________________________________________ Database sequence: | | | | | 77 0 20 40 60 Plus Strand HSPs: Score = 145 (51.0 bits), Expect = 3.2e-09, P = 3.2e-09 Identities = 30/67 (44%), Positives = 46/67 (68%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G K + YRIVA++ SR +G+ + ++GFY+P N++ LNI I +E+GAQPT TV+ Sbjct: 10 GRKGQVTYRIVAMNNLSRRDGKAIEELGFYNPRTNESSLNIANIKRRIEQGAQPTNTVRY 69 Query: 206 ILKRAGV 226 IL +A + Sbjct: 70 ILAKANI 76
>gi|10120996|pdb|1EMW|A Chain A, Solution Structure Of The Ribosomal Protein S16 From Thermus Thermophilus >gi|10835578|pdb|1FJF|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit >gi|10835600|pdb|1FJG|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin And Paromomycin Length = 88 Frame 2 hits (HSPs): ________________________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 Plus Strand HSPs: Score = 141 (49.6 bits), Expect = 8.5e-09, P = 8.5e-09 Identities = 30/71 (42%), Positives = 44/71 (61%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQT-YLNIPV--ILYFLERGAQPTGT 196 G+K YRIV D R + +G+ + K+G+YDP K +L + V Y+L GAQPT T Sbjct: 10 GSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDT 69 Query: 197 VQDILKRAGVF 229 + +L++AGVF Sbjct: 70 ARRLLRQAGVF 80
>gi|7488723|pir||T06340 ribosomal protein S16 - soybean chloroplast (fragment) >gi|984308|gb|AAA80642.1| (U26948) ribosomal protein S16 [Glycine max] Length = 28 Frame 3 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 28 0 20 Plus Strand HSPs: Score = 140 (49.3 bits), Expect = 1.1e-08, P = 1.1e-08 Identities = 27/28 (96%), Positives = 27/28 (96%), Frame = +3 Query: 39 EPFIESLQSMFDLXEREEIFGKWVFMIQ 122 EPFIESLQSMFDL EREEIFGKWVFMIQ Sbjct: 1 EPFIESLQSMFDLEEREEIFGKWVFMIQ 28
>gi|7440449|pir||T05282 ribosomal protein S16, organellar - Arabidopsis thaliana >gi|3096931|emb|CAA18841.1| (AL023094) putative ribosomal protein S16 [Arabidopsis thaliana] >gi|7270412|emb|CAB80179.1| (AL161585) putative ribosomal protein S16 [Arabidopsis thaliana] Length = 113 Frame 2 hits (HSPs): ________________________________ __________________________________________________ Database sequence: | | | | 113 0 50 100 Plus Strand HSPs: Score = 140 (49.3 bits), Expect = 1.1e-08, P = 1.1e-08 Identities = 30/72 (41%), Positives = 44/72 (61%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIK-----NQTYLNIPVILYFLERGAQPT 190 G K R YR+V D +SR +G+ + +GFYDP++ ++ L I Y+L GAQPT Sbjct: 11 GCKHRPFYRVVVADEKSRRDGKQIEVLGFYDPLQGKEDADRVSLKFDRIKYWLSVGAQPT 70 Query: 191 GTVQDILKRAGV 226 TV+ +L RAG+ Sbjct: 71 DTVESMLFRAGL 82
>gi|7769072|gb|AAF69243.1|AF173880_6 (AF173880) 30S ribosomal protein S16-like protein [Acidithiobacillus ferrooxidans] Length = 86 Frame 2 hits (HSPs): ________________________________________ __________________________________________________ Database sequence: | | | | | | 86 0 20 40 60 80 Plus Strand HSPs: Score = 138 (48.6 bits), Expect = 1.8e-08, P = 1.8e-08 Identities = 31/69 (44%), Positives = 41/69 (59%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPV--ILYFLERGAQPTGTV 199 G K+R Y IV D RSR +GR + ++GFY+PI L I Y+L +GAQP+ TV Sbjct: 10 GAKKRPFYHIVVADSRSRRDGRFIERLGFYNPIGAVAELRIDKERAAYWLSQGAQPSDTV 69 Query: 200 QDILKRAGV 226 LK+ GV Sbjct: 70 AGFLKKEGV 78
