SERA_MOUSE - (Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 122 || unambiguous || 99.6% Confident
HBA_HUMAN - (P01922) Hemoglobin alpha chain || Number of peptides = 6 || unambiguous || 99.6% Confident
CABA_MOUSE - (Q99020) CARG-binding factor-A (CBF-A) || Number of peptides = 5 || unambiguous || 99.6% Confident
TGM2_MOUSE - (P21981) Protein-glutamine gamma-glutamyltransferase (EC 2.3.2.13) (Tissue transglutaminase) (TGase C) (TGC) (TG(C)) (Tranglutaminase 2) || Number of peptides = 4 || ambiguous || 99.6% Confident
RHOA_MOUSE - (Q9QUI0) Transforming protein RhoA || Number of peptides = 4 || ambiguous || 99.6% Confident
TBA1_HUMAN - (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) || Number of peptides = 46 || ambiguous || 99.6% Confident
Q91Y37 - (Q91Y37) Cytosolic aminopeptidase P || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9Z1F9 - (Q9Z1F9) ARX || Number of peptides = 6 || unambiguous || 99.6% Confident
IRE1_MOUSE - (P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) || Number of peptides = 5 || ambiguous || 99.6% Confident
ENOB_HUMAN - (P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) || Number of peptides = 1 || unambiguous || 99.6% Confident
IF5A_HUMAN - (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) || Number of peptides = 19 || ambiguous || 99.6% Confident
GTP1_MOUSE - (P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) || Number of peptides = 6 || ambiguous || 99.6% Confident
K2C1_HUMAN - (P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) || Number of peptides = 22 || unambiguous || 99.6% Confident
IMD2_MOUSE - (P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) || Number of peptides = 6 || ambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 50 || ambiguous || 99.6% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 23 || ambiguous || 99.6% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 35 || unambiguous || 99.6% Confident
Q99PC3 - (Q99PC3) CGI-74-like SR-rich protein || Number of peptides = 1 || ambiguous || 99.6% Confident
O89112 - (O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
HEM3_MOUSE - (P22907) Porphobilinogen deaminase (EC 4.3.1.8) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) (PBG-D) || Number of peptides = 4 || unambiguous || 99.6% Confident
PHS2_MOUSE - (Q9WUB3) Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) || Number of peptides = 5 || unambiguous || 99.6% Confident
PUR2_MOUSE - (Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)] || Number of peptides = 5 || unambiguous || 99.6% Confident
MK01_MOUSE - (P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) || Number of peptides = 4 || ambiguous || 99.6% Confident
GTA4_MOUSE - (P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4) || Number of peptides = 7 || unambiguous || 99.6% Confident
MOES_MOUSE - (P26041) Moesin (Membrane-organizing extension spike protein) || Number of peptides = 8 || ambiguous || 99.6% Confident
PUA2_MOUSE - (P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase) || Number of peptides = 7 || unambiguous || 99.6% Confident
PDX5_MOUSE - (P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) || Number of peptides = 3 || ambiguous || 99.6% Confident
O55181 - (O55181) RBP associated molecule RAM14-1 || Number of peptides = 18 || unambiguous || 99.6% Confident
O70565 - (O70565) Cp27 protein || Number of peptides = 1 || ambiguous || 99.6% Confident
SNXC_MOUSE - (O70493) Sorting nexin 12 (SDP8 protein) || Number of peptides = 2 || ambiguous || 99.6% Confident
SEP7_MOUSE - (O55131) Septin 7 (CDC10 protein homolog) || Number of peptides = 6 || ambiguous || 99.6% Confident
TSN_MOUSE - (Q62348) Translin || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9Z2N8 - (Q9Z2N8) BAF53a || Number of peptides = 1 || ambiguous || 99.6% Confident
GLP1_HUMAN - (P43220) Glucagon-like peptide 1 receptor precursor (GLP-1 receptor) (GLP-1-R) (GLP-1R) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q91VC7 - (Q91VC7) PKC-potentiated PP1 inhibitory protein (RIKEN cDNA 1110001M11 gene) || Number of peptides = 1 || unambiguous || 99.6% Confident
LA_MOUSE - (P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) || Number of peptides = 2 || ambiguous || 99.6% Confident
TF1B_MOUSE - (Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) || Number of peptides = 9 || unambiguous || 99.6% Confident
TBCA_MOUSE - (P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9QZM0 - (Q9QZM0) PLIC-2 || Number of peptides = 2 || ambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 73 || ambiguous || 99.6% Confident
Q91ZJ5 - (Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2 || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9H3T7 - (Q9H3T7) MOP-4 || Number of peptides = 2 || ambiguous || 99.6% Confident
143E_HUMAN - (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) || Number of peptides = 7 || ambiguous || 99.6% Confident
O88306 - (O88306) DJ-1 || Number of peptides = 10 || ambiguous || 99.6% Confident
CAH2_MOUSE - (P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) || Number of peptides = 20 || ambiguous || 99.6% Confident
O35678 - (O35678) MONOGLYCERIDE lipase (EC 3.1.1.23) || Number of peptides = 1 || unambiguous || 99.6% Confident
PGK1_HUMAN - (P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) || Number of peptides = 1 || unambiguous || 99.6% Confident
APOH_MOUSE - (Q01339) Beta-2-glycoprotein I precursor (Apolipoprotein H) (Apo-H) (B2GPI) (Beta(2)GPI) (Activated protein C-binding protein) (APC inhibitor) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9CZ44 - (Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence || Number of peptides = 4 || ambiguous || 99.6% Confident
RAN_HUMAN - (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) || Number of peptides = 14 || ambiguous || 99.6% Confident
Q9CWE4 - (Q9CWE4) 2410153K17Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
LIS1_MOUSE - (P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) || Number of peptides = 3 || ambiguous || 99.6% Confident
FABE_MOUSE - (Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) || Number of peptides = 5 || unambiguous || 99.6% Confident
ARF1_HUMAN - (P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 || Number of peptides = 11 || ambiguous || 99.6% Confident
TCPE_MOUSE - (P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) || Number of peptides = 8 || ambiguous || 99.6% Confident
APE1_MOUSE - (P28352) DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP endonuclease 1) (APEX nuclease) (APEN) || Number of peptides = 2 || unambiguous || 99.6% Confident
PA1G_MOUSE - (Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CXA2 - (Q9CXA2) 2810055F11Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
SODC_MOUSE - (P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9UG94 - (Q9UG94) Hypothetical protein || Number of peptides = 1 || unambiguous || 99.6% Confident
PIMT_MOUSE - (P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9EQR0 - (Q9EQR0) Fatty acid synthase || Number of peptides = 18 || unambiguous || 99.6% Confident
TRFE_MOUSE - (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) || Number of peptides = 54 || unambiguous || 99.6% Confident
TCPY_MOUSE - (Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) || Number of peptides = 4 || unambiguous || 99.6% Confident
UBP5_MOUSE - (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) || Number of peptides = 5 || unambiguous || 99.6% Confident
PSA6_MOUSE - (Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) || Number of peptides = 7 || ambiguous || 99.6% Confident
PDX1_MOUSE - (P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) || Number of peptides = 14 || unambiguous || 99.6% Confident
AMPB_MOUSE - (Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV) || Number of peptides = 3 || unambiguous || 99.6% Confident
O35864 - (O35864) 38 kDa MOV34 ISOLOGUE (Kip1 C-terminus interacting protein-2) (COP9 (Constitutive photomorphogenic), subunit 5) (Arabidopsis) || Number of peptides = 3 || ambiguous || 99.6% Confident
PPCE_MOUSE - (Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 4 || ambiguous || 99.6% Confident
PE15_MOUSE - (Q62048) Astrocytic phosphoprotein PEA-15 || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9D1A2 - (Q9D1A2) 0610010E05Rik protein (RIKEN cDNA 0610010E05 gene) || Number of peptides = 3 || ambiguous || 99.6% Confident
DHA1_MOUSE - (P24549) Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Aldehyde dehydrogenase, cytosolic) (ALDH class 1) (ALHDII) (ALDH-E1) || Number of peptides = 6 || unambiguous || 99.6% Confident
VAB2_MOUSE - (P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) || Number of peptides = 6 || ambiguous || 99.6% Confident
CAZ2_MOUSE - (P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) || Number of peptides = 5 || unambiguous || 99.6% Confident
SPS1_HUMAN - (P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1) || Number of peptides = 4 || unambiguous || 99.6% Confident
P137_MOUSE - (Q60865) GPI-anchored protein p137 (p137GPI) || Number of peptides = 2 || ambiguous || 99.6% Confident
SPCO_MOUSE - (Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) || Number of peptides = 11 || unambiguous || 99.6% Confident
EZRI_MOUSE - (P26040) Ezrin (p81) (Cytovillin) (Villin 2) || Number of peptides = 3 || ambiguous || 99.6% Confident
ICAL_MOUSE - (P51125) Calpain inhibitor (Calpastatin) || Number of peptides = 5 || unambiguous || 99.6% Confident
IMB1_MOUSE - (P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG) || Number of peptides = 5 || unambiguous || 99.6% Confident
K6PL_MOUSE - (P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q9CQ60 - (Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) || Number of peptides = 8 || unambiguous || 99.6% Confident
DYHC_MOUSE - (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) || Number of peptides = 17 || unambiguous || 99.6% Confident
SYS_MOUSE - (P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q8R1H0 - (Q8R1H0) Hypothetical 8.3 kDa protein || Number of peptides = 4 || unambiguous || 99.6% Confident
CO3_MOUSE - (P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] || Number of peptides = 14 || unambiguous || 99.6% Confident
Q91WJ8 - (Q91WJ8) Similar to far upstream element (FUSE) binding protein 1 || Number of peptides = 6 || unambiguous || 99.6% Confident
PRS8_HUMAN - (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) || Number of peptides = 3 || ambiguous || 99.6% Confident
ACF7_MOUSE - (Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) || Number of peptides = 29 || unambiguous || 99.6% Confident
DPY2_MOUSE - (O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) || Number of peptides = 16 || unambiguous || 99.6% Confident
FKB4_MOUSE - (P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q8VCI5 - (Q8VCI5) Peroxisomal farnesylated protein || Number of peptides = 2 || unambiguous || 99.6% Confident
SAD1_MOUSE - (Q60710) SAM domain and HD domain-containing protein 1 (Interferon-gamma inducible protein Mg11) || Number of peptides = 4 || unambiguous || 99.6% Confident
GFA1_MOUSE - (P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) || Number of peptides = 6 || unambiguous || 99.6% Confident
DYNA_MOUSE - (O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) || Number of peptides = 14 || unambiguous || 99.6% Confident
YAP1_MOUSE - (P46938) 65 kDa Yes-associated protein (YAP65) || Number of peptides = 1 || unambiguous || 99.6% Confident
LKHA_MOUSE - (P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 14 || unambiguous || 99.6% Confident
G6PI_MOUSE - (P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9ESF7 - (Q9ESF7) Sep2 (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9R1T2 - (Q9R1T2) mRNA similar to human SUA1, complete CDS (2400010M20RIK protein) || Number of peptides = 1 || unambiguous || 99.6% Confident
P97825 - (P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CST4 - (Q9CST4) 5830445C04Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9CYG6 - (Q9CYG6) 5730478E03Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CWI4 - (Q9CWI4) Esterase 10 || Number of peptides = 2 || unambiguous || 99.6% Confident
HS9B_MOUSE - (P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) || Number of peptides = 21 || ambiguous || 99.6% Confident
S3B1_MOUSE - (Q99NB9) Splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit) || Number of peptides = 6 || ambiguous || 99.6% Confident
AATC_MOUSE - (P05201) Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-1) || Number of peptides = 3 || unambiguous || 99.6% Confident
COTR_MOUSE - (P07759) Contrapsin precursor || Number of peptides = 3 || ambiguous || 99.6% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
PRS4_HUMAN - (Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) || Number of peptides = 2 || ambiguous || 99.6% Confident
CC37_MOUSE - (Q61081) Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) || Number of peptides = 3 || ambiguous || 99.6% Confident
TPP2_MOUSE - (Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) || Number of peptides = 9 || unambiguous || 99.6% Confident
SH3L_MOUSE - (Q9JJU8) SH3 domain-binding glutamic acid-rich-like protein || Number of peptides = 3 || unambiguous || 99.6% Confident
Q8R016 - (Q8R016) Similar to bleomycin hydrolase || Number of peptides = 10 || unambiguous || 99.6% Confident
BAG3_MOUSE - (Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q91VW3 - (Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3 || Number of peptides = 4 || unambiguous || 99.6% Confident
O15250 - (O15250) Aminopeptidase P-like (EC 3.4.11.9) (XAA-PRO aminopeptidase) (X-PRO aminopeptidase) (Proline aminopeptidase) (Aminoacylproline aminopeptidase) (Soluble aminopeptidase P) || Number of peptides = 1 || unambiguous || 99.6% Confident
TTHY_MOUSE - (P07309) Transthyretin precursor (Prealbumin) || Number of peptides = 8 || unambiguous || 99.6% Confident
PGK1_MOUSE - (P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q61646 - (Q61646) Haptoglobin || Number of peptides = 2 || unambiguous || 99.6% Confident
Q99K88 - (Q99K88) Hypothetical 38.1 kDa protein || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9Z0P5 - (Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q99K47 - (Q99K47) Fibrinogen A alpha polypeptide || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9D9F5 - (Q9D9F5) 1700082G03Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
ACLY_MOUSE - (Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9D892 - (Q9D892) 2010016I08Rik protein || Number of peptides = 5 || unambiguous || 99.6% Confident
Q91VH6 - (Q91VH6) CGI-27 protein (C21orf19-like protein) || Number of peptides = 5 || unambiguous || 99.6% Confident
ENOA_MOUSE - (P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) || Number of peptides = 71 || unambiguous || 99.6% Confident
143T_MOUSE - (P35216) 14-3-3 protein tau (14-3-3 protein theta) || Number of peptides = 5 || ambiguous || 99.6% Confident
TALI_MOUSE - (P26039) Talin || Number of peptides = 27 || unambiguous || 99.6% Confident
APA4_MOUSE - (P06728) Apolipoprotein A-IV precursor (Apo-AIV) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9DAJ6 - (Q9DAJ6) 1500026J17Rik protein || Number of peptides = 4 || ambiguous || 99.6% Confident
SAHH_MOUSE - (P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) || Number of peptides = 5 || unambiguous || 99.6% Confident
CRKL_HUMAN - (P46109) Crk-like protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9EPL8 - (Q9EPL8) RanBP7/importin 7 || Number of peptides = 2 || ambiguous || 99.6% Confident
Q8VC30 - (Q8VC30) Similar to DKFZP586B1621 protein || Number of peptides = 5 || unambiguous || 99.6% Confident
Q8VDD5 - (Q8VDD5) Nonmuscle heavy chain myosin II-A || Number of peptides = 16 || unambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 15 || ambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 14 || ambiguous || 99.6% Confident
HMG4_MOUSE - (O54879) High mobility group protein 4 (HMG-4) (High mobility group protein 2a) (HMG-2a) || Number of peptides = 1 || ambiguous || 99.6% Confident
FBL1_MOUSE - (Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) || Number of peptides = 4 || unambiguous || 99.6% Confident
PSD7_MOUSE - (P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q8R2X0 - (Q8R2X0) Similar to EH-domain containing 2 || Number of peptides = 6 || unambiguous || 99.6% Confident
ANX5_MOUSE - (P48036) Annexin V (Lipocortin V) (Endonexin II) (Calphobindin I) (CBP-I) (Placental anticoagulant protein I) (PAP-I) (PP4) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) (Anchorin CII) || Number of peptides = 14 || unambiguous || 99.6% Confident
RBB9_MOUSE - (O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9DD21 - (Q9DD21) 0610006A11Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
WDR1_MOUSE - (O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CR98 - (Q9CR98) 2010309E21Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
A2HS_MOUSE - (P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) || Number of peptides = 29 || unambiguous || 99.6% Confident
MDHC_MOUSE - (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) || Number of peptides = 7 || unambiguous || 99.6% Confident
K1CJ_HUMAN - (P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9D096 - (Q9D096) 2610034N03Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
TCPD_MOUSE - (P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) || Number of peptides = 4 || ambiguous || 99.6% Confident
GDIR_MOUSE - (Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) || Number of peptides = 4 || unambiguous || 99.6% Confident
PHS3_HUMAN - (P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) || Number of peptides = 5 || unambiguous || 99.6% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 21 || ambiguous || 99.6% Confident
VTDB_MOUSE - (P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
CAPB_MOUSE - (P47757) F-actin capping protein beta subunit (CapZ beta) || Number of peptides = 2 || ambiguous || 99.6% Confident
S142_MOUSE - (Q99J08) SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9D1G1 - (Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
KCRB_MOUSE - (Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) || Number of peptides = 8 || unambiguous || 99.6% Confident
O70379 - (O70379) Thioredoxin-related protein || Number of peptides = 3 || ambiguous || 99.6% Confident
TAG2_MOUSE - (Q9WVA4) Transgelin 2 || Number of peptides = 17 || unambiguous || 99.6% Confident
NED4_MOUSE - (P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q8VDP3 - (Q8VDP3) Similar to hypothetical protein FLJ11937 || Number of peptides = 4 || unambiguous || 99.6% Confident
A2MG_MOUSE - (Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) || Number of peptides = 16 || unambiguous || 99.6% Confident
2AAA_HUMAN - (P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q922D8 - (Q922D8) Similar to C1-tetrahydrofolate synthase || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CQM9 - (Q9CQM9) Thioredoxin-like 2 || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CR86 - (Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) || Number of peptides = 3 || ambiguous || 99.6% Confident
HDGF_MOUSE - (P51859) Hepatoma-derived growth factor (HDGF) || Number of peptides = 4 || ambiguous || 99.6% Confident
UBC7_HUMAN - (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) || Number of peptides = 5 || ambiguous || 99.6% Confident
K6PF_MOUSE - (P47857) 6-phosphofructokinase, muscle type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme A) (PFK-A) || Number of peptides = 5 || unambiguous || 99.6% Confident
IF6_MOUSE - (O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP)) || Number of peptides = 5 || unambiguous || 99.6% Confident
PPI1_MOUSE - (P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) || Number of peptides = 5 || unambiguous || 99.6% Confident
PDX2_MOUSE - (Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9QYB1 - (Q9QYB1) Intracellular chloride channel protein || Number of peptides = 4 || ambiguous || 99.6% Confident
HS74_MOUSE - (Q61316) Heat shock 70-related protein APG-2 || Number of peptides = 6 || unambiguous || 99.6% Confident
SBP2_MOUSE - (Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56) || Number of peptides = 4 || unambiguous || 99.6% Confident
CAP1_MOUSE - (P40124) Adenylyl cyclase-associated protein 1 (CAP 1) || Number of peptides = 9 || unambiguous || 99.6% Confident
PLSL_MOUSE - (Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65) || Number of peptides = 7 || unambiguous || 99.6% Confident
K22E_HUMAN - (P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e) || Number of peptides = 14 || unambiguous || 99.6% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 20 || ambiguous || 99.6% Confident
Q8VD78 - (Q8VD78) Hypothetical 50.8 kDa protein || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CRK7 - (Q9CRK7) 9430095H01Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
DHCA_MOUSE - (P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9D1L0 - (Q9D1L0) Ethanol induced 6 || Number of peptides = 1 || unambiguous || 99.6% Confident
PMG1_MOUSE - (Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) || Number of peptides = 11 || ambiguous || 99.6% Confident
Q99LJ3 - (Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
COF1_MOUSE - (P18760) Cofilin, non-muscle isoform || Number of peptides = 33 || unambiguous || 99.6% Confident
K1CI_HUMAN - (P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9) || Number of peptides = 10 || unambiguous || 99.6% Confident
UBA1_MOUSE - (Q02053) Ubiquitin-activating enzyme E1 1 || Number of peptides = 16 || unambiguous || 99.6% Confident
MPK4_MOUSE - (P47809) Dual specificity mitogen-activated protein kinase kinase 4 (EC 2.7.1.-) (MAP kinase kinase 4) (MAPKK 4) (MAPK/ERK kinase 4) (JNK activating kinase 1) (C-JUN N-terminal kinase kinase 1) (JNK kinase 1) (JNKK 1) (SAPK/ERK kinase 1) (SEK1) || Number of peptides = 4 || unambiguous || 99.6% Confident
ARI1_MOUSE - (Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9D7H1 - (Q9D7H1) 2010016I08Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
O09132 - (O09132) A6 gene product || Number of peptides = 4 || unambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 162 || unambiguous || 99.6% Confident
RTC1_MOUSE - (Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase) || Number of peptides = 4 || unambiguous || 99.6% Confident
A1T1_MOUSE - (P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 12 || ambiguous || 99.6% Confident
RAC1_HUMAN - (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) || Number of peptides = 1 || ambiguous || 99.6% Confident
HS9A_MOUSE - (P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) || Number of peptides = 29 || unambiguous || 99.6% Confident
PEBP_MOUSE - (P70296) Phosphatidylethanolamine-binding protein (PEBP) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9D1P4 - (Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
TES_MOUSE - (P47226) Testin (TES1/TES2) || Number of peptides = 3 || unambiguous || 99.6% Confident
SBP1_MOUSE - (P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56) || Number of peptides = 14 || unambiguous || 99.6% Confident
NAL1_HUMAN - (Q9C000) NACHT-, LRR- and PYD-containing protein 2 (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) (Caspase recruitment domain protein 7) || Number of peptides = 13 || unambiguous || 99.6% Confident
GMDS_HUMAN - (O60547) GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) (GMD) || Number of peptides = 2 || unambiguous || 99.6% Confident
PMGE_MOUSE - (P15327) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM) || Number of peptides = 2 || unambiguous || 99.6% Confident
CLP2_MOUSE - (Q08093) Calponin H2, smooth muscle || Number of peptides = 3 || ambiguous || 99.6% Confident
EF1G_MOUSE - (Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) || Number of peptides = 7 || unambiguous || 99.6% Confident
PSA5_MOUSE - (Q9Z2U1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome zeta chain) (EC 3.4.25.1) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) || Number of peptides = 2 || ambiguous || 99.6% Confident
ADHA_MOUSE - (P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) || Number of peptides = 38 || unambiguous || 99.6% Confident
CAZ1_MOUSE - (P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
DHAM_MOUSE - (P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2) || Number of peptides = 5 || unambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 111 || unambiguous || 99.6% Confident
H11_MOUSE - (P43275) Histone H1.1 (H1 VAR.3) (H1A) || Number of peptides = 4 || unambiguous || 99.6% Confident
HBB2_MOUSE - (P02089) Hemoglobin beta-2 chain (B2) (Minor) || Number of peptides = 22 || unambiguous || 99.6% Confident
ANX1_MOUSE - (P10107) Annexin I (Lipocortin I) (Calpactin II) (Chromobindin 9) (P35) (Phospholipase A2 inhibitory protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
TCPH_MOUSE - (P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) || Number of peptides = 7 || ambiguous || 99.6% Confident
DPP3_MOUSE - (Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) || Number of peptides = 12 || unambiguous || 99.6% Confident
K6A1_MOUSE - (P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) || Number of peptides = 4 || unambiguous || 99.6% Confident
O35499 - (O35499) Nuclear autoantigenic sperm protein || Number of peptides = 6 || unambiguous || 99.6% Confident
PUR9_MOUSE - (Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] || Number of peptides = 6 || unambiguous || 99.6% Confident
Q91W89 - (Q91W89) Similar to mannosidase, alpha, class 2C, member 1 || Number of peptides = 4 || unambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 26 || ambiguous || 99.6% Confident
AAC2_MOUSE - (Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) || Number of peptides = 5 || ambiguous || 99.6% Confident
HBAZ_MOUSE - (P06467) Hemoglobin zeta chain || Number of peptides = 6 || unambiguous || 99.6% Confident
ST13_MOUSE - (Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9DAR7 - (Q9DAR7) 1700001E16Rik protein (RIKEN cDNA 1700001E16 gene) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9Z1R2 - (Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) || Number of peptides = 9 || unambiguous || 99.6% Confident
GCB_MOUSE - (P01866) Ig gamma-2B chain C region || Number of peptides = 3 || ambiguous || 99.6% Confident
Q925K4 - (Q925K4) Copine 1 protein (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9D8S9 - (Q9D8S9) 1810037G04Rik protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9D819 - (Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene) || Number of peptides = 2 || unambiguous || 99.6% Confident
LGUL_MOUSE - (Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9DCT8 - (Q9DCT8) 0610010I23Rik protein (Cysteine-rich protein 2) || Number of peptides = 2 || unambiguous || 99.6% Confident
KC21_MOUSE - (Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37) || Number of peptides = 4 || ambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 42 || unambiguous || 99.6% Confident
AMPL_MOUSE - (Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) || Number of peptides = 3 || ambiguous || 99.6% Confident
PAK2_HUMAN - (Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) || Number of peptides = 9 || unambiguous || 99.6% Confident
ITH2_MOUSE - (Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9Z1Y4 - (Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) || Number of peptides = 3 || unambiguous || 99.6% Confident
NDKB_MOUSE - (Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18) || Number of peptides = 4 || unambiguous || 99.6% Confident
S23A_HUMAN - (Q15436) Protein transport protein Sec23A (SEC23-related protein A) || Number of peptides = 1 || unambiguous || 99.6% Confident
POSC_MOUSE - (Q9Z2Y8) Proline synthetase co-transcribed bacterial homolog protein || Number of peptides = 4 || unambiguous || 99.6% Confident
SPCN_HUMAN - (Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) || Number of peptides = 8 || unambiguous || 99.6% Confident
GSHC_MOUSE - (P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CV31 - (Q9CV31) 2310014J01Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
SYD_MOUSE - (Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9Z1K1 - (Q9Z1K1) HS1 binding protein 3 || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CRY5 - (Q9CRY5) 3010001M15Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 99.6% Confident
CRKL_MOUSE - (P47941) Crk-like protein || Number of peptides = 3 || unambiguous || 99.6% Confident
ATOX_MOUSE - (O08997) Copper transport protein ATOX1 (Metal transport protein ATX1) || Number of peptides = 2 || unambiguous || 99.6% Confident
FETA_MOUSE - (P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) || Number of peptides = 94 || unambiguous || 99.6% Confident
EF1B_MOUSE - (O70251) Elongation factor 1-beta (EF-1-beta) || Number of peptides = 3 || ambiguous || 99.6% Confident
TKT_MOUSE - (P40142) Transketolase (EC 2.2.1.1) (TK) (P68) || Number of peptides = 32 || unambiguous || 99.6% Confident
CLI5_HUMAN - (Q9NZA1) Chloride intracellular channel protein 5 || Number of peptides = 5 || unambiguous || 99.6% Confident
PTPA_MOUSE - (P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q8VEH5 - (Q8VEH5) Similar to KIAA0766 gene product || Number of peptides = 5 || unambiguous || 99.6% Confident
FSC1_MOUSE - (Q61553) Fascin (Singed-like protein) || Number of peptides = 8 || unambiguous || 99.6% Confident
NTF2_HUMAN - (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9D7P7 - (Q9D7P7) 2300003G24Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
PSA1_MOUSE - (Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9CY02 - (Q9CY02) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041L04, full insert sequence (Erythroid differentiation related factor) || Number of peptides = 1 || unambiguous || 99.6% Confident
CYTB_MOUSE - (Q62426) Cystatin B (Stefin B) || Number of peptides = 3 || unambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 1 || unambiguous || 99.6% Confident
APA1_MOUSE - (Q00623) Apolipoprotein A-I precursor (Apo-AI) || Number of peptides = 13 || unambiguous || 99.6% Confident
DCUP_MOUSE - (P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD) || Number of peptides = 2 || unambiguous || 99.6% Confident
143Z_MOUSE - (P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) || Number of peptides = 5 || ambiguous || 99.6% Confident
ALFA_MOUSE - (P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) || Number of peptides = 14 || unambiguous || 99.6% Confident
AOP2_MOUSE - (O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9QYS9 - (Q9QYS9) QKI-5 protein || Number of peptides = 5 || ambiguous || 99.6% Confident
PTB_MOUSE - (P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) || Number of peptides = 3 || ambiguous || 99.6% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 13 || ambiguous || 99.6% Confident
