BLASTX+BEAUTY Search Results
WU-BLAST 2.0 search of the National Center for Biotechnology
Information's NR Protein Database.
BEAUTY post-processing provided by the
Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:
No Repeats Found.
Reference: Gish, Warren (1994-1997). unpublished.
Gish, Warren and David J. States (1993). Identification of protein coding
regions by database similarity search. Nat. Genet. 3:266-72.
Notice: statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.
Query= 'E09F02_K14_11.ab1'
(561 letters)
Translating both strands of query sequence in all 6 reading frames
Database: nr
625,274 sequences; 197,782,623 total letters.
Observed Numbers of Database Sequences Satisfying
Various EXPECTation Thresholds (E parameter values)
Histogram units: = 3 Sequences : less than 3 sequences
EXPECTation Threshold
(E parameter)
|
V Observed Counts-->
10000 667 156 |====================================================
6310 511 95 |===============================
3980 416 111 |=====================================
2510 305 114 |======================================
1580 191 57 |===================
1000 134 48 |================
631 86 30 |==========
398 56 26 |========
251 30 9 |===
158 21 8 |==
100 13 2 |:
63.1 11 3 |=
39.8 8 3 |=
25.1 5 3 |=
15.8 2 0 |
>>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 2 <<<<<<<<<<<<<<<<<
10.0 2 0 |
6.31 2 1 |:
3.98 1 0 |
2.51 1 0 |
1.58 1 1 |:
Smallest
Sum
Reading High Probability
Sequences producing High-scoring Segment Pairs: Frame Score P(N) N
gi|149499|gb|AAA64241.1|(M63289) beta-lactamase [Lact... +2 69 0.63 1
gi|12742394 ref|XP_009559.2| FT005 protei... +2 40 0.995 2
Use the 
and 
icons to retrieve links to Entrez:
E = Retrieve Entrez links (e.g., Medline abstracts, FASTA-formatted sequence reports).
R = Retrieve links to Related sequences (neighbors).
Use the 
icon (if present) to retrieve links to the Sequence Retrieval System (SRS).
Use the 
icon (if present) to retrieve links to the Ligand Enzyme and Chemical Compound Database .
Use the 
icon (if present) to retrieve links to the Protein Data Bank database.
>gi|149499|gb|AAA64241.1| (M63289) beta-lactamase [Lactococcus lactis]
Length = 48
Frame 2 hits (HSPs): ___________________________________________
__________________________________________________
Database sequence: | | | | 48
0 20 40
Plus Strand HSPs:
Score = 69 (24.3 bits), Expect = 1.0, P = 0.63
Identities = 16/42 (38%), Positives = 25/42 (59%), Frame = +2
Query: 5 GRGIVGNSDVTGIKHAHDEKDEKIAVDKEHISSILKIGSVTI 130
G G++G+S GIK AH E E + D+E + +I +I T+
Sbjct: 8 GLGLIGSSIALGIKKAHPEF-EILGSDREEVENIAQIPPETL 48
>gi|12742394 ref|XP_009559.2| FT005 protein [Homo sapiens]
Length = 47
Frame 2 hits (HSPs): ______________
Frame 1 hits (HSPs): _________
__________________________________________________
Database sequence: | | | | 47
0 20 40
Plus Strand HSPs:
Score = 40 (14.1 bits), Expect = 5.4, Sum P(2) = 1.0
Identities = 8/13 (61%), Positives = 11/13 (84%), Frame = +2
Query: 77 AVDKEHISSILKI 115
+VD+EHIS +L I
Sbjct: 29 SVDQEHISPLLYI 41
Score = 38 (13.4 bits), Expect = 5.4, Sum P(2) = 1.0
Identities = 5/9 (55%), Positives = 5/9 (55%), Frame = +1
Query: 13 HCW*F*CHW 39
HCW HW
Sbjct: 6 HCWTLATHW 14
Parameters:
filter=none
matrix=BLOSUM62
V=50
B=50
E=10
gi
H=1
sort_by_pvalue
echofilter
ctxfactor=5.98
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
Std. 0 BLOSUM62 0.318 0.135 0.401
+3 0 BLOSUM62 0.318 0.135 0.401 0.357 0.157 0.534
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
+2 0 BLOSUM62 0.318 0.135 0.401 0.340 0.151 0.469
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
+1 0 BLOSUM62 0.318 0.135 0.401 0.379 0.172 0.831
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
-1 0 BLOSUM62 0.318 0.135 0.401 0.334 0.143 0.462
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
-2 0 BLOSUM62 0.318 0.135 0.401 0.370 0.163 0.603
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
-3 0 BLOSUM62 0.318 0.135 0.401 0.346 0.151 0.496
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+3 0 186 186 10. 76 3 12 22 0.12 34
31 0.12 37
+2 0 186 186 10. 76 3 12 22 0.12 34
31 0.12 37
+1 0 187 187 10. 76 3 12 22 0.12 34
31 0.12 37
-1 0 187 187 10. 76 3 12 22 0.12 34
31 0.12 37
-2 0 186 186 10. 76 3 12 22 0.12 34
31 0.12 37
-3 0 186 186 10. 76 3 12 22 0.12 34
31 0.12 37
Statistics:
Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr
Title: nr
Release date: unknown
Posted date: 4:06 PM CST Feb 28, 2001
Format: BLAST
# of letters in database: 197,782,623
# of sequences in database: 625,274
# of database sequences satisfying E: 2
No. of states in DFA: 598 (59 KB)
Total size of DFA: 210 KB (256 KB)
Time to generate neighborhood: 0.02u 0.00s 0.02t Elapsed: 00:00:00
No. of threads or processors used: 6
Search cpu time: 174.25u 1.17s 175.42t Elapsed: 00:00:33
Total cpu time: 174.28u 1.19s 175.47t Elapsed: 00:00:34
Start: Wed Jan 23 13:50:03 2002 End: Wed Jan 23 13:50:37 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000