>gi|6692969|gb|AAF24928.1| (AF110602) 30S ribosomal protein S16 [Centella erecta] >gi|6692970|gb|AAF24929.1| (AF110603) 30S ribosomal protein S16 [Centella asiatica] >gi|6692971|gb|AAF24930.1| (AF110604) 30S ribosomal protein S16 [Centella triflora] >gi|6692972|gb|AAF24931.1| (AF110605) 30S ribosomal protein S16 [Centella hirtella] Length = 28 Frame 2 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 28 0 20 Plus Strand HSPs: Score = 135 (47.5 bits), Expect = 3.7e-08, P = 3.7e-08 Identities = 27/28 (96%), Positives = 27/28 (96%), Frame = +2 Query: 41 AVYRIVAIDVRSRXEGRDLRKVGFYDPI 124 AVYRIVAIDVRSR EGRDLRKVGFYDPI Sbjct: 1 AVYRIVAIDVRSRREGRDLRKVGFYDPI 28
>gi|11357038|pir||E82874 ribosomal protein S16 UU568 [imported] - Ureaplasma urealyticum >gi|6899576|gb|AAF30982.1|AE002155_4 (AE002155) ribosomal protein S16 [Ureaplasma urealyticum] Length = 101 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | | || 101 0 20 40 60 80 100 Plus Strand HSPs: Score = 133 (46.8 bits), Expect = 6.0e-08, P = 6.0e-08 Identities = 25/68 (36%), Positives = 42/68 (61%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 GT ++ +RIV +D +++ G + +G YDP+ Q L IL L+ GAQP+ TV++ Sbjct: 13 GTHKKPFFRIVVMDAKTKANGAYIENLGHYDPVLGQVVLKKEAILAQLQNGAQPSETVKN 72 Query: 206 ILKRAGVF 229 IL + G++ Sbjct: 73 ILSQEGIW 80
>gi|12056104|emb|CAC21226.1| (AJ224859) ribosomal protein S16 [Thermus thermophilus] Length = 91 Frame 2 hits (HSPs): ____________________________________ __________________________________________________ Database sequence: | | | | | | 91 0 20 40 60 80 Plus Strand HSPs: Score = 133 (46.8 bits), Expect = 6.0e-08, P = 6.0e-08 Identities = 28/64 (43%), Positives = 41/64 (64%), Frame = +2 Query: 47 YRIVAIDVRSRXEGRDLRKVGFYDPIKNQT-YLNIPV--ILYFLERGAQPTGTVQDILKR 217 YRIV D R + +G+ + K+G+YDP K +L + V Y+L GAQPT T + +L++ Sbjct: 20 YRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQ 79 Query: 218 AGVF 229 AGVF Sbjct: 80 AGVF 83
>gi|11467622 ref|NP_050674.1| ribosomal protein S16 [Guillardia theta] >gi|6094133|sp|O78423|RR16_GUITH CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|3602947|gb|AAC35608.1| (AF041468) ribosomal protein S16 [Guillardia theta] Length = 76 Frame 2 hits (HSPs): ___________________________________________ __________________________________________________ Database sequence: | | | | | 76 0 20 40 60 Plus Strand HSPs: Score = 132 (46.5 bits), Expect = 7.7e-08, P = 7.7e-08 Identities = 23/64 (35%), Positives = 43/64 (67%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G K +A YR+V + S+ +GR + ++GFY+P N+T++N+ + L +G +PT TV++ Sbjct: 10 GRKGQASYRLVVMPSTSKRDGRAIEELGFYNPCTNETHINVERVKVRLSQGVKPTSTVKN 69 Query: 206 ILKR 217 +L + Sbjct: 70 LLDK 73