ENPL_MOUSE - (P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) || Number of peptides = 6 || unambiguous || 99.6% Confident
MDHM_MOUSE - (P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37) || Number of peptides = 2 || unambiguous || 99.6% Confident
APA2_MOUSE - (P09813) Apolipoprotein A-II precursor (Apo-AII) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q8R312 - (Q8R312) Hypothetical 28.6 kDa protein || Number of peptides = 3 || unambiguous || 99.6% Confident
IQG1_MOUSE - (Q9JKF1) Ras GTPase-activating-like protein IQGAP1 || Number of peptides = 13 || unambiguous || 99.6% Confident
TCPZ_MOUSE - (P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) || Number of peptides = 9 || unambiguous || 99.6% Confident
KPY2_MOUSE - (P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) || Number of peptides = 37 || unambiguous || 99.6% Confident
Q9UQE6 - (Q9UQE6) Protein phosphatase-1 regulatory subunit 7 beta2 || Number of peptides = 3 || ambiguous || 99.6% Confident
SRC8_MOUSE - (Q60598) Src substrate cortactin || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9DCC4 - (Q9DCC4) 1110058B13Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
ANX2_MOUSE - (P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV) || Number of peptides = 2 || unambiguous || 99.6% Confident
O08795 - (O08795) Alpha glucosidase II, beta subunit || Number of peptides = 1 || ambiguous || 99.6% Confident
FKB1_MOUSE - (P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) || Number of peptides = 2 || ambiguous || 99.6% Confident
MCM6_MOUSE - (P97311) DNA replication licensing factor MCM6 (Mis5 homolog) || Number of peptides = 6 || unambiguous || 99.6% Confident
IDE_MOUSE - (Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 4 || unambiguous || 99.6% Confident
CLH1_HUMAN - (Q00610) Clathrin heavy chain 1 (CLH-17) || Number of peptides = 22 || unambiguous || 99.6% Confident
PIR_MOUSE - (Q9D711) Pirin || Number of peptides = 2 || unambiguous || 99.6% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 34 || unambiguous || 99.6% Confident
Q9JJH0 - (Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9D0E1 - (Q9D0E1) 2610023M21Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 81 || unambiguous || 99.6% Confident
Q923D2 - (Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein) || Number of peptides = 6 || unambiguous || 99.6% Confident
TPIS_MOUSE - (P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9CVA3 - (Q9CVA3) 2210415M20Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
FKB3_MOUSE - (Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) || Number of peptides = 3 || unambiguous || 99.6% Confident
CGC8_MOUSE - (Q9D187) Hypothetical protein CGI-128 homolog || Number of peptides = 1 || ambiguous || 99.6% Confident
XDH_MOUSE - (Q00519) Xanthine dehydrogenase/oxidase [Includes: Xanthine dehydrogenase (EC 1.1.1.204) (XD); Xanthine oxidase (EC 1.1.3.22) (XO) (Xanthine oxidoreductase)] || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9DAW9 - (Q9DAW9) 1600014M03Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
O70140 - (O70140) Calcyclin binding protein (Fragment) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9QXD8 - (Q9QXD8) LIM domains containing protein 1 || Number of peptides = 2 || unambiguous || 99.6% Confident
MGN_HUMAN - (P50606) Mago nashi protein homolog (P50606) Mago nashi protein homolog || Number of peptides = 3 || ambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 72 || ambiguous || 99.6% Confident
P97315 - (P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) || Number of peptides = 10 || ambiguous || 99.6% Confident
HXB3_MOUSE - (P09026) Homeobox protein Hox-B3 (Hox-2.7) (MH-23) || Number of peptides = 26 || unambiguous || 99.6% Confident
Q61167 - (Q61167) APC-binding protein EB2 (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
6PGD_MOUSE - (Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) || Number of peptides = 6 || ambiguous || 99.5% Confident
Q9CZP1 - (Q9CZP1) 2700038L12Rik protein || Number of peptides = 4 || ambiguous || 99.5% Confident
ADA_MOUSE - (P03958) Adenosine deaminase (EC 3.5.4.4) (Adenosine aminohydrolase) || Number of peptides = 1 || unambiguous || 99.5% Confident
UGDH_MOUSE - (O70475) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc dehydrogenase) (UDP-GlcDH) (UDPGDH) || Number of peptides = 1 || unambiguous || 99.5% Confident
AMBP_MOUSE - (Q07456) AMBP protein precursor [Contains: Alpha-1-microglobulin; Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (HI-30)] || Number of peptides = 1 || ambiguous || 99.4% Confident
Q9CRE7 - (Q9CRE7) 2410174K12Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 99.4% Confident
IF2A_HUMAN - (P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) || Number of peptides = 1 || unambiguous || 99.4% Confident
EGF_MOUSE - (P01132) Pro-epidermal growth factor precursor (EGF) [Contains: Epidermal growth factor] || Number of peptides = 20 || unambiguous || 99.4% Confident
ILK1_HUMAN - (Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) || Number of peptides = 3 || ambiguous || 99.4% Confident
Q8VDM6 - (Q8VDM6) Similar to E1B-55 kDa-associated protein 5 || Number of peptides = 2 || unambiguous || 99.4% Confident
M2GD_HUMAN - (Q9UI17) Dimethylglycine dehydrogenase, mitochondrial precursor (EC 1.5.99.2) (ME2GLYDH) || Number of peptides = 1 || unambiguous || 99.4% Confident
PGMU_MOUSE - (Q9D0F9) Phosphoglucomutase (EC 5.4.2.2) (Glucose phosphomutase) (PGM) || Number of peptides = 3 || unambiguous || 99.4% Confident
ROA2_MOUSE - (O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) || Number of peptides = 12 || ambiguous || 99.4% Confident
TEBP_MOUSE - (Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23) || Number of peptides = 3 || ambiguous || 99.4% Confident
PUR8_MOUSE - (P54822) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylosuccinase) (ASL) (ASASE) || Number of peptides = 2 || unambiguous || 99.4% Confident
Q9DCG9 - (Q9DCG9) 0610038D11Rik protein || Number of peptides = 1 || ambiguous || 99.4% Confident
UBCH_HUMAN - (P37286) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19) (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) (P37286) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19) (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) || Number of peptides = 1 || ambiguous || 99.4% Confident
CDC2_MOUSE - (P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9CSN8 - (Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) || Number of peptides = 2 || ambiguous || 99.4% Confident
GSH1_MOUSE - (P97494) Glutamate--cysteine ligase catalytic subunit (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS heavy chain) || Number of peptides = 6 || ambiguous || 99.4% Confident
Q14185 - (Q14185) DOCK180 protein || Number of peptides = 8 || unambiguous || 99.4% Confident
DPY1_MOUSE - (P97427) Dihydropyrimidinase related protein-1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (ULIP3 protein) || Number of peptides = 4 || ambiguous || 99.4% Confident
KPYR_MOUSE - (P53657) Pyruvate kinase, isozymes R/L (EC 2.7.1.40) (L-PK) || Number of peptides = 5 || unambiguous || 99.4% Confident
IF41_HUMAN - (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) || Number of peptides = 3 || ambiguous || 99.3% Confident
Q9QZE7 - (Q9QZE7) Translin associated protein X (Translin-associated factor X) || Number of peptides = 1 || unambiguous || 99.3% Confident
Q96B94 - (Q96B94) Similar to KIAA0807 protein || Number of peptides = 1 || unambiguous || 99.3% Confident
Q61166 - (Q61166) APC-binding protein EB1 homolog || Number of peptides = 3 || unambiguous || 99.3% Confident
RIK1_MOUSE - (Q60855) Receptor-interacting serine/threonine protein kinase 2 (EC 2.7.1.-) (Serine/threonine protein kinase RIP) (Cell death protein RIP) (Receptor interacting protein) || Number of peptides = 2 || unambiguous || 99.3% Confident
PSD1_HUMAN - (Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) || Number of peptides = 3 || unambiguous || 99.3% Confident
Q9D9F9 - (Q9D9F9) C330027I04Rik protein || Number of peptides = 1 || ambiguous || 99.3% Confident
Q922P1 - (Q922P1) RIKEN cDNA 2010012F05 gene || Number of peptides = 4 || ambiguous || 99.3% Confident
WDR1_HUMAN - (O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1) || Number of peptides = 2 || unambiguous || 99.3% Confident
MGD1_HUMAN - (Q9Y5V3) Melanoma-associated antigen D1 (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) (PRO2292) || Number of peptides = 3 || unambiguous || 99.3% Confident
H105_MOUSE - (Q61699) Heat-shock protein 105 kDa (Heat shock-related 100 kDa protein E7I) (HSP-E7I) (Heat shock 110 kDa protein) (42 degrees C-HSP) || Number of peptides = 4 || unambiguous || 99.3% Confident
PUR6_MOUSE - (Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)] || Number of peptides = 1 || unambiguous || 99.3% Confident
Q9D3B7 - (Q9D3B7) 6330404L05Rik protein || Number of peptides = 3 || ambiguous || 99.3% Confident
Q9D1L4 - (Q9D1L4) 0610039D01Rik protein (RIKEN cDNA 0610039D01 gene) || Number of peptides = 1 || unambiguous || 99.3% Confident
RECK_HUMAN - (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) || Number of peptides = 8 || unambiguous || 99.3% Confident
IC1_MOUSE - (P97290) Plasma protease C1 inhibitor precursor (C1 Inh) (C1Inh) || Number of peptides = 5 || unambiguous || 99.2% Confident
Q9D6U5 - (Q9D6U5) 2310057C03Rik protein || Number of peptides = 1 || ambiguous || 99.2% Confident
QOR_MOUSE - (P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin) || Number of peptides = 3 || unambiguous || 99.2% Confident
HP28_HUMAN - (Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) || Number of peptides = 1 || unambiguous || 99.2% Confident
O35727 - (O35727) Factor XII || Number of peptides = 3 || unambiguous || 99.2% Confident
Q96SC3 - (Q96SC3) Fibulin-6 (Fragment) || Number of peptides = 7 || ambiguous || 99.2% Confident
Q91XF0 - (Q91XF0) Similar to pyridoxine 5'-phosphate oxidase (Expressed sequence AI415282) || Number of peptides = 3 || unambiguous || 99.2% Confident
Z219_HUMAN - (Q9P2Y4) Zinc finger protein 219 || Number of peptides = 16 || unambiguous || 99.2% Confident
Q99KS1 - (Q99KS1) Hypothetical 16.5 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 99.2% Confident
TCP1_MOUSE - (P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) || Number of peptides = 4 || ambiguous || 99.2% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 3 || unambiguous || 99.1% Confident
MCM2_MOUSE - (P97310) DNA replication licensing factor MCM2 || Number of peptides = 10 || unambiguous || 99.1% Confident
MCM7_MOUSE - (Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) || Number of peptides = 3 || unambiguous || 99.1% Confident
GLYG_MOUSE - (Q9R062) Glycogenin-1 (EC 2.4.1.186) || Number of peptides = 5 || unambiguous || 99.1% Confident
PPI2_MOUSE - (P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) || Number of peptides = 2 || ambiguous || 99.1% Confident
GYG2_HUMAN - (O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) || Number of peptides = 4 || unambiguous || 99.1% Confident
LAS1_MOUSE - (Q61792) LIM and SH3 domain protein 1 (LASP-1) (MLN 50) || Number of peptides = 2 || ambiguous || 99.1% Confident
Q921L0 - (Q921L0) Similar to phosphatidylinositol binding clathrin assembly protein || Number of peptides = 4 || ambiguous || 99.1% Confident
FLNA_HUMAN - (P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) || Number of peptides = 11 || unambiguous || 99.1% Confident
VINC_MOUSE - (Q64727) Vinculin (Metavinculin) || Number of peptides = 12 || unambiguous || 99.1% Confident
Q9CYD6 - (Q9CYD6) 5730525G14Rik protein || Number of peptides = 2 || ambiguous || 99.1% Confident
HBD_HUMAN - (P02042) Hemoglobin delta chain || Number of peptides = 26 || unambiguous || 99.1% Confident
IF4G_HUMAN - (Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) || Number of peptides = 6 || unambiguous || 99.1% Confident
VAA1_MOUSE - (P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) || Number of peptides = 5 || ambiguous || 99.1% Confident
CT11_MOUSE - (Q9D269) Cystatin 11 precursor || Number of peptides = 1 || unambiguous || 99.1% Confident
RET1_MOUSE - (Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI) || Number of peptides = 1 || ambiguous || 99.1% Confident
GELS_MOUSE - (P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) || Number of peptides = 3 || ambiguous || 99.1% Confident
PP1A_HUMAN - (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) || Number of peptides = 3 || ambiguous || 99.1% Confident
Q9Z332 - (Q9Z332) Keratin 6 alpha || Number of peptides = 2 || ambiguous || 99.0% Confident
Q8R346 - (Q8R346) Similar to alanyl-tRNA synthetase (H. sapiens) || Number of peptides = 4 || unambiguous || 99.0% Confident
Q62084 - (Q62084) PNG protein || Number of peptides = 2 || ambiguous || 99.0% Confident
TERA_MOUSE - (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] || Number of peptides = 14 || ambiguous || 99.0% Confident
ROG_MOUSE - (O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G) || Number of peptides = 8 || unambiguous || 98.9% Confident
Q9NR99 - (Q9NR99) Adlican || Number of peptides = 15 || unambiguous || 98.9% Confident
PRSX_HUMAN - (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) || Number of peptides = 4 || ambiguous || 98.8% Confident
Q9DCL8 - (Q9DCL8) 0610025N14Rik protein || Number of peptides = 4 || unambiguous || 98.8% Confident
Q9Y372 - (Q9Y372) CGI-62 protein || Number of peptides = 1 || ambiguous || 98.7% Confident
CDNC_MOUSE - (P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2) || Number of peptides = 1 || ambiguous || 98.7% Confident
Q8VD36 - (Q8VD36) Similar to hypothetical protein FLJ12168 || Number of peptides = 8 || ambiguous || 98.7% Confident
Q9H853 - (Q9H853) Hypothetical protein FLJ13940 || Number of peptides = 4 || unambiguous || 98.7% Confident
Q8VHX8 - (Q8VHX8) Filamin A (Fragment) || Number of peptides = 1 || unambiguous || 98.6% Confident
SG2N_MOUSE - (Q9ERG2) Cell-cycle autoantigen SG2NA (S/G2 antigen) || Number of peptides = 3 || ambiguous || 98.6% Confident
LEG3_MOUSE - (P16110) Galectin-3 (Galactose-specific lectin 3) (MAC-2 antigen) (IgE-binding protein) (35 kDa lectin) (Carbohydrate binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-34 galactoside-binding lectin) || Number of peptides = 2 || ambiguous || 98.6% Confident
KCRB_HUMAN - (P12277) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) || Number of peptides = 1 || unambiguous || 98.6% Confident
MCM3_MOUSE - (P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) || Number of peptides = 5 || unambiguous || 98.6% Confident
Q91X94 - (Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) || Number of peptides = 4 || ambiguous || 98.6% Confident
Q60817 - (Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) || Number of peptides = 2 || ambiguous || 98.6% Confident
TCPQ_MOUSE - (P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta) || Number of peptides = 5 || unambiguous || 98.6% Confident
RADI_MOUSE - (P26043) Radixin || Number of peptides = 7 || unambiguous || 98.6% Confident
KAC_MOUSE - (P01837) Ig kappa chain C region || Number of peptides = 2 || ambiguous || 98.6% Confident
143G_HUMAN - (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 6 || ambiguous || 98.6% Confident
TRAL_MOUSE - (Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) || Number of peptides = 10 || unambiguous || 98.6% Confident
GC1_MOUSE - (P01868) Ig gamma-1 chain C region || Number of peptides = 5 || ambiguous || 98.6% Confident
Q8R3V9 - (Q8R3V9) Hypothetical 52.0 kDa protein || Number of peptides = 4 || unambiguous || 98.6% Confident
DJA1_MOUSE - (P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) || Number of peptides = 2 || ambiguous || 98.5% Confident
RPGR_HUMAN - (Q92834) X-linked retinitis pigmentosa GTPase regulator || Number of peptides = 2 || unambiguous || 98.5% Confident
Q921X8 - (Q921X8) Unknown (Protein for MGC:11985) || Number of peptides = 3 || unambiguous || 98.5% Confident
ADHX_MOUSE - (P28474) Alcohol dehydrogenase class III (EC 1.1.1.1) (Alcohol dehydrogenase 2) (Glutathione-dependent formaldehyde dehydrogenase) (EC 1.2.1.1) (FDH) (FALDH) (Alcohol dehydrogenase-B2) (ADH-B2) || Number of peptides = 2 || unambiguous || 98.5% Confident
HBB0_MOUSE - (P04443) Hemoglobin beta-H0 chain || Number of peptides = 4 || unambiguous || 98.5% Confident
DYJ2_HUMAN - (O43237) Dynein light intermediate chain 2, cytosolic (LIC53/55) (LIC-2) || Number of peptides = 1 || ambiguous || 98.4% Confident
Q9DCZ7 - (Q9DCZ7) WD40 protein Ciao1 || Number of peptides = 3 || unambiguous || 98.3% Confident
ATC4_HUMAN - (O75185) Probable calcium-transporting ATPase KIAA0703 (EC 3.6.3.8) || Number of peptides = 10 || unambiguous || 98.3% Confident
STN1_MOUSE - (P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) || Number of peptides = 4 || unambiguous || 98.3% Confident
STN2_MOUSE - (P55821) Stathmin 2 (SCG10 protein) (Superior cervical ganglion-10 protein) || Number of peptides = 2 || ambiguous || 98.3% Confident
Q9WTM5 - (Q9WTM5) DNA helicase || Number of peptides = 2 || ambiguous || 98.2% Confident
CDK4_MOUSE - (P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) || Number of peptides = 5 || unambiguous || 98.2% Confident
CLI1_MOUSE - (Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) || Number of peptides = 6 || ambiguous || 98.2% Confident
Q9D6E6 - (Q9D6E6) 2900073G15Rik protein || Number of peptides = 2 || ambiguous || 98.2% Confident
O08817 - (O08817) CW17 protein || Number of peptides = 3 || ambiguous || 98.2% Confident
LDHA_MOUSE - (P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) || Number of peptides = 8 || unambiguous || 98.2% Confident
THIO_MOUSE - (P10639) Thioredoxin (ATL-derived factor) (ADF) || Number of peptides = 10 || unambiguous || 98.2% Confident
Q8R2L7 - (Q8R2L7) Similar to hypothetical protein MGC5395 || Number of peptides = 2 || unambiguous || 98.1% Confident
RGSA_MOUSE - (Q9CQE5) Regulator of G-protein signaling 10 (RGS10) || Number of peptides = 4 || unambiguous || 98.1% Confident
O35295 - (O35295) Vascular actin single-stranded DNA-binding factor 2 p44 component || Number of peptides = 2 || unambiguous || 98.1% Confident
Q91YL6 - (Q91YL6) Hypothetical 34.0 kDa protein || Number of peptides = 1 || unambiguous || 98.1% Confident
PHS_HUMAN - (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) || Number of peptides = 1 || ambiguous || 98.1% Confident
PCK7_MOUSE - (Q61139) Proprotein convertase subtilisin/kexin type 7 precursor (EC 3.4.21.-) (Proprotein convertase PC7) (Subtilisin/kexin-like protease PC7) (Prohormone convertase PC7) (Subtilisin-like proprotein convertase 7) (SPC7) || Number of peptides = 4 || unambiguous || 98.0% Confident
Q9CXZ2 - (Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence || Number of peptides = 4 || ambiguous || 98.0% Confident
GTM5_MOUSE - (P48774) Glutathione S-transferase Mu 5 (EC 2.5.1.18) (GST class-mu 5) (Fibrous sheath component 2) (Fsc2) || Number of peptides = 1 || unambiguous || 98.0% Confident
Q9D6D4 - (Q9D6D4) 2900092C05Rik protein || Number of peptides = 1 || unambiguous || 98.0% Confident
Q99JY9 - (Q99JY9) Hypothetical 47.4 kDa protein || Number of peptides = 1 || ambiguous || 98.0% Confident
Q8VCM7 - (Q8VCM7) Similar to fibrinogen, gamma polypeptide || Number of peptides = 2 || ambiguous || 98.0% Confident
HBB_HUMAN - (P02023) Hemoglobin beta chain || Number of peptides = 5 || ambiguous || 98.0% Confident
IMD1_MOUSE - (P50096) Inosine-5'-monophosphate dehydrogenase 1 (EC 1.1.1.205) (IMP dehydrogenase 1) (IMPDH-I) (IMPD 1) || Number of peptides = 2 || unambiguous || 97.9% Confident
NDKA_MOUSE - (P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) || Number of peptides = 6 || unambiguous || 97.9% Confident
DEST_MOUSE - (Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) || Number of peptides = 4 || unambiguous || 97.9% Confident
MLEN_MOUSE - (Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) || Number of peptides = 3 || ambiguous || 97.9% Confident
Q8TBK2 - (Q8TBK2) Similar to hypothetical protein FLJ21148 || Number of peptides = 2 || unambiguous || 97.9% Confident
O00429 - (O00429) Dynamin-like protein || Number of peptides = 4 || ambiguous || 97.8% Confident
Q9H1T6 - (Q9H1T6) BA261P9.2 (Putative novel protein similar to fly CG7340 and human putative aminopeptidase ZK353.6 in chromosome 3 (EC 3.4.11.-)) (Fragment) || Number of peptides = 2 || unambiguous || 97.8% Confident
PRO1_MOUSE - (P10924) Profilin I || Number of peptides = 6 || unambiguous || 97.8% Confident
Q9DAN1 - (Q9DAN1) 1700007B13Rik protein || Number of peptides = 14 || unambiguous || 97.8% Confident
Q8R1K5 - (Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) || Number of peptides = 1 || ambiguous || 97.8% Confident
A1T3_MOUSE - (Q00896) Alpha-1-antitrypsin 1-3 precursor (Serine protease inhibitor 1-3) (Alpha-1 protease inhibitor 3) || Number of peptides = 5 || ambiguous || 97.8% Confident
A1T2_MOUSE - (P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 8 || ambiguous || 97.8% Confident
UB5B_HUMAN - (P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) (P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) || Number of peptides = 3 || ambiguous || 97.6% Confident
P97412 - (P97412) Lysosomal trafficking regulator (CHS1 homolog) || Number of peptides = 18 || unambiguous || 97.5% Confident
Q91V41 - (Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) || Number of peptides = 4 || ambiguous || 97.5% Confident
EPA3_HUMAN - (P29320) Ephrin type-A receptor 3 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor ETK1) (HEK) (HEK4) || Number of peptides = 5 || unambiguous || 97.5% Confident
ACBP_MOUSE - (P31786) Acyl-CoA-binding protein (ACBP) (Diazepam binding inhibitor) (DBI) (Endozepine) (EP) || Number of peptides = 1 || unambiguous || 97.4% Confident
Q9WVQ5 - (Q9WVQ5) MMRP19 (Monocyte macrophage 19) || Number of peptides = 3 || unambiguous || 97.4% Confident
GTM2_MOUSE - (P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5) || Number of peptides = 3 || unambiguous || 97.4% Confident
PSDB_HUMAN - (O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) || Number of peptides = 2 || unambiguous || 97.3% Confident
UBCI_HUMAN - (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) || Number of peptides = 4 || ambiguous || 97.3% Confident
PYRG_MOUSE - (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) || Number of peptides = 3 || ambiguous || 97.3% Confident
CNBP_MOUSE - (P53996) Cellular nucleic acid binding protein (CNBP) || Number of peptides = 2 || ambiguous || 97.2% Confident
FAS_MOUSE - (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) || Number of peptides = 7 || unambiguous || 97.2% Confident
Q96MP7 - (Q96MP7) Hypothetical protein FLJ32070 || Number of peptides = 9 || unambiguous || 97.2% Confident
SERC_MOUSE - (Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) || Number of peptides = 7 || unambiguous || 97.1% Confident
Q9JIX4 - (Q9JIX4) DNA binding protein DESRT || Number of peptides = 4 || unambiguous || 97.1% Confident
CIA1_HUMAN - (O76071) WD-repeat containing protein Ciao 1 || Number of peptides = 17 || unambiguous || 97.1% Confident
PSD3_MOUSE - (P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen) || Number of peptides = 1 || ambiguous || 97.0% Confident
O89055 - (O89055) Nonmuscle myosin heavy chain-A (Fragment) || Number of peptides = 3 || unambiguous || 97.0% Confident
Q8VBV7 - (Q8VBV7) Hypothetical 23.3 kDa protein (Similar to COP9 homolog) (Expressed sequence AA408242) || Number of peptides = 1 || unambiguous || 97.0% Confident
Q91WC3 - (Q91WC3) Similar to fatty-acid-coenzyme A ligase, long-chain 6 || Number of peptides = 2 || unambiguous || 96.9% Confident
LCFA_HUMAN - (P41215) Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (Long-chain acyl-CoA synthetase 1) (LACS 1) (Palmitoyl-CoA ligase) || Number of peptides = 1 || ambiguous || 96.9% Confident
Q8VED5 - (Q8VED5) Similar to keratin 6A (Fragment) || Number of peptides = 3 || unambiguous || 96.9% Confident
PLSI_HUMAN - (Q14651) I-plastin (Intestine-specific plastin) || Number of peptides = 9 || unambiguous || 96.9% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 7 || unambiguous || 96.9% Confident
ZYX_MOUSE - (Q62523) Zyxin || Number of peptides = 8 || unambiguous || 96.8% Confident
GIPC_MOUSE - (Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) || Number of peptides = 3 || unambiguous || 96.8% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 14 || unambiguous || 96.8% Confident
Q9GZQ2 - (Q9GZQ2) DRC3 || Number of peptides = 1 || unambiguous || 96.8% Confident
FSC1_HUMAN - (Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) || Number of peptides = 2 || ambiguous || 96.8% Confident
P2BA_MOUSE - (P20652) Serine/threonine protein phosphatase 2B catalytic subunit, alpha isoform (EC 3.1.3.16) (Calmodulin-dependent calcineurin A subunit, alpha isoform) (CAM-PRP catalytic subunit) || Number of peptides = 5 || unambiguous || 96.8% Confident
CP2B_MOUSE - (O35084) 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (EC 1.14.-.-) (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha) || Number of peptides = 9 || unambiguous || 96.7% Confident
Q9Y2H9 - (Q9Y2H9) Hypothetical protein KIAA0973 (Fragment) || Number of peptides = 4 || unambiguous || 96.7% Confident
Q8VHA6 - (Q8VHA6) SOCS box protein ASB-18 || Number of peptides = 8 || unambiguous || 96.7% Confident
IDE_HUMAN - (P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 6 || unambiguous || 96.7% Confident
Z298_HUMAN - (P57071) Zinc finger protein 298 (PR-domain zinc finger protein 15) (Fragment) || Number of peptides = 14 || unambiguous || 96.7% Confident
Q9JI02 - (Q9JI02) 11 kDa secreted protein || Number of peptides = 1 || unambiguous || 96.6% Confident
CAH1_MOUSE - (P13634) Carbonic anhydrase I (EC 4.2.1.1) (Carbonate dehydratase I) (CA-I) || Number of peptides = 3 || unambiguous || 96.6% Confident
PSA2_MOUSE - (P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) || Number of peptides = 1 || ambiguous || 96.5% Confident
U186_MOUSE - (Q923D4) Hypothetical protein MGC11596 || Number of peptides = 1 || ambiguous || 96.4% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 3 || ambiguous || 96.3% Confident
143B_MOUSE - (Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 12 || unambiguous || 96.3% Confident
Q9CXT4 - (Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence || Number of peptides = 8 || unambiguous || 96.3% Confident
CARE_HUMAN - (Q9BXL6) Caspase recruitment domain protein 14 (CARD-containing MAGUK protein 2) (Carma 2) || Number of peptides = 3 || unambiguous || 96.3% Confident
DYL1_HUMAN - (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) || Number of peptides = 1 || ambiguous || 96.3% Confident
UNRI_MOUSE - (Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) || Number of peptides = 1 || unambiguous || 96.3% Confident
Q922S1 - (Q922S1) Similar to phenylalanine-tRNA synthetase-like || Number of peptides = 3 || ambiguous || 96.3% Confident
DSC1_HUMAN - (Q08554) Desmocollin 1A/1B precursor (Desmosomal glycoprotein 2/3) (DG2/DG3) || Number of peptides = 4 || ambiguous || 96.3% Confident
Q9H3S6 - (Q9H3S6) TCAM-1 (Fragment) || Number of peptides = 1 || unambiguous || 96.3% Confident
Q9D7P5 - (Q9D7P5) 2300004C15Rik protein || Number of peptides = 2 || ambiguous || 96.3% Confident
Q9Y2V6 - (Q9Y2V6) Hypothetical protein || Number of peptides = 2 || unambiguous || 96.2% Confident
ITA5_MOUSE - (P11688) Integrin alpha-5 precursor (Fibronectin receptor alpha subunit) (Integrin alpha-F) (VLA-5) (CD49e) || Number of peptides = 4 || unambiguous || 96.1% Confident
ATXX_MOUSE - (P28658) Ataxin-10 (Spinocerebellar ataxia type 10 protein homolog) (Brain protein E46) || Number of peptides = 4 || unambiguous || 96.1% Confident
Q9H0R5 - (Q9H0R5) Hypothetical protein || Number of peptides = 6 || ambiguous || 96.0% Confident
Q96N70 - (Q96N70) Hypothetical protein FLJ31331 || Number of peptides = 3 || unambiguous || 96.0% Confident
EF1D_MOUSE - (P57776) Elongation factor 1-delta (EF-1-delta) || Number of peptides = 4 || unambiguous || 95.9% Confident
Q99LE7 - (Q99LE7) Similar to paxillin (Fragment) || Number of peptides = 1 || ambiguous || 95.9% Confident
Q9EPF1 - (Q9EPF1) L-gicerin/MUC18 || Number of peptides = 3 || unambiguous || 95.7% Confident
CALU_MOUSE - (O35887) Calumenin precursor || Number of peptides = 2 || ambiguous || 95.7% Confident
O94779 - (O94779) HNB-2 || Number of peptides = 4 || unambiguous || 95.7% Confident
O35737 - (O35737) Heterogeneous nuclear ribonucleoprotein H || Number of peptides = 2 || ambiguous || 95.7% Confident
TIE1_MOUSE - (Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112) || Number of peptides = 6 || unambiguous || 95.7% Confident
LEG1_MOUSE - (P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) || Number of peptides = 4 || ambiguous || 95.6% Confident
Q9NRD8 - (Q9NRD8) NADPH thyroid oxidase 2 || Number of peptides = 7 || unambiguous || 95.5% Confident
O88544 - (O88544) COP9 complex subunit 4 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 4) (ARABIDOPSIS) || Number of peptides = 5 || ambiguous || 95.4% Confident
Q9BW18 - (Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit || Number of peptides = 2 || ambiguous || 95.4% Confident
Q8R1Q8 - (Q8R1Q8) Hypothetical 56.6 kDa protein || Number of peptides = 1 || ambiguous || 95.3% Confident
Q9CT17 - (Q9CT17) 2610019N13Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 95.2% Confident
LCFB_MOUSE - (P41216) Long-chain-fatty-acid--CoA ligase 2 (EC 6.2.1.3) (Long-chain acyl-CoA synthetase 2) (LACS 2) || Number of peptides = 4 || unambiguous || 95.2% Confident
Q9EQ00 - (Q9EQ00) cAMP-dependent protein kinase regulatory subunit || Number of peptides = 2 || unambiguous || 95.2% Confident
K2C1_MOUSE - (P04104) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (67 kDa cytokeratin) || Number of peptides = 6 || unambiguous || 95.1% Confident
Q9R0H5 - (Q9R0H5) Type II cytokeratin (Keratin protein K6irs) || Number of peptides = 2 || ambiguous || 95.1% Confident
ADDB_MOUSE - (Q9QYB8) Beta adducin (Erythrocyte adducin beta subunit) (Add97) || Number of peptides = 2 || ambiguous || 95.0% Confident
DYI2_MOUSE - (O88487) Dynein intermediate chain 2, cytosolic (DH IC-2) (Cytoplasmic dynein intermediate chain 2) || Number of peptides = 2 || unambiguous || 95.0% Confident
GIT1_HUMAN - (Q9Y2X7) ARF GTPase-activating protein GIT1 (G protein-coupled receptor kinase-interactor 1) || Number of peptides = 5 || unambiguous || 94.9% Confident
HAIR_MOUSE - (Q61645) Hairless protein || Number of peptides = 5 || unambiguous || 94.9% Confident
Q9ER48 - (Q9ER48) Stretch regulated skeletal muscle protein || Number of peptides = 2 || unambiguous || 94.9% Confident
MKR3_MOUSE - (Q60764) Makorin 3 (Zinc-finger protein 127) || Number of peptides = 1 || unambiguous || 94.9% Confident