>gi|6015979|gb|AAF01482.1|AF137263_1 (AF137263) 30S ribosomal protein S16-like protein [Bacteroides thetaiotaomicron] Length = 184 Frame 2 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | 184 0 50 100 150 Plus Strand HSPs: Score = 128 (45.1 bits), Expect = 2.0e-07, P = 2.0e-07 Identities = 29/71 (40%), Positives = 42/71 (59%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTY--LNIPVILYFLERGAQPTGTV 199 G K A Y IV D R+ +G+ + K+G Y+P N LN L ++ +GAQP+ TV Sbjct: 11 GRKSYAFYSIVIADSRAPRDGKFIEKIGTYNPNTNPATVDLNFDAALAWVLKGAQPSDTV 70 Query: 200 QDILKRAGVFM 232 ++IL R GV+M Sbjct: 71 RNILSREGVYM 81
>gi|11467477 ref|NP_043623.1| 30S ribosomal protein S16 [Odontella sinensis] >gi|1350877|sp|P49503|RR16_ODOSI CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|7440453|pir||S78282 ribosomal protein S16, chloroplast - Odontella sinensis chloroplast >gi|1185172|emb|CAA91655.1| (Z67753) 30S ribosomal protein S16 [Odontella sinensis] Length = 79 Frame 2 hits (HSPs): ___________________________________________ __________________________________________________ Database sequence: | | | | | 79 0 20 40 60 Plus Strand HSPs: Score = 127 (44.7 bits), Expect = 2.6e-07, P = 2.6e-07 Identities = 24/67 (35%), Positives = 45/67 (67%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G K++ YR+V ++ +R +GR + +VG+Y+ I ++Y ++ I +L GA+PT TV + Sbjct: 10 GRKKQPSYRLVVMENTTRRDGRPVEQVGYYNTITKESYFDVIKIKKWLNYGAKPTQTVLN 69 Query: 206 ILKRAGV 226 +LK+A + Sbjct: 70 LLKKAKI 76
>gi|7388144|sp|Q9Z965|RS16_CHLPN 30S RIBOSOMAL PROTEIN S16 >gi|7440456|pir||B72117 S16 ribosomal protein - Chlamydophila pneumoniae (strain CWL029) >gi|4376379|gb|AAD18269.1| (AE001598) S16 Ribosomal Protein [Chlamydophila pneumoniae CWL029] >gi|8163473|gb|AAF73692.1| (AE002223) ribosomal protein S16 [Chlamydophila pneumoniae AR39] >gi|8978490|dbj|BAA98327.1| (AP002545) S16 ribosomal protein [Chlamydophila pneumoniae J138] Length = 119 Frame 2 hits (HSPs): __________________________________ __________________________________________________ Database sequence: | | | | 119 0 50 100 Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.3e-07, P = 3.3e-07 Identities = 29/80 (36%), Positives = 46/80 (57%), Frame = +2 Query: 23 RGTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTY-LNIPVILYFLERGAQPTGTV 199 +G + VYR+V DV S +G+ + +G+YDP + Y L I Y+LERGAQ + Sbjct: 10 QGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSSINYQLKSERIFYWLERGAQLSSKA 69 Query: 200 QDILKRA--GVFMXLSSNQQ 253 + ++K+ GV+ L S Q+ Sbjct: 70 EALVKQGAPGVYSALLSKQE 89
>gi|7388157|sp|Q9X1Q2|RS16_THEMA 30S RIBOSOMAL PROTEIN S16 >gi|7440450|pir||G72236 ribosomal protein S16 - Thermotoga maritima (strain MSB8) >gi|4982135|gb|AAD36633.1|AE001802_2 (AE001802) ribosomal protein S16 [Thermotoga maritima] Length = 95 Frame 2 hits (HSPs): _____________________________________ __________________________________________________ Database sequence: | | | | | | 95 0 20 40 60 80 Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.3e-07, P = 3.3e-07 Identities = 23/68 (33%), Positives = 44/68 (64%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKN-QTYLNIPVILYFLERGAQPTGTVQ 202 G + + YRIV +D R R +G + +G+Y+P+K + +++ + ++ +GAQP+ TV+ Sbjct: 10 GKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEGEIKIDVERAVEWILKGAQPSDTVR 69 Query: 203 DILKRAGV 226 DI ++ GV Sbjct: 70 DIFRKFGV 77