IMA5_MOUSE - (O35345) Importin alpha-6 subunit (Karyopherin alpha-5 subunit) (Importin alpha S2) || Number of peptides = 2 || unambiguous || 94.9% Confident
Q9D1M2 - (Q9D1M2) 1110003E08Rik protein || Number of peptides = 1 || ambiguous || 94.9% Confident
MIF_MOUSE - (P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) || Number of peptides = 5 || unambiguous || 94.9% Confident
Q922B6 - (Q922B6) Unknown (Protein for MGC:7807) || Number of peptides = 3 || ambiguous || 94.9% Confident
O95996 - (O95996) APCL protein || Number of peptides = 4 || unambiguous || 94.9% Confident
Q96BZ3 - (Q96BZ3) Similar to hypothetical protein MGC2605 || Number of peptides = 2 || unambiguous || 94.9% Confident
P97462 - (P97462) Embryonic ECTODERM development (Embryonic ECTODERM development protein) || Number of peptides = 3 || unambiguous || 94.8% Confident
IL4R_HUMAN - (P24394) Interleukin-4 receptor alpha chain precursor (IL-4R-alpha) (CD124 antigen) || Number of peptides = 2 || unambiguous || 94.8% Confident
STRN_MOUSE - (O55106) Striatin || Number of peptides = 4 || unambiguous || 94.8% Confident
Q9D1L3 - (Q9D1L3) 1110003N24Rik protein || Number of peptides = 2 || unambiguous || 94.8% Confident
Q9CX82 - (Q9CX82) 3100002B05Rik protein || Number of peptides = 6 || unambiguous || 94.8% Confident
O43423 - (O43423) Pp32r1 || Number of peptides = 1 || unambiguous || 94.6% Confident
GCAA_MOUSE - (P01863) Ig gamma-2A chain C region, A allele || Number of peptides = 3 || ambiguous || 94.5% Confident
Q9JHJ3 - (Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) || Number of peptides = 37 || unambiguous || 94.5% Confident
R23B_MOUSE - (P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58) || Number of peptides = 2 || ambiguous || 94.5% Confident
PSD5_HUMAN - (Q16401) 26S proteasome non-ATPase regulatory subunit 5 (26S proteasome subunit S5B) (26S protease subunit S5 basic) || Number of peptides = 3 || unambiguous || 94.4% Confident
CYTC_MOUSE - (P21460) Cystatin C precursor (Cystatin 3) || Number of peptides = 2 || unambiguous || 94.4% Confident
ALFA_HUMAN - (P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1) || Number of peptides = 7 || unambiguous || 94.4% Confident
FRZB_MOUSE - (P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3) || Number of peptides = 1 || ambiguous || 94.4% Confident
Q9EQJ0 - (Q9EQJ0) Calcium channel || Number of peptides = 2 || unambiguous || 94.3% Confident
Q9P2D7 - (Q9P2D7) Hypothetical protein KIAA1410 (Fragment) || Number of peptides = 2 || unambiguous || 94.3% Confident
O95788 - (O95788) Voltage-gated sodium channel alpha subunit || Number of peptides = 4 || unambiguous || 94.3% Confident
Q9D8W9 - (Q9D8W9) 1810027D10Rik protein || Number of peptides = 2 || ambiguous || 94.3% Confident
Q9EQC5 - (Q9EQC5) 105-kDa kinase-like protein || Number of peptides = 4 || unambiguous || 94.3% Confident
ILK_MOUSE - (O55222) Integrin-linked protein kinase (EC 2.7.1.-) || Number of peptides = 6 || unambiguous || 94.2% Confident
Q9EPK6 - (Q9EPK6) Sil1 protein precursor || Number of peptides = 5 || unambiguous || 94.2% Confident
Q99JJ2 - (Q99JJ2) Hypothetical 45.1 kDa protein || Number of peptides = 2 || unambiguous || 94.1% Confident
Q99KJ9 - (Q99KJ9) Hypothetical 73.2 kDa protein || Number of peptides = 5 || unambiguous || 94.1% Confident
Q91VL3 - (Q91VL3) Similar to Rho guanine nucleotide exchange factor (GEF) 1 || Number of peptides = 5 || unambiguous || 94.1% Confident
Q9D3V6 - (Q9D3V6) 4933432H23Rik protein || Number of peptides = 1 || unambiguous || 94.1% Confident
O08797 - (O08797) Serine proteinase inhibitor 6 || Number of peptides = 2 || unambiguous || 94.1% Confident
PTNB_MOUSE - (P35235) Protein-tyrosine phosphatase, non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase SYP) || Number of peptides = 1 || ambiguous || 94.0% Confident
AP19_MOUSE - (P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) || Number of peptides = 1 || ambiguous || 94.0% Confident
Q99NE6 - (Q99NE6) EDF-1 protein || Number of peptides = 3 || ambiguous || 94.0% Confident
S107_HUMAN - (P31151) S100 calcium-binding protein A7 (Psoriasin) || Number of peptides = 2 || unambiguous || 93.8% Confident
AAC4_MOUSE - (P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) || Number of peptides = 10 || unambiguous || 93.7% Confident
TCPG_MOUSE - (P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin) || Number of peptides = 3 || ambiguous || 93.7% Confident
Q91YS8 - (Q91YS8) Similar to calcium/calmodulin-dependent protein kinase I || Number of peptides = 2 || ambiguous || 93.5% Confident
ANM1_MOUSE - (Q9JIF0) Protein arginine N-methyltransferase 1 (EC 2.1.1.-) || Number of peptides = 2 || unambiguous || 93.5% Confident
OAT_MOUSE - (P29758) Ornithine aminotransferase, mitochondrial precursor (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) || Number of peptides = 2 || unambiguous || 93.4% Confident
TCTP_MOUSE - (P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein) || Number of peptides = 4 || unambiguous || 93.4% Confident
Q9CRI0 - (Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) || Number of peptides = 2 || ambiguous || 93.3% Confident
PSB5_MOUSE - (O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6) || Number of peptides = 2 || ambiguous || 93.2% Confident
BIN1_MOUSE - (O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) || Number of peptides = 2 || unambiguous || 93.2% Confident
TUL2_MOUSE - (P46686) Tubby related protein 2 (Tubby-like protein 2) (P4-6 protein) (Fragment) || Number of peptides = 2 || unambiguous || 93.2% Confident
Y391_HUMAN - (O15091) Hypothetical protein KIAA0391 || Number of peptides = 3 || unambiguous || 93.2% Confident
Q9CXG9 - (Q9CXG9) 3321402G02Rik protein || Number of peptides = 1 || ambiguous || 93.2% Confident
Q9JLP3 - (Q9JLP3) Putative extracellular matrix protein MUSH2A || Number of peptides = 6 || unambiguous || 93.0% Confident
Q8WY20 - (Q8WY20) Centrosome-associated protein 350 (Hypothetical protein KIAA0480) || Number of peptides = 15 || unambiguous || 93.0% Confident
Q9UIS8 - (Q9UIS8) Testis-specific methyl-CpG binding protein 2 || Number of peptides = 10 || unambiguous || 93.0% Confident
UE3A_MOUSE - (O08759) Ubiquitin-protein ligase E3A (EC 6.3.2.-) (Oncogenic protein-associated protein E6-AP) || Number of peptides = 1 || ambiguous || 92.9% Confident
O88464 - (O88464) Heparan sulfate 2-sulfotransferase || Number of peptides = 4 || ambiguous || 92.8% Confident
MYO6_MOUSE - (Q64331) Myosin VI || Number of peptides = 9 || unambiguous || 92.8% Confident
Q60864 - (Q60864) MSTI1 || Number of peptides = 4 || ambiguous || 92.8% Confident
Q99K51 - (Q99K51) Hypothetical 70.7 kDa protein || Number of peptides = 3 || ambiguous || 92.7% Confident
O35945 - (O35945) Aldehyde dehydrogenase Ahd-2-like || Number of peptides = 2 || unambiguous || 92.7% Confident
NDR2_MOUSE - (Q9QYG0) NDRG2 protein (Ndr2 protein) || Number of peptides = 5 || unambiguous || 92.7% Confident
CAD2_HUMAN - (P19022) Neural-cadherin precursor (N-cadherin) (Cadherin-2) || Number of peptides = 7 || unambiguous || 92.7% Confident
Q96A90 - (Q96A90) G6b-C protein precursor || Number of peptides = 5 || unambiguous || 92.6% Confident
Q60845 - (Q60845) Dystonin isoform 2 (Fragment) || Number of peptides = 2 || ambiguous || 92.6% Confident
Q8R2Y6 - (Q8R2Y6) Hypothetical 35.4 kDa protein || Number of peptides = 4 || ambiguous || 92.6% Confident
Q9D8X5 - (Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) || Number of peptides = 25 || ambiguous || 92.6% Confident
Q91V24 - (Q91V24) ATP-binding cassette transporter sub-family A member 7 || Number of peptides = 7 || unambiguous || 92.6% Confident
ANX3_MOUSE - (O35639) Annexin III (Lipocortin III) (Placental anticoagulant protein III) (PAP-III) (35-alpha calcimedin) || Number of peptides = 3 || unambiguous || 92.5% Confident
Q9JLN5 - (Q9JLN5) Erythroid membrane-associated protein ERMAP || Number of peptides = 5 || unambiguous || 92.5% Confident
Q9D5V5 - (Q9D5V5) 4921514I20Rik protein || Number of peptides = 4 || ambiguous || 92.5% Confident
K2C8_MOUSE - (P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A) || Number of peptides = 5 || ambiguous || 92.5% Confident
MAP4_HUMAN - (P27816) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 4 || unambiguous || 92.5% Confident
OASL_MOUSE - (Q9Z2F2) 54 kDa 2'-5'-oligoadenylate synthetase like protein (EC 2.7.7.-) (p54 OASL) (p54OASL) (M1204) || Number of peptides = 2 || unambiguous || 92.4% Confident
Q8R5L0 - (Q8R5L0) Age-related protein || Number of peptides = 1 || unambiguous || 92.3% Confident
Q8WX19 - (Q8WX19) BA490F3.2.1 (Novel protein isoform 1) || Number of peptides = 6 || unambiguous || 92.3% Confident
M1A2_HUMAN - (O60476) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2) || Number of peptides = 6 || ambiguous || 92.2% Confident
Q96AA2 - (Q96AA2) Obscurin || Number of peptides = 13 || unambiguous || 92.2% Confident
Q9H9U6 - (Q9H9U6) Hypothetical protein FLJ12543 || Number of peptides = 7 || unambiguous || 92.0% Confident
ADFP_HUMAN - (Q99541) Adipophilin (Adipose differentiation-related protein) (ADRP) || Number of peptides = 6 || unambiguous || 92.0% Confident
RB1A_HUMAN - (P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein) || Number of peptides = 1 || ambiguous || 92.0% Confident
MY9B_MOUSE - (Q9QY06) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 6 || unambiguous || 92.0% Confident
SCP1_MOUSE - (Q62209) Synaptonemal complex protein 1 (SCP-1 protein) || Number of peptides = 9 || unambiguous || 92.0% Confident
ATFB_MOUSE - (O35451) Cyclic-AMP-dependent transcription factor ATF-6 beta (Activating transcription factor 6 beta) (ATF6-beta) (cAMP responsive element binding protein-like 1) (cAMP response element binding protein-related protein) (Creb-rp) || Number of peptides = 7 || unambiguous || 92.0% Confident
RSU1_MOUSE - (Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1) || Number of peptides = 5 || ambiguous || 91.9% Confident
Q9CW19 - (Q9CW19) 1500041B16Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 91.7% Confident
Q9CZ85 - (Q9CZ85) 2810038F24Rik protein || Number of peptides = 6 || unambiguous || 91.7% Confident
MY9B_HUMAN - (Q13459) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 8 || unambiguous || 91.6% Confident
LMA5_MOUSE - (Q61001) Laminin alpha-5 chain precursor || Number of peptides = 11 || unambiguous || 91.5% Confident
Q14840 - (Q14840) Mitogen inducible gene mig-2 (Fragment) || Number of peptides = 5 || unambiguous || 91.5% Confident
HBE_MOUSE - (P02104) Hemoglobin epsilon-Y2 chain || Number of peptides = 4 || ambiguous || 91.5% Confident
Q99KN9 - (Q99KN9) Similar to KIAA0171 gene product (Fragment) || Number of peptides = 1 || ambiguous || 91.5% Confident
SEP2_MOUSE - (P42208) Septin 2 (NEDD5 protein) || Number of peptides = 4 || ambiguous || 91.3% Confident
TP2A_MOUSE - (Q01320) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3) || Number of peptides = 4 || unambiguous || 91.3% Confident
Q9D7I8 - (Q9D7I8) 2310007D09Rik protein || Number of peptides = 7 || unambiguous || 91.2% Confident
Q91YE4 - (Q91YE4) 67 kDa polymerase-associated factor PAF67 || Number of peptides = 4 || ambiguous || 91.2% Confident
ADK_MOUSE - (P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment) || Number of peptides = 1 || ambiguous || 91.2% Confident
ZF25_HUMAN - (Q9UII5) Zinc finger protein ZFD25 || Number of peptides = 2 || unambiguous || 91.1% Confident
Q9D9R1 - (Q9D9R1) Adult male testis cDNA, RIKEN full-length enriched library, clone:1700030N20, full insert sequence || Number of peptides = 6 || ambiguous || 91.1% Confident
Q9NU12 - (Q9NU12) DJ102H19.3 (Novel protein) || Number of peptides = 1 || unambiguous || 91.1% Confident
RGL2_MOUSE - (Q61193) Ral guanine nucleotide dissociation stimulator-like 2 (RalGDS-like factor) || Number of peptides = 3 || unambiguous || 91.0% Confident
CA1C_MOUSE - (Q60847) Collagen alpha 1(XII) chain precursor || Number of peptides = 16 || unambiguous || 90.9% Confident
O43163 - (O43163) Hypothetical protein KIAA0436 (Fragment) || Number of peptides = 7 || unambiguous || 90.9% Confident
Q96QE3 - (Q96QE3) ATP/GTP-binding protein || Number of peptides = 16 || unambiguous || 90.9% Confident
PODX_HUMAN - (O00592) Podocalyxin-like protein 1 precursor || Number of peptides = 2 || unambiguous || 90.7% Confident
O08794 - (O08794) Alpha glucosidase II, alpha subunit || Number of peptides = 9 || unambiguous || 90.7% Confident
Q921J0 - (Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) || Number of peptides = 2 || unambiguous || 90.5% Confident
Q8TEL1 - (Q8TEL1) FLJ00182 protein (Fragment) || Number of peptides = 3 || unambiguous || 90.5% Confident
Q9NQS5 - (Q9NQS5) Inflammation-related G protein-coupled receptor EX33 (Orphan G protein-coupled receptor 84) (Putative G-protein coupled receptor) || Number of peptides = 2 || unambiguous || 90.5% Confident
O95848 - (O95848) Hypothetical protein || Number of peptides = 6 || unambiguous || 90.5% Confident
Q9CY91 - (Q9CY91) G1 to phase transition 2 || Number of peptides = 3 || ambiguous || 90.5% Confident
Q91VW5 - (Q91VW5) Golgi autoantigen, golgin subfamily a, 4 (Fragment) || Number of peptides = 5 || ambiguous || 90.5% Confident
C1QC_MOUSE - (Q02105) Complement C1q subcomponent, C chain precursor || Number of peptides = 3 || unambiguous || 90.4% Confident
Q9UPW8 - (Q9UPW8) Hypothetical protein KIAA1032 (Fragment) || Number of peptides = 3 || unambiguous || 90.3% Confident
DCT2_MOUSE - (Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) || Number of peptides = 2 || unambiguous || 90.2% Confident
TVA1_HUMAN - (P04436) T-cell receptor alpha chain V region HPB-MLT precursor (Fragment) || Number of peptides = 3 || unambiguous || 90.1% Confident
Q9Z2E1 - (Q9Z2E1) Methyl-CpG binding protein MBD2 || Number of peptides = 2 || unambiguous || 90.1% Confident
Q61241 - (Q61241) Serine/threonine kinase || Number of peptides = 7 || unambiguous || 90.1% Confident
HH3R_HUMAN - (Q9Y5N1) Histamine H3 receptor (HH3R) (G protein-coupled receptor 97) || Number of peptides = 2 || unambiguous || 90.1% Confident
PSD4_MOUSE - (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) || Number of peptides = 3 || ambiguous || 90.0% Confident
Q9ESQ1 - (Q9ESQ1) Type IV collagen alpha 6 chain || Number of peptides = 8 || unambiguous || 89.9% Confident
Q9EST0 - (Q9EST0) NCBE || Number of peptides = 6 || unambiguous || 89.9% Confident
Q99J36 - (Q99J36) Similar to hypothetical protein FLJ20274 || Number of peptides = 1 || ambiguous || 89.9% Confident
Q9CVS4 - (Q9CVS4) 1700049J03Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 89.8% Confident
PPCT_MOUSE - (P53808) Phosphatidylcholine transfer protein (PC-TP) || Number of peptides = 2 || unambiguous || 89.6% Confident
CPTM_HUMAN - (Q92523) Carnitine O-palmitoyltransferase I, mitochondrial muscle isoform (EC 2.3.1.21) (CPT I) (CPTI-M) (Carnitine palmitoyltransferase I like protein) || Number of peptides = 7 || unambiguous || 89.4% Confident
Q16301 - (Q16301) Cerebrin-50 || Number of peptides = 3 || unambiguous || 89.4% Confident
FMN1_MOUSE - (Q05860) Formin 1 isoforms I/II/III (Limb deformity protein) || Number of peptides = 10 || unambiguous || 89.4% Confident
P2CB_MOUSE - (P36993) Protein phosphatase 2C beta isoform (EC 3.1.3.16) (PP2C-beta) (IA) (Protein phosphatase 1B) || Number of peptides = 2 || ambiguous || 89.3% Confident
PCB1_HUMAN - (Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) || Number of peptides = 8 || unambiguous || 89.2% Confident
IF42_MOUSE - (P10630) Eukaryotic initiation factor 4A-II (eIF-4A-II) (eIF4A-II) || Number of peptides = 1 || ambiguous || 89.2% Confident
SEP6_MOUSE - (Q9R1T4) Septin 6 || Number of peptides = 2 || ambiguous || 89.2% Confident
O35328 - (O35328) Proline-rich protein 9-1 (Fragment) || Number of peptides = 3 || unambiguous || 89.2% Confident
Q9H4A1 - (Q9H4A1) CDC2L5 protein kinase || Number of peptides = 6 || unambiguous || 89.2% Confident
Q96MB5 - (Q96MB5) Hypothetical protein FLJ32682 || Number of peptides = 5 || unambiguous || 89.1% Confident
TRXB_HUMAN - (Q16881) Thioredoxin reductase, cytoplasmic precursor (EC 1.6.4.5) (TR) || Number of peptides = 6 || unambiguous || 88.7% Confident
Q9JII6 - (Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase) || Number of peptides = 7 || unambiguous || 88.7% Confident
TYB0_HUMAN - (P13472) Thymosin beta-10 || Number of peptides = 1 || unambiguous || 88.7% Confident
SNX5_MOUSE - (Q9D8U8) Sorting nexin 5 || Number of peptides = 2 || ambiguous || 88.7% Confident
NME1_HUMAN - (Q12879) Glutamate [NMDA] receptor subunit epsilon 1 precursor (N-methyl D-aspartate receptor subtype 2A) (NR2A) (NMDAR2A) (hNR2A) || Number of peptides = 1 || unambiguous || 88.7% Confident
APT_MOUSE - (P08030) Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT) || Number of peptides = 3 || unambiguous || 88.6% Confident
O2B3_HUMAN - (O76000) Olfactory receptor 2B3 (Olfactory receptor 6-4) (OR6-4) (Hs6M1-1) || Number of peptides = 5 || unambiguous || 88.6% Confident
O70619 - (O70619) Hypothetical 19.3 kDa protein || Number of peptides = 2 || unambiguous || 88.6% Confident
Q9Z1S3 - (Q9Z1S3) Ras activator RasGRP || Number of peptides = 4 || unambiguous || 88.5% Confident
Q9D0R8 - (Q9D0R8) 2600001B17Rik protein || Number of peptides = 3 || ambiguous || 88.5% Confident
TBA1_MOUSE - (P02551) Tubulin alpha-1 chain || Number of peptides = 1 || ambiguous || 88.4% Confident
Q91WX6 - (Q91WX6) SNF-1 related kinase || Number of peptides = 6 || ambiguous || 88.4% Confident
HO1_HUMAN - (P09601) Heme oxygenase 1 (EC 1.14.99.3) (HO-1) || Number of peptides = 2 || unambiguous || 88.4% Confident
Q9BZE5 - (Q9BZE5) PGC-1 related co-activator (Hypothetical protein KIAA0595) || Number of peptides = 4 || unambiguous || 88.4% Confident
ZEP2_HUMAN - (P31629) Human immunodeficiency virus type I enhancer-binding protein 2 (HIV-EP2) || Number of peptides = 6 || ambiguous || 88.3% Confident
Q9D1J1 - (Q9D1J1) 1110005F07Rik protein || Number of peptides = 2 || unambiguous || 88.1% Confident
HEPS_MOUSE - (O35453) Serine protease hepsin (EC 3.4.21.-) || Number of peptides = 2 || ambiguous || 88.1% Confident
CYRB_HUMAN - (P32927) Cytokine receptor common beta chain precursor (CDw131 antigen) || Number of peptides = 10 || unambiguous || 88.0% Confident
RASH_MOUSE - (Q61411) Transforming protein P21/H-RAS-1 (C-H-RAS) || Number of peptides = 5 || ambiguous || 88.0% Confident
Q93052 - (Q93052) LIPOMA PREFERRED partner (LPP) || Number of peptides = 5 || unambiguous || 87.8% Confident
Q9H280 - (Q9H280) Serologically defined breast cancer antigen NY-BR-62 (Fragment) || Number of peptides = 1 || unambiguous || 87.8% Confident
Q60690 - (Q60690) Myelin gene expression factor (Fragment) || Number of peptides = 2 || unambiguous || 87.7% Confident
CA14_MOUSE - (P02463) Collagen alpha 1(IV) chain precursor || Number of peptides = 11 || unambiguous || 87.7% Confident
CPD9_MOUSE - (P11714) Cytochrome P450 2D9 (EC 1.14.14.1) (CYPIID9) (P450-16-alpha) (CA) (Testosterone 16-alpha hydroxylase) || Number of peptides = 4 || unambiguous || 87.7% Confident
ST31_HUMAN - (Q9BXU1) Serine/threonine protein kinase 31 (EC 2.7.1.37) (Serine/threonine-protein kinase NYD-SPK) || Number of peptides = 8 || unambiguous || 87.5% Confident
Q99LS3 - (Q99LS3) Similar to phosphoserine phosphatase || Number of peptides = 2 || unambiguous || 87.5% Confident
Q99KD5 - (Q99KD5) Hypothetical 103.4 kDa protein || Number of peptides = 2 || unambiguous || 87.5% Confident
YC18_HUMAN - (Q9ULK2) Hypothetical protein KIAA1218 (Fragment) || Number of peptides = 3 || unambiguous || 87.2% Confident
VIME_MOUSE - (P20152) Vimentin || Number of peptides = 4 || unambiguous || 87.0% Confident
Q8VHQ0 - (Q8VHQ0) SPI3L2 || Number of peptides = 11 || unambiguous || 87.0% Confident
O15096 - (O15096) Phosphatidylinositol 4-kinase || Number of peptides = 3 || unambiguous || 87.0% Confident
Q9CZT3 - (Q9CZT3) 2610529C04Rik protein || Number of peptides = 2 || unambiguous || 86.9% Confident
Q9DBG3 - (Q9DBG3) 1300012O03Rik protein || Number of peptides = 5 || ambiguous || 86.9% Confident
RP30_MOUSE - (O88796) Ribonuclease P protein subunit p30 (EC 3.1.26.5) (RNaseP protein p30) (RNase P subunit 2) || Number of peptides = 4 || ambiguous || 86.7% Confident
GDIC_MOUSE - (Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) || Number of peptides = 2 || ambiguous || 86.6% Confident
SODM_MOUSE - (P09671) Superoxide dismutase [Mn], mitochondrial precursor (EC 1.15.1.1) || Number of peptides = 1 || unambiguous || 86.5% Confident
Q9CVB6 - (Q9CVB6) 2210023N03Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 86.5% Confident
O54971 - (O54971) Ubiquitin protein ligase || Number of peptides = 5 || unambiguous || 86.5% Confident
RNHL_HUMAN - (O75792) Ribonuclease HI large subunit (EC 3.1.26.-) (RNase HI large subunit) (RNase H(35)) (Ribonuclease H2) (RNase H2) || Number of peptides = 2 || unambiguous || 86.3% Confident
Q8TE58 - (Q8TE58) Metalloprotease disintegrin 15 with thrombospondin domains || Number of peptides = 1 || unambiguous || 86.3% Confident
Q99KN5 - (Q99KN5) Similar to thyroid hormone receptor interactor 12 || Number of peptides = 6 || unambiguous || 86.2% Confident
Q15673 - (Q15673) TYL protein || Number of peptides = 5 || ambiguous || 86.2% Confident
Q96N29 - (Q96N29) Hypothetical protein FLJ31482 || Number of peptides = 1 || ambiguous || 86.1% Confident
CYC_HUMAN - (P00001) Cytochrome c || Number of peptides = 6 || unambiguous || 86.1% Confident
Q9H0C0 - (Q9H0C0) Hypothetical protein || Number of peptides = 2 || unambiguous || 86.1% Confident
ITA3_MOUSE - (Q62470) Integrin alpha-3 precursor (Galactoprotein B3) (GAPB3) (VLA-3 alpha chain) (CD49c) || Number of peptides = 17 || unambiguous || 86.0% Confident
TYY1_MOUSE - (Q00899) Transcriptional repressor protein YY1 (Yin and yang 1) (YY-1) (Delta transcription factor) (NF-E1) (UCR-motif DNA-binding protein) || Number of peptides = 3 || ambiguous || 85.9% Confident
APB_HUMAN - (P04114) Apolipoprotein B-100 precursor (Apo B-100) [Contains: Apolipoprotein B-48 (Apo B-48)] || Number of peptides = 16 || unambiguous || 85.7% Confident
CFAB_MOUSE - (P04186) Complement factor B precursor (EC 3.4.21.47) (C3/C5 convertase) || Number of peptides = 2 || unambiguous || 85.7% Confident
CRTC_MOUSE - (P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) || Number of peptides = 3 || unambiguous || 85.5% Confident
Q9H9F7 - (Q9H9F7) Hypothetical protein FLJ12788 || Number of peptides = 2 || unambiguous || 85.3% Confident
Q9Y6X0 - (Q9Y6X0) SET-binding protein (SEB) (Hypothetical protein KIAA0437) || Number of peptides = 12 || unambiguous || 85.1% Confident
Q9CXF4 - (Q9CXF4) 4432405K22Rik protein || Number of peptides = 3 || unambiguous || 84.8% Confident
Q8VD76 - (Q8VD76) TFIIH basal transcription factor complex p34 subunit (Basic transcription factor 2 34 kDa subunit) (BTF2-p34) (General transcription factor IIH polypeptide 3) || Number of peptides = 9 || unambiguous || 84.8% Confident
VGR2_MOUSE - (P35918) Vascular endothelial growth factor receptor 2 precursor (EC 2.7.1.112) (VEGFR-2) (Protein-tyrosine kinase receptor flk-1) (Fetal liver kinase 1) (Kinase NYK) || Number of peptides = 15 || unambiguous || 84.8% Confident
CLN3_HUMAN - (Q13286) CLN3 protein (Battenin) (Batten disease protein) || Number of peptides = 1 || ambiguous || 84.8% Confident
Y893_HUMAN - (O94967) Hypothetical protein KIAA0893 || Number of peptides = 1 || unambiguous || 84.8% Confident
Q9CQ04 - (Q9CQ04) 5730405M13Rik protein || Number of peptides = 2 || ambiguous || 84.7% Confident
CENF_HUMAN - (P49454) CENP-F kinetochore protein (Centromere protein F) (Mitosin) (AH antigen) || Number of peptides = 10 || unambiguous || 84.7% Confident
Q924X8 - (Q924X8) Olfactory receptor S85 (Olfactory receptor MOR13-6) || Number of peptides = 2 || unambiguous || 84.7% Confident
Q9DAH0 - (Q9DAH0) Four and a half LIM domains 4 || Number of peptides = 5 || unambiguous || 84.6% Confident
Q91Y38 - (Q91Y38) UDP-N-acetylglucosaminyltransferase || Number of peptides = 2 || ambiguous || 84.4% Confident
O00285 - (O00285) Putative alternative lens membrane intrinsic protein (Fragment) || Number of peptides = 1 || unambiguous || 84.1% Confident
Q96B97 - (Q96B97) C-Cbl-interacting protein || Number of peptides = 3 || unambiguous || 83.9% Confident
O88473 - (O88473) HERC2 protein || Number of peptides = 12 || unambiguous || 83.9% Confident
LRP1_HUMAN - (Q07954) Low-density lipoprotein receptor-related protein 1 precursor (LRP) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD91) || Number of peptides = 4 || unambiguous || 83.9% Confident
RYR3_HUMAN - (Q15413) Ryanodine receptor 3 (Brain-type ryanodine receptor) (RyR3) (RYR-3) (Brain ryanodine receptor-calcium release channel) || Number of peptides = 15 || unambiguous || 83.8% Confident
ANR2_MOUSE - (Q9WV06) Ankyrin repeat domain protein 2 (Skeletal muscle ankyrin repeat protein) (mArpp) || Number of peptides = 7 || unambiguous || 83.8% Confident
Q9CS92 - (Q9CS92) 5730406M06Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 83.8% Confident
DNPE_MOUSE - (Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21) || Number of peptides = 8 || unambiguous || 83.8% Confident
Q9H6D7 - (Q9H6D7) Hypothetical protein FLJ22363 || Number of peptides = 5 || unambiguous || 83.5% Confident
Q9WU78 - (Q9WU78) ALG-2 interacting protein AIP1 || Number of peptides = 5 || ambiguous || 83.4% Confident
W70T_MOUSE - (Q9D2V7) 70 kDa WD-repeat tumor rejection antigen homolog || Number of peptides = 2 || unambiguous || 83.4% Confident
Q9DCY9 - (Q9DCY9) Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) || Number of peptides = 1 || unambiguous || 83.1% Confident
CA17_HUMAN - (Q02388) Collagen alpha 1(VII) chain precursor (Long-chain collagen) (LC collagen) || Number of peptides = 14 || unambiguous || 83.1% Confident
Q9CZK3 - (Q9CZK3) 2700069A07Rik protein || Number of peptides = 1 || ambiguous || 83.1% Confident
Q9JJN2 - (Q9JJN2) Zinc-finger homeodomain protein 4 || Number of peptides = 13 || unambiguous || 83.0% Confident
Q99JT9 - (Q99JT9) Similar to hypothetical protein FLJ10913 || Number of peptides = 1 || unambiguous || 83.0% Confident
P78324 - (P78324) Protein tyrosine phosphatase, NON-receptor type substrate 1 precursor (SHP substrate-1) (Inhibitory receptor SHPS-1) (SHPS-1) (Signal-regulatory protein ALPHA-1) (SIRP-ALPHA1) (MYD-1 antigen) || Number of peptides = 1 || ambiguous || 83.0% Confident
Q9D577 - (Q9D577) 4930505M11Rik protein || Number of peptides = 3 || unambiguous || 82.7% Confident
Q9D4W6 - (Q9D4W6) 4930571B16Rik protein || Number of peptides = 1 || unambiguous || 82.5% Confident
GSHR_MOUSE - (P47791) Glutathione reductase, mitochondrial precursor (EC 1.6.4.2) (GR) (GRase) || Number of peptides = 4 || unambiguous || 82.5% Confident
SG2_MOUSE - (Q03517) Secretogranin II precursor (SGII) (Chromogranin C) || Number of peptides = 10 || unambiguous || 82.4% Confident
DF5L_HUMAN - (P57764) DFN5-like protein FLJ12150 || Number of peptides = 1 || unambiguous || 82.4% Confident
G25B_HUMAN - (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) || Number of peptides = 2 || ambiguous || 82.4% Confident
MK14_MOUSE - (P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1) || Number of peptides = 1 || ambiguous || 82.4% Confident
Q9JLI2 - (Q9JLI2) Collagen type V alpha 3 chain || Number of peptides = 13 || unambiguous || 82.3% Confident
SYI_HUMAN - (P41252) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) (IRS) || Number of peptides = 6 || unambiguous || 82.3% Confident
Q9D140 - (Q9D140) 1110030O19Rik protein || Number of peptides = 2 || unambiguous || 82.2% Confident
Q9D9D6 - (Q9D9D6) 1700095D18Rik protein || Number of peptides = 1 || unambiguous || 82.1% Confident
Q9DBG7 - (Q9DBG7) 1300011P19Rik protein || Number of peptides = 3 || unambiguous || 82.0% Confident
Q8VGJ7 - (Q8VGJ7) Olfactory receptor MOR136-11 || Number of peptides = 1 || unambiguous || 81.9% Confident
Q8R2Q7 - (Q8R2Q7) Similar to hypothetical protein FLJ20318 || Number of peptides = 2 || unambiguous || 81.8% Confident
DD24_HUMAN - (Q9GZR7) ATP-dependent RNA helicase DDX24 (DEAD-box protein 24) || Number of peptides = 9 || unambiguous || 81.6% Confident
PHS1_MOUSE - (Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) || Number of peptides = 10 || unambiguous || 81.6% Confident
SCO2_HUMAN - (O43819) SCO2 protein homolog, mitochondrial precursor || Number of peptides = 5 || unambiguous || 81.5% Confident
O60321 - (O60321) Hypothetical protein KIAA0575 || Number of peptides = 1 || unambiguous || 81.4% Confident
O54988 - (O54988) Serine/threonine protein kinase || Number of peptides = 4 || ambiguous || 81.4% Confident
Q9D007 - (Q9D007) 2610209L14Rik protein || Number of peptides = 1 || ambiguous || 81.3% Confident
P97293 - (P97293) MAP kinase kinase 3B (Mitogen activated protein kinase kinase 3) || Number of peptides = 2 || unambiguous || 81.2% Confident
Q62293 - (Q62293) T cell-specific protein || Number of peptides = 3 || unambiguous || 81.2% Confident
Q91WL0 - (Q91WL0) Similar to hypothetical protein FLJ21522 (Epidermal growth factor receptor pathway substrate 8 related protein 3) || Number of peptides = 5 || unambiguous || 81.1% Confident
Q99KD0 - (Q99KD0) Hypothetical 24.4 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 81.1% Confident
COTE_HUMAN - (P81408) COTE1 protein || Number of peptides = 4 || unambiguous || 81.0% Confident
ACTZ_HUMAN - (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) || Number of peptides = 1 || ambiguous || 80.9% Confident
ENOG_MOUSE - (P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2) || Number of peptides = 2 || ambiguous || 80.8% Confident
Q9DAM2 - (Q9DAM2) 1700007I06Rik protein || Number of peptides = 4 || ambiguous || 80.8% Confident
GTO1_MOUSE - (O09131) Glutathione transferase omega 1 (EC 2.5.1.18) (GSTO 1-1) (p28) || Number of peptides = 2 || unambiguous || 80.5% Confident
Q9NVI1 - (Q9NVI1) Hypothetical protein FLJ10719 (Fragment) || Number of peptides = 4 || unambiguous || 80.4% Confident
Q9CVN8 - (Q9CVN8) 1700027M21Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 80.3% Confident
Q9DCL7 - (Q9DCL7) 0610025O11Rik protein || Number of peptides = 5 || ambiguous || 80.3% Confident
PPCC_MOUSE - (Q9Z2V4) Phosphoenolpyruvate carboxykinase, cytosolic [GTP] (EC 4.1.1.32) (Phosphoenolpyruvate carboxylase) (PEPCK-C) || Number of peptides = 9 || unambiguous || 80.2% Confident
PLIN_HUMAN - (O60240) Perilipin (PERI) (Lipid droplet-associated protein) || Number of peptides = 1 || unambiguous || 80.1% Confident
Q9ULM3 - (Q9ULM3) Hypothetical protein KIAA1197 (Fragment) || Number of peptides = 9 || unambiguous || 80.0% Confident
IMA4_MOUSE - (O35343) Importin alpha-4 subunit (Karyopherin alpha-4 subunit) (Importin alpha Q1) || Number of peptides = 7 || unambiguous || 80.0% Confident