>gi|6094161|sp|O83875|RS16_TREPA 30S RIBOSOMAL PROTEIN S16 >gi|7440446|pir||F71267 probable ribosomal protein S16 (rpsP) - syphilis spirochete >gi|3323218|gb|AAC65857.1| (AE001259) ribosomal protein S16 (rpsP) [Treponema pallidum] Length = 123 Frame 2 hits (HSPs): _________________________________ Annotated Domains: _______________________________________________ __________________________________________________ Database sequence: | | | | 123 0 50 100 __________________ Annotated Domains: PFAM Ribosomal_S16: Ribosomal protein S16 9..68 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 10..67 PRODOM PD167364: RS16_TREPA 69..122 PROSITE MITOCH_CARRIER: Mitochondrial energy tra 67..76 __________________ Plus Strand HSPs: Score = 123 (43.3 bits), Expect = 6.9e-07, P = 6.9e-07 Identities = 28/81 (34%), Positives = 47/81 (58%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIK---NQTYLNIPVILYFLERGAQPTGT 196 G+K+R YRIV D R +GR + ++G Y PI + + ++LERGAQP+ T Sbjct: 11 GSKKRPYYRIVVQDAREPRDGRAIEELGIYQPIAPKGTEVSFRLDRARFWLERGAQPSDT 70 Query: 197 VQDIL--KRAGVFMXLSSNQQ 253 V+ +L +R V ++S+++ Sbjct: 71 VRRLLQSRRGSVLNAVASDER 91
>gi|6601576|gb|AAF19037.1| (L08896) 30S ribosomal protein S16 [Mycoplasma gallisepticum] Length = 80 Frame 2 hits (HSPs): ___________________________________________ __________________________________________________ Database sequence: | | | | | 80 0 20 40 60 Plus Strand HSPs: Score = 123 (43.3 bits), Expect = 6.9e-07, P = 6.9e-07 Identities = 23/69 (33%), Positives = 43/69 (62%), Frame = +2 Query: 47 YRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQDILKRAGV 226 YR+V +D R + +G + +G DPI LN + + +L++GAQPT TV+ IL + G+ Sbjct: 11 YRMVVVDSRVKRDGSYIELIGHIDPINGANKLNGALAIEWLKKGAQPTDTVKSILSKEGI 70 Query: 227 FMXLSSNQQ 253 + +++++ Sbjct: 71 WKQYAASKK 79
>gi|12724572|gb|AAK05667.1|AE006387_10 (AE006387) 30S ribosomal protein S16 [Lactococcus lactis subsp. lactis] Length = 90 Frame 2 hits (HSPs): _______________________________________ __________________________________________________ Database sequence: | | | | | | 90 0 20 40 60 80 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 26/69 (37%), Positives = 44/69 (63%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPI--KNQTYLNIPVILYFLERGAQPTGTV 199 G+K++ YRI D R+ +G+ + VG Y+P+ + Q L +L +L +GAQP+ TV Sbjct: 11 GSKKKPFYRINVADSRAPRDGKFIETVGTYNPLVTEEQVTLKEERVLEWLSKGAQPSDTV 70 Query: 200 QDILKRAGV 226 +++L +AGV Sbjct: 71 RNLLSKAGV 79
>gi|133804|sp|P28521|RR16_CYACA CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 >gi|280367|pir||S25087 ribosomal protein S16, chloroplast - red alga (Cyanidium caldarium) chloroplast >gi|11283|emb|CAA44462.1| (X62578) small ribosomal subunit protein S16 [Cyanidium caldarium] Length = 77 Frame 2 hits (HSPs): ____________________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 77 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00732A: Ribosomal protein S16 proteins 1..36 BLOCKS