Q9BT04 - (Q9BT04) Similar to hypothetical protein FLJ22688 (Hypothetical protein) || Number of peptides = 5 || unambiguous || 79.8% Confident
O70576 - (O70576) Stag3 protein || Number of peptides = 10 || unambiguous || 79.8% Confident
Q925C1 - (Q925C1) GIG18 || Number of peptides = 2 || ambiguous || 79.7% Confident
ATPB_MOUSE - (P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) || Number of peptides = 1 || ambiguous || 79.7% Confident
P11A_HUMAN - (P42336) Phosphatidylinositol 3-kinase catalytic subunit, alpha isoform (EC 2.7.1.137) (PI3-kinase p110 subunit alpha) (PtdIns-3-kinase p110) (PI3K) || Number of peptides = 3 || unambiguous || 79.5% Confident
Q9BVL0 - (Q9BVL0) Similar to hypothetical protein FLJ20643 || Number of peptides = 2 || ambiguous || 79.4% Confident
DHA5_HUMAN - (P30837) Aldehyde dehydrogenase X, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) || Number of peptides = 2 || unambiguous || 79.3% Confident
IRS1_HUMAN - (P35568) Insulin receptor substrate-1 (IRS-1) || Number of peptides = 3 || unambiguous || 79.3% Confident
QORL_HUMAN - (O95825) Quinone oxidoreductase-like 1 (QOH-1) (4P11) || Number of peptides = 4 || unambiguous || 79.3% Confident
Q8R3D4 - (Q8R3D4) Hypothetical 72.1 kDa protein || Number of peptides = 1 || unambiguous || 79.2% Confident
Q99MH6 - (Q99MH6) Nkd || Number of peptides = 2 || unambiguous || 79.2% Confident
Q921L7 - (Q921L7) Similar to HEMK homolog 7kb (Expressed sequence AW049265) || Number of peptides = 9 || unambiguous || 79.2% Confident
ABC9_HUMAN - (Q9NP78) ATP-binding cassette, sub-family B, member 9 precursor (ATP-binding cassette transporter 9) (ABC transporter 9 protein) (TAP-like protein) (TAPL) (hABCB9) || Number of peptides = 2 || unambiguous || 79.2% Confident
O88783 - (O88783) Murine coagulation factor V || Number of peptides = 7 || unambiguous || 79.2% Confident
UNG_MOUSE - (P97931) Uracil-DNA glycosylase, mitochondrial precursor (EC 3.2.2.-) (UDG) || Number of peptides = 1 || ambiguous || 79.1% Confident
Q9CR16 - (Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) || Number of peptides = 4 || unambiguous || 79.1% Confident
Q91YD6 - (Q91YD6) Villin-like protein (Fragment) || Number of peptides = 4 || ambiguous || 79.0% Confident
MEC2_MOUSE - (Q9Z2D6) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2) || Number of peptides = 4 || unambiguous || 79.0% Confident
EHD1_MOUSE - (Q9WVK4) EH-domain containing protein 1 (mPAST1) || Number of peptides = 5 || unambiguous || 78.9% Confident
GAL1_MOUSE - (Q9R0N0) Galactokinase (EC 2.7.1.6) (Galactose kinase) || Number of peptides = 3 || unambiguous || 78.9% Confident
Q61285 - (Q61285) ALDR protein (ATP-binding cassette, sub-family D (ALD), member 2) || Number of peptides = 3 || ambiguous || 78.9% Confident
Q61730 - (Q61730) Interleukin 1 receptor accessory protein precursor || Number of peptides = 1 || ambiguous || 78.8% Confident
Q8TCY7 - (Q8TCY7) BNIP-Sbeta || Number of peptides = 1 || ambiguous || 78.6% Confident
O15074 - (O15074) Hypothetical protein KIAA0368 (Fragment) || Number of peptides = 4 || unambiguous || 78.5% Confident
Q99KZ5 - (Q99KZ5) Similar to hypothetical protein FLJ22087 || Number of peptides = 2 || unambiguous || 78.4% Confident
Q8VD73 - (Q8VD73) Similar to potassium voltage gated channel, shaker related subfamily, beta member 3 || Number of peptides = 5 || unambiguous || 78.4% Confident
P70336 - (P70336) Rho-associated, coiled-coil forming protein kinase p160 ROCK-2 || Number of peptides = 5 || unambiguous || 78.4% Confident
Q8WWL2 - (Q8WWL2) Spir-2 protein (Fragment) || Number of peptides = 8 || unambiguous || 78.3% Confident
Q96JB1 - (Q96JB1) Axonemal dynein heavy chain 8 || Number of peptides = 15 || unambiguous || 78.3% Confident
Q9H841 - (Q9H841) Hypothetical protein FLJ13955 || Number of peptides = 1 || unambiguous || 78.3% Confident
A1AT_HUMAN - (P01009) Alpha-1-antitrypsin precursor (Alpha-1 protease inhibitor) (Alpha-1-antiproteinase) (PRO0684/PRO2209) || Number of peptides = 2 || ambiguous || 78.2% Confident
Q9DBV3 - (Q9DBV3) 1200013B07Rik protein || Number of peptides = 5 || ambiguous || 78.2% Confident
Q9DA72 - (Q9DA72) 1700019B03Rik protein || Number of peptides = 2 || unambiguous || 78.2% Confident
Q9QXZ2 - (Q9QXZ2) TAGL-alpha || Number of peptides = 2 || unambiguous || 78.2% Confident
ASSY_MOUSE - (P16460) Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) || Number of peptides = 1 || ambiguous || 78.2% Confident
Q99LR1 - (Q99LR1) Hypothetical 20.9 kDa protein || Number of peptides = 4 || unambiguous || 78.1% Confident
5H2B_HUMAN - (P41595) 5-hydroxytryptamine 2B receptor (5-HT-2B) (Serotonin receptor) || Number of peptides = 2 || unambiguous || 78.1% Confident
Q9D0Q5 - (Q9D0Q5) 2600006K01Rik protein || Number of peptides = 1 || unambiguous || 78.0% Confident
Q9JJU6 - (Q9JJU6) B-Raf protein (Fragment) || Number of peptides = 4 || ambiguous || 78.0% Confident
TNF9_MOUSE - (P41274) Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL) || Number of peptides = 1 || unambiguous || 78.0% Confident
Q9BTR0 - (Q9BTR0) Hypothetical protein || Number of peptides = 8 || unambiguous || 78.0% Confident
Q62258 - (Q62258) Spi2 proteinase inhibitor || Number of peptides = 3 || ambiguous || 77.9% Confident
MYBB_MOUSE - (P48972) Myb-related protein B (B-Myb) || Number of peptides = 1 || unambiguous || 77.7% Confident
FLIH_HUMAN - (Q13045) Flightless-I protein homolog || Number of peptides = 3 || unambiguous || 77.5% Confident
MAON_HUMAN - (Q16798) NADP-dependent malic enzyme, mitochondrial precursor (EC 1.1.1.40) (NADP-ME) (Malic enzyme 3) || Number of peptides = 2 || unambiguous || 77.4% Confident
EXL1_MOUSE - (Q9JKV7) Exostosin-like 1 (EC 2.4.1.-) (Exostosin-L) (Multiple exostosis-like protein) || Number of peptides = 3 || unambiguous || 77.2% Confident
SMOO_HUMAN - (P53814) Smoothelin || Number of peptides = 4 || unambiguous || 77.2% Confident
Q8TAJ6 - (Q8TAJ6) Similar to KIAA1076 protein (Fragment) || Number of peptides = 3 || ambiguous || 77.1% Confident
Q924V8 - (Q924V8) Carboxylesterase MH1 (EC 3.1.1.1) || Number of peptides = 3 || ambiguous || 77.1% Confident
P2AA_MOUSE - (P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) || Number of peptides = 4 || ambiguous || 77.1% Confident
Q9HBF9 - (Q9HBF9) Gag-pro-pol protein (Fragment) || Number of peptides = 7 || unambiguous || 76.7% Confident
Q96C81 - (Q96C81) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 76.7% Confident
ASSY_HUMAN - (P00966) Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) || Number of peptides = 2 || unambiguous || 76.7% Confident
Q9Z113 - (Q9Z113) Insulinoma-associated protein || Number of peptides = 3 || unambiguous || 76.7% Confident
TENX_HUMAN - (P22105) Tenascin-X precursor (TN-X) (Hexabrachion-like) || Number of peptides = 8 || unambiguous || 76.7% Confident
ABCR_HUMAN - (P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein) || Number of peptides = 6 || unambiguous || 76.4% Confident
SCAB_MOUSE - (Q9WU38) Amiloride-sensitive sodium channel beta-subunit (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) || Number of peptides = 1 || unambiguous || 76.4% Confident
Q96JH2 - (Q96JH2) Hypothetical protein KIAA1855 (Fragment) || Number of peptides = 8 || unambiguous || 76.4% Confident
PGK2_MOUSE - (P09041) Phosphoglycerate kinase, testis specific (EC 2.7.2.3) || Number of peptides = 1 || ambiguous || 76.4% Confident
Q99K70 - (Q99K70) Similar to Rag C protein || Number of peptides = 2 || ambiguous || 76.4% Confident
Q8VI94 - (Q8VI94) 2',5'-oligoadenylate synthetase-like 9 || Number of peptides = 5 || unambiguous || 76.3% Confident
Q96IC4 - (Q96IC4) Similar to RIKEN cDNA 9430029K10 gene (Fragment) || Number of peptides = 1 || ambiguous || 76.2% Confident
143S_MOUSE - (O70456) 14-3-3 protein sigma (Stratifin) || Number of peptides = 3 || ambiguous || 76.1% Confident
CD48_MOUSE - (P18181) MRC OX-45 surface antigen precursor (BCM1 surface antigen) (BLAST-1) (CD48) (HM48-1) || Number of peptides = 2 || unambiguous || 76.1% Confident
Q9DB38 - (Q9DB38) 1500015O20Rik protein || Number of peptides = 3 || unambiguous || 76.1% Confident
GTA4_HUMAN - (O15217) Glutathione S-transferase A4-4 (EC 2.5.1.18) (GST class-alpha) || Number of peptides = 1 || unambiguous || 76.0% Confident
Q91W50 - (Q91W50) Hypothetical 88.8 kDa protein || Number of peptides = 8 || unambiguous || 76.0% Confident
O94932 - (O94932) Hypothetical protein KIAA0847 (Fragment) || Number of peptides = 5 || unambiguous || 75.9% Confident
CTRO_MOUSE - (P49025) Citron protein (Rho-interacting, serine/threonine kinase 21) || Number of peptides = 5 || ambiguous || 75.8% Confident
PESC_MOUSE - (Q9EQ61) Pescadillo homolog 1 || Number of peptides = 2 || unambiguous || 75.7% Confident
Q91X47 - (Q91X47) Unknown (Protein for MGC:18784) || Number of peptides = 2 || unambiguous || 75.7% Confident
SACS_HUMAN - (Q9NZJ4) Sacsin || Number of peptides = 4 || unambiguous || 75.6% Confident
FP48_HUMAN - (Q92990) FKBP-associated protein 48 kDa (FK506-binding protein-associated protein 48 kDa) || Number of peptides = 1 || ambiguous || 75.4% Confident
ENP5_MOUSE - (Q9WUZ9) Ectonucleoside triphosphate diphosphohydrolase 5 precursor (EC 3.6.1.6) (NTPDase5) (Nucleoside diphosphatase) (CD39 antigen-like 4) (ER-UDPase) || Number of peptides = 2 || ambiguous || 75.3% Confident
Q9P2G7 - (Q9P2G7) Hypothetical protein KIAA1380 (Fragment) || Number of peptides = 6 || unambiguous || 75.2% Confident
CD5R_MOUSE - (Q62938) Cyclin-dependent kinase 5 activator 1 precursor (CDK5 activator 1) (Cyclin-dependent kinase 5 regulatory subunit 1) (Tau protein kinase II 23 kDa subunit) (TPKII regulatory subunit) (P23) (P25) (P35) || Number of peptides = 2 || unambiguous || 75.2% Confident
Q9D2E8 - (Q9D2E8) Adult male testis cDNA, RIKEN full-length enriched library, clone:4930578M22, full insert sequence || Number of peptides = 1 || unambiguous || 75.2% Confident
Q9H0P0 - (Q9H0P0) Hypothetical protein || Number of peptides = 2 || unambiguous || 75.1% Confident
GLI1_MOUSE - (P47806) Zinc finger protein GLI1 (Glioma-associated oncogene homolog) || Number of peptides = 3 || unambiguous || 75.0% Confident
Q9BYZ4 - (Q9BYZ4) PRTD-NY2 || Number of peptides = 9 || unambiguous || 74.9% Confident
O60622 - (O60622) Protocadherin 43 || Number of peptides = 7 || ambiguous || 74.9% Confident
Q9D6M0 - (Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene) || Number of peptides = 6 || unambiguous || 74.9% Confident
Q9BRU0 - (Q9BRU0) Similar to RIKEN cDNA 4931428F02 gene || Number of peptides = 1 || unambiguous || 74.8% Confident
Q922M3 - (Q922M3) Similar to tumor necrosis factor, alpha-induced protein 1 (Endothelial) || Number of peptides = 4 || unambiguous || 74.7% Confident
UBL3_MOUSE - (Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3) || Number of peptides = 2 || unambiguous || 74.7% Confident
Q15170 - (Q15170) Transcription factor S-II-related protein (PP21) || Number of peptides = 4 || unambiguous || 74.7% Confident
DPOL_HUMAN - (Q9UGP5) DNA polymerase lambda (EC 2.7.7.7) (Pol Lambda) (DNA polymerase kappa) (DNA polymerase beta-2) (Pol beta2) || Number of peptides = 4 || unambiguous || 74.6% Confident
Q99L48 - (Q99L48) Similar to CGI-07 protein || Number of peptides = 4 || unambiguous || 74.6% Confident
O14686 - (O14686) ALR || Number of peptides = 19 || ambiguous || 74.6% Confident
Q96Q36 - (Q96Q36) ALS2CR11 protein (Fragment) || Number of peptides = 3 || unambiguous || 74.6% Confident
EGR4_HUMAN - (Q05215) Early growth response protein 4 (EGR-4) (AT133) || Number of peptides = 3 || unambiguous || 74.5% Confident
MDR1_HUMAN - (P08183) Multidrug resistance protein 1 (P-glycoprotein 1) (CD243 antigen) || Number of peptides = 6 || unambiguous || 74.5% Confident
Q9NVP5 - (Q9NVP5) Hypothetical protein FLJ10599 (Fragment) || Number of peptides = 4 || unambiguous || 74.5% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 2 || ambiguous || 74.5% Confident
Q9Z2I5 - (Q9Z2I5) Hypoxia inducible factor three alpha || Number of peptides = 3 || unambiguous || 74.5% Confident
O70491 - (O70491) Retinoic acid-responsive protein || Number of peptides = 4 || unambiguous || 74.4% Confident
Q9DAE4 - (Q9DAE4) 1700012F10Rik protein || Number of peptides = 4 || ambiguous || 74.4% Confident
Q61627 - (Q61627) Glutamate receptor delta-1 subunit precursor || Number of peptides = 5 || unambiguous || 74.2% Confident
Q96FR0 - (Q96FR0) Hypothetical protein || Number of peptides = 1 || unambiguous || 74.1% Confident
PGCA_MOUSE - (Q61282) Aggrecan core protein precursor (Cartilage-specific proteoglycan core protein) (CSPCP) || Number of peptides = 5 || unambiguous || 74.1% Confident
AHNK_HUMAN - (Q09666) Neuroblast differentiation associated protein AHNAK (Desmoyokin) (Fragments) || Number of peptides = 8 || unambiguous || 74.0% Confident
O54909 - (O54909) Cis-retinol androgen dehydrogenase 1 || Number of peptides = 2 || unambiguous || 74.0% Confident
Q02646 - (Q02646) MBP-2 (MHC binding protein-2) || Number of peptides = 3 || unambiguous || 74.0% Confident
Q9NTJ7 - (Q9NTJ7) Hypothetical protein || Number of peptides = 1 || unambiguous || 74.0% Confident
GBP1_HUMAN - (P32455) Interferon-induced guanylate-binding protein 1 (Guanine nucleotide-binding protein 1) || Number of peptides = 2 || unambiguous || 74.0% Confident
CA39_HUMAN - (Q14050) Collagen alpha 3(IX) chain precursor || Number of peptides = 5 || unambiguous || 74.0% Confident
HXD9_HUMAN - (P28356) Homeobox protein Hox-D9 (Hox-4C) (Hox-5.2) || Number of peptides = 5 || unambiguous || 74.0% Confident
Q8VCR5 - (Q8VCR5) Similar to hypothetical protein FLJ11036 || Number of peptides = 1 || unambiguous || 73.7% Confident
Q96M54 - (Q96M54) Hypothetical protein FLJ32818 || Number of peptides = 2 || unambiguous || 73.7% Confident
CA11_HUMAN - (P02452) Collagen alpha 1(I) chain precursor || Number of peptides = 7 || unambiguous || 73.7% Confident
O35053 - (O35053) Collagen a1 XIX chain || Number of peptides = 4 || unambiguous || 73.7% Confident
CAD2_MOUSE - (P15116) Neural-cadherin precursor (N-cadherin) (Cadherin-2) || Number of peptides = 8 || unambiguous || 73.7% Confident
Q8VGP3 - (Q8VGP3) Olfactory receptor MOR227-1 || Number of peptides = 11 || unambiguous || 73.7% Confident
Q9QY43 - (Q9QY43) GABA receptor epsilon subunit || Number of peptides = 5 || ambiguous || 73.7% Confident
CA1B_MOUSE - (Q61245) Collagen alpha 1(XI) chain precursor || Number of peptides = 9 || unambiguous || 73.7% Confident
Q9CWP2 - (Q9CWP2) Expressed sequence tag mouse EST 55 || Number of peptides = 1 || ambiguous || 73.7% Confident
DTNB_HUMAN - (O60941) Dystrobrevin beta (Beta-dystrobrevin) (DTN-B) || Number of peptides = 3 || unambiguous || 73.6% Confident
O43245 - (O43245) Protein || Number of peptides = 3 || unambiguous || 73.4% Confident
PEX6_HUMAN - (Q13608) Peroxisome assembly factor-2 (PAF-2) (Peroxisomal-type ATPase 1) (Peroxin-6) || Number of peptides = 3 || ambiguous || 73.3% Confident
Q9QXA3 - (Q9QXA3) Mouse fat 1 cadherin (Fragment) || Number of peptides = 11 || unambiguous || 73.2% Confident
Q9HAV4 - (Q9HAV4) Exportin 5 || Number of peptides = 6 || unambiguous || 73.2% Confident
Q9NSE4 - (Q9NSE4) Mitochondrial isoleucine tRNA synthetase (Fragment) || Number of peptides = 3 || unambiguous || 73.1% Confident
KPCB_MOUSE - (P04410) Protein kinase C, beta type (EC 2.7.1.-) (PKC-beta) (PKC-B) || Number of peptides = 5 || ambiguous || 73.1% Confident
Q9DCZ0 - (Q9DCZ0) 0610008F14Rik protein || Number of peptides = 3 || unambiguous || 73.0% Confident
KLKD_MOUSE - (P36368) Glandular kallikrein K13 precursor (EC 3.4.21.35) (Tissue kallikrein) (MGK-13) (Epidermal growth factor-binding protein type B) (EGF-BP B) (Prorenin-converting enzyme) (PRECE) || Number of peptides = 3 || unambiguous || 73.0% Confident
Q8WYP5 - (Q8WYP5) Transcription factor ELYS || Number of peptides = 8 || unambiguous || 73.0% Confident
PGDR_HUMAN - (P09619) Beta platelet-derived growth factor receptor precursor (EC 2.7.1.112) (PDGF-R-beta) (CD140b antigen) || Number of peptides = 4 || unambiguous || 73.0% Confident
YYY2_HUMAN - (O00597) Very very hypothetical protein CYCL || Number of peptides = 1 || unambiguous || 72.9% Confident
Q9C095 - (Q9C095) Hypothetical protein KIAA1768 (Fragment) || Number of peptides = 2 || unambiguous || 72.8% Confident
Q9ULG1 - (Q9ULG1) Hypothetical protein KIAA1259 (Fragment) || Number of peptides = 3 || unambiguous || 72.7% Confident
MAP4_MOUSE - (P27546) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 7 || unambiguous || 72.7% Confident
Q9D714 - (Q9D714) 2310042E16Rik protein || Number of peptides = 1 || unambiguous || 72.7% Confident
Q9QYY0 - (Q9QYY0) GRB2-associated binding protein 1 || Number of peptides = 5 || unambiguous || 72.5% Confident
HEPS_HUMAN - (P05981) Serine protease hepsin (EC 3.4.21.-) (Transmembrane protease, serine 1) || Number of peptides = 2 || unambiguous || 72.4% Confident
O08995 - (O08995) Myelin transcription factor 1 || Number of peptides = 7 || unambiguous || 72.0% Confident
Q9JMJ9 - (Q9JMJ9) Vomeroglandin precursor || Number of peptides = 6 || ambiguous || 72.0% Confident
Q8TF55 - (Q8TF55) Hypothetical protein KIAA1946 (Fragment) || Number of peptides = 4 || unambiguous || 71.9% Confident
Q92946 - (Q92946) FUSE binding protein 3 (Fragment) || Number of peptides = 3 || unambiguous || 71.5% Confident
S109_MOUSE - (P31725) Calgranulin B (Migration inhibitory factor-related protein 14) (MRP-14) (P14) (Leukocyte L1 complex heavy chain) || Number of peptides = 1 || unambiguous || 71.4% Confident
Q99PG9 - (Q99PG9) Zinc finger 202 m1 || Number of peptides = 1 || unambiguous || 71.3% Confident
Q921M5 - (Q921M5) Unknown (Protein for IMAGE:3597757) (Fragment) || Number of peptides = 5 || unambiguous || 71.3% Confident
CBF_HUMAN - (Q03701) CCAAT-box-binding transcription factor (CCAAT-binding factor) (CBF) || Number of peptides = 4 || unambiguous || 71.2% Confident
Q13577 - (Q13577) 51C protein || Number of peptides = 6 || unambiguous || 71.2% Confident
Q96IS3 - (Q96IS3) Similar to retina and anterior neural fold homeobox (Hypothetical protein) || Number of peptides = 2 || unambiguous || 71.2% Confident
Q8R374 - (Q8R374) Hypothetical 29.4 kDa protein (Fragment) || Number of peptides = 2 || unambiguous || 71.1% Confident
Q9Y361 - (Q9Y361) CGI-46 protein || Number of peptides = 1 || ambiguous || 70.9% Confident
Q9CUR8 - (Q9CUR8) 4833427E09Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 70.8% Confident
Q8TE71 - (Q8TE71) EEG1L || Number of peptides = 1 || ambiguous || 70.8% Confident
KDGG_MOUSE - (Q91WG7) Diacylglycerol kinase, gamma (EC 2.7.1.107) (Diglyceride kinase) (DGK-gamma) (DAG kinase gamma) (88 kDa diacylglycerol kinase) || Number of peptides = 2 || unambiguous || 70.8% Confident
Q921Q5 - (Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1 || Number of peptides = 3 || unambiguous || 70.7% Confident
O95135 - (O95135) Ataxin-2-like protein A2LP || Number of peptides = 4 || unambiguous || 70.7% Confident
Q9H2Y7 - (Q9H2Y7) Zinc finger protein 106 (ZFP106) || Number of peptides = 4 || unambiguous || 70.3% Confident
Q9QWY8 - (Q9QWY8) ADP-ribosylation factor-directed GTPase activating protein isoform a || Number of peptides = 3 || ambiguous || 70.2% Confident
Q9UFA4 - (Q9UFA4) Hypothetical protein (Fragment) || Number of peptides = 8 || unambiguous || 70.2% Confident
Q99PC9 - (Q99PC9) Protein phosphatase 2 regulatory subunit B56 delta isoform || Number of peptides = 2 || ambiguous || 70.2% Confident
Q9H091 - (Q9H091) Hypothetical protein || Number of peptides = 1 || unambiguous || 70.2% Confident
RPOM_HUMAN - (O00411) DNA-directed RNA polymerase, mitochondrial precursor (EC 2.7.7.6) (MTRPOL) || Number of peptides = 9 || unambiguous || 70.1% Confident
Q9D2M4 - (Q9D2M4) 4632412I06Rik protein || Number of peptides = 1 || unambiguous || 70.1% Confident
Q9CYN6 - (Q9CYN6) 5730405E07Rik protein || Number of peptides = 2 || unambiguous || 70.0% Confident
Q8R4P9 - (Q8R4P9) Multidrug resistance-associated protein 7B || Number of peptides = 6 || unambiguous || 69.9% Confident
Q9DC14 - (Q9DC14) 1200007H22Rik protein || Number of peptides = 4 || ambiguous || 69.8% Confident
O54865 - (O54865) Soluble guanylate cyclase beta-1 subunit || Number of peptides = 5 || ambiguous || 69.8% Confident
Q99KC8 - (Q99KC8) Similar to loss of heterozygosity, 11, chromosomal region 2, gene A || Number of peptides = 4 || unambiguous || 69.8% Confident
Q62412 - (Q62412) Nebulin (Fragment) || Number of peptides = 4 || unambiguous || 69.8% Confident
Q9NVH0 - (Q9NVH0) Hypothetical protein FLJ10738 || Number of peptides = 4 || unambiguous || 69.7% Confident
Q96PK2 - (Q96PK2) Macrophin 1 isoform 4 || Number of peptides = 3 || unambiguous || 69.7% Confident
O94928 - (O94928) Hypothetical protein KIAA0842 (Fragment) || Number of peptides = 2 || unambiguous || 69.6% Confident
Q9CQ26 - (Q9CQ26) 5330424L14Rik protein (5730422L11Rik protein) (RIKEN cDNA 5730422L11 gene) (AMSH) (Associated molecule with the SH3 domain of STAM) || Number of peptides = 1 || unambiguous || 69.6% Confident
Q9D4D4 - (Q9D4D4) 4933401I19Rik protein || Number of peptides = 3 || unambiguous || 69.6% Confident
A1B1_MOUSE - (O35643) Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta large chain) || Number of peptides = 6 || unambiguous || 69.4% Confident
Q9C0A3 - (Q9C0A3) Hypothetical protein KIAA1760 (Fragment) || Number of peptides = 3 || unambiguous || 69.4% Confident
O00301 - (O00301) KSRP || Number of peptides = 2 || unambiguous || 69.2% Confident
SYW_MOUSE - (P32921) Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tryptophan--tRNA ligase) (TrpRS) || Number of peptides = 2 || unambiguous || 69.2% Confident
Q9H695 - (Q9H695) Hypothetical protein FLJ22474 || Number of peptides = 2 || unambiguous || 69.1% Confident
Q9CZ95 - (Q9CZ95) 2810035F15Rik protein || Number of peptides = 2 || unambiguous || 69.1% Confident
COQ6_HUMAN - (Q9Y2Z9) Putative ubiquinone biosynthesis monooxgenase COQ6 (EC 1.14.13.-) (CGI-10) || Number of peptides = 2 || ambiguous || 69.1% Confident
CGG2_HUMAN - (Q16589) Cyclin G2 || Number of peptides = 1 || unambiguous || 69.1% Confident
Q9CR25 - (Q9CR25) 9130020C19Rik protein || Number of peptides = 4 || unambiguous || 68.9% Confident
CNK_HUMAN - (Q9H4B4) Cytokine-inducible serine/threonine-protein kinase (EC 2.7.1.37) (FGF-inducible kinase) (Proliferation-related kinase) || Number of peptides = 4 || ambiguous || 68.8% Confident
Q96PI7 - (Q96PI7) Apoptosis-inhibitor-like protein || Number of peptides = 2 || unambiguous || 68.8% Confident
ZEP1_HUMAN - (P15822) Zinc finger protein 40 (Human immunodeficiency virus type I enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex binding protein 1) (MBP-1) (Positive regulatory domain II binding factor 1) (PRDII-BF1) || Number of peptides = 10 || unambiguous || 68.8% Confident
KINH_MOUSE - (Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) || Number of peptides = 5 || unambiguous || 68.7% Confident
Q9Y2S5 - (Q9Y2S5) HSPC015 || Number of peptides = 1 || ambiguous || 68.7% Confident
HO1_MOUSE - (P14901) Heme oxygenase 1 (EC 1.14.99.3) (HO-1) (P32 protein) || Number of peptides = 3 || unambiguous || 68.6% Confident
O14795 - (O14795) Munc13 || Number of peptides = 3 || unambiguous || 68.5% Confident
ITH1_MOUSE - (Q61702) Inter-alpha-trypsin inhibitor heavy chain H1 precursor (ITI heavy chain H1) || Number of peptides = 6 || unambiguous || 68.5% Confident
Q91VJ3 - (Q91VJ3) Similar to Adenosin kinase || Number of peptides = 4 || unambiguous || 68.3% Confident
NBL4_HUMAN - (Q9HCS5) Band 4.1-like protein 4 (NBL4 protein) || Number of peptides = 1 || unambiguous || 68.3% Confident
G6PI_HUMAN - (P06744) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) (Sperm antigen-36) (SA-36) || Number of peptides = 2 || unambiguous || 68.2% Confident
TAL1_MOUSE - (Q93092) Transaldolase (EC 2.2.1.2) || Number of peptides = 4 || unambiguous || 68.2% Confident
Q9BQT9 - (Q9BQT9) Calsyntenin-3 protein precursor || Number of peptides = 3 || ambiguous || 68.2% Confident
PER3_MOUSE - (O70361) Period circadian protein 3 (mPER3) || Number of peptides = 3 || unambiguous || 68.1% Confident
MAOX_MOUSE - (P06801) NADP-dependent malic enzyme (EC 1.1.1.40) (NADP-ME) (Malic enzyme 1) || Number of peptides = 10 || unambiguous || 68.1% Confident
Q9R1D2 - (Q9R1D2) Cyclin-dependent kinase 6 || Number of peptides = 1 || ambiguous || 68.1% Confident
Q96M04 - (Q96M04) Hypothetical protein FLJ32933 || Number of peptides = 2 || unambiguous || 68.0% Confident
Q9CZA7 - (Q9CZA7) 2810026P18Rik protein || Number of peptides = 2 || unambiguous || 68.0% Confident
O88286 - (O88286) WizL || Number of peptides = 12 || unambiguous || 68.0% Confident
CA21_HUMAN - (P08123) Collagen alpha 2(I) chain precursor || Number of peptides = 13 || ambiguous || 67.9% Confident
Q9H2T8 - (Q9H2T8) Ribeye || Number of peptides = 1 || unambiguous || 67.9% Confident
Q9UH48 - (Q9UH48) Gastric cancer-related protein GCYS-20 || Number of peptides = 7 || unambiguous || 67.8% Confident
KPT3_MOUSE - (Q04899) Serine/threonine-protein kinase PCTAIRE-3 (EC 2.7.1.-) || Number of peptides = 2 || unambiguous || 67.8% Confident
NDF6_MOUSE - (P48986) Neurogenic differentiation factor 6 (NeuroD6) (Atonal protein homolog 2) (Helix-loop-helix protein mATH-2) (MATH2) (NEX-1 protein) || Number of peptides = 1 || ambiguous || 67.8% Confident
Q8R0A4 - (Q8R0A4) Similar to zinc finger protein 295 || Number of peptides = 4 || unambiguous || 67.8% Confident
MKKS_MOUSE - (Q9JI70) McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin || Number of peptides = 3 || ambiguous || 67.7% Confident
ACC8_HUMAN - (Q09428) Sulfonylurea receptor 1 || Number of peptides = 7 || unambiguous || 67.7% Confident
MYH2_HUMAN - (Q9UKX2) Myosin heavy chain, skeletal muscle, adult 2 (Myosin heavy chain IIa) (MyHC-IIa) || Number of peptides = 7 || ambiguous || 67.7% Confident
NUGL_HUMAN - (Q9Y2C4) Endonuclease G like 1 (EC 3.1.30.-) (Endo G like) || Number of peptides = 4 || unambiguous || 67.6% Confident
Q99LI0 - (Q99LI0) Similar to thyroid hormone receptor interactor 10 || Number of peptides = 3 || ambiguous || 67.5% Confident
O75433 - (O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog) || Number of peptides = 2 || unambiguous || 67.5% Confident
Q96SH7 - (Q96SH7) BA204P2.1.3 (Interleukin 20 receptor alpha, isoform 3) || Number of peptides = 1 || unambiguous || 67.4% Confident
Q96CK4 - (Q96CK4) Hypothetical protein || Number of peptides = 4 || unambiguous || 67.4% Confident
Q9D5J4 - (Q9D5J4) 4930432J16Rik protein || Number of peptides = 6 || unambiguous || 67.4% Confident
ABF1_HUMAN - (Q15911) Alpha-fetoprotein enhancer binding protein (AT motif-binding factor) (AT-binding transcription factor 1) || Number of peptides = 5 || unambiguous || 67.4% Confident
MY5C_HUMAN - (Q9NQX4) Myosin Vc (Myosin 5C) || Number of peptides = 7 || unambiguous || 67.4% Confident
Q8WXA6 - (Q8WXA6) AF15q14 isoform 2 || Number of peptides = 2 || unambiguous || 67.4% Confident
Q9JHW9 - (Q9JHW9) Retinaldehyde dehydrogenase 3 (EC 1.2.1.3) || Number of peptides = 1 || unambiguous || 67.4% Confident
Q91Z16 - (Q91Z16) Hypothetical 86.8 kDa protein (Fragment) || Number of peptides = 6 || unambiguous || 67.4% Confident
Q922Y3 - (Q922Y3) Unknown (Protein for IMAGE:3498575) (Fragment) || Number of peptides = 1 || ambiguous || 67.4% Confident
CTE1_MOUSE - (O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) || Number of peptides = 5 || ambiguous || 67.4% Confident
Q9HAR2 - (Q9HAR2) Lectomedin-3 || Number of peptides = 6 || unambiguous || 67.3% Confident
ARP2_HUMAN - (O15142) Actin-like protein 2 (Actin-related protein 2) || Number of peptides = 4 || unambiguous || 67.3% Confident
Q9WTP5 - (Q9WTP5) PB-cadherin || Number of peptides = 3 || unambiguous || 67.3% Confident
TR5H_HUMAN - (P17752) Tryptophan 5-monooxygenase (EC 1.14.16.4) (Tryptophan 5-hydroxylase) || Number of peptides = 2 || unambiguous || 67.2% Confident
G3BP_MOUSE - (P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) || Number of peptides = 3 || unambiguous || 67.2% Confident
Q969H1 - (Q969H1) Hypothetical protein FLJ30820 (Hypothetical protein FLJ30672) || Number of peptides = 1 || unambiguous || 67.1% Confident
SCF_HUMAN - (P21583) Kit ligand precursor (C-kit ligand) (Stem cell factor) (SCF) (Mast cell growth factor) (MGF) || Number of peptides = 3 || ambiguous || 67.0% Confident
Q96GE2 - (Q96GE2) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 67.0% Confident
SYN1_HUMAN - (P17600) Synapsin I (Brain protein 4.1) || Number of peptides = 1 || unambiguous || 67.0% Confident
TRHY_HUMAN - (Q07283) Trichohyalin || Number of peptides = 2 || unambiguous || 67.0% Confident
PER1_MOUSE - (O35973) Period circadian protein 1 (Circadian pacemaker protein Rigui) (mPER) (M-Rigui) || Number of peptides = 7 || unambiguous || 66.9% Confident
Q9H8C5 - (Q9H8C5) Hypothetical protein FLJ13765 || Number of peptides = 3 || unambiguous || 66.9% Confident
Q8R1G6 - (Q8R1G6) Hypothetical 37.7 kDa protein || Number of peptides = 2 || unambiguous || 66.8% Confident
Q8WV16 - (Q8WV16) Hypothetical protein || Number of peptides = 1 || unambiguous || 66.7% Confident
Q9NUW9 - (Q9NUW9) Hypothetical protein FLJ11088 || Number of peptides = 2 || unambiguous || 66.6% Confident
Q8VFD6 - (Q8VFD6) Olfactory receptor MOR275-2 || Number of peptides = 6 || unambiguous || 66.5% Confident
B3A2_MOUSE - (P13808) Anion exchange protein 2 (Non-erythroid band 3-like protein) (B3RP) || Number of peptides = 6 || unambiguous || 66.4% Confident
M2B2_HUMAN - (Q9Y2E5) Epididymis-specific alpha-mannosidase precursor (EC 3.2.1.24) (Mannosidase alpha class 2B member 2) || Number of peptides = 2 || unambiguous || 66.4% Confident
Q9H5R3 - (Q9H5R3) Hypothetical protein FLJ23147 || Number of peptides = 4 || unambiguous || 66.4% Confident
Q8VE84 - (Q8VE84) Hypothetical 55.0 kDa protein (Fragment) || Number of peptides = 5 || unambiguous || 66.4% Confident
Q8WXX0 - (Q8WXX0) Ciliary dynein heavy chain 7 || Number of peptides = 22 || unambiguous || 66.3% Confident
PDL1_MOUSE - (O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) || Number of peptides = 3 || unambiguous || 66.3% Confident
Q9DBK8 - (Q9DBK8) Repeat family 3 gene || Number of peptides = 8 || ambiguous || 66.3% Confident
Q91X55 - (Q91X55) Similar to salivary protein 2 || Number of peptides = 1 || unambiguous || 66.2% Confident
NB2M_HUMAN - (O43676) NADH-ubiquinone oxidoreductase B12 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B12) (CI-B12) || Number of peptides = 1 || unambiguous || 66.1% Confident
O88349 - (O88349) Latent TGF beta binding protein || Number of peptides = 13 || unambiguous || 66.0% Confident
Q9HBL2 - (Q9HBL2) HT018 || Number of peptides = 2 || unambiguous || 66.0% Confident
AD07_HUMAN - (Q9H2U9) ADAM 7 precursor (A disintegrin and metalloproteinase domain 7) (Sperm maturation-related glycoprotein GP-83) || Number of peptides = 3 || unambiguous || 66.0% Confident
O75932 - (O75932) SYT interacting protein SIP || Number of peptides = 3 || unambiguous || 66.0% Confident
Q9UPV1 - (Q9UPV1) Hypothetical protein KIAA1051 (MEF3 like 1) (Paternally expressed gene 10 ORF1) (Fragment) || Number of peptides = 5 || unambiguous || 66.0% Confident
Q91XW2 - (Q91XW2) Putative ubiquitin-specific protease || Number of peptides = 7 || unambiguous || 65.9% Confident
Q9NVH9 - (Q9NVH9) Hypothetical protein FLJ10724 || Number of peptides = 8 || unambiguous || 65.9% Confident
O00370 - (O00370) Putative p150 || Number of peptides = 4 || unambiguous || 65.9% Confident
Q9UI92 - (Q9UI92) Putative WHSC1 protein || Number of peptides = 4 || ambiguous || 65.9% Confident
Q9ERN6 - (Q9ERN6) Cardiac Ca2+ release channel || Number of peptides = 35 || unambiguous || 65.8% Confident
ZO2_MOUSE - (Q9Z0U1) Tight junction protein ZO-2 (Zonula occludens 2 protein) (Zona occludens 2 protein) (Tight junction protein 2) || Number of peptides = 3 || unambiguous || 65.8% Confident
O95347 - (O95347) Chromosome-associated protein-E || Number of peptides = 3 || unambiguous || 65.7% Confident
Q8VBV0 - (Q8VBV0) Protein tyrosine phosphatase, receptor type, delta A || Number of peptides = 4 || unambiguous || 65.7% Confident
Q60638 - (Q60638) Microtubule-associated protein 4 (Fragment) || Number of peptides = 5 || unambiguous || 65.6% Confident
FOH1_HUMAN - (Q04609) Glutamate carboxypeptidase II (EC 3.4.17.21) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Pteroylpoly-gamma-glutamate carboxypeptidase) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Folate hydrolase 1) (Prostate-specific membrane antigen) (PSMA) (PSM) || Number of peptides = 5 || ambiguous || 65.5% Confident
OTOR_MOUSE - (Q9JIE3) Otoraplin precursor (Melanoma inhibitory activity-like protein) || Number of peptides = 4 || unambiguous || 65.5% Confident
Q920N7 - (Q920N7) Synaptotagmin XII || Number of peptides = 2 || unambiguous || 65.5% Confident
Q63870 - (Q63870) Type VII collagen || Number of peptides = 16 || unambiguous || 65.5% Confident
P2BA_HUMAN - (Q08209) Serine/threonine protein phosphatase 2B catalytic subunit, alpha isoform (EC 3.1.3.16) (Calmodulin-dependent calcineurin A subunit, alpha isoform) (CAM-PRP catalytic subunit) || Number of peptides = 2 || unambiguous || 65.5% Confident
ARH6_HUMAN - (Q15052) Rho guanine nucleotide exchange factor 6 (PAK-interacting exchange factor alpha) (Alpha-Pix) (COOL-2) || Number of peptides = 8 || unambiguous || 65.5% Confident
Q9CVJ7 - (Q9CVJ7) 1810048F22Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 65.5% Confident
Q9BU79 - (Q9BU79) Hypothetical protein || Number of peptides = 2 || unambiguous || 65.5% Confident
Q9CZU4 - (Q9CZU4) 2610524P08Rik protein || Number of peptides = 5 || unambiguous || 65.5% Confident
Q9BY92 - (Q9BY92) Hypothetical protein KIAA1668 (Fragment) || Number of peptides = 4 || unambiguous || 65.4% Confident
Q99KR6 - (Q99KR6) Hypothetical 42.0 kDa protein (Phafin 1) || Number of peptides = 2 || unambiguous || 65.4% Confident
RPA5_MOUSE - (P52432) DNA-directed RNA polymerase I 40 kDa polypeptide (EC 2.7.7.6) (RPA40) || Number of peptides = 7 || ambiguous || 65.3% Confident
SHBG_MOUSE - (P97497) Sex hormone-binding globulin precursor (SHBG) (Sex steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) || Number of peptides = 11 || unambiguous || 65.3% Confident
ERR2_HUMAN - (O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor, beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2) || Number of peptides = 1 || unambiguous || 65.2% Confident
Q8R1C0 - (Q8R1C0) Similar to potassium voltage-gated channel, Shaw-related subfamily, member 4 || Number of peptides = 3 || unambiguous || 65.2% Confident
Q96C74 - (Q96C74) AKAP-associated sperm protein || Number of peptides = 2 || unambiguous || 65.2% Confident
P70264 - (P70264) Proton-dependent peptide transporter (Fragment) || Number of peptides = 1 || unambiguous || 65.1% Confident
THYG_MOUSE - (O08710) Thyroglobulin precursor || Number of peptides = 10 || unambiguous || 65.1% Confident
Q9CTH1 - (Q9CTH1) 1110008L16Rik protein (Fragment) || Number of peptides = 6 || unambiguous || 65.1% Confident
Q9BRC1 - (Q9BRC1) Hypothetical protein || Number of peptides = 1 || unambiguous || 65.1% Confident
EPA7_MOUSE - (Q61772) Ephrin type-A receptor 7 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor EHK-3) (EPH homology kinase-3) (Embryonic brain kinase) (EBK) (Developmental kinase 1) (MDK-1) || Number of peptides = 6 || unambiguous || 65.0% Confident
Q8VI41 - (Q8VI41) Zinc finger protein 352 || Number of peptides = 2 || unambiguous || 65.0% Confident
Y711_HUMAN - (O94819) Hypothetical protein KIAA0711 || Number of peptides = 5 || unambiguous || 65.0% Confident
O75067 - (O75067) Hypothetical protein KIAA0479 (Fragment) || Number of peptides = 1 || unambiguous || 65.0% Confident
Q9Z1U1 - (Q9Z1U1) Olfactory receptor G6 (Fragment) || Number of peptides = 2 || unambiguous || 65.0% Confident
Q9D2K1 - (Q9D2K1) 4921524P20Rik protein || Number of peptides = 5 || ambiguous || 65.0% Confident
NCB2_MOUSE - (P81117) Nucleobindin 2 precursor (DNA-binding protein NEFA) || Number of peptides = 2 || unambiguous || 64.9% Confident
TIE1_HUMAN - (P35590) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112) || Number of peptides = 1 || unambiguous || 64.9% Confident
Q9ES34 - (Q9ES34) Ubiquitin-protein ligase UBE3B (Fragment) || Number of peptides = 4 || unambiguous || 64.9% Confident
Q12789 - (Q12789) TFIIIC box B-binding subunit (Transcription factor (TFIIIC) alpha chain) (3' partial) || Number of peptides = 9 || unambiguous || 64.9% Confident
YL1_HUMAN - (Q15906) YL-1 protein || Number of peptides = 1 || unambiguous || 64.8% Confident
Q8TC00 - (Q8TC00) Similar to chromosome 17 open reading frame 1A || Number of peptides = 5 || ambiguous || 64.7% Confident
Q9BQ06 - (Q9BQ06) Fanconi anemia complementation group D2 protein, isoform 2 || Number of peptides = 5 || ambiguous || 64.6% Confident
Q9CZI4 - (Q9CZI4) 2700087H15Rik protein || Number of peptides = 1 || unambiguous || 64.5% Confident
TYB4_MOUSE - (P20065) Thymosin beta-4 (T beta 4) || Number of peptides = 4 || ambiguous || 64.4% Confident
SYT1_MOUSE - (P46096) Synaptotagmin I (SytI) (p65) || Number of peptides = 5 || ambiguous || 64.3% Confident
IPSP_MOUSE - (P70458) Plasma serine protease inhibitor precursor (PCI) (Protein C inhibitor) (Plasminogen activator inhibitor-3) (PAI3) || Number of peptides = 2 || unambiguous || 64.3% Confident
Q9Y5Z7 - (Q9Y5Z7) Host cell factor 2 || Number of peptides = 4 || unambiguous || 64.3% Confident
O14584 - (O14584) WUGSC:H_GS034D21.1 protein (Fragment) || Number of peptides = 5 || unambiguous || 64.2% Confident
Q9Y5A1 - (Q9Y5A1) NY-REN-36 antigen (Fragment) || Number of peptides = 2 || unambiguous || 64.2% Confident
Q9Y6N3 - (Q9Y6N3) CLCA homolog || Number of peptides = 8 || unambiguous || 64.2% Confident
Q9CTB9 - (Q9CTB9) 1110030K07Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 64.1% Confident
Q96MI1 - (Q96MI1) Hypothetical protein FLJ32343 || Number of peptides = 1 || unambiguous || 64.1% Confident
Q9D3F5 - (Q9D3F5) 5830415F09Rik protein || Number of peptides = 1 || unambiguous || 64.1% Confident
Q9D3V8 - (Q9D3V8) 4933432B09Rik protein || Number of peptides = 6 || unambiguous || 64.0% Confident
KEMK_MOUSE - (Q05512) Putative serine/threonine-protein kinase EMK (EC 2.7.1.-) || Number of peptides = 2 || unambiguous || 64.0% Confident
O15017 - (O15017) Hypothetical protein KIAA0299 (Fragment) || Number of peptides = 4 || unambiguous || 64.0% Confident
Q9H6D2 - (Q9H6D2) Hypothetical protein FLJ22374 (Fragment) || Number of peptides = 4 || unambiguous || 64.0% Confident
Q8VF71 - (Q8VF71) Olfactory receptor MOR223-6 || Number of peptides = 3 || ambiguous || 64.0% Confident
GPDA_MOUSE - (P13707) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic (EC 1.1.1.8) (GPD-C) (GPDH-C) || Number of peptides = 6 || unambiguous || 63.9% Confident
TRBP_MOUSE - (P97473) TAR RNA-binding protein 2 (Protamine-1 RNA binding protein) (PRM-1 RNA binding protein) || Number of peptides = 2 || unambiguous || 63.9% Confident
Q9NY15 - (Q9NY15) Stabilin-1 || Number of peptides = 13 || unambiguous || 63.7% Confident
Q9H799 - (Q9H799) Hypothetical protein FLJ21126 (Fragment) || Number of peptides = 1 || unambiguous || 63.7% Confident
NEBU_HUMAN - (P20929) Nebulin || Number of peptides = 17 || unambiguous || 63.6% Confident
Q99LX0 - (Q99LX0) Similar to DJ-1 protein || Number of peptides = 1 || ambiguous || 63.5% Confident
CADD_MOUSE - (Q9WTR5) Cadherin-13 precursor (Truncated-cadherin) (T-cadherin) (T-cad) (Heart-cadherin) (H-cadherin) || Number of peptides = 8 || unambiguous || 63.5% Confident
BMR2_MOUSE - (O35607) Bone morphogenetic protein receptor type II precursor (EC 2.7.1.37) (BMP type II receptor) (BMPR-II) (BRK-3) || Number of peptides = 5 || unambiguous || 63.5% Confident
LAM5_MOUSE - (Q61168) Lysosomal-associated multitransmembrane protein (Retinoic acid-inducible E3 protein) || Number of peptides = 2 || unambiguous || 63.4% Confident
TEA2_MOUSE - (P48301) Transcriptional enhancer factor TEF-4 (TEA domain family member 2) (TEAD-2) (Embryonic TEA domain-containing factor) (ETF) (ETEF-1) || Number of peptides = 2 || unambiguous || 63.4% Confident
PC16_HUMAN - (Q96JQ0) Protocadherin 16 precursor (Cadherin 19) (Cadherin fibroblast 1) || Number of peptides = 12 || unambiguous || 63.4% Confident
NAC1_MOUSE - (P70414) Sodium/calcium exchanger 1 precursor (Na(+)/Ca(2+)-exchange protein 1) || Number of peptides = 3 || unambiguous || 63.2% Confident
VINE_MOUSE - (Q9R1Z8) Vinexin (SH3-containing adapter molecule-1) (SCAM-1) (SH3 domain-containing protein SH3P3) || Number of peptides = 2 || unambiguous || 63.2% Confident
ZO1_HUMAN - (Q07157) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) || Number of peptides = 5 || unambiguous || 63.2% Confident
Q9NTG2 - (Q9NTG2) Hypothetical protein (Fragment) || Number of peptides = 6 || unambiguous || 63.0% Confident
Q07617 - (Q07617) Infertility-related sperm protein || Number of peptides = 3 || unambiguous || 63.0% Confident
Q8WYN7 - (Q8WYN7) HUST3 || Number of peptides = 2 || unambiguous || 63.0% Confident
AOAH_HUMAN - (P28039) Acyloxyacyl hydrolase precursor (EC 3.1.1.77) || Number of peptides = 4 || unambiguous || 62.9% Confident
O14637 - (O14637) Laminin alpha 3b chain (Fragment) || Number of peptides = 9 || unambiguous || 62.8% Confident
Q9P063 - (Q9P063) HSPC319 (Fragment) || Number of peptides = 2 || unambiguous || 62.8% Confident
GP15_HUMAN - (P49685) G protein-coupled receptor GPR15 (BOB) || Number of peptides = 1 || unambiguous || 62.7% Confident
O60363 - (O60363) SA gene || Number of peptides = 5 || unambiguous || 62.6% Confident
ERG1_HUMAN - (Q14534) Squalene monooxygenase (EC 1.14.99.7) (Squalene epoxidase) (SE) || Number of peptides = 4 || unambiguous || 62.6% Confident
Q96NW4 - (Q96NW4) FLJ00040 protein (Fragment) || Number of peptides = 4 || ambiguous || 62.4% Confident
XRC2_MOUSE - (Q9CX47) DNA-repair protein XRCC2 (X-ray repair cross-complementing protein 2) || Number of peptides = 1 || unambiguous || 62.4% Confident
CGD3_MOUSE - (P30282) G1/S-specific cyclin D3 || Number of peptides = 5 || unambiguous || 62.4% Confident
Q9ESL7 - (Q9ESL7) Niban || Number of peptides = 1 || unambiguous || 62.4% Confident
ERB3_HUMAN - (P21860) Receptor protein-tyrosine kinase erbB-3 precursor (EC 2.7.1.112) (c-erbB3) (Tyrosine kinase-type cell surface receptor HER3) || Number of peptides = 12 || unambiguous || 62.4% Confident
Q9Y683 - (Q9Y683) HSPC035 protein || Number of peptides = 2 || ambiguous || 62.2% Confident
Q9BU97 - (Q9BU97) Hypothetical protein KIAA1115 || Number of peptides = 2 || unambiguous || 62.2% Confident
OPT_HUMAN - (Q9UBM4) Opticin precursor (Oculoglycan) || Number of peptides = 1 || unambiguous || 62.2% Confident
Q91XA6 - (Q91XA6) Unknown (Protein for MGC:18668) || Number of peptides = 1 || unambiguous || 62.2% Confident
CSE1_MOUSE - (Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) || Number of peptides = 5 || unambiguous || 62.1% Confident
MM16_MOUSE - (Q9WTR0) Matrix metalloproteinase-16 precursor (EC 3.4.24.-) (MMP-16) (Membrane-type matrix metalloproteinase 3) (MT-MMP 3) (MTMMP3) (Membrane-type-3 matrix metalloproteinase) (MT3-MMP) (MT3MMP) || Number of peptides = 10 || unambiguous || 62.0% Confident
Q9D0D6 - (Q9D0D6) 2610024N01Rik protein || Number of peptides = 3 || ambiguous || 62.0% Confident
Q8R0E5 - (Q8R0E5) RIKEN cDNA 1700022C21 gene || Number of peptides = 1 || unambiguous || 61.9% Confident
Q8TCN5 - (Q8TCN5) Hypothetical protein || Number of peptides = 2 || unambiguous || 61.9% Confident
VEGB_HUMAN - (P49765) Vascular endothelial growth factor B precursor (VEGF-B) (VEGF related factor) (VRF) || Number of peptides = 1 || unambiguous || 61.9% Confident
O94836 - (O94836) Hypothetical protein KIAA0731 (Fragment) || Number of peptides = 7 || unambiguous || 61.9% Confident
TRAL_HUMAN - (Q12931) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) || Number of peptides = 4 || unambiguous || 61.7% Confident
Q9H910 - (Q9H910) Hypothetical protein FLJ13092 (HN1 like) || Number of peptides = 1 || unambiguous || 61.7% Confident
DLL1_HUMAN - (O00548) Delta-like protein 1 precursor (Drosophila Delta homolog 1) (Delta1) (H-Delta-1) || Number of peptides = 3 || ambiguous || 61.7% Confident
Q9H960 - (Q9H960) Hypothetical protein FLJ12988 || Number of peptides = 1 || unambiguous || 61.7% Confident
ALD1_MOUSE - (P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7) || Number of peptides = 3 || unambiguous || 61.6% Confident
CYC_MOUSE - (P00009) Cytochrome c, somatic || Number of peptides = 2 || unambiguous || 61.6% Confident
ALDR_MOUSE - (P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) || Number of peptides = 3 || ambiguous || 61.6% Confident
Q9EQQ9 - (Q9EQQ9) Cytosolic beta-N-acetylglucosaminidase || Number of peptides = 5 || unambiguous || 61.6% Confident
Q8R3T6 - (Q8R3T6) Similar to hypothetical protein MGC2376 || Number of peptides = 1 || unambiguous || 61.6% Confident
O95568 - (O95568) Hypothetical protein || Number of peptides = 3 || unambiguous || 61.5% Confident
Q99MP0 - (Q99MP0) T-box 1 || Number of peptides = 4 || unambiguous || 61.5% Confident
Q9CSF2 - (Q9CSF2) 2810405K07Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 61.5% Confident
PRKD_MOUSE - (P97313) DNA-dependent protein kinase catalytic subunit (EC 2.7.1.37) (DNA-PKcs) (P460) || Number of peptides = 5 || unambiguous || 61.5% Confident
FDFT_MOUSE - (P53798) Farnesyl-diphosphate farnesyltransferase (EC 2.5.1.21) (Squalene synthetase) (SQS) (SS) (FPP:FPP farnesyltransferase) || Number of peptides = 5 || unambiguous || 61.4% Confident
GC3_HUMAN - (P01860) Ig gamma-3 chain C region (Heavy chain disease protein) (HDC) || Number of peptides = 1 || unambiguous || 61.4% Confident
9KD_HUMAN - (P13994) 9 kDa protein || Number of peptides = 5 || unambiguous || 61.4% Confident
CHD1_MOUSE - (P40201) Chromodomain-helicase-DNA-binding protein 1 (CHD-1) || Number of peptides = 6 || unambiguous || 61.4% Confident
O88443 - (O88443) SWAP-70 || Number of peptides = 2 || unambiguous || 61.4% Confident
Q9UPZ6 - (Q9UPZ6) Hypothetical protein KIAA0960 (Fragment) || Number of peptides = 8 || unambiguous || 61.3% Confident
CA24_MOUSE - (P08122) Collagen alpha 2(IV) chain precursor || Number of peptides = 7 || unambiguous || 61.3% Confident
DLG2_HUMAN - (Q15700) Channel associated protein of synapse-110 (Chapsyn-110) (Discs, large homolog 2) || Number of peptides = 7 || unambiguous || 61.2% Confident
Q9CXL1 - (Q9CXL1) 3200001F09Rik protein || Number of peptides = 1 || unambiguous || 61.2% Confident
Q8VFA0 - (Q8VFA0) Olfactory receptor MOR225-5 || Number of peptides = 1 || unambiguous || 61.2% Confident
O08847 - (O08847) RNA polymerase II largest subunit || Number of peptides = 4 || unambiguous || 61.1% Confident
KDGT_HUMAN - (P52824) Diacylglycerol kinase, theta (EC 2.7.1.107) (Diglyceride kinase) (DGK-theta) (DAG kinase theta) || Number of peptides = 2 || unambiguous || 61.0% Confident
Y056_HUMAN - (P42695) Hypothetical protein KIAA0056 (Fragment) || Number of peptides = 2 || unambiguous || 61.0% Confident
Q96NL7 - (Q96NL7) Hypothetical protein FLJ30651 || Number of peptides = 3 || unambiguous || 60.8% Confident
CD11_MOUSE - (P11609) T-cell surface glycoprotein CD1d1 precursor (CD1.1 antigen) || Number of peptides = 5 || unambiguous || 60.8% Confident
Q15134 - (Q15134) Phosphatidylinositol 3-kinase || Number of peptides = 4 || unambiguous || 60.8% Confident
TRFR_HUMAN - (P34981) Thyrotropin-releasing hormone receptor (TRH-R) (Thyroliberin receptor) || Number of peptides = 3 || unambiguous || 60.7% Confident
Q9CY59 - (Q9CY59) 2500002N19Rik protein || Number of peptides = 1 || ambiguous || 60.6% Confident
G45B_HUMAN - (O75293) Growth arrest and DNA-damage-inducible protein GADD45 beta (Negative growth-regulatory protein MyD118) (Myeloid differentiation primary response protein MyD118) || Number of peptides = 1 || unambiguous || 60.6% Confident
Q96L76 - (Q96L76) ATP-binding cassette transporter G1 || Number of peptides = 1 || unambiguous || 60.5% Confident
Q14667 - (Q14667) Hypothetical protein KIAA0100 (Fragment) || Number of peptides = 7 || unambiguous || 60.5% Confident
AOC3_HUMAN - (Q16853) Membrane copper amine oxidase (EC 1.4.3.6) (Vascular adhesion protein-1) (VAP-1) (HPAO) || Number of peptides = 10 || unambiguous || 60.5% Confident
ZN29_HUMAN - (P17037) Zinc finger protein 29 (Zinc finger protein KOX26) (Fragment) || Number of peptides = 8 || unambiguous || 60.5% Confident
PTPZ_HUMAN - (P23471) Protein-tyrosine phosphatase zeta precursor (EC 3.1.3.48) (R-PTP-zeta) || Number of peptides = 11 || unambiguous || 60.5% Confident
Q925U4 - (Q925U4) EDEM protein || Number of peptides = 5 || unambiguous || 60.3% Confident
Q9BPX3 - (Q9BPX3) Chromosome-associated protein-G (Condensin subunit CAP-G) || Number of peptides = 5 || unambiguous || 60.3% Confident
Q91XY3 - (Q91XY3) Protocadherin gamma A5 || Number of peptides = 4 || unambiguous || 60.3% Confident
PPOV_HUMAN - (Q9UKK3) Vault poly(ADP-ribose) polymerase (EC 2.4.2.30) (VPARP) (193-kDa vault protein) (PARP-related/IalphaI-related H5/proline-rich) (PH5P) || Number of peptides = 6 || unambiguous || 60.3% Confident
Q9NXB3 - (Q9NXB3) Hypothetical protein FLJ20342 || Number of peptides = 3 || unambiguous || 60.2% Confident
Q8QZU6 - (Q8QZU6) Similar to unknown (Protein for IMAGE:3534875) (Fragment) || Number of peptides = 5 || unambiguous || 60.2% Confident
Q9P153 - (Q9P153) PRO2729 (Similar to serine/threonine kinase 10) || Number of peptides = 3 || unambiguous || 60.1% Confident
Q91YD3 - (Q91YD3) Transcription factor || Number of peptides = 3 || unambiguous || 60.0% Confident
O94868 - (O94868) Hypothetical protein KIAA0769 || Number of peptides = 5 || unambiguous || 59.9% Confident
O43606 - (O43606) Hypothetical protein (Fragment) || Number of peptides = 4 || unambiguous || 59.9% Confident
Q91ZE6 - (Q91ZE6) Beta4-spectrin || Number of peptides = 16 || unambiguous || 59.8% Confident
Q9UFD8 - (Q9UFD8) Hypothetical protein (Fragment) || Number of peptides = 5 || unambiguous || 59.8% Confident
Q8R585 - (Q8R585) Similar to hypothetical protein FLJ22635 || Number of peptides = 5 || unambiguous || 59.8% Confident
Q9BQA9 - (Q9BQA9) Hypothetical protein || Number of peptides = 2 || unambiguous || 59.8% Confident
Q9ERL7 - (Q9ERL7) Glia maturation factor-gamma (0610039G16Rik protein) (2310057N07Rik protein) (Glia maturation factor, gamma) || Number of peptides = 1 || unambiguous || 59.8% Confident
Q9ESF9 - (Q9ESF9) Odorant receptor B3 (Fragment) || Number of peptides = 4 || unambiguous || 59.7% Confident
Q9CYH7 - (Q9CYH7) 5730460C07Rik protein || Number of peptides = 4 || unambiguous || 59.7% Confident
Q9UPF6 - (Q9UPF6) CD3e-associated protein || Number of peptides = 4 || ambiguous || 59.6% Confident
Q9CT58 - (Q9CT58) 2600001J17Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 59.5% Confident
Q9Z2X0 - (Q9Z2X0) SA || Number of peptides = 2 || unambiguous || 59.5% Confident
DPOA_HUMAN - (P09884) DNA polymerase alpha catalytic subunit (EC 2.7.7.7) || Number of peptides = 3 || unambiguous || 59.5% Confident
RFX5_HUMAN - (P48382) DNA-binding protein RFX5 (Regulatory factor X subunit 5) || Number of peptides = 10 || unambiguous || 59.5% Confident
DBP_MOUSE - (Q60925) D-site-binding protein (Albumin D box-binding protein) || Number of peptides = 14 || unambiguous || 59.4% Confident
Q96LD4 - (Q96LD4) Gene overexpressed in astrocytoma || Number of peptides = 4 || unambiguous || 59.4% Confident
Q96IA7 - (Q96IA7) Hypothetical protein FLJ31409 (Fragment) || Number of peptides = 7 || unambiguous || 59.4% Confident
Q9H4U3 - (Q9H4U3) DJ14N1.1.2 (Profilaggrin 3' end) (Fragment) || Number of peptides = 2 || unambiguous || 59.3% Confident
Q9CUR1 - (Q9CUR1) 4921528I01Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 59.3% Confident
O35056 - (O35056) KIF16B (Fragment) || Number of peptides = 3 || unambiguous || 59.2% Confident
PAX7_MOUSE - (P47239) Paired box protein Pax-7 (Fragment) || Number of peptides = 1 || ambiguous || 59.2% Confident
Q92738 - (Q92738) Hypothetical protein KIAA0019 || Number of peptides = 4 || unambiguous || 59.2% Confident
RHG6_HUMAN - (O43182) Rho-GTPase-activating protein 6 (Rho-type GTPase-activating protein RhoGAPX-1) || Number of peptides = 3 || unambiguous || 59.1% Confident
Q9P2C9 - (Q9P2C9) Hypothetical protein KIAA1418 (Fragment) || Number of peptides = 5 || ambiguous || 59.1% Confident
Q9CY26 - (Q9CY26) 2700085E05Rik protein || Number of peptides = 1 || ambiguous || 59.1% Confident
Q8R420 - (Q8R420) ATP-binding cassette transporter ABCA3 || Number of peptides = 4 || unambiguous || 59.1% Confident
Q8VHV9 - (Q8VHV9) Ikap || Number of peptides = 3 || ambiguous || 58.9% Confident
CA16_HUMAN - (P12109) Collagen alpha 1(VI) chain precursor || Number of peptides = 8 || unambiguous || 58.8% Confident
Q9UPP2 - (Q9UPP2) Hypothetical protein KIAA1110 (Fragment) || Number of peptides = 4 || unambiguous || 58.7% Confident
Q9Y6X6 - (Q9Y6X6) Hypothetical protein KIAA0865 (Fragment) || Number of peptides = 1 || ambiguous || 58.7% Confident
KF3B_MOUSE - (Q61771) Kinesin-like protein KIF3B (Microtubule plus end-directed kinesin motor 3B) || Number of peptides = 5 || unambiguous || 58.7% Confident
Q9JJG3 - (Q9JJG3) Brain cDNA, clone MNCb-1826 || Number of peptides = 4 || unambiguous || 58.6% Confident
Q9D135 - (Q9D135) 2300003P22Rik protein || Number of peptides = 2 || unambiguous || 58.6% Confident
Q9DC86 - (Q9DC86) 2200008D09Rik protein || Number of peptides = 3 || ambiguous || 58.5% Confident
CGB1_HUMAN - (P14635) G2/mitotic-specific cyclin B1 || Number of peptides = 2 || unambiguous || 58.5% Confident
Q9Z125 - (Q9Z125) OASIS protein || Number of peptides = 3 || ambiguous || 58.5% Confident
ABC9_MOUSE - (Q9JJ59) ATP-binding cassette, sub-family B, member 9 precursor (ATP-binding cassette transporter 9) (ABC transporter 9 protein) (TAP-like protein) (TAPL) (mABCB9) || Number of peptides = 6 || unambiguous || 58.5% Confident
P97499 - (P97499) Telomerase protein-1 || Number of peptides = 10 || unambiguous || 58.5% Confident
Q8VI37 - (Q8VI37) Paxillin alpha || Number of peptides = 1 || unambiguous || 58.5% Confident
Q9H1B6 - (Q9H1B6) Xylosyltransferase I (EC 2.4.2.26) (Fragment) || Number of peptides = 2 || unambiguous || 58.3% Confident
VEGD_MOUSE - (P97946) Vascular endothelial growth factor D precursor (VEGF-D) (c-fos induced growth factor) (FIGF) || Number of peptides = 2 || unambiguous || 58.3% Confident
C343_HUMAN - (Q9HB55) Cytochrome P450 3A43 (EC 1.14.14.1) || Number of peptides = 2 || unambiguous || 58.2% Confident
CA21_MOUSE - (Q01149) Collagen alpha 2(I) chain precursor || Number of peptides = 17 || unambiguous || 58.2% Confident
PCNT_MOUSE - (P48725) Pericentrin || Number of peptides = 7 || unambiguous || 58.2% Confident
Q9UKV3 - (Q9UKV3) AcinusL || Number of peptides = 6 || unambiguous || 58.0% Confident
Q99MI6 - (Q99MI6) Immunity-associated nucleotide 4 || Number of peptides = 1 || unambiguous || 58.0% Confident
SM3C_HUMAN - (Q99985) Semaphorin 3C precursor (Semaphorin E) (Sema E) || Number of peptides = 3 || unambiguous || 58.0% Confident
Q8VDM9 - (Q8VDM9) Hypothetical 81.3 kDa protein || Number of peptides = 6 || unambiguous || 58.0% Confident
NRTN_MOUSE - (P97463) Neurturin precursor || Number of peptides = 2 || unambiguous || 57.9% Confident
TP2B_HUMAN - (Q02880) DNA topoisomerase II, beta isozyme (EC 5.99.1.3) || Number of peptides = 1 || unambiguous || 57.9% Confident
Q8VFJ7 - (Q8VFJ7) Olfactory receptor MOR213-6 || Number of peptides = 2 || unambiguous || 57.8% Confident
TISR_HUMAN - (Q9Y5M6) Oculomedin (Trabecular meshwork inducible stretch response protein) (TISR) || Number of peptides = 3 || unambiguous || 57.7% Confident
Q96R77 - (Q96R77) Olfactory receptor (Fragment) || Number of peptides = 1 || unambiguous || 57.6% Confident
GAL7_HUMAN - (P07902) Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10) || Number of peptides = 2 || unambiguous || 57.6% Confident
Q99MM9 - (Q99MM9) Radial spokehead-L protein || Number of peptides = 4 || ambiguous || 57.6% Confident
IRF6_MOUSE - (P97431) Interferon regulatory factor 6 (IRF-6) || Number of peptides = 1 || unambiguous || 57.6% Confident
Q96KT1 - (Q96KT1) Hypothetical protein || Number of peptides = 1 || unambiguous || 57.6% Confident
P70335 - (P70335) Rho-associated, coiled-coil forming protein kinase p160 ROCK-1 || Number of peptides = 6 || ambiguous || 57.6% Confident
Q9NZR2 - (Q9NZR2) Low density lipoprotein receptor related protein-deleted in tumor || Number of peptides = 14 || unambiguous || 57.4% Confident
LMA2_MOUSE - (Q60675) Laminin alpha-2 chain precursor (Laminin M chain) (Merosin heavy chain) || Number of peptides = 7 || unambiguous || 57.3% Confident
ITB2_MOUSE - (P11835) Integrin beta-2 precursor (Cell surface adhesion glycoproteins LFA-1/CR3/P150,95 beta-subunit) (CD18) (Complement receptor C3 beta-subunit) || Number of peptides = 4 || unambiguous || 57.3% Confident
Q9UFU8 - (Q9UFU8) Hypothetical protein (Fragment) || Number of peptides = 7 || unambiguous || 57.3% Confident
CP3P_MOUSE - (O09158) Cytochrome P450 3A25 (EC 1.14.14.1) (CYPIIIA25) || Number of peptides = 2 || unambiguous || 57.3% Confident
Q8WYZ1 - (Q8WYZ1) Hypothetical protein || Number of peptides = 1 || unambiguous || 57.3% Confident
O95811 - (O95811) Retinoblastoma binding protein 2 homolog 1 || Number of peptides = 5 || unambiguous || 57.2% Confident
S142_HUMAN - (O76054) SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (hTAP) (Supernatant protein factor) (SPF) (Squalene transfer protein) || Number of peptides = 4 || unambiguous || 57.2% Confident
Q9WUC2 - (Q9WUC2) SH2-containing inositol phosphatase || Number of peptides = 4 || ambiguous || 57.2% Confident
Q9CQM2 - (Q9CQM2) 1110007A14Rik protein (Putative KDEL receptor) (RIKEN cDNA 1110007A14 gene) || Number of peptides = 1 || ambiguous || 57.2% Confident
Q60912 - (Q60912) Zfp70p (Fragment) || Number of peptides = 1 || unambiguous || 57.2% Confident
CA44_HUMAN - (P53420) Collagen alpha 4(IV) chain precursor || Number of peptides = 7 || unambiguous || 57.2% Confident
Q9Y431 - (Q9Y431) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 57.2% Confident
Q15042 - (Q15042) Hypothetical protein KIAA0066 (Fragment) || Number of peptides = 12 || unambiguous || 57.1% Confident
Q9H4G6 - (Q9H4G6) DJ885L7.9.1 (Death associated transcription factor 1 (Contains KIAA0333), isoform 1) (Fragment) || Number of peptides = 5 || ambiguous || 57.1% Confident
GC5L_MOUSE - (O55102) GCN5-like protein 1 || Number of peptides = 1 || unambiguous || 57.1% Confident
INVO_HUMAN - (P07476) Involucrin || Number of peptides = 4 || unambiguous || 57.1% Confident
Z197_HUMAN - (O14709) Zinc finger protein 197 (ZnF20) || Number of peptides = 5 || unambiguous || 57.0% Confident
Q96BQ1 - (Q96BQ1) Similar to RIKEN cDNA 1810037C20 gene || Number of peptides = 1 || unambiguous || 57.0% Confident
CUT1_MOUSE - (P53564) CCAAT displacement protein (CDP) (Cut-like 1) (Homeobox protein Cux) (Fragment) || Number of peptides = 4 || unambiguous || 57.0% Confident
Q9D468 - (Q9D468) 4933411B03Rik protein || Number of peptides = 3 || unambiguous || 57.0% Confident
IRK8_MOUSE - (P97794) ATP-sensitive inward rectifier potassium channel 8 (Potassium channel, inwardly rectifying, subfamily J, member 8) (Inwardly rectifier K+ channel Kir6.1) (uKATP-1) || Number of peptides = 4 || unambiguous || 57.0% Confident
Q9Z1L5 - (Q9Z1L5) Calcium channel alpha-2-delta-C subunit || Number of peptides = 3 || unambiguous || 57.0% Confident
Q9UQR0 - (Q9UQR0) SCML2 protein (DJ1129A6.1) (Sex comb on midleg (Drosophila)-like 2) || Number of peptides = 4 || unambiguous || 57.0% Confident
Q9D0I8 - (Q9D0I8) 2610012O22Rik protein || Number of peptides = 1 || ambiguous || 57.0% Confident
Q9JLD3 - (Q9JLD3) KRAB-zinc finger protein KID3 || Number of peptides = 2 || unambiguous || 57.0% Confident
LV6D_HUMAN - (P06318) Ig lambda chain V-VI region WLT || Number of peptides = 3 || unambiguous || 56.9% Confident
O14948 - (O14948) TFEC isoform (or TFECL) || Number of peptides = 1 || unambiguous || 56.9% Confident
G6PT_MOUSE - (P35576) Glucose-6-phosphatase (EC 3.1.3.9) (G6Pase) (G-6-Pase) || Number of peptides = 2 || unambiguous || 56.9% Confident
MSRE_HUMAN - (P21757) Macrophage scavenger receptor types I and II (Macrophage acetylated LDL receptor I and II) || Number of peptides = 4 || unambiguous || 56.9% Confident
O35884 - (O35884) N-RAP || Number of peptides = 7 || unambiguous || 56.9% Confident
CAH3_MOUSE - (P16015) Carbonic anhydrase III (EC 4.2.1.1) (Carbonate dehydratase III) (CA-III) || Number of peptides = 2 || ambiguous || 56.9% Confident
POL2_MOUSE - (P11369) Retrovirus-related POL polyprotein [Contains: Reverse transcriptase (EC 2.7.7.49); Endonuclease] || Number of peptides = 3 || ambiguous || 56.9% Confident
O54887 - (O54887) Testis specific serine kinase substrate || Number of peptides = 1 || unambiguous || 56.9% Confident
Q99987 - (Q99987) VRK2 || Number of peptides = 1 || unambiguous || 56.8% Confident
CTD1_MOUSE - (P30999) Catenin delta-1 (p120 catenin) (p120(ctn)) (Cadherin-associated Src substrate) (CAS) (p120(cas)) || Number of peptides = 2 || unambiguous || 56.7% Confident
Q9D7U5 - (Q9D7U5) 4933404O11Rik protein || Number of peptides = 2 || unambiguous || 56.7% Confident
FATH_HUMAN - (Q14517) Cadherin-related tumor suppressor homolog precursor (Fat protein homolog) || Number of peptides = 13 || unambiguous || 56.7% Confident
Q9NVJ0 - (Q9NVJ0) Hypothetical protein FLJ10706 || Number of peptides = 2 || ambiguous || 56.7% Confident
Q60779 - (Q60779) Growth arrest specific || Number of peptides = 3 || unambiguous || 56.6% Confident
RRM1_HUMAN - (Q9UET6) Putative ribosomal RNA methyltransferase 1 (EC 2.1.1.-) (rRNA (uridine-2'-O-)-methyltransferase) (JM23 protein) || Number of peptides = 5 || unambiguous || 56.6% Confident
O95995 - (O95995) Growth arrest specific 11 || Number of peptides = 3 || unambiguous || 56.6% Confident