BL00732B: Ribosomal protein S16 proteins 48..74 DOMO DM00778: ESCHERICHIACOLIRIBOSOMALPROTEIN 1..39 DOMO DM01106: ESCHERICHIACOLIRIBOSOMALPROTEIN 41..76 PFAM Ribosomal_S16: Ribosomal protein S16 8..64 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 8..63 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 2..11 __________________ Plus Strand HSPs: Score = 119 (41.9 bits), Expect = 1.8e-06, P = 1.8e-06 Identities = 23/67 (34%), Positives = 43/67 (64%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPVILYFLERGAQPTGTVQD 205 G K++ ++IV ++ + +G+ + ++GF +P + YLNI I ++L GA+PT TV D Sbjct: 10 GRKKQTSFKIVVMNNLDKRDGQAIEELGFMNPRTKEKYLNINKINHYLRLGAKPTKTVFD 69 Query: 206 ILKRAGV 226 +L +A + Sbjct: 70 LLNKAKI 76
>gi|11276624|pir||E81180 30S ribosomal protein S16 NMB0592 [imported] - Neisseria meningitidis (group B strain MD58, group A strain Z2491) >gi|7225822|gb|AAF41020.1| (AE002415) 30S ribosomal protein S16 [Neisseria meningitidis MC58] >gi|7379515|emb|CAB84078.1| (AL162754) putative 30S ribosomal protein S16 [Neisseria meningitidis Z2491] Length = 81 Frame 2 hits (HSPs): __________________________________________ __________________________________________________ Database sequence: | | | | | | 81 0 20 40 60 80 Plus Strand HSPs: Score = 116 (40.8 bits), Expect = 3.8e-06, P = 3.8e-06 Identities = 23/67 (34%), Positives = 41/67 (61%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTY----LNIPVILYFLERGAQPTG 193 G+K R Y ++ D RSR +GR + +VGFY+P+ N+ LN + +++ +GAQ + Sbjct: 10 GSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVANEKQERVRLNADRLNHWIAQGAQVSD 69 Query: 194 TVQDILK 214 +V ++K Sbjct: 70 SVAKLIK 76
>gi|6094159|sp|O69879|RS16_STRCO 30S RIBOSOMAL PROTEIN S16 >gi|7481752|pir||T34776 ribosomal protein S16 - Streptomyces coelicolor >gi|3191984|emb|CAA19383.1| (AL023797) 30S ribosomal protein S16 [Streptomyces coelicolor A3(2)] Length = 139 Frame 2 hits (HSPs): ______________________ Annotated Domains: ___________________________________________ __________________________________________________ Database sequence: | | | | 139 0 50 100 __________________ Annotated Domains: PFAM Ribosomal_S16: Ribosomal protein S16 9..67 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 9..66 PRODOM PD057816: RS16(2) 68..119 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 3..12 __________________ Plus Strand HSPs: Score = 115 (40.5 bits), Expect = 4.8e-06, P = 4.8e-06 Identities = 25/61 (40%), Positives = 36/61 (59%), Frame = +2 Query: 47 YRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPV--ILYFLERGAQPTGTVQDILKRA 220 YRIV D R+R +GR + ++G Y P N + + + + Y+L GAQPT V ILK+ Sbjct: 18 YRIVVADSRTRRDGRAIEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKKT 77 Query: 221 G 223 G Sbjct: 78 G 78
>gi|6094160|sp|O86868|RS16_STRLI 30S RIBOSOMAL PROTEIN S16 >gi|3336919|emb|CAB06804.1| (Z86111) 30S ribosomal protein S16 [Streptomyces lividans] Length = 139 Frame 2 hits (HSPs): ______________________ Annotated Domains: ___________________________________________ __________________________________________________ Database sequence: | | | | 139 0 50 100 __________________ Annotated Domains: PFAM Ribosomal_S16: Ribosomal protein S16 9..67 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 9..66 PRODOM PD057816: RS16(2) 68..119 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 3..12 __________________ Plus Strand HSPs: Score = 115 (40.5 bits), Expect = 4.8e-06, P = 4.8e-06 Identities = 25/61 (40%), Positives = 36/61 (59%), Frame = +2 Query: 47 YRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPV--ILYFLERGAQPTGTVQDILKRA 220 YRIV D R+R +GR + ++G Y P N + + + + Y+L GAQPT V ILK+ Sbjct: 18 YRIVVADSRTRRDGRAIEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKKT 77 Query: 221 G 223 G Sbjct: 78 G 78
>gi|11360423|pir||H82847 30S ribosomal protein S16 XF0107 [imported] - Xylella fastidiosa (strain 9a5c) >gi|9104887|gb|AAF82920.1|AE003864_8 (AE003864) 30S ribosomal protein S16 [Xylella fastidiosa] Length = 86 Frame 2 hits (HSPs): _______________________________________ __________________________________________________ Database sequence: | | | | | | 86 0 20 40 60 80 Plus Strand HSPs: Score = 115 (40.5 bits), Expect = 4.8e-06, P = 4.8e-06 Identities = 22/67 (32%), Positives = 44/67 (65%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPI----KNQTYLNIPVILYFLERGAQPTG 193 G K+R Y+I+ D R++ +GR++ +VG Y+P+ +++ LN+ + ++++ GAQ T Sbjct: 10 GAKKRPFYQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNMARVEHWVKNGAQLTD 69 Query: 194 TVQDILK 214 V+ +LK Sbjct: 70 KVRSLLK 76
>gi|7388142|sp|O84029|RS16_CHLTR 30S RIBOSOMAL PROTEIN S16 >gi|7440459|pir||E71566 probable S16 ribosomal protein - Chlamydia trachomatis (serotype D, strain UW3/Cx) >gi|3328416|gb|AAC67616.1| (AE001277) S16 Ribosomal Protein [Chlamydia trachomatis] Length = 116 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 116 0 50 100 Plus Strand HSPs: Score = 113 (39.8 bits), Expect = 7.9e-06, P = 7.9e-06 Identities = 27/79 (34%), Positives = 43/79 (54%), Frame = +2 Query: 23 RGTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTY-LNIPVILYFLERGAQPTGTV 199 +G K VYR+V DV S +G+ + +G+YDP Q Y L I Y+L +GA+ T Sbjct: 10 QGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLNQGAELTEKA 69 Query: 200 QDILKRA--GVFMXLSSNQ 250 ++K+ GV+ L + + Sbjct: 70 GALVKQGAPGVYAELMAKK 88
>gi|8163190|gb|AAF73544.1| (AE002297) ribosomal protein S16 [Chlamydia muridarum] Length = 116 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 116 0 50 100 Plus Strand HSPs: Score = 113 (39.8 bits), Expect = 7.9e-06, P = 7.9e-06 Identities = 27/79 (34%), Positives = 43/79 (54%), Frame = +2 Query: 23 RGTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTY-LNIPVILYFLERGAQPTGTV 199 +G K VYR+V DV S +G+ + +G+YDP Q Y L I Y+L +GA+ T Sbjct: 10 QGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLNQGAELTEKA 69 Query: 200 QDILKRA--GVFMXLSSNQ 250 ++K+ GV+ L + + Sbjct: 70 GALVKQGAPGVYAELMAKK 88