Q9DBW1 - (Q9DBW1) 1200012D01Rik protein (RIKEN cDNA 1200012D01 gene) || Number of peptides = 2 || unambiguous || 56.6% Confident
Q8VG95 - (Q8VG95) Olfactory receptor MOR256-5 || Number of peptides = 2 || unambiguous || 56.5% Confident
Q8TF32 - (Q8TF32) Hypothetical protein KIAA1969 (Fragment) || Number of peptides = 3 || unambiguous || 56.5% Confident
ATX1_HUMAN - (P54253) Ataxin-1 (Spinocerebellar ataxia type 1 protein) || Number of peptides = 3 || unambiguous || 56.5% Confident
LAT1_MOUSE - (Q9Z127) Large neutral amino acids transporter small subunit 1 (L-type amino acid transporter 1) (4F2 light chain) (4F2 LC) (4F2LC) || Number of peptides = 2 || unambiguous || 56.4% Confident
Q96BT7 - (Q96BT7) Hypothetical protein || Number of peptides = 3 || unambiguous || 56.4% Confident
Q9H9G6 - (Q9H9G6) Hypothetical protein FLJ12768 || Number of peptides = 1 || unambiguous || 56.4% Confident
HA2K_MOUSE - (P01910) H-2 class II histocompatibility antigen, A-K alpha chain precursor || Number of peptides = 1 || unambiguous || 56.4% Confident
Q9H3T8 - (Q9H3T8) MOP-3 || Number of peptides = 4 || unambiguous || 56.2% Confident
O15045 - (O15045) Hypothetical protein KIAA0336 || Number of peptides = 3 || unambiguous || 56.2% Confident
C263_MOUSE - (P58659) Protein C21orf63 homolog precursor || Number of peptides = 7 || ambiguous || 56.2% Confident
Q96CR9 - (Q96CR9) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 56.2% Confident
Q14828 - (Q14828) MG44 protein (Fragment) || Number of peptides = 5 || unambiguous || 56.2% Confident
Q9D168 - (Q9D168) 1110020M19Rik protein || Number of peptides = 3 || unambiguous || 56.1% Confident
YC94_HUMAN - (Q9P2Q2) Hypothetical protein KIAA1294 (Fragment) || Number of peptides = 4 || unambiguous || 56.1% Confident
E2BD_MOUSE - (Q61749) Translation initiation factor eIF-2B delta subunit (eIF-2B GDP-GTP exchange factor) || Number of peptides = 3 || unambiguous || 56.1% Confident
Q9UKT9 - (Q9UKT9) Zinc finger DNA binding protein Aiolos || Number of peptides = 1 || ambiguous || 56.0% Confident
Q91V45 - (Q91V45) G-protein-coupled receptor GPR54 (G protein-coupled receptor 54) || Number of peptides = 2 || unambiguous || 55.9% Confident
Q9NT72 - (Q9NT72) Hypothetical protein (Fragment) || Number of peptides = 7 || unambiguous || 55.9% Confident
HO2_MOUSE - (O70252) Heme oxygenase 2 (EC 1.14.99.3) (HO-2) || Number of peptides = 3 || unambiguous || 55.8% Confident
Q9CYX9 - (Q9CYX9) 2810431D22Rik protein || Number of peptides = 1 || ambiguous || 55.7% Confident
Y053_HUMAN - (P42331) Hypothetical protein KIAA0053 || Number of peptides = 1 || unambiguous || 55.7% Confident
CONT_MOUSE - (P12960) Contactin precursor (Neural cell surface protein F3) || Number of peptides = 7 || unambiguous || 55.6% Confident
Q9WU89 - (Q9WU89) Odorant receptor S18 || Number of peptides = 2 || unambiguous || 55.6% Confident
Q99JR9 - (Q99JR9) RIKEN cDNA 4931428D14 gene || Number of peptides = 1 || unambiguous || 55.5% Confident
Q8TEQ2 - (Q8TEQ2) FLJ00141 protein (Fragment) || Number of peptides = 7 || ambiguous || 55.5% Confident
GCFC_HUMAN - (Q9Y5B6) GC-rich sequence DNA-binding factor homolog || Number of peptides = 5 || unambiguous || 55.5% Confident
AGAL_HUMAN - (P06280) Alpha-galactosidase A precursor (EC 3.2.1.22) (Melibiase) (Alpha-D-galactoside galactohydrolase) (Alpha-D-galactosidase A) (Agalsidase alfa) || Number of peptides = 4 || unambiguous || 55.5% Confident
Q8VHI7 - (Q8VHI7) NYD-SP28 protein || Number of peptides = 2 || unambiguous || 55.5% Confident
Q99KS4 - (Q99KS4) Hypothetical 59.4 kDa protein (Fragment) || Number of peptides = 5 || ambiguous || 55.4% Confident
DPOL_MOUSE - (Q9QXE2) DNA polymerase lambda (EC 2.7.7.7) (Pol Lambda) (DNA polymerase kappa) || Number of peptides = 2 || unambiguous || 55.4% Confident
PESC_HUMAN - (O00541) Pescadillo homolog 1 || Number of peptides = 2 || unambiguous || 55.4% Confident
Q96JN2 - (Q96JN2) Hypothetical protein KIAA1793 (Fragment) || Number of peptides = 5 || unambiguous || 55.4% Confident
Q8R065 - (Q8R065) Hypothetical 26.3 kDa protein || Number of peptides = 4 || unambiguous || 55.4% Confident
Q9DAS8 - (Q9DAS8) 1600029N02Rik protein || Number of peptides = 1 || ambiguous || 55.3% Confident
DBDR_HUMAN - (P21918) D(1B) dopamine receptor (D(5) dopamine receptor) (D1beta dopamine receptor) || Number of peptides = 2 || unambiguous || 55.3% Confident
Q96MA6 - (Q96MA6) Hypothetical protein FLJ32704 || Number of peptides = 2 || unambiguous || 55.2% Confident
Q9CZ24 - (Q9CZ24) 1190004A01Rik protein || Number of peptides = 3 || unambiguous || 55.2% Confident
Q9Y364 - (Q9Y364) CGI-50 protein || Number of peptides = 6 || unambiguous || 55.1% Confident
Q96D88 - (Q96D88) Similar to hypothetical protein MGC3121 (Fragment) || Number of peptides = 2 || ambiguous || 55.0% Confident
Q9CQC1 - (Q9CQC1) 1200013P10Rik protein (Crooked neck protein) || Number of peptides = 2 || ambiguous || 55.0% Confident
O00372 - (O00372) Putative p150 || Number of peptides = 1 || unambiguous || 55.0% Confident
Q9D9Q2 - (Q9D9Q2) 1700034J04Rik protein || Number of peptides = 1 || unambiguous || 55.0% Confident
TDR1_HUMAN - (Q9BXT4) Tudor domain containing protein 1 || Number of peptides = 5 || unambiguous || 54.9% Confident
GEPH_HUMAN - (Q9NQX3) Gephyrin || Number of peptides = 4 || unambiguous || 54.9% Confident
P79522 - (P79522) MHC class I region proline rich protein || Number of peptides = 1 || unambiguous || 54.9% Confident
O88836 - (O88836) Chromosome 6 BAC-284H12 (RESEARCH GENETICS mouse BAC LIBRARY) complete sequence (RESEARCH GENETICS mouse BAC LIBRARY) (Gene rich cluster, B gene) || Number of peptides = 2 || unambiguous || 54.9% Confident
P70196 - (P70196) TRAF6 || Number of peptides = 1 || ambiguous || 54.9% Confident
PERE_HUMAN - (P11678) Eosinophil peroxidase precursor (EC 1.11.1.7) (EPO) || Number of peptides = 5 || unambiguous || 54.9% Confident
Q925S1 - (Q925S1) MRP5 (Fragment) || Number of peptides = 1 || unambiguous || 54.8% Confident
SM3E_MOUSE - (P70275) Semaphorin 3E precursor (Semaphorin H) (Sema H) || Number of peptides = 3 || unambiguous || 54.8% Confident
TSP3_HUMAN - (P49746) Thrombospondin 3 precursor || Number of peptides = 3 || unambiguous || 54.8% Confident
Q9D891 - (Q9D891) 0610039J17Rik protein || Number of peptides = 3 || ambiguous || 54.6% Confident
Q9DAB5 - (Q9DAB5) Histone H2B || Number of peptides = 1 || unambiguous || 54.6% Confident
ICEB_MOUSE - (P70343) Caspase-11 precursor (EC 3.4.22.-) (ICH-3 protease) || Number of peptides = 1 || unambiguous || 54.6% Confident
STX5_HUMAN - (Q13190) Syntaxin 5 || Number of peptides = 3 || ambiguous || 54.6% Confident
Q8TAP6 - (Q8TAP6) Hypothetical protein || Number of peptides = 10 || unambiguous || 54.6% Confident
TRFL_MOUSE - (P08071) Lactotransferrin precursor (Lactoferrin) || Number of peptides = 4 || unambiguous || 54.5% Confident
AMYP_MOUSE - (P00688) Alpha-amylase, pancreatic precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) || Number of peptides = 6 || ambiguous || 54.5% Confident
PER3_HUMAN - (P56645) Period circadian protein 3 (hPER3) || Number of peptides = 3 || unambiguous || 54.5% Confident
Q9H9X4 - (Q9H9X4) Hypothetical protein FLJ12489 || Number of peptides = 2 || unambiguous || 54.5% Confident
Q9CUC1 - (Q9CUC1) Adult male testis cDNA, RIKEN full-length enriched library, clone:4933427D11, full insert sequence (Fragment) || Number of peptides = 2 || unambiguous || 54.5% Confident
Q9D5S6 - (Q9D5S6) 4921528I07Rik protein || Number of peptides = 2 || unambiguous || 54.5% Confident
Q9CY99 - (Q9CY99) 2610029D06Rik protein || Number of peptides = 4 || unambiguous || 54.4% Confident
O15153 - (O15153) Sodium bicarbonate cotransporter || Number of peptides = 1 || unambiguous || 54.4% Confident
Q9Y6R7 - (Q9Y6R7) Human Fc gamma BP (Fragment) || Number of peptides = 7 || unambiguous || 54.4% Confident
GAK_HUMAN - (O14976) Cyclin G-associated kinase (EC 2.7.1.-) || Number of peptides = 3 || unambiguous || 54.3% Confident
Q9Y6Z4 - (Q9Y6Z4) HGC6.1.1 protein || Number of peptides = 3 || unambiguous || 54.2% Confident
MM02_MOUSE - (P33434) 72 kDa type IV collagenase precursor (EC 3.4.24.24) (72 kDa gelatinase) (Matrix metalloproteinase-2) (MMP-2) (Gelatinase A) || Number of peptides = 7 || unambiguous || 54.2% Confident
Q9UM03 - (Q9UM03) Protein kinase PKNbeta || Number of peptides = 5 || unambiguous || 54.2% Confident
Q8WV37 - (Q8WV37) Hypothetical protein || Number of peptides = 2 || unambiguous || 54.2% Confident
CGB2_MOUSE - (P30276) G2/mitotic-specific cyclin B2 || Number of peptides = 1 || unambiguous || 54.2% Confident
SM3B_MOUSE - (Q62177) Semaphorin 3B precursor (Semaphorin A) (Sema A) || Number of peptides = 5 || unambiguous || 54.1% Confident
Q9EQ30 - (Q9EQ30) Ran binding protein 5 (Fragment) || Number of peptides = 4 || unambiguous || 54.1% Confident
Q96MR9 - (Q96MR9) Hypothetical protein FLJ31986 || Number of peptides = 9 || unambiguous || 54.1% Confident
Q9Z2S5 - (Q9Z2S5) ELP || Number of peptides = 1 || unambiguous || 54.1% Confident
Q9Y3E8 - (Q9Y3E8) CGI-150 protein || Number of peptides = 3 || unambiguous || 54.0% Confident
Q9P275 - (Q9P275) Hypothetical protein KIAA1453 (Fragment) || Number of peptides = 2 || unambiguous || 53.9% Confident
Q8VI53 - (Q8VI53) Mlx interactor MIR (Fragment) || Number of peptides = 2 || unambiguous || 53.9% Confident
Q13356 - (Q13356) Cyclophilin-like protein CYP-60 || Number of peptides = 4 || ambiguous || 53.9% Confident
Q96KR8 - (Q96KR8) Myosin heavy chain || Number of peptides = 6 || unambiguous || 53.9% Confident
Q9H1V4 - (Q9H1V4) DJ1182A14.3 (Similar to MST1 (Macrophage stimulating 1 (Hepatocyte growth factor-like))) || Number of peptides = 7 || unambiguous || 53.9% Confident
TR85_HUMAN - (Q9Y2L5) TRS85 homolog || Number of peptides = 3 || unambiguous || 53.9% Confident
Q9BTR7 - (Q9BTR7) Hypothetical protein || Number of peptides = 3 || ambiguous || 53.9% Confident
Q8VBT9 - (Q8VBT9) RIKEN cDNA 1190006K01 gene (Similar to alveolar soft part sarcoma chromosome region, candidate 1) || Number of peptides = 4 || unambiguous || 53.8% Confident
OPH1_MOUSE - (Q99J31) Oligophrenin 1 || Number of peptides = 2 || unambiguous || 53.8% Confident
Q99434 - (Q99434) Neuroblastoma (Putative neuroblastoma protein) || Number of peptides = 4 || unambiguous || 53.8% Confident
K1CO_HUMAN - (P19012) Keratin, type I cytoskeletal 15 (Cytokeratin 15) (K15) (CK 15) || Number of peptides = 3 || unambiguous || 53.8% Confident
Q9H9L6 - (Q9H9L6) Hypothetical protein FLJ12668 || Number of peptides = 7 || unambiguous || 53.8% Confident
Q9D5B8 - (Q9D5B8) 4930468A15Rik protein || Number of peptides = 1 || unambiguous || 53.8% Confident
Q9NXV0 - (Q9NXV0) Hypothetical protein FLJ20043 || Number of peptides = 2 || unambiguous || 53.8% Confident
Q9BSQ2 - (Q9BSQ2) Similar to RIKEN cDNA 4632407K17 gene || Number of peptides = 2 || ambiguous || 53.8% Confident
CU05_HUMAN - (Q9Y3R5) Protein C21orf5 || Number of peptides = 8 || unambiguous || 53.8% Confident
Q9D4J6 - (Q9D4J6) 4931428F04Rik protein || Number of peptides = 2 || unambiguous || 53.8% Confident
CFAH_HUMAN - (P08603) Complement factor H precursor (H factor 1) || Number of peptides = 2 || unambiguous || 53.8% Confident
Q9D7E9 - (Q9D7E9) 2310011E08Rik protein || Number of peptides = 1 || unambiguous || 53.7% Confident
SPC3_MOUSE - (Q9D8V7) Microsomal signal peptidase 21 kDa subunit (EC 3.4.-.-) (SPase 21 kDa subunit) (SPC21) || Number of peptides = 1 || ambiguous || 53.7% Confident
AI75_HUMAN - (Q9Y6N9) Autoimmune enteropathy-related antigen AIE-75 (Antigen NY-CO-38/NY-CO-37) (PDZ-73 protein) || Number of peptides = 2 || ambiguous || 53.7% Confident
Q9JME7 - (Q9JME7) mRNA, complete cds, clone:2-6 (1810017G16Rik protein) (RIKEN cDNA 1810017G16 gene) || Number of peptides = 2 || ambiguous || 53.7% Confident
O43168 - (O43168) Hypothetical protein KIAA0443 || Number of peptides = 6 || unambiguous || 53.7% Confident
Q9DCT9 - (Q9DCT9) 0610010I20Rik protein || Number of peptides = 3 || ambiguous || 53.6% Confident
Q96KG3 - (Q96KG3) AKAP350C (Fragment) || Number of peptides = 1 || unambiguous || 53.5% Confident
IKKA_MOUSE - (Q60680) Inhibitor of nuclear factor kappa-B kinase alpha subunit (EC 2.7.1.-) (I kappa-B kinase alpha) (IkBKA) (IKK-alpha) (IKK-A) (IkappaB kinase) (I-kappa-B kinase 1) (IKK1) (Conserved helix-loop-helix ubiquitous kinase) (Nuclear factor NFkappaB inhibitor kinase alpha) (NFKBIKA) || Number of peptides = 5 || unambiguous || 53.5% Confident
Q96DL6 - (Q96DL6) Hypothetical protein FLJ32794 || Number of peptides = 5 || unambiguous || 53.5% Confident
E2K1_MOUSE - (Q9Z2R9) Eukaryotic translation initiation factor 2 alpha kinase 1 (EC 2.7.1.-) (Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase) (Heme-regulated inhibitor) (HRI) (Heme-controlled repressor) (HCR) (Hemin-sensitive initiation factor-2 alpha kinase) || Number of peptides = 4 || unambiguous || 53.5% Confident
Q8VIM6 - (Q8VIM6) Stereocilin || Number of peptides = 7 || unambiguous || 53.5% Confident
Q9H0G7 - (Q9H0G7) Hypothetical protein || Number of peptides = 10 || unambiguous || 53.4% Confident
O43199 - (O43199) Deleted in liver cancer-1 || Number of peptides = 6 || ambiguous || 53.3% Confident
SKD1_MOUSE - (P46467) SKD1 protein (Vacuolar sorting protein 4b) || Number of peptides = 1 || ambiguous || 53.3% Confident
Q96MM1 - (Q96MM1) Hypothetical protein FLJ32169 || Number of peptides = 3 || unambiguous || 53.3% Confident
Q96S08 - (Q96S08) Some homology with holliday junction DNA helicase RUVB like || Number of peptides = 8 || unambiguous || 53.3% Confident
Q9Z1K3 - (Q9Z1K3) Multiple PDZ domain protein || Number of peptides = 9 || unambiguous || 53.3% Confident
UBP7_HUMAN - (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15) (Ubiquitin thiolesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus associated ubiquitin-specific protease) || Number of peptides = 7 || unambiguous || 53.3% Confident
Q9P1P1 - (Q9P1P1) PRO0398 || Number of peptides = 4 || unambiguous || 53.3% Confident
Q9R0P2 - (Q9R0P2) KIAA312p (Fragment) || Number of peptides = 3 || ambiguous || 53.3% Confident
LEG4_HUMAN - (P56470) Galectin-4 (Lactose-binding lectin 4) (L-36 lactose binding protein) (L36LBP) (Antigen NY-CO-27) || Number of peptides = 3 || unambiguous || 53.3% Confident
Q9H5M7 - (Q9H5M7) Hypothetical protein FLJ23293 || Number of peptides = 1 || unambiguous || 53.3% Confident
Q924I1 - (Q924I1) Matrix extracellular phosphoglycoprotein precursor || Number of peptides = 2 || unambiguous || 53.3% Confident
FL3L_HUMAN - (P49771) SL cytokine precursor (Fms-related tyrosine kinase 3 ligand) (Flt3 ligand) (Flt3L) || Number of peptides = 2 || unambiguous || 53.3% Confident
Q9D7V4 - (Q9D7V4) 2210401K11Rik protein || Number of peptides = 1 || ambiguous || 53.2% Confident
O95813 - (O95813) Cerberus-related protein (Cerberus-related 1) || Number of peptides = 2 || unambiguous || 53.2% Confident
Q9JI47 - (Q9JI47) Erbb2-interacting protein ERBIN (Fragment) || Number of peptides = 2 || unambiguous || 53.1% Confident
Q9GZU2 - (Q9GZU2) Paternally expressed gene 3 isoform 1 (Kruppel-type zinc finger protein) || Number of peptides = 4 || unambiguous || 53.1% Confident
Q9D4Z3 - (Q9D4Z3) 4930535B06Rik protein || Number of peptides = 1 || unambiguous || 53.1% Confident
Q9H9J3 - (Q9H9J3) Hypothetical protein FLJ12700 || Number of peptides = 1 || unambiguous || 53.1% Confident
CAG2_MOUSE - (Q09200) Beta-1,4 N-acetylgalactosaminyltransferase (EC 2.4.1.92) ((N-acetylneuraminyl)-galactosylglucosylceramide) (GM2/GD2 synthase) (GalNAc-T) || Number of peptides = 13 || unambiguous || 53.0% Confident
ITAM_MOUSE - (P05555) Integrin alpha-M precursor (Cell surface glycoprotein MAC-1 alpha subunit) (CR-3 alpha chain) (CD11b) (Leukocyte adhesion receptor MO1) || Number of peptides = 13 || unambiguous || 53.0% Confident
Q9CTE8 - (Q9CTE8) 1500026A19Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 53.0% Confident
RFX3_MOUSE - (P48381) DNA-binding protein RFX3 (Fragment) || Number of peptides = 2 || ambiguous || 53.0% Confident
DBS_HUMAN - (O15068) Guanine nucleotide exchange factor DBS (DBL's big sister) (MCF2 transforming sequence-like protein) (Fragment) || Number of peptides = 5 || unambiguous || 53.0% Confident
Q9CTY8 - (Q9CTY8) 2310047I15Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 53.0% Confident
CANS_MOUSE - (O88456) Calcium-dependent protease, small subunit (Calpain regulatory subunit) (Calcium-activated neutral proteinase) (CANP) || Number of peptides = 3 || unambiguous || 52.8% Confident
Q9DAB4 - (Q9DAB4) 1700015E05Rik protein || Number of peptides = 1 || ambiguous || 52.8% Confident
Q8VG71 - (Q8VG71) Olfactory receptor MOR165-5 || Number of peptides = 5 || unambiguous || 52.8% Confident
O75167 - (O75167) Hypothetical protein KIAA0680 || Number of peptides = 4 || unambiguous || 52.8% Confident
Q9BW04 - (Q9BW04) Hypothetical protein || Number of peptides = 4 || unambiguous || 52.8% Confident
Q8WYU4 - (Q8WYU4) Hypothetical protein || Number of peptides = 3 || unambiguous || 52.8% Confident
Q9HBQ9 - (Q9HBQ9) Hypothetical protein || Number of peptides = 2 || unambiguous || 52.8% Confident
NEST_HUMAN - (P48681) Nestin || Number of peptides = 6 || unambiguous || 52.7% Confident
Q9ULI6 - (Q9ULI6) Hypothetical protein KIAA1234 (Fragment) || Number of peptides = 6 || unambiguous || 52.7% Confident
Q9Y4A3 - (Q9Y4A3) R33590_1 || Number of peptides = 2 || unambiguous || 52.7% Confident
Q14114 - (Q14114) Apolipoprotein E receptor 2 precursor || Number of peptides = 1 || unambiguous || 52.7% Confident
O70365 - (O70365) Golgi autoantigen golgin subtype a4 || Number of peptides = 2 || unambiguous || 52.7% Confident
SGCA_MOUSE - (P82350) Alpha-sarcoglycan precursor (Alpha-SG) (Adhalin) (50 kDa dystrophin-associated glycoprotein) (50DAG) || Number of peptides = 4 || unambiguous || 52.6% Confident
PTPM_MOUSE - (P28828) Protein-tyrosine phosphatase MU precursor (EC 3.1.3.48) (R-PTP-MU) || Number of peptides = 6 || unambiguous || 52.5% Confident
MCT2_MOUSE - (P15119) Mast cell protease 2 precursor (EC 3.4.21.-) (MMCP-2) || Number of peptides = 3 || unambiguous || 52.5% Confident
Q8VCN9 - (Q8VCN9) Similar to tubulin-specific chaperone c || Number of peptides = 2 || unambiguous || 52.5% Confident
CIW6_HUMAN - (Q9Y257) Potassium channel subfamily K member 6 (Inward rectifying potassium channel protein TWIK-2) (TWIK-originated similarity sequence) || Number of peptides = 2 || unambiguous || 52.5% Confident
Q9UJX5 - (Q9UJX5) Anaphase-promoting complex subunit 4 || Number of peptides = 2 || unambiguous || 52.5% Confident
Q9H462 - (Q9H462) BA416N2.2 (Similar to murine FISH (An SH3 and PX domain-containing protein, and Src substrate)) (Fragment) || Number of peptides = 3 || ambiguous || 52.5% Confident
Q9H501 - (Q9H501) BA526K24.1 (Novel protein) || Number of peptides = 2 || unambiguous || 52.5% Confident
Q9P1Y6 - (Q9P1Y6) Hypothetical protein KIAA1542 (Fragment) || Number of peptides = 12 || unambiguous || 52.5% Confident
P11G_MOUSE - (Q9JHG7) Phosphatidylinositol 3-kinase catalytic subunit, gamma isoform (EC 2.7.1.137) (PI3-kinase p110 subunit gamma) (PtdIns-3-kinase p110) (PI3K) (PI3Kgamma) || Number of peptides = 5 || unambiguous || 52.5% Confident
Q9QZR9 - (Q9QZR9) Alpha 4 collagen IV || Number of peptides = 8 || unambiguous || 52.5% Confident
Q9WVG9 - (Q9WVG9) Male-specific lethal-3 homolog 1 (Drosophila) || Number of peptides = 4 || unambiguous || 52.5% Confident
O60280 - (O60280) Hypothetical protein KIAA0528 (Fragment) || Number of peptides = 11 || unambiguous || 52.5% Confident
P97358 - (P97358) TAFI68 || Number of peptides = 3 || unambiguous || 52.4% Confident
O95381 - (O95381) Connector enhancer of KSR-like protein CNK1 || Number of peptides = 5 || unambiguous || 52.4% Confident
Q99PK2 - (Q99PK2) Ubiquitin-protein ligase Nedd4-2 || Number of peptides = 5 || unambiguous || 52.4% Confident
Q9BTJ1 - (Q9BTJ1) Ribosomal protein S27 || Number of peptides = 14 || unambiguous || 52.3% Confident
Q9HAW4 - (Q9HAW4) Hu-Claspin || Number of peptides = 4 || unambiguous || 52.3% Confident
HEY1_HUMAN - (Q9Y5J3) Hairy/enhancer-of-split related with YRPW motif 1 (Hairy and enhancer of split related-1) (HESR-1) (Cardiovascular helix-loop-helix factor 2) (HES-related repressor protein 2 HERP2) || Number of peptides = 1 || unambiguous || 52.3% Confident
K1CL_HUMAN - (Q99456) Keratin, type I cytoskeletal 12 (Cytokeratin 12) || Number of peptides = 5 || unambiguous || 52.3% Confident
Q9QUS3 - (Q9QUS3) BAMACAN || Number of peptides = 5 || ambiguous || 52.3% Confident
SPBP_MOUSE - (P15501) Prostatic spermine-binding protein precursor (SBP) (Major prostatic secretory glycoprotein) (P25) || Number of peptides = 4 || unambiguous || 52.2% Confident
ERR1_HUMAN - (P11474) Steroid hormone receptor ERR1 (Estrogen-related receptor, alpha) (ERR-alpha) (Estrogen receptor-like 1) || Number of peptides = 2 || unambiguous || 52.2% Confident
Q9DAE0 - (Q9DAE0) 1700012K17Rik protein (Attaches to Cre) || Number of peptides = 1 || ambiguous || 52.2% Confident
BSS4_HUMAN - (Q9GZN4) Brain-specific serine protease 4 precursor (EC 3.4.21.-) (BSSP-4) (SP001LA) || Number of peptides = 6 || unambiguous || 52.1% Confident
Q9H6Y2 - (Q9H6Y2) Hypothetical protein FLJ21702 || Number of peptides = 1 || ambiguous || 52.0% Confident
Q01078 - (Q01078) Protein PC326 || Number of peptides = 2 || unambiguous || 52.0% Confident
Q9H4F3 - (Q9H4F3) 28kD interferon responsive protein || Number of peptides = 3 || ambiguous || 52.0% Confident
Q9NPM3 - (Q9NPM3) Hypothetical protein (Fragment) || Number of peptides = 8 || unambiguous || 52.0% Confident
Q9DAF7 - (Q9DAF7) 1700011M07Rik protein || Number of peptides = 1 || ambiguous || 52.0% Confident
WDR6_HUMAN - (Q9NNW5) WD-repeat protein 6 || Number of peptides = 6 || unambiguous || 51.9% Confident
CA28_MOUSE - (P25318) Collagen alpha 2(VIII) chain (Endothelial collagen) (Fragment) || Number of peptides = 1 || unambiguous || 51.9% Confident
NICA_MOUSE - (P57716) Nicastrin precursor || Number of peptides = 6 || unambiguous || 51.9% Confident
CLAT_HUMAN - (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase) (Choline acetylase) (ChAT) || Number of peptides = 2 || unambiguous || 51.9% Confident
Q92624 - (Q92624) Hypothetical protein KIAA0228 (Fragment) || Number of peptides = 1 || unambiguous || 51.9% Confident
CAS2_MOUSE - (P02664) Epsilon casein precursor || Number of peptides = 2 || unambiguous || 51.9% Confident
CIK4_MOUSE - (Q61423) Voltage-gated potassium channel protein Kv1.4 || Number of peptides = 4 || ambiguous || 51.8% Confident
Q96NB7 - (Q96NB7) Hypothetical protein FLJ31132 || Number of peptides = 1 || unambiguous || 51.7% Confident
MYH3_HUMAN - (P11055) Myosin heavy chain, fast skeletal muscle, embryonic (Muscle embryonic myosin heavy chain) (SMHCE) || Number of peptides = 3 || unambiguous || 51.7% Confident
Q9BYK8 - (Q9BYK8) DJ697K14.6 (Novel protein, KIAA1769) || Number of peptides = 7 || unambiguous || 51.7% Confident
Q8TEH9 - (Q8TEH9) FLJ00218 protein (Fragment) || Number of peptides = 2 || unambiguous || 51.7% Confident
AD20_HUMAN - (O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 20) || Number of peptides = 3 || unambiguous || 51.7% Confident
ORP8_HUMAN - (Q9BZF1) Oxysterol binding protein-related protein 8 (OSBP-related protein 8) (ORP-8) || Number of peptides = 2 || unambiguous || 51.7% Confident
Q96IF8 - (Q96IF8) Hypothetical protein (Fragment) || Number of peptides = 3 || unambiguous || 51.7% Confident
KLKF_HUMAN - (Q9H2R5) Kallikrein 15 precursor (EC 3.4.21.-) (ACO protease) || Number of peptides = 1 || unambiguous || 51.7% Confident
Q8R5C9 - (Q8R5C9) Hypothetical 91.5 kDa protein (Fragment) || Number of peptides = 4 || unambiguous || 51.7% Confident
Q9UND2 - (Q9UND2) Homeobox protein DUX3 || Number of peptides = 3 || ambiguous || 51.7% Confident
UTY_MOUSE - (P79457) Ubiquitously transcribed Y chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein ON the Y chromosome) (Male-specific histocompatibility antigen H-YDB) || Number of peptides = 6 || unambiguous || 51.7% Confident
LYOX_MOUSE - (P28301) Protein-lysine 6-oxidase precursor (EC 1.4.3.13) (Lysyl oxidase) (RAS excision protein) || Number of peptides = 4 || unambiguous || 51.6% Confident
Q91W48 - (Q91W48) Archain 1 || Number of peptides = 2 || ambiguous || 51.6% Confident
Q8R3S9 - (Q8R3S9) Hypothetical 58.4 kDa protein (Fragment) || Number of peptides = 3 || ambiguous || 51.6% Confident
IQG2_HUMAN - (Q13576) Ras GTPase-activating-like protein IQGAP2 || Number of peptides = 4 || unambiguous || 51.6% Confident
Q9NSP4 - (Q9NSP4) Hypothetical protein || Number of peptides = 2 || unambiguous || 51.6% Confident
Q9D5C0 - (Q9D5C0) 4930467E23Rik protein || Number of peptides = 1 || unambiguous || 51.5% Confident
DM3L_HUMAN - (Q9UJW3) DNA (cytosine-5)-methyltransferase 3-like || Number of peptides = 4 || unambiguous || 51.5% Confident
O75497 - (O75497) Cell cycle-regulated factor p78 || Number of peptides = 1 || unambiguous || 51.5% Confident
IL6B_MOUSE - (Q00560) Interleukin-6 receptor beta chain precursor (IL-6R-beta) (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (GP130) || Number of peptides = 7 || unambiguous || 51.5% Confident
M3K2_HUMAN - (Q9Y2U5) Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.1.-) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2) || Number of peptides = 5 || unambiguous || 51.5% Confident
Q9ULW4 - (Q9ULW4) RIE2 sid2705 (Hypothetical protein) || Number of peptides = 1 || unambiguous || 51.5% Confident
Q9CQ76 - (Q9CQ76) 5730521E12Rik protein || Number of peptides = 2 || unambiguous || 51.5% Confident
PSPB_MOUSE - (P50405) Pulmonary surfactant-associated protein B precursor (SP-B) (Pulmonary surfactant-associated proteolipid SPL(Phe)) || Number of peptides = 1 || unambiguous || 51.4% Confident
Q9Y5A0 - (Q9Y5A0) NY-REN-37 antigen (Fragment) || Number of peptides = 3 || ambiguous || 51.4% Confident
Q9HCH0 - (Q9HCH0) Hypothetical protein KIAA1602 (Fragment) || Number of peptides = 5 || unambiguous || 51.4% Confident
Q9H6L2 - (Q9H6L2) Hypothetical protein FLJ22167 || Number of peptides = 5 || unambiguous || 51.4% Confident
PSA3_MOUSE - (O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) || Number of peptides = 2 || ambiguous || 51.4% Confident
Y539_HUMAN - (O60287) Hypothetical protein KIAA0539 (Fragment) || Number of peptides = 7 || unambiguous || 51.4% Confident
CP8B_HUMAN - (Q9UNU6) Cytochrome P450 8B1 (EC 1.14.-.-) (CYPVIIIB1) (Sterol 12-alpha-hydroxylase) (7 alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase) || Number of peptides = 6 || unambiguous || 51.3% Confident
Q8WZ42 - (Q8WZ42) Titin || Number of peptides = 109 || unambiguous || 51.3% Confident
Q9H9V5 - (Q9H9V5) Hypothetical protein FLJ12525 || Number of peptides = 2 || unambiguous || 51.2% Confident
Q96CR1 - (Q96CR1) Hypothetical protein || Number of peptides = 3 || unambiguous || 51.1% Confident
Q9UHJ1 - (Q9UHJ1) Cytochrome b5 reductase 1 || Number of peptides = 1 || ambiguous || 51.1% Confident
MM15_HUMAN - (P51511) Matrix metalloproteinase-15 precursor (EC 3.4.24.-) (MMP-15) (Membrane-type matrix metalloproteinase 2) (MT-MMP 2) (MTMMP2) (Membrane-type-2 matrix metalloproteinase) (MT2-MMP) (MT2MMP) (SMCP-2) || Number of peptides = 1 || unambiguous || 51.1% Confident
Q61830 - (Q61830) Macrophage mannose receptor precursor || Number of peptides = 7 || unambiguous || 51.0% Confident
Q9H2Q8 - (Q9H2Q8) GREB1a (Fragment) || Number of peptides = 5 || unambiguous || 51.0% Confident
Q9BSS3 - (Q9BSS3) Hypothetical protein || Number of peptides = 3 || unambiguous || 51.0% Confident
MOT4_HUMAN - (O15427) Monocarboxylate transporter 4 (MCT 4) (MCT 3) || Number of peptides = 2 || unambiguous || 51.0% Confident
Q9CPV6 - (Q9CPV6) 2310007G06Rik protein || Number of peptides = 2 || unambiguous || 51.0% Confident
ITAH_HUMAN - (Q9UKX5) Integrin alpha-11 precursor || Number of peptides = 8 || unambiguous || 51.0% Confident
Q99LE6 - (Q99LE6) Similar to ATP-binding cassette, sub-family F (GCN20), member 2 || Number of peptides = 2 || ambiguous || 51.0% Confident
O60346 - (O60346) Hypothetical protein KIAA0606 (Fragment) || Number of peptides = 4 || unambiguous || 51.0% Confident
Q9WVS3 - (Q9WVS3) Sif and Tiam1-like exchange factor || Number of peptides = 6 || unambiguous || 51.0% Confident
Q9HCD3 - (Q9HCD3) Hypothetical protein KIAA1639 (Fragment) || Number of peptides = 4 || unambiguous || 51.0% Confident
Q8R0C7 - (Q8R0C7) Similar to hypothetical protein FLJ10900 (Fragment) || Number of peptides = 1 || unambiguous || 51.0% Confident
SPCP_HUMAN - (O15020) Spectrin beta chain, brain 2 (Spectrin, non-erythroid beta chain 2) (Beta-III spectrin) || Number of peptides = 9 || unambiguous || 50.9% Confident
K1CS_MOUSE - (P19001) Keratin, type I cytoskeletal 19 (Cytokeratin 19) (K19) (CK 19) || Number of peptides = 4 || unambiguous || 50.9% Confident
Q8WWW8 - (Q8WWW8) GAB3 || Number of peptides = 2 || unambiguous || 50.9% Confident
Q9D0A9 - (Q9D0A9) 2610030F17Rik protein || Number of peptides = 1 || ambiguous || 50.9% Confident
MY15_HUMAN - (Q9UKN7) Myosin XV (Unconventional myosin-15) || Number of peptides = 10 || unambiguous || 50.9% Confident
LAD1_HUMAN - (O00515) Ladinin 1 (Lad-1) (120 kDa linear IgA bullous dermatosis antigen) (97 kDa linear IgA bullous dermatosis antigen) (Linear IgA disease antigen homolog) (LadA) || Number of peptides = 6 || unambiguous || 50.9% Confident
CU56_MOUSE - (Q9D9W0) Putative protein C21orf56 homolog || Number of peptides = 4 || unambiguous || 50.9% Confident
Q9EQ17 - (Q9EQ17) Tyrosine phosphatase LAR || Number of peptides = 3 || ambiguous || 50.8% Confident
Q91YW8 - (Q91YW8) Hypothetical 77.8 kDa protein || Number of peptides = 3 || ambiguous || 50.8% Confident
Q96MZ3 - (Q96MZ3) Hypothetical protein FLJ31668 || Number of peptides = 2 || unambiguous || 50.8% Confident
HD_HUMAN - (P42858) Huntingtin (Huntington's disease protein) (HD protein) || Number of peptides = 10 || unambiguous || 50.7% Confident
ATPJ_HUMAN - (P56385) ATP synthase e chain, mitochondrial (EC 3.6.3.14) || Number of peptides = 2 || unambiguous || 50.7% Confident
Q9NVM6 - (Q9NVM6) Hypothetical protein FLJ10634 || Number of peptides = 3 || unambiguous || 50.7% Confident
Q9Y408 - (Q9Y408) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 50.7% Confident
NUD6_HUMAN - (P53370) Nucleoside diphosphate-linked moiety X motif 6 (Protein GFG) (GFG-1) (Antisense basic fibroblast growth factor) || Number of peptides = 3 || unambiguous || 50.7% Confident
Q9BQU8 - (Q9BQU8) BA261N11.2.1 (Novel protein, isoform 1) || Number of peptides = 1 || unambiguous || 50.7% Confident
CR2_HUMAN - (P20023) Complement receptor type 2 precursor (Cr2) (Complement C3d receptor) (Epstein-Barr virus receptor) (EBV receptor) (CD21 antigen) || Number of peptides = 3 || unambiguous || 50.6% Confident
ARI1_HUMAN - (Q9Y4X5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein) (HHARI) (H7-AP2) (HUSSY-27) (MOP-6) || Number of peptides = 5 || unambiguous || 50.5% Confident