>gi|585937|sp|P21474|RS16_BACSU 30S RIBOSOMAL PROTEIN S16 (BS17) >gi|477949|pir||C47154 ribosomal protein S16 (BS17) rpsP - Bacillus subtilis >gi|2309081|dbj|BAA21692.1| (D14356) 30S ribosomal protein S16 [Bacillus subtilis] >gi|2633971|emb|CAB13472.1| (Z99112) ribosomal protein S16 (BS17) [Bacillus subtilis] Length = 90 Frame 2 hits (HSPs): ____________________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 90 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00732A: Ribosomal protein S16 proteins 1..36 BLOCKS BL00732B: Ribosomal protein S16 proteins 50..76 DOMO DM00778: ESCHERICHIACOLIRIBOSOMALPROTEIN 1..40 DOMO DM01106: ESCHERICHIACOLIRIBOSOMALPROTEIN 42..84 PFAM Ribosomal_S16: Ribosomal protein S16 8..66 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 8..65 PRODOM PD158100: RS16_BACSU 67..88 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 3..12 __________________ Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 1.3e-05, P = 1.3e-05 Identities = 25/78 (32%), Positives = 42/78 (53%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIP--VILYFLERGAQPTGTV 199 G K+ YRIV D RS +GR + VG Y+P+ + I + L +L+ GA+P+ TV Sbjct: 11 GAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWLQTGAKPSDTV 70 Query: 200 QDILKRAGVFMXLSSNQQ 253 +++ G+ + +Q Sbjct: 71 RNLFSSQGIMEKFHNAKQ 88
>gi|3024578|sp|O07348|RS16_THEAQ 30S RIBOSOMAL PROTEIN S16 >gi|2149138|gb|AAB58503.1| (U82109) ribosomal protein S16 [Thermus aquaticus] Length = 67 Frame 2 hits (HSPs): ____________________________________________ Annotated Domains: _____________________________________________ __________________________________________________ Database sequence: | | | | | 67 0 20 40 60 __________________ Annotated Domains: PFAM Ribosomal_S16: Ribosomal protein S16 8..67 __________________ Plus Strand HSPs: Score = 110 (38.7 bits), Expect = 1.6e-05, P = 1.6e-05 Identities = 25/58 (43%), Positives = 34/58 (58%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQT-YLNIPV--ILYFLERGAQPT 190 G+K YRIV DVR + +G + K+G+YDP K +L + V Y+L GAQPT Sbjct: 10 GSKHNPHYRIVVTDVRRKRDGAYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPT 67
>gi|8777434|dbj|BAA97024.1| (AB024035) 30S ribosomal protein S16 [Arabidopsis thaliana] Length = 135 Frame 2 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | 135 0 50 100 Plus Strand HSPs: Score = 110 (38.7 bits), Expect = 1.6e-05, P = 1.6e-05 Identities = 26/72 (36%), Positives = 41/72 (56%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTY-----LNIPVILYFLERGAQPT 190 G K R +R++A D RS +G+ L +G+++P+ Q L I Y+L GAQP+ Sbjct: 11 GCKNRPFFRVMAADSRSPRDGKHLEVLGYFNPLPGQDGGKRMGLKFDRIKYWLSVGAQPS 70 Query: 191 GTVQDILKRAGV 226 VQ +L R+G+ Sbjct: 71 DPVQRLLFRSGL 82
>gi|7473841|pir||D75414 ribosomal protein S16 - Deinococcus radiodurans (strain R1) >gi|6459040|gb|AAF10863.1|AE001976_6 (AE001976) ribosomal protein S16 [Deinococcus radiodurans] Length = 84 Frame 2 hits (HSPs): __________________________________________ __________________________________________________ Database sequence: | | | | | | 84 0 20 40 60 80 Plus Strand HSPs: Score = 109 (38.4 bits), Expect = 2.1e-05, P = 2.1e-05 Identities = 26/70 (37%), Positives = 40/70 (57%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIK-NQTYLNIPV--ILYFLERGAQPTGT 196 G+ YRIV DVR +G + +G YDP K ++ +L I V +++ +GAQPT T Sbjct: 10 GSAHNPHYRIVVADVRRPRDGGYIESLGHYDPRKTSENFLKIDVERANHWIAQGAQPTDT 69 Query: 197 VQDILKRAGV 226 + +L+ GV Sbjct: 70 ARRLLRSQGV 79