O54978 - (O54978) Zinc finger protein || Number of peptides = 6 || ambiguous || 50.4% Confident
KNG_MOUSE - (O08677) Kininogen precursor [Contains: Bradykinin] || Number of peptides = 3 || unambiguous || 50.3% Confident
ABC1_HUMAN - (O95477) ATP-binding cassette, sub-family A, member 1 (ATP-binding cassette transporter 1) (ATP-binding cassette 1) (ABC-1) (Cholesterol efflux regulatory protein) || Number of peptides = 4 || unambiguous || 50.3% Confident
Q92918 - (Q92918) Hematopoietic progenitor kinase || Number of peptides = 4 || unambiguous || 50.3% Confident
Q9H7S9 - (Q9H7S9) Hypothetical protein FLJ14299 || Number of peptides = 4 || unambiguous || 50.3% Confident
O35243 - (O35243) Antigen containing epitope to monoclonal antibody MMS-85/12 (Fragment) || Number of peptides = 8 || unambiguous || 50.2% Confident
Q9CVS8 - (Q9CVS8) 2810002D23Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 50.2% Confident
Q99JS9 - (Q99JS9) Similar to hypothetical protein MGC2744 || Number of peptides = 2 || unambiguous || 50.2% Confident
Q8VEK7 - (Q8VEK7) Hypothetical 27.3 kDa protein || Number of peptides = 4 || ambiguous || 50.2% Confident
ACHE_HUMAN - (Q04844) Acetylcholine receptor protein, epsilon chain precursor || Number of peptides = 4 || unambiguous || 50.2% Confident
LOXR_MOUSE - (O70582) Arachidonate 12-lipoxygenase, 12R type (EC 1.13.11.-) (Epidermis-type lipoxygenase 12) (12R-lipoxygenase) || Number of peptides = 3 || unambiguous || 50.2% Confident
Q9D6U9 - (Q9D6U9) 2310051N18Rik protein || Number of peptides = 2 || unambiguous || 50.1% Confident
Q9CUG8 - (Q9CUG8) 4930557B21Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 50.1% Confident
ACRO_HUMAN - (P10323) Acrosin precursor (EC 3.4.21.10) || Number of peptides = 4 || unambiguous || 50.1% Confident
Q9CS17 - (Q9CS17) 5730502P04Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 50.1% Confident
Q9D3Q4 - (Q9D3Q4) 5033428A16Rik protein || Number of peptides = 1 || unambiguous || 50.1% Confident
Q8WUC7 - (Q8WUC7) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 50.1% Confident
Q8TC85 - (Q8TC85) Similar to RIKEN cDNA 4930453N24 gene || Number of peptides = 2 || unambiguous || 50.0% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/data/search/2002-TK-LungDevo/lung_NMyc_cyto_3
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
USERA_MOUSE99.6%357.4%485514496.9(Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) 
	TK120303_NMyc_cyto3_step08.2548.2548.2	1.5051	0.1615	1800.26	8	3440.0%	1	R.VVNCARGGIVDEGALLR.A
	TK120303_NMyc_cyto3_step04.2146.2146.2	3.9162	0.5053	2049.69	1	5560.0%	2	R.ALVDHENVISCPHLGASTK.E
UQ9CY4099.6%122388456.6%122131848.8(Q9CY40) Hemoglobin, beta adult major chain 
*	TK120303_NMyc_cyto3_step05.3039.3039.2	1.4631	0.0386	2488.45	214	1500.0%	1	-.MVLNMELKPWKGCFASFPTTK.T
*	TK120303_NMyc_cyto3_step07.2751.2751.3	1.9295	0.0651	2919.56	1	1900.0%	1	K.GCFASFPTTKTYFPHFDVSHGSAQVK.G
	TK120303_NMyc_cyto3_step10.3974.3974.3	5.2805	0.5644	2996.14	1	3100.0%	31	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK120303_NMyc_cyto3_step01.3788.3788.3	1.779	0.0416	3134.11	5	1750.0%	1	K.VADALANAAGHLDDLPGALSALSDLHAHKLR.V
	TK120303_NMyc_cyto3_step02.3421.3421.2	3.3792	0.3592	2868.02	1	3390.0%	42	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UHBA_HUMAN99.6%61257.4%141151268.7(P01922) Hemoglobin alpha chain 
*	TK120303_NMyc_cyto3_step07.3271.3271.3	1.8865	0.078	2999.52	1	2050.0%	1	K.VADALTNAVAHVDDMPNALSALSDLHAHK.L
*	TK120303_NMyc_cyto3_step12.3118.3118.2	1.318	0.1747	3026.23	2	1670.0%	1	K.LLSHCLLVTLAAHLPAEFTPAVHASLDK.F
*	TK120303_NMyc_cyto3_step02.1597.1597.1	2.6741	0.0561	1531.74	2	5710.0%	3	K.VGAHAGEYGAEALER.M
*	TK120303_NMyc_cyto3_step01.2071.2071.1	0.9364	0.0316	1074.57	59	3750.0%	1	R.MFLSFPTTK.T
UCABA_MOUSE99.6%5714.7%285308317.9(Q99020) CARG-binding factor-A (CBF-A) 
*	TK120303_NMyc_cyto3_step03.3458.3458.2	3.5208	0.4087	2198.1	1	5280.0%	1	R.EYFGQFGEIEAIELPIDPK.L
	TK120303_NMyc_cyto3_step01.1991.1991.1	2.5356	0.4384	1504.59	1	5380.0%	1	K.IFVGGLNPEATEEK.I
	TK120303_NMyc_cyto3_step10.1147.1147.1	2.346	0.3512	992.54	1	7500.0%	2	K.KFHTVSGSK.C
	TK120303_NMyc_cyto3_step04.1282.1282.1	1.889	0.3981	862.51	1	7860.0%	1	K.FHTVSGSK.C
UTGM2_MOUSE99.6%4413.8%686770465.1(P21981) Protein-glutamine gamma-glutamyltransferase (EC 2.3.2.13) (Tissue transglutaminase) (TGase C) (TGC) (TG(C)) (Tranglutaminase 2) 
	TK120303_NMyc_cyto3_step02.3079.3079.2	3.658	0.4286	2498.72	1	4750.0%	1	R.VVTNYNSAHDQNSNLLIEYFR.N
	TK120303_NMyc_cyto3_step05.2840.2840.3	2.3807	0.2057	3643.94	165	1080.0%	1	R.VVTNYNSAHDQNSNLLIEYFRNEFGELESNK.S
	TK120303_NMyc_cyto3_step02.4285.4285.3	2.1669	0.1364	4625.46	10	1040.0%	1	K.ARFSLSDNVEEGSWSASVLDQQDNVLSLQLCTPANAPIGLYR.L
	TK120303_NMyc_cyto3_step12.1283.1283.2	1.0298	0.0054	2477.98	7	2620.0%	1	R.WDNNYGDGISPMAWIGSVDILR.R
URHOA_MOUSE99.6%41019.7%193217826.1(Q9QUI0) Transforming protein RhoA 
	TK120303_NMyc_cyto3_step01.4386.4386.2	2.3871	0.1523	2776.37	2	2610.0%	1	K.DQFPEVYVPTVFENYVADIEVDGK.Q
	TK120303_NMyc_cyto3_step10.2417.2417.2	4.0859	0.584	1608.77	1	8460.0%	3	K.HFCPNVPIILVGNK.K
UTBA1_HUMAN99.6%4627844.8%451501525.1(P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) 
	TK120303_NMyc_cyto3_step02.2779.2779.2	4.7783	0.6037	2753.87	1	4780.0%	2	K.AYHEQLSVAEITNACFEPANQMVK.C
	TK120303_NMyc_cyto3_step03.4260.4260.1	1.5936	0.0617	1411.92	1	5000.0%	2	R.QLFHPEQLITGK.E
	TK120303_NMyc_cyto3_step01.2927.2927.1	1.9352	0.2545	1586.65	1	4580.0%	2	R.SIQFVDWCPTGFK.V
	TK120303_NMyc_cyto3_step01.1378.1378.1	0.9419	0.069	781.4	10	5830.0%	1	R.LSVDYGK.K
	TK120303_NMyc_cyto3_step06.2923.2923.2	3.1824	0.5815	1758.48	1	5670.0%	8	R.IHFPLATYAPVISAEK.A
	TK120303_NMyc_cyto3_step01.3552.3552.2	2.7994	0.5069	2413.61	1	3500.0%	4	R.FDGALNVDLTEFQTNLVPYPR.I
	TK120303_NMyc_cyto3_step01.2879.2879.1	1.3064	0.2582	1086.85	4	5620.0%	1	K.EIIDLVLDR.I
	TK120303_NMyc_cyto3_step01.3994.3994.2	0.9557	0.0495	2210.78	3	2500.0%	1	K.VGINYQPPTVVPGGDLAKVQR.A
	TK120303_NMyc_cyto3_step06.3220.3220.3	2.6026	0.1684	4301.3	1	1620.0%	3	R.ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDK.T
	TK120303_NMyc_cyto3_step03.3028.3028.2	4.5987	0.6166	2333.83	1	6320.0%	12	R.AFVHWYVGEGMEEGEFSEAR.E
	TK120303_NMyc_cyto3_step04.1376.1376.1	1.3487	0.2424	777.48	1	5830.0%	3	R.GHYTIGK.E
	TK120303_NMyc_cyto3_step01.1655.1655.1	1.2417	0.089	1017.77	4	5000.0%	1	K.DVNAAIATIK.T
	TK120303_NMyc_cyto3_step06.1077.1077.1	0.9291	0.2808	508.52	2	6670.0%	4	K.HVPR.A
UQ91Y3799.6%71121.5%623695665.6(Q91Y37) Cytosolic aminopeptidase P 
*	TK120303_NMyc_cyto3_step11.1211.1211.1	1.8005	0.263	1046.55	17	4440.0%	2	R.SAGHHLVPVK.E
	TK120303_NMyc_cyto3_step09.3261.3261.3	5.7726	0.6441	3634.98	1	2650.0%	2	R.SALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYK.T
	TK120303_NMyc_cyto3_step05.3136.3136.3	2.5536	0.2711	3701.62	1	1440.0%	1	R.RQQADFVDLSFPTISSTGPNGAIIHYAPVPETNR.T
*	TK120303_NMyc_cyto3_step11.2834.2834.3	2.0253	0.1328	4045.19	36	1180.0%	1	R.QAMRNSEYVAEPIQAYIIPSGDAHQSEYIAPCDCR.R
*	TK120303_NMyc_cyto3_step10.3836.3836.3	1.5565	0.0072	2339.58	29	2000.0%	1	R.VDAPGVKQHLLLDLGLEAEYR.I
UQ9Z1F999.6%6619.6%638705695.2(Q9Z1F9) ARX 
*	TK120303_NMyc_cyto3_step05.3147.3147.3	4.8664	0.674	3587.15	1	2590.0%	1	K.ESVLQFHPQANIEAHHDSIMNPDYNVEFFR.Q
	TK120303_NMyc_cyto3_step02.0767.0767.2	1.1569	0.2024	2800.59	15	1670.0%	1	K.NLVLTGFSHIDLIDLDTIDVSNLNR.Q
*	TK120303_NMyc_cyto3_step11.2255.2255.3	4.1472	0.586	3444.7	1	2500.0%	1	K.RKPPVPLDWAEVQSQGEANADQQNEPQLGLK.D
	TK120303_NMyc_cyto3_step03.4247.4247.2	2.0278	0.1227	2778.21	1	2610.0%	1	R.LQADDFLQDYTLLINILHSEDLGK.D
	TK120303_NMyc_cyto3_step07.2300.2300.2	1.4651	0.1686	1730.17	34	2860.0%	1	R.QFILVMNALDNRAAR.N
UIRE1_MOUSE99.6%559.1%889981407.5(P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) 
	TK120303_NMyc_cyto3_step09.2967.2967.2	1.8175	0.1071	2091.64	60	2220.0%	1	R.IIPPGSGIIHQVNLEYLAR.V
	TK120303_NMyc_cyto3_step03.2608.2608.2	3.995	0.6104	1776.36	1	5940.0%	1	K.NPFAHLAEPLDAAQPGK.R
	TK120303_NMyc_cyto3_step01.0846.0846.1	1.2408	0.0303	488.43	25	6670.0%	1	R.LLNK.F
	TK120303_NMyc_cyto3_step01.2970.2970.1	2.2244	0.2487	1472.72	1	5000.0%	1	R.YQQAGLPLIVLAGK.E
	TK120303_NMyc_cyto3_step01.3920.3920.2	2.8483	0.5299	2763.11	1	2690.0%	1	R.SNLVGMGVIPLEYLPGETADSLGLTGR.E
UENOB_HUMAN99.6%116.9%433468567.7(P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) 
*	TK120303_NMyc_cyto3_step04.4273.4273.3	3.5164	0.0029	3025.82	2	2500.0%	1	R.HIADLAGNPDLILPVPAFNVINGGSHAGNK.L
UIF5A_HUMAN99.6%196560.8%153167015.2(P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) 
	TK120303_NMyc_cyto3_step01.1804.1804.1	1.5553	0.1348	777.67	2	7500.0%	1	K.NGFVVLK.G
	TK120303_NMyc_cyto3_step09.3663.3663.2	4.9359	0.4518	2628.68	1	4350.0%	6	K.YDCGEEILITVLSAMTEEAAVAIK.A
	TK120303_NMyc_cyto3_step03.3135.3135.1	3.543	0.6064	1301.66	1	7270.0%	2	K.VHLVGIDIFTGK.K
	TK120303_NMyc_cyto3_step01.4274.4274.2	3.1026	0.5224	2584.42	1	4090.0%	3	R.NDFQLIGIQDGYLSLLQDSGEVR.E
	TK120303_NMyc_cyto3_step02.3556.3556.2	3.0816	0.3915	2737.74	1	3040.0%	1	K.RNDFQLIGIQDGYLSLLQDSGEVR.E
	TK120303_NMyc_cyto3_step01.0456.0456.1	1.0702	0.167	895.26	1	6430.0%	1	K.IVEMSTSK.T
	TK120303_NMyc_cyto3_step02.2065.2065.2	3.4033	0.5015	2164.93	1	5590.0%	3	K.KYEDICPSTHNMDVPNIK.R
UGTP1_MOUSE99.6%61018.7%209234067.8(P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) 
	TK120303_NMyc_cyto3_step04.2024.2024.2	2.3528	0.227	1939.03	2	3820.0%	1	K.AFLSSPEHVNRPINGNGK.Q
	TK120303_NMyc_cyto3_step03.4090.4090.3	1.2057	0.0256	2069.28	17	2080.0%	1	K.AFLSSPEHVNRPINGNGKQ.-
	TK120303_NMyc_cyto3_step12.2660.2660.2	4.0285	0.4011	2138.64	1	5260.0%	2	K.ALPGHLKPFETLLSQNQGGK.A
UK2C1_HUMAN99.6%228230.8%643658868.1(P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) 
*	TK120303_NMyc_cyto3_step05.3171.3171.3	2.066	0.0070	2622.88	12	1960.0%	1	R.FSSCGGGGGSFGAGGGFGSRSLVNLGGSK.S
*	TK120303_NMyc_cyto3_step03.3626.3626.2	3.4782	0.592	1998.09	1	5670.0%	4	R.THNLEPYFESFINNLR.R
*	TK120303_NMyc_cyto3_step01.1328.1328.1	2.1073	0.3445	1125.46	1	6670.0%	1	K.AEAESLYQSK.Y
*	TK120303_NMyc_cyto3_step04.3463.3463.3	1.6474	0.0071	3316.31	3	1510.0%	7	R.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G
*	TK120303_NMyc_cyto3_step12.1804.1804.2	1.3033	0.0785	2385.78	6	2000.0%	1	R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G
*	TK120303_NMyc_cyto3_step01.2007.2007.1	1.7638	0.1788	1357.67	1	5910.0%	1	K.LNDLEDALQQAK.E
*	TK120303_NMyc_cyto3_step01.1283.1283.1	1.2641	0.1347	1002.13	81	4380.0%	2	K.DVDGAYMTK.V
*	TK120303_NMyc_cyto3_step05.3705.3705.2	1.1628	0.1943	2567.59	1	2200.0%	1	R.MSGECAPNVSVSVSTSHTTISGGGSR.G
*	TK120303_NMyc_cyto3_step04.4358.4358.3	2.0521	0.101	4302.02	6	1150.0%	2	R.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGR.G
*	TK120303_NMyc_cyto3_step01.2483.2483.1	2.145	0.2022	1385.68	1	5910.0%	2	K.SLNNQFASFIDK.V
UIMD2_MOUSE99.6%6616.0%514557857.3(P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) 
	TK120303_NMyc_cyto3_step01.0311.0311.1	1.1524	0.2309	1158.5	1	6360.0%	1	K.VAQGVSGAVQDK.G
	TK120303_NMyc_cyto3_step04.2766.2766.2	1.5737	0.0133	1964.16	44	2350.0%	1	K.GKLPIVNENDELVAIIAR.T
	TK120303_NMyc_cyto3_step03.2199.2199.1	2.6585	0.3927	1431.54	2	5420.0%	1	R.HGFCGIPITDTGR.M
	TK120303_NMyc_cyto3_step03.2800.2800.2	3.47	0.5657	1893.16	1	5000.0%	1	R.FGVPVIADGGIQNVGHIAK.A
	TK120303_NMyc_cyto3_step03.1663.1663.2	2.2953	0.4326	1916.44	1	4710.0%	1	R.TSSAQVEGGVHSLHSYEK.R
	TK120303_NMyc_cyto3_step01.2036.2036.1	1.3175	0.0163	1399.67	5	4230.0%	1	K.IKVAQGVSGAVQDK.G
UHS7C_MOUSE99.6%5071824.3%646708715.5(P08109) Heat shock cognate 71 kDa protein 
	TK120303_NMyc_cyto3_step03.2164.2164.1	3.1362	0.5632	1483.75	1	6150.0%	4	K.SQIHDIVLVGGSTR.I
	TK120303_NMyc_cyto3_step01.2234.2234.1	1.5023	0.2327	1201.81	5	4090.0%	1	K.DAGTIAGLNVLR.I
	TK120303_NMyc_cyto3_step03.2610.2610.1	2.1026	0.1869	1237.5	1	7220.0%	2	R.MVNHFIAEFK.R
	TK120303_NMyc_cyto3_step05.2728.2728.3	2.3895	0.3217	2844.65	6	1670.0%	1	K.DAGTIAGLNVLRIINEPTAAAIAYGLDK.K
	TK120303_NMyc_cyto3_step01.3435.3435.2	4.7671	0.6177	2260.94	1	5230.0%	1	K.SINPDEAVAYGAAVQAAILSGDK.S
	TK120303_NMyc_cyto3_step01.1620.1620.1	1.9736	0.1261	993.62	1	6880.0%	1	K.EIAEAYLGK.T
	TK120303_NMyc_cyto3_step09.3688.3688.2	1.79	0.3965	3001.6	1	2690.0%	17	R.TLSSSTQASIEIDSLYEGIDFYTSITR.A
	TK120303_NMyc_cyto3_step09.3647.3647.2	1.3043	0.2088	2518.75	1	2830.0%	20	R.GVPQIEVTFDIDANGILNVSAVDK.S
	TK120303_NMyc_cyto3_step03.2708.2708.2	1.2154	0.0256	2267.38	68	1900.0%	1	K.GPAVGIDLGTTYSCVGVFQHGK.V
UQ9NPL899.6%2344319.3%285321938.2(Q9NPL8) C3orf1 hypothetical protein 
	TK120303_NMyc_cyto3_step09.2405.2405.2	1.1805	0.021	2356.43	5	2080.0%	1	R.GLVAGGIIGALLGTPVGGLLMAFQK.Y
	TK120303_NMyc_cyto3_step07.2824.2824.2	1.0487	0.1164	2920.99	107	1740.0%	1	K.QQYIEQSQAEIYHNRFDAVQSAHR.A
	TK120303_NMyc_cyto3_step11.0115.0115.3	3.2701	0.1616	3010.57	2	2250.0%	21	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
UQ91V8699.6%3563116.3%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) 
*	TK120303_NMyc_cyto3_step03.1919.1919.1	2.2211	0.192	1108.78	1	6360.0%	23	K.VVAGVAAALAHK.Y
*	TK120303_NMyc_cyto3_step08.3610.3610.2	2.7967	0.4794	2383.34	1	3260.0%	1	K.DFTPAAQAAFQKVVAGVAAALAHK.Y
UQ99PC399.6%114.1%3924659810.0(Q99PC3) CGI-74-like SR-rich protein 
	TK120303_NMyc_cyto3_step08.2148.2148.2	4.4654	0.4738	1867.6	1	6670.0%	1	K.SHLLNCCPHDVLSGTR.M
UO8911299.6%3319.3%399453417.8(O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1) 
*	TK120303_NMyc_cyto3_step04.3052.3052.2	4.7241	0.6074	2539.49	1	5710.0%	1	K.IPQSHIQQICENILTSGENLSR.K
*	TK120303_NMyc_cyto3_step05.2863.2863.2	1.9234	0.0711	2796.26	15	1600.0%	1	R.SITFLCGDAGPLAVAAVLYHKMNSEK.Q
*	TK120303_NMyc_cyto3_step03.0906.0906.2	0.7623	0.022	3121.46	56	1070.0%	1	R.TADTPFSLFEGMAGTIYFLADLLVPTKAK.F
UHEM3_MOUSE99.6%4420.5%361393027.1(P22907) Porphobilinogen deaminase (EC 4.3.1.8) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) (PBG-D) 
*	TK120303_NMyc_cyto3_step11.3774.3774.2	1.3621	0.0203	2630.24	2	2170.0%	1	R.VGQILHPEECMYAVGQGALAVEVR.A
*	TK120303_NMyc_cyto3_step03.4510.4510.2	1.2822	0.0396	1788.49	46	2500.0%	1	K.TLETLPEKSAVGTSSLR.R
*	TK120303_NMyc_cyto3_step08.3630.3630.2	3.6589	0.4723	2201.08	1	4470.0%	1	R.KLDELQEFSAIVLAVAGLQR.M
*	TK120303_NMyc_cyto3_step05.1875.1875.2	2.4974	0.393	1569.25	1	5830.0%	1	K.RQNPCDAVVFHPK.F
UPHS2_MOUSE99.6%577.1%842972867.1(Q9WUB3) Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) 
*	TK120303_NMyc_cyto3_step06.0537.0537.2	0.7264	0.0202	1276.06	38	2780.0%	1	K.VFADYEEYIK.C
*	TK120303_NMyc_cyto3_step01.3726.3726.2	1.4938	0.0467	1801.05	16	3120.0%	2	K.QISVRGLAGVENVSELK.K
*	TK120303_NMyc_cyto3_step11.2518.2518.2	2.9813	0.3263	1690.73	1	5380.0%	1	K.ARPEFTLPVHFYGR.V
	TK120303_NMyc_cyto3_step02.3140.3140.2	4.3657	0.1022	2120.97	1	5280.0%	1	K.VAIQLNDTHPSLAIPELMR.I
UPUR2_MOUSE99.6%558.5%10101073376.8(Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)] 
*	TK120303_NMyc_cyto3_step08.3240.3240.2	1.6264	0.0326	2317.09	23	2140.0%	1	K.VAEHKIFPAALQLVASGAVQLR.E
	TK120303_NMyc_cyto3_step04.2955.2955.2	4.0393	0.5527	1666.41	1	8000.0%	1	K.AFAHITGGGLLENIPR.V
*	TK120303_NMyc_cyto3_step05.2732.2732.2	1.2834	0.051	2354.05	12	2270.0%	1	R.VAVLISGTGSNLQALIDSTRDPK.S
*	TK120303_NMyc_cyto3_step04.2586.2586.2	1.1502	0.0392	2147.52	15	2370.0%	1	R.VLTVTAVQENLMSALAEARK.G
*	TK120303_NMyc_cyto3_step06.1664.1664.1	1.0506	0.0263	654.62	3	6250.0%	1	K.IHWAK.E
UMK01_MOUSE99.6%4418.7%358412767.0(P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) 
	TK120303_NMyc_cyto3_step02.3163.3163.3	5.408	0.6092	3521.9	1	3020.0%	1	K.RIEVEQALAHPYLEQYYDPSDEPIAEAPFK.F
	TK120303_NMyc_cyto3_step06.2751.2751.2	1.6095	0.183	2679.75	1	2250.0%	1	K.LLKTQHLSNDHICYFLYQILR.G
	TK120303_NMyc_cyto3_step10.1367.1367.1	1.3882	0.1968	1209.65	2	5560.0%	1	K.YIHSANVLHR.D
	TK120303_NMyc_cyto3_step03.0528.0528.1	0.9356	0.0298	768.31	1	8000.0%	1	R.FQPGYR.S
UGTA4_MOUSE99.6%72714.0%222255647.4(P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4) 
*	TK120303_NMyc_cyto3_step08.3627.3627.2	4.1002	0.6269	2113.79	1	5590.0%	5	R.WLLAAAGVEFEEEFLETR.E
*	TK120303_NMyc_cyto3_step04.1932.1932.2	1.5515	0.24	1453.8	4	4580.0%	1	R.KPPPDGPYVEVVR.T
UMOES_MOUSE99.6%81017.5%576676366.6(P26041) Moesin (Membrane-organizing extension spike protein) 
	TK120303_NMyc_cyto3_step10.1953.1953.2	1.2211	0.0288	2136.74	35	2350.0%	1	K.IAQDLEMYGVNYFSIKNK.K
	TK120303_NMyc_cyto3_step05.1667.1667.1	2.0035	0.3417	1235.63	1	5620.0%	2	R.IQVWHEEHR.G
	TK120303_NMyc_cyto3_step01.3767.3767.2	4.2859	0.6078	2083.65	1	6880.0%	1	K.FYPEDVSEELIQDITQR.L
	TK120303_NMyc_cyto3_step03.2234.2234.1	1.7544	0.1866	961.7	1	7140.0%	1	R.KESPLLFK.F
	TK120303_NMyc_cyto3_step07.2699.2699.2	1.4315	0.0109	1403.68	38	4090.0%	1	K.TANDMIHAENMR.L
	TK120303_NMyc_cyto3_step02.4391.4391.2	1.6734	0.1229	1878.4	27	3210.0%	1	K.RILALCMGNHELYMR.R
	TK120303_NMyc_cyto3_step09.3328.3328.2	2.6975	0.3358	2492.43	1	4050.0%	1	K.KGSELWLGVDALGLNIYEQNDR.L
UPUA2_MOUSE99.6%7918.4%456501506.6(P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase) 
	TK120303_NMyc_cyto3_step01.0426.0426.1	1.3813	0.0051	765.36	2	8000.0%	1	K.VEVQYK.T
	TK120303_NMyc_cyto3_step05.2561.2561.2	5.029	0.2818	2211.47	1	6390.0%	2	R.AHIVFDFHQAADGIQEQQR.Q
*	TK120303_NMyc_cyto3_step02.1557.1557.1	0.7961	0.1733	1008.43	341	3750.0%	1	K.GIRPVYSSK.A
	TK120303_NMyc_cyto3_step09.2504.2504.2	1.4484	0.0063	1953.84	8	3000.0%	1	R.MCDLVSDFDGFSERFK.V
	TK120303_NMyc_cyto3_step10.1970.1970.2	1.3418	0.0404	2190.56	3	2780.0%	1	K.VEVQYKTLPGWNTDISNAR.T
	TK120303_NMyc_cyto3_step07.2003.2003.2	1.2032	0.0145	2286.35	16	2000.0%	1	R.VGIGAFPTEQDNEIGELLQTR.G
UPDX5_MOUSE99.6%3511.0%210218978.9(P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) 
	TK120303_NMyc_cyto3_step04.2994.2994.1	2.2377	0.2367	1063.55	1	7500.0%	1	K.KVNLAELFK.G
	TK120303_NMyc_cyto3_step04.2492.2492.1	2.7113	0.2943	1469.75	1	5380.0%	2	K.THLPGFVEQAGALK.A
UO5518199.6%184634.6%280318898.4(O55181) RBP associated molecule RAM14-1 
*	TK120303_NMyc_cyto3_step02.1700.1700.1	1.9164	0.3249	1198.59	1	7140.0%	1	R.YWHDNCFR.C
	TK120303_NMyc_cyto3_step03.2354.2354.2	4.5272	0.5984	2418.91	1	4210.0%	1	K.GSSVVAYEGQSWHDYCFHCK.K
*	TK120303_NMyc_cyto3_step02.2071.2071.2	4.2791	0.6264	1914.69	1	6790.0%	1	R.FVFHNEQVYCPDCAK.K
*	TK120303_NMyc_cyto3_step02.1144.1144.1	2.0335	0.3604	831.56	1	7140.0%	5	R.KPISADAK.E
	TK120303_NMyc_cyto3_step02.1307.1307.1	1.5729	0.1908	1059.77	1	5830.0%	1	K.FDCHYCR.D
	TK120303_NMyc_cyto3_step01.0288.0288.1	1.7336	0.2691	1193.23	1	6250.0%	2	K.DCFTCSNCK.Q
*	TK120303_NMyc_cyto3_step04.2207.2207.1	3.3141	0.4706	1490.62	1	5830.0%	3	K.CLHPLASETFVSK.D
*	TK120303_NMyc_cyto3_step08.2231.2231.2	3.4144	0.5082	2070.66	1	6000.0%	1	K.RFVFHNEQVYCPDCAK.K
*	TK120303_NMyc_cyto3_step04.1160.1160.1	1.166	0.132	719.31	1	7500.0%	1	R.HCCLK.C
	TK120303_NMyc_cyto3_step01.2270.2270.1	1.4688	0.106	1182.71	9	5500.0%	1	K.QVIGTGSFFPK.G
UO7056599.6%117.1%295329364.8(O70565) Cp27 protein 
	TK120303_NMyc_cyto3_step04.2147.2147.2	3.2027	0.5306	2063.58	1	4750.0%	1	R.EKPQALVTSPATPLPAGSGIK.R
USNXC_MOUSE99.6%246.7%165191167.3(O70493) Sorting nexin 12 (SDP8 protein) 
	TK120303_NMyc_cyto3_step05.1312.1312.1	2.4292	0.4789	1207.61	1	6500.0%	2	K.IAGHPLAQNER.C
USEP7_MOUSE99.6%61221.3%436505508.6(O55131) Septin 7 (CDC10 protein homolog) 
	TK120303_NMyc_cyto3_step10.2688.2688.3	1.9093	0.0808	4392.07	2	1410.0%	1	K.VLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSK.F
	TK120303_NMyc_cyto3_step04.3543.3543.2	1.9837	0.1674	2609.35	8	2270.0%	3	K.STLINSLFLTDLYSPEYPGPSHR.I
	TK120303_NMyc_cyto3_step07.2491.2491.2	1.0917	0.1909	1569.92	1	4170.0%	1	K.ADTLTPEECQQFK.K
	TK120303_NMyc_cyto3_step06.3155.3155.2	1.1474	0.0424	1956.26	24	3120.0%	1	K.NLEGYVGFANLPNQVYR.K
UTSN_MOUSE99.6%51117.1%228262016.4(Q62348) Translin 
	TK120303_NMyc_cyto3_step11.3645.3645.2	1.8106	0.0555	2385.21	54	1750.0%	1	-.MSVSEIFVELQGFLAAEQDIR.E
	TK120303_NMyc_cyto3_step08.1271.1271.2	1.0923	0.0352	1323.2	7	4000.0%	1	K.VEEVVYDLSIR.G
	TK120303_NMyc_cyto3_step04.1558.1558.1	1.9666	0.4861	801.56	1	7500.0%	3	K.THLTSLK.T
UQ9Z2N899.6%117.0%429474305.6(Q9Z2N8) BAF53a 
	TK120303_NMyc_cyto3_step03.2902.2902.2	3.4091	0.5784	3094.63	1	3100.0%	1	R.STGLILDSGATHTTAIPVHDGYVLQQGIVK.S
UGLP1_HUMAN99.6%115911.9%463530608.1(P43220) Glucagon-like peptide 1 receptor precursor (GLP-1 receptor) (GLP-1-R) (GLP-1R) 
*	TK120303_NMyc_cyto3_step07.3681.3681.2	1.3012	0.1778	2629.39	1	2400.0%	1	K.CPTSSLSSGATAGSSMYTATCQASCS.-
*	TK120303_NMyc_cyto3_step10.3646.3646.3	2.3546	0.0571	3065.48	7	1880.0%	7	R.LALLLLGMVGRAGPRPQGATVSLWETVQK.W
UQ91VC799.6%1115.0%147166497.3(Q91VC7) PKC-potentiated PP1 inhibitory protein (RIKEN cDNA 1110001M11 gene) 
*	TK120303_NMyc_cyto3_step01.3958.3958.2	4.0185	0.5715	2460.84	1	4760.0%	1	K.IQGLLEACANPTEDFVQELLAK.L
ULA_MOUSE99.6%243.9%415477569.8(P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) 
	TK120303_NMyc_cyto3_step03.3220.3220.2	4.4481	0.6427	2075.78	1	7000.0%	2	K.ICHQIEYYFGDFNLPR.D
UTF1B_MOUSE99.6%91116.3%834888475.8(Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) 
*	TK120303_NMyc_cyto3_step10.1221.1221.2	2.1143	0.2213	2006.93	2	3680.0%	1	K.IVAERPGTNSTGPGPMAPPR.A
	TK120303_NMyc_cyto3_step08.1639.1639.1	1.3459	0.1675	932.46	3	6670.0%	1	K.HQEHILR.F
*	TK120303_NMyc_cyto3_step11.1706.1706.2	1.4004	0.163	2659.87	1	2120.0%	1	K.IVAERPGTNSTGPGPMAPPRAPGPLSK.Q
	TK120303_NMyc_cyto3_step06.1568.1568.2	1.8166	0.0368	1850.48	32	2780.0%	1	K.EEDGSLSLDGADSTGVVAK.L
*	TK120303_NMyc_cyto3_step10.2625.2625.2	1.1742	0.061	2935.22	48	1550.0%	1	K.FSAVLVEPPPLNLPSAGLSSQELSGPGDGP.-
*	TK120303_NMyc_cyto3_step08.2262.2262.3	6.7854	0.7126	3326.66	1	3090.0%	2	K.RPAASSAAAASAAASSPAGGGGEAQELLEHCGVCR.E
	TK120303_NMyc_cyto3_step04.1102.1102.1	1.0001	0.2017	698.5	31	5000.0%	1	K.HATLQK.N
	TK120303_NMyc_cyto3_step01.2180.2180.1	2.098	0.1732	1521.74	1	4550.0%	1	K.DHQYQFLEDAVR.N
UTBCA_MOUSE99.6%1115.9%107126265.3(P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A) 
*	TK120303_NMyc_cyto3_step02.3135.3135.2	4.5959	0.5353	2007.56	1	7190.0%	1	R.RLEAAYTDLQQILESEK.D
UQ9QZM099.6%224.4%638673795.3(Q9QZM0) PLIC-2 
	TK120303_NMyc_cyto3_step02.2705.2705.2	3.8499	0.3419	1765.45	1	6070.0%	1	R.NPEISHLLNNPDIMR.Q
	TK120303_NMyc_cyto3_step08.1356.1356.2	0.8547	0.0441	1418.44	113	2500.0%	1	K.SQTDQLVLIFAGK.I
UEF11_MOUSE99.6%73134736.8%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) 
	TK120303_NMyc_cyto3_step02.3108.3108.2	3.8463	0.6665	2519.52	1	4130.0%	15	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK120303_NMyc_cyto3_step02.3851.3851.2	4.0446	0.6001	2914.14	1	4110.0%	31	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK120303_NMyc_cyto3_step01.1230.1230.1	1.5354	0.0043	1284.42	4	4500.0%	1	K.MDSTEPPYSQK.R
	TK120303_NMyc_cyto3_step02.1564.1564.1	1.5806	0.0947	1122.74	23	3890.0%	2	K.STTTGHLIYK.C
	TK120303_NMyc_cyto3_step01.1654.1654.1	1.0506	0.2752	1025.72	2	5500.0%	1	K.IGGIGTVPVGR.V
	TK120303_NMyc_cyto3_step03.2272.2272.2	2.8075	0.4935	1406.84	1	7730.0%	1	K.YYVTIIDAPGHR.D
	TK120303_NMyc_cyto3_step07.3047.3047.2	1.5569	0.098	2482.21	1	2730.0%	1	K.SVEMHHEALSEALPGDNVGFNVK.N
	TK120303_NMyc_cyto3_step02.2728.2728.1	2.6682	0.442	1316.77	1	6820.0%	1	R.EHALLAYTLGVK.Q
	TK120303_NMyc_cyto3_step01.1594.1594.1	1.6405	0.3094	870.72	1	8570.0%	1	K.QLIVGVNK.M
	TK120303_NMyc_cyto3_step09.2499.2499.2	3.2853	0.3794	1591.19	1	6430.0%	10	K.THINIVVIGHVDSGK.S
	TK120303_NMyc_cyto3_step01.1792.1792.1	1.5242	0.041	975.53	1	7860.0%	1	R.LPLQDVYK.I
	TK120303_NMyc_cyto3_step02.1471.1471.1	1.3752	0.0646	938.79	52	6670.0%	1	K.RYEEIVK.E
UQ91ZJ599.6%339.3%508569797.6(Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2 
	TK120303_NMyc_cyto3_step11.1902.1902.2	1.2442	0.1293	2545.57	63	1670.0%	1	K.TYNTDVPLVLMNSFNTDEDTKK.I
*	TK120303_NMyc_cyto3_step04.1980.1980.1	2.1887	0.4542	1584.69	1	5000.0%	1	K.ILTTAASHEFEHTK.K
	TK120303_NMyc_cyto3_step03.2096.2096.1	1.2935	0.0073	1413.6	14	4000.0%	1	K.RCEFVMEVTNK.T
UQ9H3T799.6%222.9%10521179986.1(Q9H3T7) MOP-4 
	TK120303_NMyc_cyto3_step03.3067.3067.2	3.7074	0.5893	1627.3	1	7310.0%	1	K.SFPAAIEHTIQWAR.D
	TK120303_NMyc_cyto3_step11.1554.1554.2	1.2605	0.0051	1957.97	60	2500.0%	1	K.FDLNEPLHLSFLQNAAK.L
U143E_HUMAN99.6%71323.1%255291744.7(P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) 
	TK120303_NMyc_cyto3_step02.2149.2149.2	3.0621	0.5317	1822.23	1	5620.0%	1	K.AASDIAMTELPPTHPIR.L
	TK120303_NMyc_cyto3_step01.1484.1484.1	1.6803	0.0321	1194.74	1	5500.0%	1	K.EAAENSLVAYK.A
	TK120303_NMyc_cyto3_step01.3523.3523.2	5.5607	0.6068	2089.82	1	6390.0%	1	K.AAFDDAIAELDTLSEESYK.D
	TK120303_NMyc_cyto3_step03.1582.1582.1	1.9693	0.3728	1239.54	1	7270.0%	3	K.HLIPAANTGESK.V
UO8830699.6%102054.3%173183526.3(O88306) DJ-1 
	TK120303_NMyc_cyto3_step07.3723.3723.2	1.4828	0.1957	1908.87	3	2780.0%	2	R.GPGTSFEFALAIVEALVGK.D
	TK120303_NMyc_cyto3_step04.1318.1318.1	1.403	0.0253	868.54	1	6430.0%	3	K.VTTHPLAK.D
	TK120303_NMyc_cyto3_step05.3537.3537.2	2.912	0.534	2328.34	1	3640.0%	2	K.GLIAAICAGPTALLAHEVGFGCK.V
	TK120303_NMyc_cyto3_step01.2775.2775.2	2.5209	0.2486	2772.58	2	2310.0%	1	K.TQGPYDVVVLPGGNLGAQNLSESPMVK.E
	TK120303_NMyc_cyto3_step01.1528.1528.1	0.8592	0.1582	815.56	5	5000.0%	1	K.VTVAGLAGK.D
	TK120303_NMyc_cyto3_step09.2087.2087.3	1.8607	0.0517	2766.07	241	1250.0%	1	K.DGLILTSRGPGTSFEFALAIVEALVGK.D
UCAH2_MOUSE99.6%206642.5%259289607.0(P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) 
	TK120303_NMyc_cyto3_step03.1308.1308.1	1.3963	0.1146	1121.47	1	5000.0%	2	K.HNGPENWHK.D
	TK120303_NMyc_cyto3_step01.2447.2447.2	1.8852	0.3329	2550.25	3	2500.0%	1	K.SIVNNGHSFNVEFDDSQDNAVLK.G
	TK120303_NMyc_cyto3_step02.2048.2048.1	1.6017	0.2768	1011.75	1	6250.0%	1	K.VLEALHSIK.T
	TK120303_NMyc_cyto3_step06.2589.2589.2	1.5778	0.2042	2643.39	1	2270.0%	1	R.LIQFHFHWGSSDGQGSEHTVNKK.K
	TK120303_NMyc_cyto3_step01.0683.0683.1	0.9773	0.0993	687.48	9	6000.0%	1	K.YGDFGK.A
	TK120303_NMyc_cyto3_step11.2483.2483.2	2.6363	0.4394	2513.56	1	3100.0%	2	R.LIQFHFHWGSSDGQGSEHTVNK.K
	TK120303_NMyc_cyto3_step05.3467.3467.2	1.3556	0.0137	2875.72	51	1880.0%	1	R.TLNFNEEGDAEEAMVDNWRPAQPLK.N
	TK120303_NMyc_cyto3_step07.2649.2649.1	2.7196	0.3601	1583.58	1	6670.0%	6	K.YAAELHLVHWNTK.Y
	TK120303_NMyc_cyto3_step12.3404.3404.3	1.6594	0.0525	3146.62	4	1920.0%	1	R.TLNFNEEGDAEEAMVDNWRPAQPLKNR.K
UO3567899.6%116.6%303333887.2(O35678) MONOGLYCERIDE lipase (EC 3.1.1.23) 
*	TK120303_NMyc_cyto3_step03.3540.3540.2	3.7695	0.5236	2333.85	1	5000.0%	1	R.ELPEVTNSVLHEVNSWVSHR.I
UPGK1_HUMAN99.6%114.6%417445978.1(P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) 
*	TK120303_NMyc_cyto3_step09.2513.2513.2	3.3915	0.5965	2036.07	1	5000.0%	1	K.SVVLMSHLGRPDGVPMPDK.Y
UAPOH_MOUSE99.6%114.9%345386198.2(Q01339) Beta-2-glycoprotein I precursor (Apolipoprotein H) (Apo-H) (B2GPI) (Beta(2)GPI) (Activated protein C-binding protein) (APC inhibitor) 
*	TK120303_NMyc_cyto3_step02.3043.3043.2	3.371	0.5453	1911.64	1	5940.0%	1	R.ICPKPDDLPFATVVPLK.T
UQ9CZ4499.6%4410.5%370407105.1(Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence 
	TK120303_NMyc_cyto3_step03.0015.0015.1	0.8944	0.0235	1533.04	10	2690.0%	1	K.SPNELVDDLFKGAK.E
	TK120303_NMyc_cyto3_step04.1823.1823.2	3.4208	0.5223	1692.09	1	7860.0%	1	R.LAHGGQVNLDMEDHR.D
	TK120303_NMyc_cyto3_step02.1515.1515.1	1.5015	0.3353	1026.8	2	5620.0%	1	R.RGEVPAELR.R
	TK120303_NMyc_cyto3_step05.3199.3199.2	1.8139	0.1661	1850.98	4	3000.0%	1	R.RLAHGGQVNLDMEDHR.D
URAN_HUMAN99.6%143233.8%216244237.5(P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) 
	TK120303_NMyc_cyto3_step09.2816.2816.2	5.0886	0.7034	2056.08	1	6180.0%	3	K.YVATLGVEVHPLVFHTNR.G
	TK120303_NMyc_cyto3_step02.1537.1537.1	1.8399	0.2294	960.82	1	7140.0%	1	R.HLTGEFEK.K
	TK120303_NMyc_cyto3_step06.2596.2596.2	1.1017	0.0302	2182.54	58	2220.0%	1	K.KYVATLGVEVHPLVFHTNR.G
	TK120303_NMyc_cyto3_step01.1688.1688.1	1.9238	0.2197	1215.63	3	5560.0%	1	K.NLQYYDISAK.S
	TK120303_NMyc_cyto3_step01.1903.1903.1	1.5626	0.0736	1294.63	1	6500.0%	1	K.FNVWDTAGQEK.F
	TK120303_NMyc_cyto3_step01.1634.1634.1	1.4981	0.1526	1015.88	2	5500.0%	1	K.LVLVGDGGTGK.T
	TK120303_NMyc_cyto3_step01.2048.2048.1	2.0328	0.2707	1515.55	1	4170.0%	1	R.VCENIPIVLCGNK.V
	TK120303_NMyc_cyto3_step07.1804.1804.1	1.8849	0.2187	1118.64	13	6250.0%	4	K.RHLTGEFEK.K
UQ9CWE499.6%2216.2%271296556.5(Q9CWE4) 2410153K17Rik protein 
	TK120303_NMyc_cyto3_step10.2996.2996.2	4.4603	0.6752	2267.48	1	4760.0%	1	K.AGVLPLLTAAITQHGQHADVVR.E
*	TK120303_NMyc_cyto3_step04.3036.3036.2	1.5286	0.0779	2429.84	21	2140.0%	1	R.EAVEQFESQGVDLSNIVKTIPK.V
ULIS1_MOUSE99.6%337.8%409465397.4(P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) 
	TK120303_NMyc_cyto3_step05.1952.1952.1	1.5218	0.2054	889.58	1	8330.0%	1	K.KWTSVIR.L
	TK120303_NMyc_cyto3_step09.2509.2509.2	3.5913	0.4872	1896.78	1	6000.0%	1	K.TLNAHEHFVTSLDFHK.T
	TK120303_NMyc_cyto3_step04.1943.1943.1	1.7198	0.1986	903.55	1	5620.0%	1	R.GVLFHSGGK.F
UFABE_MOUSE99.6%51136.3%135151376.5(Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) 
*	TK120303_NMyc_cyto3_step03.0842.0842.2	1.0028	0.0405	2969.09	1	1920.0%	1	K.MAAMAKPDCIITCDGNNITVKTESTVK.T
*	TK120303_NMyc_cyto3_step01.2035.2035.2	2.0428	0.384	2452.47	1	4000.0%	1	K.TETVCTFQDGALVQHQQWDGK.E
*	TK120303_NMyc_cyto3_step02.2152.2152.2	2.6714	0.3547	2578.14	1	3330.0%	3	R.KTETVCTFQDGALVQHQQWDGK.E
UARF1_HUMAN99.6%118323.3%180205666.8(P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 
	TK120303_NMyc_cyto3_step04.4307.4307.2	1.4817	0.0585	2156.39	29	2350.0%	9	R.HYFQNTQGLIFVVDSNDR.E
	TK120303_NMyc_cyto3_step01.2787.2787.1	1.6754	0.2442	1090.56	1	6670.0%	1	R.DAVLLVFANK.Q
	TK120303_NMyc_cyto3_step01.2759.2759.1	1.9682	0.2157	1566.78	1	5000.0%	1	K.NISFTVWDVGGQDK.I
UTCPE_MOUSE99.6%82811.3%541596246.0(P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) 
	TK120303_NMyc_cyto3_step04.3893.3893.2	3.5126	0.4208	3115.94	1	2930.0%	5	K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
	TK120303_NMyc_cyto3_step04.1316.1316.1	1.3875	0.2035	757.5	1	6670.0%	1	K.SHIMAAK.A
	TK120303_NMyc_cyto3_step06.2641.2641.2	2.5237	0.5279	1611.92	1	5380.0%	1	K.IAILTCPFEPPKPK.T
	TK120303_NMyc_cyto3_step02.2229.2229.1	1.3038	4.0E-4	1183.66	9	4440.0%	1	R.SLHDALCVIR.N
UAPE1_MOUSE99.6%2214.6%316353597.9(P28352) DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP endonuclease 1) (APEX nuclease) (APEN) 
*	TK120303_NMyc_cyto3_step11.0012.0012.2	1.1397	0.0916	3103.31	2	1920.0%	1	K.CSENKLPAELQELPGLTHQYWSAPSDK.E
	TK120303_NMyc_cyto3_step04.2891.2891.2	4.0317	0.5195	2191.97	1	5280.0%	1	R.KPLVLCGDLNVAHEEIDLR.N
UPA1G_MOUSE99.6%5929.7%232258536.9(Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) 
*	TK120303_NMyc_cyto3_step08.2612.2612.2	3.3024	0.5042	2447.42	1	3410.0%	2	K.IVVVWVGTNNHSHTAEQVTGGIK.A
	TK120303_NMyc_cyto3_step07.1433.1433.1	1.5168	0.0957	918.52	1	7140.0%	2	R.GQHPNPLR.E
*	TK120303_NMyc_cyto3_step05.0559.0559.3	1.9839	0.0698	4255.78	1	1550.0%	1	R.AALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSR.L
UQ9CXA299.6%228.2%354378046.7(Q9CXA2) 2810055F11Rik protein 
*	TK120303_NMyc_cyto3_step08.2984.2984.1	1.2284	0.0738	947.53	12	6670.0%	1	R.QHLDYIR.R
*	TK120303_NMyc_cyto3_step09.3253.3253.2	3.421	0.5774	2293.27	1	4760.0%	1	R.FHSVPAFVLASDLTVDVPGHGK.V
USODC_MOUSE99.6%143830.7%153158116.5(P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) 
*	TK120303_NMyc_cyto3_step02.2207.2207.1	1.8671	0.2412	1369.87	9	4170.0%	4	R.VISLSGEHSIIGR.T
*	TK120303_NMyc_cyto3_step09.3308.3308.2	1.6687	0.1181	2119.76	3	2500.0%	2	K.HGGPADEERHVGDLGNVTAGK.D