>gi|10175103|dbj|BAB06202.1| (AP001515) 30S ribosomal protein S16 [Bacillus halodurans] Length = 90 Frame 2 hits (HSPs): _________________________________________ __________________________________________________ Database sequence: | | | | | | 90 0 20 40 60 80 Plus Strand HSPs: Score = 107 (37.7 bits), Expect = 3.4e-05, P = 3.4e-05 Identities = 22/73 (30%), Positives = 43/73 (58%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIPV--ILYFLERGAQPTGTV 199 G+K+ YR+V D RS +GR + ++G Y+P+ + + L ++ +GA+P+ TV Sbjct: 11 GSKKAPFYRVVVADSRSPRDGRFIEEIGTYNPLTQPAKVELKEDRALDWMLKGAKPSDTV 70 Query: 200 QDILKRAGVFMXL 238 +++ +AG+ L Sbjct: 71 RNLFSKAGLMEKL 83
>gi|3914894|sp|P81290|RS16_BACST 30S RIBOSOMAL PROTEIN S16 >gi|243177|gb|AAB21088.1| ribosomal protein S16 [Bacillus stearothermophilus, Peptide, 88 aa] Length = 88 Frame 2 hits (HSPs): _______________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | 88 0 20 40 60 80 __________________ Annotated Domains: PFAM Ribosomal_S16: Ribosomal protein S16 8..66 PRODOM PD003791: RS16(16) RR16(10) RT24(3) 8..65 PRODOM PD157411: RS16_BACST 67..87 PROSITE RIBOSOMAL_S16: Ribosomal protein S16 sig 2..11 __________________ Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 5.6e-05, P = 5.6e-05 Identities = 23/68 (33%), Positives = 40/68 (58%), Frame = +2 Query: 26 GTKQRAVYRIVAIDVRSRXEGRDLRKVGFYDPIKNQTYLNIP--VILYFLERGAQPTGTV 199 G K++ YRIV D RS +GR + +G Y+P+ + I + L +L+ GA+P+ T Sbjct: 10 GAKKKPFYRIVVADSRSPRDGRFIETIGTYNPVAEPAEIKIDEELALKWLQNGAKPSDT- 68 Query: 200 QDILKRAGV 226 + +L + G+ Sbjct: 69 RSLLSKQGL 77 WARNING: HSPs involving 35 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.95 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.349 0.157 0.503 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.332 0.147 0.440 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.337 0.146 0.497 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.376 0.170 0.688 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.347 0.161 0.522 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.342 0.148 0.484 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 89 84 10. 61 3 12 22 0.12 31 28 0.096 33 +2 0 89 85 10. 61 3 12 22 0.12 31 28 0.098 33 +1 0 90 86 10. 62 3 12 22 0.12 31 28 0.10 33 -1 0 90 86 10. 62 3 12 22 0.12 31 28 0.10 33 -2 0 89 86 10. 62 3 12 22 0.12 31 28 0.10 33 -3 0 89 85 10. 61 3 12 22 0.12 31 28 0.098 33 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 85 No. of states in DFA: 581 (57 KB) Total size of DFA: 118 KB (128 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 80.17u 1.19s 81.36t Elapsed: 00:00:14 Total cpu time: 80.22u 1.22s 81.44t Elapsed: 00:00:15 Start: Wed Jan 16 12:52:37 2002 End: Wed Jan 16 12:52:52 2002 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000