	TK120303_NMyc_cyto3_step01.1446.1446.1	1.0974	0.0515	689.59	26	6000.0%	1	K.AVCVLK.G
*	TK120303_NMyc_cyto3_step02.1480.1480.1	2.9363	0.5574	1169.67	1	6820.0%	3	R.HVGDLGNVTAGK.D
*	TK120303_NMyc_cyto3_step02.1265.1265.1	1.5009	0.1436	845.45	1	7500.0%	2	R.TMVVHEK.Q
UQ9UG9499.6%1110.6%132149719.5(Q9UG94) Hypothetical protein 
*	TK120303_NMyc_cyto3_step03.3022.3022.1	2.8641	0.0535	1549.73	1	5000.0%	1	K.HPELFKALGIAQPK.G
UPIMT_MOUSE99.6%61421.2%226245037.6(P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) 
	TK120303_NMyc_cyto3_step03.3394.3394.3	4.0346	0.4672	3507.97	1	2050.0%	1	R.MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR.L
	TK120303_NMyc_cyto3_step07.2033.2033.1	2.822	0.4464	1479.76	1	4230.0%	3	K.SGGASHSELIHNLR.K
UQ9EQR099.6%18229.6%25042724266.6(Q9EQR0) Fatty acid synthase 
*	TK120303_NMyc_cyto3_step02.0747.0747.2	0.8127	0.0343	2836.37	17	1600.0%	2	R.QHSQDLAFVSMLNDIAATPTAAMPFR.G
	TK120303_NMyc_cyto3_step01.4714.4714.1	1.1723	0.064	1252.83	27	4000.0%	1	K.FDASFFGVHPK.Q
*	TK120303_NMyc_cyto3_step03.2067.2067.3	1.4121	0.0072	3020.85	38	1480.0%	1	R.EEEPEAVLPGAQPTLISAISKTFCPAHK.S
*	TK120303_NMyc_cyto3_step10.1841.1841.3	1.6225	0.0132	3473.58	11	1640.0%	1	R.QAPAPTAHAALPHLLHASGRTLEAVQDLLEQGR.Q
*	TK120303_NMyc_cyto3_step10.3968.3968.1	1.165	0.0409	1468.65	118	3180.0%	1	R.RQQEQLVPTLEK.F
*	TK120303_NMyc_cyto3_step01.3394.3394.1	2.191	0.3842	1412.74	1	5450.0%	1	K.DNLEFFLTNLGK.V
*	TK120303_NMyc_cyto3_step11.3359.3359.2	1.493	0.1522	2018.3	43	2110.0%	1	R.QAPAPTAHAALPHLLHASGR.T
*	TK120303_NMyc_cyto3_step04.2114.2114.2	2.0932	0.2377	1292.09	1	6000.0%	1	R.LQVVDRPLPVR.G
*	TK120303_NMyc_cyto3_step02.3419.3419.3	5.3933	0.5505	3526.44	1	2500.0%	1	R.CPAGVVPACHNSEDTVTISGPQAAVNEFVEQLK.Q
*	TK120303_NMyc_cyto3_step06.2329.2329.1	1.6171	0.2247	850.54	1	7140.0%	1	K.ALHLVGLK.R
*	TK120303_NMyc_cyto3_step04.1792.1792.1	1.6106	0.0028	1270.62	5	5000.0%	2	R.HFQLEQDKPK.E
*	TK120303_NMyc_cyto3_step01.0275.0275.1	1.7511	0.2687	1259.55	1	5000.0%	1	R.VQEVQQVSTNK.R
*	TK120303_NMyc_cyto3_step05.1269.1269.1	0.9729	0.0411	1027.41	77	3890.0%	1	R.QAPLLIGSTK.S
*	TK120303_NMyc_cyto3_step09.3377.3377.2	1.3723	0.1363	2465.47	14	1820.0%	1	R.TGGLAFHSYFMEGIAPTLLQALK.K
*	TK120303_NMyc_cyto3_step04.2051.2051.2	1.0845	0.0234	1425.91	21	3750.0%	1	K.LDPGSPELQQVLK.H
UTRFE_MOUSE99.6%5416035.6%697767247.2(Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) 
*	TK120303_NMyc_cyto3_step02.1416.1416.1	1.7292	0.3175	1114.57	1	6250.0%	2	K.KTSYPDCIK.A
*	TK120303_NMyc_cyto3_step02.2025.2025.1	2.5132	0.3218	1479.6	1	5420.0%	3	K.KGTDFQLNQLEGK.K
*	TK120303_NMyc_cyto3_step03.2207.2207.1	1.7366	0.228	1174.7	1	5620.0%	2	K.WCALSHLER.T
	TK120303_NMyc_cyto3_step04.1215.1215.1	1.4467	0.159	889.49	1	7140.0%	3	K.SCHTGLGR.S
*	TK120303_NMyc_cyto3_step01.2794.2794.1	2.4023	0.4401	1239.89	1	7000.0%	1	K.DFQLFSSPLGK.D
*	TK120303_NMyc_cyto3_step01.3252.3252.2	3.4592	0.497	2554.93	1	4550.0%	1	K.AVLTSQETLFGGSDCTGNFCLFK.S
*	TK120303_NMyc_cyto3_step01.1728.1728.1	1.7292	0.1345	971.65	4	5620.0%	2	K.GYYAVAVVK.A
*	TK120303_NMyc_cyto3_step07.2035.2035.2	4.1204	0.5791	2011.9	1	5880.0%	6	K.DFASCHLAQAPNHVVVSR.K
*	TK120303_NMyc_cyto3_step06.2265.2265.2	1.8726	0.386	2058.25	1	3750.0%	1	K.EDLIWEILKVAQEHFGK.G
*	TK120303_NMyc_cyto3_step01.1447.1447.1	1.1169	0.1365	964.45	1	6110.0%	1	K.DGGGDVAFVK.H
*	TK120303_NMyc_cyto3_step01.2123.2123.1	1.6903	0.2096	1580.68	2	4170.0%	1	K.QEDFELLCPDGTR.K
*	TK120303_NMyc_cyto3_step04.2416.2416.1	2.0388	0.1765	1423.21	1	5910.0%	7	R.LYLGHNYVTAIR.N
	TK120303_NMyc_cyto3_step01.2055.2055.1	1.274	0.1292	663.5	9	7500.0%	1	K.DLLFR.D
*	TK120303_NMyc_cyto3_step10.4032.4032.2	1.6311	0.1492	1958.49	152	1760.0%	2	K.GDVAFVKHQTVLDNTEGK.N
*	TK120303_NMyc_cyto3_step01.3627.3627.1	1.9937	0.0054	1160.8	2	7500.0%	1	K.EDLIWEILK.V
	TK120303_NMyc_cyto3_step02.1260.1260.1	1.4557	0.1828	917.52	3	5000.0%	2	K.VAQEHFGK.G
*	TK120303_NMyc_cyto3_step07.1431.1431.1	1.2691	0.0835	951.55	43	4380.0%	2	R.IPSHAVVAR.K
*	TK120303_NMyc_cyto3_step01.3278.3278.1	2.5684	0.4142	1572.75	1	5000.0%	1	K.NNGKEDLIWEILK.V
*	TK120303_NMyc_cyto3_step02.2625.2625.2	2.9148	0.5187	1314.33	1	7500.0%	1	K.HTTIFEVLPEK.A
*	TK120303_NMyc_cyto3_step03.2691.2691.2	1.1866	0.0020	1526.67	2	4230.0%	1	K.TVLPPDGPRLACVK.K
*	TK120303_NMyc_cyto3_step01.1238.1238.1	1.4109	0.2708	973.67	24	4380.0%	3	K.LPEGTTPEK.Y
*	TK120303_NMyc_cyto3_step07.1928.1928.1	1.5333	0.0813	1257.51	2	4440.0%	1	R.LLEACTFHKH.-
*	TK120303_NMyc_cyto3_step02.1327.1327.1	1.8739	0.337	1241.55	1	6000.0%	1	K.HQTVLDNTEGK.N
*	TK120303_NMyc_cyto3_step01.2058.2058.1	1.9501	0.222	1323.66	1	6500.0%	1	K.CDEWSIISEGK.I
	TK120303_NMyc_cyto3_step01.1946.1946.1	1.3311	0.0201	635.56	1	7500.0%	1	K.DLLFK.D
UTCPY_MOUSE99.6%4612.8%531581847.7(Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) 
*	TK120303_NMyc_cyto3_step05.2773.2773.2	3.5637	0.4576	2317.47	1	3500.0%	2	K.DGNVLLHEMQIQHPTASIIAK.V
*	TK120303_NMyc_cyto3_step01.3466.3466.2	1.3761	0.0145	2893.98	46	1350.0%	1	R.TSLQTKVHAELADILTEAVVDSVLAIR.R
*	TK120303_NMyc_cyto3_step08.3252.3252.2	1.1975	0.0384	2266.43	31	2110.0%	1	K.VLAQNSGYDLQETLIKIQTK.H
UUBP5_MOUSE99.6%5514.5%858958335.0(P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) 
	TK120303_NMyc_cyto3_step07.3065.3065.2	1.6056	0.0728	1578.91	10	3330.0%	1	R.VTSAVEALLSADSASR.K
*	TK120303_NMyc_cyto3_step01.4254.4254.2	1.9732	0.3602	2576.28	2	2730.0%	1	R.LAIGVEGGFDLTEDKFEFDEDVK.I
	TK120303_NMyc_cyto3_step05.4222.4222.3	1.9762	0.0142	4572.35	8	1160.0%	1	K.LDVSIEMPEELDISQLRGTGLQPGEEELPDIAPPLVTPDEPK.G
*	TK120303_NMyc_cyto3_step04.2276.2276.2	3.5638	0.5173	2826.91	1	3650.0%	1	K.LGHGLLSGEYSKPALESGDGEQVPEQK.E
	TK120303_NMyc_cyto3_step03.1604.1604.2	4.3496	0.5958	1824.84	1	7000.0%	1	R.YFDGSGGNNHAVEHYR.E
UPSA6_MOUSE99.6%71530.1%246273726.7(Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) 
	TK120303_NMyc_cyto3_step05.1895.1895.3	1.4932	0.0249	4141.97	10	1210.0%	1	R.IADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYK.C
	TK120303_NMyc_cyto3_step11.1146.1146.1	1.0893	0.0192	1170.63	29	4440.0%	1	K.QTESTSFLEK.K
	TK120303_NMyc_cyto3_step04.2267.2267.1	1.7862	0.3186	1156.77	3	5000.0%	2	R.HITIFSPEGR.L
	TK120303_NMyc_cyto3_step02.3173.3173.2	3.1707	0.4771	1981.36	1	4710.0%	3	R.ILTEAEIDAHLVALAERD.-
UPDX1_MOUSE99.6%145836.7%199221768.1(P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) 
	TK120303_NMyc_cyto3_step01.2095.2095.1	1.7026	0.2623	1196.7	13	5000.0%	1	R.LVQAFQFTDK.H
	TK120303_NMyc_cyto3_step01.2423.2423.1	2.0881	0.1887	922.75	3	7140.0%	2	R.GLFIIDDK.G
*	TK120303_NMyc_cyto3_step07.2848.2848.2	2.7081	0.3913	1766.28	1	4690.0%	1	K.KQGGLGPMNIPLISDPK.R
	TK120303_NMyc_cyto3_step01.1547.1547.1	1.4312	0.2749	1164.51	4	5000.0%	1	K.ATAVMPDGQFK.D
	TK120303_NMyc_cyto3_step01.0555.0555.1	0.8721	0.0867	673.33	2	7500.0%	1	K.EYFSK.Q
*	TK120303_NMyc_cyto3_step07.2099.2099.2	4.2092	0.5422	2395.62	1	4050.0%	7	K.HGEVCPAGWKPGSDTIKPDVNK.S
UAMPB_MOUSE99.6%358.9%650723435.3(Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV) 
*	TK120303_NMyc_cyto3_step11.1461.1461.2	2.0207	0.3586	1902.11	2	3530.0%	2	R.RPLHSAQAVDVASASSFR.A
	TK120303_NMyc_cyto3_step04.0907.0907.3	0.9016	0.0215	4710.45	2	1090.0%	1	R.SLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRR.I
UO3586499.6%3312.3%334375496.5(O35864) 38 kDa MOV34 ISOLOGUE (Kip1 C-terminus interacting protein-2) (COP9 (Constitutive photomorphogenic), subunit 5) (Arabidopsis) 
	TK120303_NMyc_cyto3_step02.3244.3244.2	3.6724	0.5144	1641.97	1	6430.0%	1	K.TTIEAIHGLMSQVIK.D
	TK120303_NMyc_cyto3_step07.4336.4336.2	1.221	0.0928	2473.75	9	2140.0%	1	K.LEQSEAQLGRGSFMLGLETHDR.K
	TK120303_NMyc_cyto3_step06.1661.1661.3	1.5581	0.0293	2134.72	30	2640.0%	1	R.DSCKTTIEAIHGLMSQVIK.D
UPPCE_MOUSE99.6%81016.2%710807525.7(Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) 
	TK120303_NMyc_cyto3_step02.3139.3139.2	3.4225	0.5042	1650.45	1	6430.0%	1	K.NILQLHDLTTGALLK.T
	TK120303_NMyc_cyto3_step01.0312.0312.1	1.4746	0.0619	906.46	10	6430.0%	1	K.AFVEAQNK.I
	TK120303_NMyc_cyto3_step04.1586.1586.1	1.6199	0.274	957.63	1	7140.0%	2	K.YSPLHNVK.L
*	TK120303_NMyc_cyto3_step10.3085.3085.2	1.2513	0.0311	2488.08	10	2140.0%	1	R.EVTVKGIDAADYQTIQIFYPSK.D
	TK120303_NMyc_cyto3_step02.2169.2169.1	1.0851	0.0669	1365.71	5	4550.0%	1	K.QSNPLLIHVDTK.A
	TK120303_NMyc_cyto3_step11.4114.4114.3	2.1638	0.1093	4118.69	1	1510.0%	1	K.RLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLK.F
	TK120303_NMyc_cyto3_step09.1179.1179.1	1.3285	0.2671	994.44	1	4500.0%	1	K.AGHGAGKPTAK.V
UQ922Y799.6%4103.2%464510285.3(Q922Y7) Unknown (Protein for MGC:6388) 
	TK120303_NMyc_cyto3_step07.2812.2812.2	3.9205	0.4934	1519.91	1	7500.0%	3	R.LLIHQSLAGGIIGVK.G
UPE15_MOUSE99.6%4633.8%130150545.0(Q62048) Astrocytic phosphoprotein PEA-15 
	TK120303_NMyc_cyto3_step03.3251.3251.2	2.8415	0.4196	1479.98	1	7730.0%	1	R.RPDLLTMVVDYR.T
	TK120303_NMyc_cyto3_step03.3311.3311.2	4.0622	0.6438	2172.24	1	4440.0%	2	K.SEEITTGSAWFSFLESHNK.L
*	TK120303_NMyc_cyto3_step05.3513.3513.1	1.3581	0.0795	1532.72	3	4170.0%	1	R.VLKISEEEELDTK.L
UQ9D1A299.6%3317.9%475527675.7(Q9D1A2) 0610010E05Rik protein (RIKEN cDNA 0610010E05 gene) 
	TK120303_NMyc_cyto3_step03.3002.3002.2	3.9955	0.5432	1878.16	1	5280.0%	1	R.YPSLSLHGIEGAFSGSGAK.T
	TK120303_NMyc_cyto3_step10.3230.3230.3	1.7544	0.0013	3803.03	39	1180.0%	1	R.EGGSIPVTLTFQEATGKNVMLLPVGSADDGAHSQNEK.L
	TK120303_NMyc_cyto3_step07.2775.2775.3	1.4132	0.0406	3321.27	186	1340.0%	1	K.TVCIYGHLDVQPAALEDGWDSEPFTLVER.E
UDHA1_MOUSE99.6%6815.4%500543197.8(P24549) Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Aldehyde dehydrogenase, cytosolic) (ALDH class 1) (ALHDII) (ALDH-E1) 
	TK120303_NMyc_cyto3_step08.3120.3120.2	1.7423	0.3093	1982.15	79	2190.0%	1	R.QAFQIGSPWRTMDASER.G
	TK120303_NMyc_cyto3_step04.3138.3138.2	2.1364	0.4073	2412.45	1	3500.0%	2	K.KFPVLNPATEEVICHVEEGDK.A
*	TK120303_NMyc_cyto3_step08.2100.2100.3	1.3565	0.0171	1560.86	5	2830.0%	1	-.SSPAQPAVPAPLADLK.I
	TK120303_NMyc_cyto3_step10.2021.2021.2	1.3146	0.0344	2287.42	144	2110.0%	1	K.FPVLNPATEEVICHVEEGDK.A
*	TK120303_NMyc_cyto3_step02.2804.2804.2	1.2397	0.0124	2832.61	44	2050.0%	1	R.REPIGVCGQIIPWNFPMLMFIWK.I
UVAB2_MOUSE99.6%6817.0%511565515.8(P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) 
	TK120303_NMyc_cyto3_step11.2313.2313.2	1.1879	0.0111	2056.85	4	2650.0%	1	R.KDHADVSNQLYACYAIGK.D
	TK120303_NMyc_cyto3_step06.2891.2891.2	3.6938	0.5991	2179.87	1	4740.0%	2	K.IPIFSAAGLPHNEIAAQICR.Q
	TK120303_NMyc_cyto3_step06.2520.2520.2	2.0365	0.0709	1595.46	1	5830.0%	1	K.RIPQSTLSEFYPR.D
	TK120303_NMyc_cyto3_step10.2929.2929.2	1.0682	0.0895	2472.22	498	1190.0%	1	R.GPVVLAEDFLDIMGQPINPQCR.I
	TK120303_NMyc_cyto3_step05.1645.1645.2	1.4094	0.0222	1598.58	415	2310.0%	1	R.QIYPPINVLPSLSR.L
UCAZ2_MOUSE99.6%5926.9%286329675.8(P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) 
	TK120303_NMyc_cyto3_step03.3198.3198.2	2.688	0.4982	2104.43	1	4120.0%	2	K.FIIHAPPGEFNEVFNDVR.L
	TK120303_NMyc_cyto3_step06.2768.2768.3	1.5761	0.0043	4274.77	3	1320.0%	1	R.EGAAHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGK.F
*	TK120303_NMyc_cyto3_step04.2846.2846.2	3.7553	0.5899	2302.6	1	5790.0%	2	K.KVDGQQTIIACIESHQFQAK.N
USPS1_HUMAN99.6%4812.0%383422686.4(P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1) 
*	TK120303_NMyc_cyto3_step12.2970.2970.2	1.0247	0.054	3181.97	25	1500.0%	2	R.TAAGLMHTFNTHAATDITGFGILGHAQNLAK.Q
	TK120303_NMyc_cyto3_step03.3327.3327.2	3.9777	0.5199	1680.84	1	7140.0%	2	R.NEVSFVIHNLPVLAK.M
UP137_MOUSE99.6%224.1%656735485.4(Q60865) GPI-anchored protein p137 (p137GPI) 
	TK120303_NMyc_cyto3_step01.1367.1367.1	1.3082	0.0193	998.47	1	6430.0%	1	R.DGYQQNFK.R
	TK120303_NMyc_cyto3_step03.3526.3526.2	3.9665	0.5954	2295.57	1	5000.0%	1	R.LNEQYEHASIHLWDLLEGK.E
USPCO_MOUSE99.6%11138.2%23632744216.0(Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) 
	TK120303_NMyc_cyto3_step08.1254.1254.3	1.6771	0.1477	2897.87	8	1770.0%	1	R.MHTTFEHDIQALGTQVRQLQEDAAR.L
	TK120303_NMyc_cyto3_step03.3484.3484.2	4.8093	0.6163	2339.16	1	6050.0%	1	K.HQILEQAVEDYAETVHQLSK.T
	TK120303_NMyc_cyto3_step07.2620.2620.2	0.8346	0.0427	1721.33	49	2500.0%	1	K.LLDPEDISVDHPDEK.S
*	TK120303_NMyc_cyto3_step03.4020.4020.3	1.5483	0.0597	3860.06	18	1210.0%	1	R.LEEAHKAQQYYFDAAEAEAWMSEQELYMMSEK.R
	TK120303_NMyc_cyto3_step11.2011.2011.2	1.2078	0.0686	2484.18	54	1430.0%	1	K.SNAHYNLQNAFNLAEQHLGLTK.L
	TK120303_NMyc_cyto3_step07.1624.1624.2	1.0314	0.0019	1266.17	17	3500.0%	1	K.DLTSVMRLLSK.H
*	TK120303_NMyc_cyto3_step04.2912.2912.3	2.0499	0.1122	3416.08	3	1670.0%	1	K.HDTSASTQSTPASSRAQTLPTSVVTITSESSPGK.R
	TK120303_NMyc_cyto3_step07.1547.1547.3	1.6874	0.031	1793.56	28	3000.0%	1	K.HALVEADIAIQAERVR.G
	TK120303_NMyc_cyto3_step01.0658.0658.1	1.0801	2.0E-4	460.29	1	8330.0%	2	R.LLSK.H
*	TK120303_NMyc_cyto3_step12.3190.3190.2	1.4823	0.0719	2035.84	13	2650.0%	1	R.TSTDHGHNLQTVQLLIKK.N
UEZRI_MOUSE99.6%334.1%585692156.1(P26040) Ezrin (p81) (Cytovillin) (Villin 2) 
	TK120303_NMyc_cyto3_step04.1598.1598.1	2.4145	0.5088	1494.88	1	5910.0%	1	R.THNDIIHNENMR.Q
	TK120303_NMyc_cyto3_step06.1659.1659.2	3.6703	0.4382	1473.47	1	7730.0%	1	R.RKPDTIEVQQMK.A
UICAL_MOUSE99.6%577.2%788849225.5(P51125) Calpain inhibitor (Calpastatin) 
	TK120303_NMyc_cyto3_step04.1671.1671.1	0.9406	0.1372	492.25	3	8330.0%	1	K.HAHK.E
	TK120303_NMyc_cyto3_step10.2728.2728.2	1.4447	0.0435	2710.69	123	1400.0%	1	K.GVVPEDAVETLAGSLGTREADPEHEK.T
	TK120303_NMyc_cyto3_step04.2931.2931.2	1.2614	0.096	2283.63	2	2500.0%	1	K.LASLKGVVPEDAVETLAGSLGTR.E
*	TK120303_NMyc_cyto3_step08.1558.1558.2	4.2759	0.5387	2126.39	1	3810.0%	2	K.AASLGSSQPSRPHVGEAATATK.V
UIMB1_MOUSE99.6%5514.3%876971524.8(P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG) 
	TK120303_NMyc_cyto3_step01.3167.3167.2	1.1739	0.0175	2566.69	10	2140.0%	1	K.ESTLEAIGYICQDIDPEQLQDK.S
	TK120303_NMyc_cyto3_step10.3065.3065.3	1.8045	0.0379	4036.35	23	1150.0%	1	R.VEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGK.D
	TK120303_NMyc_cyto3_step03.1618.1618.2	1.7957	0.1391	1880.0	2	4330.0%	1	K.LLETTDRPDGHQNNLR.S
*	TK120303_NMyc_cyto3_step05.2241.2241.3	1.6348	0.1059	3470.42	10	1550.0%	1	K.AAGVCLMLLSTCCEDDIVPHVLPFIKEHIK.N
	TK120303_NMyc_cyto3_step02.3695.3695.2	5.249	0.6283	2123.92	1	7220.0%	1	K.VQHQDALQISDVVMASLLR.M
UK6PL_MOUSE99.6%132317.6%780853017.1(P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) 
*	TK120303_NMyc_cyto3_step09.2624.2624.3	1.7146	0.0468	4253.47	6	1410.0%	1	K.ISESTAQNYAHLTIAGLVGSIDNDFCGTDMTIGTDSALHR.I
	TK120303_NMyc_cyto3_step01.0422.0422.1	0.9826	0.1102	547.31	1	7500.0%	1	R.ILSSK.M
	TK120303_NMyc_cyto3_step04.2479.2479.2	4.7008	0.6461	1911.06	1	6470.0%	3	R.TNVLGHLQQGGAPTPFDR.N
*	TK120303_NMyc_cyto3_step11.2450.2450.2	2.7975	0.477	1733.48	1	5000.0%	2	R.TLPKPHLEAIVENLR.T
	TK120303_NMyc_cyto3_step06.1611.1611.1	0.7252	0.0716	919.45	189	4380.0%	1	R.IKQSASGTK.R
*	TK120303_NMyc_cyto3_step02.2693.2693.2	3.8258	0.514	2230.91	1	4250.0%	1	R.TGISEGHTVYIVHDGFEGLAK.G
	TK120303_NMyc_cyto3_step04.1308.1308.1	1.112	0.0399	709.6	14	6000.0%	1	K.LLAHQK.V
*	TK120303_NMyc_cyto3_step01.3866.3866.1	1.8461	0.0874	1418.71	1	5450.0%	1	R.NEWGSLLEELVK.E
*	TK120303_NMyc_cyto3_step10.1175.1175.1	1.6944	0.2551	1205.29	1	5000.0%	2	R.HGKPISSSYVK.D
UQ9CQ6099.6%81250.6%257272545.8(Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) 
*	TK120303_NMyc_cyto3_step11.3007.3007.3	2.0507	0.0118	3899.66	7	1350.0%	1	-.MAAPAPSLISVFSSPQELGASLAQLVAQRAASCLEGDR.G
*	TK120303_NMyc_cyto3_step01.3375.3375.2	3.381	0.3922	2808.82	1	3600.0%	1	K.LPIPDSQVLTINPALPVEDAAEDYAR.K
*	TK120303_NMyc_cyto3_step04.3851.3851.2	3.535	0.5919	2344.24	1	3640.0%	2	R.VTLTLPVLNAAQSIIFVATGEGK.A
*	TK120303_NMyc_cyto3_step09.3084.3084.2	1.3293	0.0565	2495.27	2	2380.0%	1	R.TGALCWFLDEAAARLLSVPFEK.H
	TK120303_NMyc_cyto3_step07.1680.1680.2	1.7804	0.2464	1603.42	1	5000.0%	2	K.IVAPISDSPKPPPQR.V
*	TK120303_NMyc_cyto3_step04.1510.1510.1	1.2093	0.2355	698.51	2	7000.0%	1	R.THLLSK.L
UDYHC_MOUSE99.6%17195.8%46445320306.4(Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) 
	TK120303_NMyc_cyto3_step01.3334.3334.1	1.2226	0.0441	1349.52	3	5000.0%	1	K.TSAPITCELLNK.Q
	TK120303_NMyc_cyto3_step01.3714.3714.2	4.2803	0.58	2599.81	1	4320.0%	1	R.FGNPLLVQDVESYDPVLNPVLNR.E
	TK120303_NMyc_cyto3_step11.2327.2327.2	1.4787	0.1382	2864.46	2	2170.0%	1	R.CVLNWFGDWSTEALYQVGKEFTSK.M
*	TK120303_NMyc_cyto3_step09.2905.2905.3	1.9157	0.1794	3436.24	19	1470.0%	1	R.VLTLSEDSPYETLHSFISNAVAPFFKSYIR.E
	TK120303_NMyc_cyto3_step07.3153.3153.2	1.1554	0.24	1982.25	3	3210.0%	1	K.SFEWLSQMRFYFDPK.Q
*	TK120303_NMyc_cyto3_step04.1828.1828.2	3.5712	0.5732	2636.0	1	3480.0%	1	R.VLRPQVTAVAQQNQGEAPEPQDMK.V
	TK120303_NMyc_cyto3_step09.1584.1584.1	1.0288	0.036	1200.53	9	4440.0%	1	R.TSFLDDAFRK.N
	TK120303_NMyc_cyto3_step11.2545.2545.3	1.4785	0.0026	3385.38	2	1810.0%	1	K.NLESALRFGNPLLVQDVESYDPVLNPVLNR.E
	TK120303_NMyc_cyto3_step11.3482.3482.2	1.4023	0.0243	2427.85	3	2780.0%	1	K.QIREVWNTYELDLVNYQNK.C
*	TK120303_NMyc_cyto3_step06.1924.1924.2	1.7718	0.1611	1751.99	3	3670.0%	1	K.RAPVIDADKPVSSQLR.V
*	TK120303_NMyc_cyto3_step03.3835.3835.2	1.7558	0.205	2945.6	1	2120.0%	2	R.MPDGPVALEESYSAVMGIVTEVEQYVK.V
	TK120303_NMyc_cyto3_step07.1824.1824.3	1.7345	0.1099	2418.32	1	3000.0%	1	R.WQASSLPADDLCTENAIMLKR.F
	TK120303_NMyc_cyto3_step06.2035.2035.1	1.4381	0.2092	1155.52	1	5000.0%	1	R.KPLSHRFLR.H
*	TK120303_NMyc_cyto3_step02.1523.1523.1	1.3766	0.039	1179.58	8	5000.0%	1	K.VPQIEVETHK.V
	TK120303_NMyc_cyto3_step01.0710.0710.1	0.9478	0.0659	444.43	1	10000.0%	1	K.RGGR.T
*	TK120303_NMyc_cyto3_step04.2734.2734.2	2.2279	0.0874	1891.55	1	3750.0%	1	K.LLTLPNGERLSLPPNVR.I
USYS_MOUSE99.6%6615.9%511582586.3(P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) 
	TK120303_NMyc_cyto3_step01.2528.2528.1	1.4389	0.0136	1512.66	21	3640.0%	1	R.DEWLRPEDLPIK.Y
	TK120303_NMyc_cyto3_step03.1304.1304.1	1.7094	0.3289	787.58	1	8000.0%	1	R.VHQFEK.I
*	TK120303_NMyc_cyto3_step01.4050.4050.2	3.0002	0.5345	2932.2	1	3150.0%	1	K.EAVGDDESVPENVLNFDDLTADALAALK.V
	TK120303_NMyc_cyto3_step03.0574.0574.3	1.2618	0.0568	2051.36	5	2210.0%	1	K.KYSHVDLVVMVDGFEGEK.G
*	TK120303_NMyc_cyto3_step01.2132.2132.1	1.3199	0.0666	1043.69	9	5620.0%	1	R.LLIDEAIQK.C
	TK120303_NMyc_cyto3_step01.0356.0356.1	1.0905	0.0058	718.41	37	5710.0%	1	K.GAVVAGSR.G
UQ8R1H099.6%41067.1%7382824.9(Q8R1H0) Hypothetical 8.3 kDa protein 
*	TK120303_NMyc_cyto3_step02.3707.3707.2	1.4604	0.0887	2916.15	76	1600.0%	1	-.MSAQTASGPTEDQVEILEYNFNKVNK.H
*	TK120303_NMyc_cyto3_step04.3099.3099.2	2.1881	0.1792	2524.72	1	3410.0%	3	K.HPDPTTLCLIAAEAGLTEEQTQK.W
UCO3_MOUSE99.6%142210.0%16631864826.8(P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] 
*	TK120303_NMyc_cyto3_step07.2693.2693.2	4.5972	0.655	1787.63	1	7670.0%	2	K.VHQYFNVGLIQPGSVK.V
*	TK120303_NMyc_cyto3_step08.3615.3615.2	2.5555	0.5073	2874.15	1	2830.0%	3	K.TELTNIKLLDDFDEYTMTIQQVIK.S
*	TK120303_NMyc_cyto3_step02.2248.2248.2	0.9531	0.0795	2075.04	11	1880.0%	1	K.LLDDFDEYTMTIQQVIK.S
*	TK120303_NMyc_cyto3_step08.2718.2718.3	1.5483	0.0259	3968.64	283	1030.0%	1	K.HLIVTPAGCGEQNMIGMTPTVIAVHYLDQTEQWEK.F
	TK120303_NMyc_cyto3_step06.1805.1805.1	0.8398	0.035	446.27	1	10000.0%	1	R.QATK.T
*	TK120303_NMyc_cyto3_step07.3416.3416.2	1.4092	0.2029	2386.95	7	2500.0%	1	R.SHFPQSWLWTIEELKEPEK.N
*	TK120303_NMyc_cyto3_step05.2633.2633.2	2.7372	0.4133	1897.99	1	4670.0%	1	R.MELKPGDNLNVNFHLR.T
*	TK120303_NMyc_cyto3_step04.1607.1607.2	1.531	0.0454	1780.94	7	3670.0%	1	K.DSITTWEILAVSLSDK.K
*	TK120303_NMyc_cyto3_step02.2143.2143.1	1.2462	0.0688	1099.9	101	5000.0%	1	K.RQEALELIK.K
*	TK120303_NMyc_cyto3_step04.1726.1726.1	1.3515	0.0657	1113.48	95	3000.0%	1	K.TVLTGASGHLR.S
*	TK120303_NMyc_cyto3_step11.2441.2441.2	1.3611	0.0038	1752.99	4	3670.0%	1	K.TVVILIETPDGIPVKR.D
UQ91WJ899.6%689.5%651685407.9(Q91WJ8) Similar to far upstream element (FUSE) binding protein 1 
	TK120303_NMyc_cyto3_step07.4414.4414.1	0.6794	0.2373	989.02	128	2500.0%	1	K.AWEEYYK.K
	TK120303_NMyc_cyto3_step02.2179.2179.1	0.9825	0.0070	1113.66	69	4380.0%	1	K.RLLDQIVEK.G
	TK120303_NMyc_cyto3_step02.3193.3193.1	2.6232	0.3228	1541.5	1	5000.0%	2	R.CQHAAEIITDLLR.S
*	TK120303_NMyc_cyto3_step11.3711.3711.2	2.0379	0.293	3165.52	1	2190.0%	1	-.MADYSTVPPPSSGSAGGGGGGVVNDAFKDALQR.A
UPRS8_HUMAN99.6%336.2%406456267.5(P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) 
	TK120303_NMyc_cyto3_step08.0185.0185.1	0.6393	0.0481	1282.5	20	2000.0%	1	R.LQAQRNELNAK.V
	TK120303_NMyc_cyto3_step03.3030.3030.1	2.9467	0.1321	1551.76	1	5380.0%	1	K.HPELFEALGIAQPK.G
UACF7_MOUSE99.6%29378.4%53276079845.5(Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) 
	TK120303_NMyc_cyto3_step01.0204.0204.1	1.1385	0.0643	788.46	4	6670.0%	1	K.NVDQAIK.N
*	TK120303_NMyc_cyto3_step07.2593.2593.2	1.416	0.0983	1907.7	44	2350.0%	1	K.DLQGDIQSHSTSFATAVK.D
*	TK120303_NMyc_cyto3_step07.2313.2313.3	1.5307	0.0248	3082.46	14	1610.0%	1	K.NLNQHSGSYEVIVAEGEALLLSVPPGEEK.K
	TK120303_NMyc_cyto3_step07.1672.1672.2	1.3304	0.0812	1263.16	2	6110.0%	1	K.LLEVWIEFGR.I
*	TK120303_NMyc_cyto3_step09.2189.2189.3	1.2075	0.0573	2435.52	32	1880.0%	1	K.MFELQVTLDPVQLESSLLRSK.A
	TK120303_NMyc_cyto3_step05.0569.0569.1	0.8262	0.0678	476.44	17	6670.0%	1	K.RSGR.E
*	TK120303_NMyc_cyto3_step11.1623.1623.2	1.9362	0.1841	2237.51	1	4170.0%	1	K.EAQTLCQELSLLIGEQYLK.D
*	TK120303_NMyc_cyto3_step06.1572.1572.3	2.119	0.2603	2804.56	4	2050.0%	1	K.NCDVQGLEHDMDEINTRWNTLNK.K
	TK120303_NMyc_cyto3_step10.3729.3729.3	1.9688	0.029	3959.97	131	1100.0%	1	K.LERAEWGNDLPSVELQLETQQHIHTSVEELGSSVK.E
*	TK120303_NMyc_cyto3_step08.3126.3126.3	7.2471	0.7273	3962.17	1	2950.0%	2	R.HQELLSQQQNFIVATQSAQSFLDQHSHNLTPEER.Q
*	TK120303_NMyc_cyto3_step04.0528.0528.1	0.9319	0.0905	945.19	63	4380.0%	1	K.QIQSPASSK.T
	TK120303_NMyc_cyto3_step04.2798.2798.2	1.5264	0.1869	1999.5	25	2500.0%	1	K.AQQEVLQALEPQVDYLR.N
	TK120303_NMyc_cyto3_step05.2432.2432.3	1.8542	0.014	3337.85	55	1170.0%	1	R.RGSDASDFDLLETQSACSDTSESSAAGGQGSSR.R
*	TK120303_NMyc_cyto3_step09.2792.2792.2	1.6239	0.0586	2166.87	7	2630.0%	1	K.GHFSSLELVPPSTLTTTHLK.A
*	TK120303_NMyc_cyto3_step06.3671.3671.2	2.0386	0.4622	2774.41	1	2920.0%	3	R.SLLEILNSAADILINSSEIDEDEIR.D
*	TK120303_NMyc_cyto3_step04.2846.2846.3	2.0508	0.1318	3453.39	12	1550.0%	1	R.SDLGQLDNEIKEAQTLCQELSLLIGEQYLK.D
	TK120303_NMyc_cyto3_step03.2947.2947.3	1.5987	0.0433	4396.95	7	1280.0%	1	R.NDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAK.E
*	TK120303_NMyc_cyto3_step02.2197.2197.3	1.3885	0.0064	3737.35	26	1360.0%	1	K.LQQVNGLGQGLIQSAGKNCDVQGLEHDMDEINTR.W
*	TK120303_NMyc_cyto3_step04.1396.1396.1	1.3518	0.2402	814.45	1	7500.0%	1	K.WHAVSSK.V
	TK120303_NMyc_cyto3_step02.1032.1032.2	1.0849	0.0133	1353.56	15	4000.0%	1	K.AQIQEQKLLQR.L
	TK120303_NMyc_cyto3_step08.1888.1888.1	0.8569	0.0605	863.19	12	5830.0%	1	R.HLQSLHK.F
	TK120303_NMyc_cyto3_step06.1151.1151.1	0.5256	0.0454	459.37	3	7500.0%	1	R.FHR.L
	TK120303_NMyc_cyto3_step04.1819.1819.2	1.0732	0.0303	1489.72	7	4170.0%	1	K.RQGSFSEDVISHK.G
	TK120303_NMyc_cyto3_step08.3439.3439.3	2.1118	0.2844	3552.26	32	1250.0%	1	K.LEMTAVADIFDRDGDGYIDYYEFVAALHPNK.D
	TK120303_NMyc_cyto3_step02.1319.1319.1	1.1253	0.072	767.72	3	6000.0%	1	K.QIEHLK.D
UDPY2_MOUSE99.6%163027.3%572621716.4(O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) 
	TK120303_NMyc_cyto3_step02.2460.2460.2	5.2298	0.5711	2171.52	1	7110.0%	2	R.NLHQSGFSLSGAQIDDNIPR.R
	TK120303_NMyc_cyto3_step02.2175.2175.1	1.1937	0.1668	1294.69	14	3640.0%	1	R.MVIPGGIDVHTR.F
	TK120303_NMyc_cyto3_step05.1148.1148.1	1.1483	0.0729	736.42	3	7000.0%	1	R.EWADSK.S
	TK120303_NMyc_cyto3_step04.2714.2714.2	3.696	0.5664	2554.99	1	4130.0%	2	K.KGTVVYGEPITASLGTDGSHYWSK.N
*	TK120303_NMyc_cyto3_step02.2928.2928.2	4.6162	0.6051	2072.76	1	6250.0%	1	K.THNSALEYNIFEGMECR.G
	TK120303_NMyc_cyto3_step03.4243.4243.2	3.0461	0.5131	2352.52	1	3420.0%	2	K.IVNDDQSFYADIYMEDGLIK.Q
	TK120303_NMyc_cyto3_step01.1770.1770.1	2.3003	0.3281	1086.65	1	7000.0%	2	R.GSPLVVISQGK.I
*	TK120303_NMyc_cyto3_step01.1514.1514.1	1.2035	0.0837	1015.62	2	5560.0%	1	K.SAAEVIAQAR.K
	TK120303_NMyc_cyto3_step02.2908.2908.2	1.6626	0.2934	2902.65	4	2120.0%	1	R.ILDLGITGPEGHVLSRPEEVEAEAVNR.S
	TK120303_NMyc_cyto3_step04.2338.2338.1	2.0315	0.3109	1141.56	1	7500.0%	3	R.KPFPDFVYK.R
UFKB4_MOUSE99.6%61012.9%457514415.7(P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) 
	TK120303_NMyc_cyto3_step06.2635.2635.2	3.6631	0.4985	2041.03	1	4440.0%	2	K.GEHSIVYLKPSYAFGSVGK.E
*	TK120303_NMyc_cyto3_step04.1935.1935.3	2.1859	0.2472	2495.0	1	2610.0%	2	K.VGEVCHITCKPEYAYGAAGSPPK.I
*	TK120303_NMyc_cyto3_step11.3874.3874.3	1.8595	0.0543	4468.36	38	1150.0%	1	K.VGEVCHITCKPEYAYGAAGSPPKIPPNATLVFEVELFEFK.G
UQ8VCI599.6%2214.4%299327334.3(Q8VCI5) Peroxisomal farnesylated protein 
	TK120303_NMyc_cyto3_step12.2068.2068.2	1.8306	0.2371	2508.78	5	1900.0%	1	K.ELAEEEPHLVEQFQKLSEAAGR.V
*	TK120303_NMyc_cyto3_step09.1567.1567.2	4.2502	0.6388	2087.58	1	5000.0%	1	K.AKPSPEHAPTISAPDASGPQK.R
USAD1_MOUSE99.6%4412.0%627726508.0(Q60710) SAM domain and HD domain-containing protein 1 (Interferon-gamma inducible protein Mg11) 
*	TK120303_NMyc_cyto3_step03.3136.3136.2	4.3386	0.6328	2244.16	1	5560.0%	1	K.HEQGSIEMFEHLVNSNELK.L
*	TK120303_NMyc_cyto3_step12.2907.2907.2	4.1483	0.5954	2154.45	1	5880.0%	1	K.VFNDPIHGHIEFHPLLIR.I
*	TK120303_NMyc_cyto3_step12.4304.4304.2	1.1621	0.0885	2201.79	1	3060.0%	1	K.EQIMGPPITPVKDSLWPYK.G
*	TK120303_NMyc_cyto3_step01.3102.3102.2	1.6074	0.1922	2084.39	5	3060.0%	1	R.DFTKPQDGDIIAPLITPLK.W
UGFA1_MOUSE99.6%6814.4%680765926.8(P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) 
	TK120303_NMyc_cyto3_step05.2433.2433.2	1.3665	0.1435	2313.95	1	2630.0%	1	K.FLESKGYDFESETDTETIAK.L
*	TK120303_NMyc_cyto3_step09.1653.1653.2	3.795	0.5165	1827.42	1	5670.0%	1	R.WATHGEPNPVNSHPQR.S
	TK120303_NMyc_cyto3_step06.3392.3392.2	1.4942	0.1075	2723.52	3	1880.0%	1	K.EITYMHSEGILAGELKHGPLALVDK.L
	TK120303_NMyc_cyto3_step07.1885.1885.3	1.7981	0.171	2237.9	3	2630.0%	1	K.SVLIMGRGYHYATCLEGALK.I
	TK120303_NMyc_cyto3_step06.2113.2113.2	1.8885	0.0796	1986.64	9	3120.0%	2	R.LPDLIKEVLSMDDEIQK.L
UDYNA_MOUSE99.6%142814.1%12811417276.0(O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) 
*	TK120303_NMyc_cyto3_step09.4171.4171.2	1.9361	0.0522	1573.66	6	4580.0%	2	K.VQTRLDETQTLLR.K
	TK120303_NMyc_cyto3_step07.1552.1552.2	0.9893	0.0146	1887.82	165	2330.0%	1	K.AIEMELRQMEVAQANR.H
	TK120303_NMyc_cyto3_step02.2304.2304.1	1.716	0.0378	1401.86	1	6000.0%	1	K.NQELEVVRQQR.E
*	TK120303_NMyc_cyto3_step10.2356.2356.1	1.2593	0.0902	1543.61	10	2940.0%	1	R.GGAPGQAPGALPGPGLVK.D
*	TK120303_NMyc_cyto3_step02.3455.3455.3	1.3367	0.0595	4295.96	27	1120.0%	1	R.KHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFK.A
*	TK120303_NMyc_cyto3_step11.3742.3742.2	1.7575	0.1476	2032.89	21	2250.0%	1	R.GPPPSGIATLVSGIAGEEPQR.G
	TK120303_NMyc_cyto3_step06.3376.3376.2	2.3382	0.0354	2088.14	5	3330.0%	1	R.LRAFLQGGQEATDIALLLR.D
	TK120303_NMyc_cyto3_step12.4330.4330.2	1.5701	0.0403	1316.86	40	4550.0%	4	K.WVGVILDEAKGK.N
	TK120303_NMyc_cyto3_step08.2140.2140.2	3.5286	0.5842	1702.4	1	5770.0%	1	R.LVLTQEQLHQLHSR.L
*	TK120303_NMyc_cyto3_step07.2115.2115.2	4.3872	0.5866	1734.7	1	6790.0%	1	K.LNQLSTHTHVVDITR.S
UYAP1_MOUSE99.6%117.8%472507035.0(P46938) 65 kDa Yes-associated protein (YAP65) 
*	TK120303_NMyc_cyto3_step12.2395.2395.3	5.2512	0.6268	3435.11	1	2500.0%	1	R.AHSSPASLQLGAVSPGTLTASGVVSGPAAAPAAQHLR.Q
ULKHA_MOUSE99.6%142621.5%610688906.4(P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) 
	TK120303_NMyc_cyto3_step08.3186.3186.2	4.8485	0.5567	2407.96	1	5240.0%	2	K.SLSNVIAHEISHSWTGNLVTNK.T
*	TK120303_NMyc_cyto3_step05.2833.2833.3	1.7279	0.0050	3253.78	6	1830.0%	1	K.QHPYLFSQCQAIHCRAILPCQDTPSVK.L
*	TK120303_NMyc_cyto3_step12.2211.2211.3	1.4594	0.0016	2115.28	311	2080.0%	1	K.VVINGQEVKYTLGESQGYK.G
*	TK120303_NMyc_cyto3_step06.1351.1351.1	2.4736	0.3318	1581.52	1	5000.0%	3	K.SHDQAVHTYQEHK.A
	TK120303_NMyc_cyto3_step05.3069.3069.2	3.294	0.5426	2204.38	1	5620.0%	2	K.TWDHFWLNEGHTVYLER.H
*	TK120303_NMyc_cyto3_step11.2437.2437.2	1.3368	0.153	1809.44	4	3000.0%	1	R.HFHALGGWGELQNTIK.T
	TK120303_NMyc_cyto3_step11.1195.1195.1	1.2574	0.0253	906.34	1	6670.0%	2	R.TQHLHLR.C
*	TK120303_NMyc_cyto3_step02.1607.1607.1	1.5452	0.1312	1150.89	1	5560.0%	1	K.TFGESHPFTK.L
UG6PI_MOUSE99.6%111527.3%557626377.9(P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) 
	TK120303_NMyc_cyto3_step10.2734.2734.3	4.6042	0.5594	3317.68	1	2410.0%	1	R.VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK.M
*	TK120303_NMyc_cyto3_step10.2494.2494.3	2.1085	0.1871	3537.64	1	1810.0%	1	R.ELFEADPERFNNFSLNLNTNHGHILVDYSK.N
	TK120303_NMyc_cyto3_step05.2003.2003.1	1.3608	0.0864	878.67	2	6430.0%	1	R.AVLHVALR.N
*	TK120303_NMyc_cyto3_step02.2965.2965.2	3.6965	0.5615	2847.71	1	3850.0%	1	K.KIEPELEGSSAVTSHDSSTNGLISFIK.Q
	TK120303_NMyc_cyto3_step03.2160.2160.2	2.8873	0.2985	1711.19	2	5000.0%	1	K.VFEGNRPTNSIVFTK.L
*	TK120303_NMyc_cyto3_step12.1103.1103.3	2.1874	0.2275	2719.76	1	2300.0%	1	K.IEPELEGSSAVTSHDSSTNGLISFIK.Q
	TK120303_NMyc_cyto3_step03.1779.1779.1	2.3922	0.3289	1188.59	1	6500.0%	2	K.HFVALSTNTAK.V
*	TK120303_NMyc_cyto3_step02.2791.2791.1	2.3869	0.3616	1587.78	1	4620.0%	1	R.VWFVSNIDGTHIAK.T
	TK120303_NMyc_cyto3_step04.3222.3222.2	2.8353	0.2016	2065.85	1	5000.0%	2	K.MIPCDFLIPVQTQHPIR.K
UQ9ESF799.6%2210.0%419487386.1(Q9ESF7) Sep2 (Fragment) 
*	TK120303_NMyc_cyto3_step06.2081.2081.2	3.6658	0.5794	1941.89	1	6330.0%	1	R.LRPQTYDLQESNVHLK.L
	TK120303_NMyc_cyto3_step02.0943.0943.2	0.973	0.1237	3009.32	13	1600.0%	1	K.LEEMGFQDSDGDSQPFSLQETYEAKR.K
UQ9R1T299.6%115.7%350386205.4(Q9R1T2) mRNA similar to human SUA1, complete CDS (2400010M20RIK protein) 
*	TK120303_NMyc_cyto3_step01.3851.3851.2	4.1287	0.508	2235.71	1	5530.0%	1	R.NDVFDSLGISPDLLPDDFVR.Y
UP9782599.6%52515.6%154160815.3(P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) 
*	TK120303_NMyc_cyto3_step06.2627.2627.2	3.8322	0.5861	2529.88	1	4350.0%	5	R.VLRPPGGGSNFSLGFDEPAEQPVR.K
UQ9CST499.6%3334.4%183195295.2(Q9CST4) 5830445C04Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step11.3113.3113.2	3.869	0.5458	1893.65	1	5940.0%	1	R.VHVQPVITDLVHGLLPR.L
*	TK120303_NMyc_cyto3_step07.2433.2433.3	2.3635	0.0982	3299.93	33	1250.0%	1	K.VDLLVFNPPYVVTPPEEVGSRGIEAAWAGGR.N
*	TK120303_NMyc_cyto3_step12.4090.4090.2	1.2707	0.0115	1667.4	1	3210.0%	1	R.GLFYLVTVKENNPGN.-
UQ9CYG699.6%247.7%222249486.0(Q9CYG6) 5730478E03Rik protein 
	TK120303_NMyc_cyto3_step03.3072.3072.2	3.845	0.5	1831.76	1	6560.0%	2	R.ATAAFILANEHNVALFK.H
UQ9CWI499.6%2211.5%312349088.2(Q9CWI4) Esterase 10 
	TK120303_NMyc_cyto3_step01.3576.3576.2	3.3131	0.5468	2726.08	1	3860.0%	1	R.MYSYVTEELPQLINANFPVDPQR.M
*	TK120303_NMyc_cyto3_step01.2032.2032.1	1.4234	0.0204	1407.61	9	4170.0%	1	R.FAVYLPPQAESGK.C
UHS9B_MOUSE99.6%215117.4%723831945.0(P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) 
	TK120303_NMyc_cyto3_step04.2623.2623.2	3.3247	0.4965	1786.89	1	6430.0%	3	K.HLEINPDHPIVETLR.Q
	TK120303_NMyc_cyto3_step02.1357.1357.1	1.611	0.2041	1141.68	2	5560.0%	1	K.LGIHEDSTNR.R
	TK120303_NMyc_cyto3_step01.0982.0982.1	1.0037	0.221	951.26	1	5620.0%	1	R.ADHGEPIGR.G
	TK120303_NMyc_cyto3_step04.2219.2219.1	1.403	0.1021	888.58	20	5830.0%	1	R.RLSELLR.Y
	TK120303_NMyc_cyto3_step04.3351.3351.2	4.42	0.6443	1812.79	1	6790.0%	4	K.HSQFIGYPITLYLEK.E
	TK120303_NMyc_cyto3_step01.0874.0874.1	1.0823	0.0618	474.45	3	8330.0%	1	K.NIVK.K
	TK120303_NMyc_cyto3_step01.1384.1384.1	1.4348	0.0687	658.52	1	8000.0%	1	K.VVVITK.H
	TK120303_NMyc_cyto3_step01.2252.2252.1	1.9076	0.2961	1527.6	9	3750.0%	1	K.SLTNDWEDHLAVK.H
	TK120303_NMyc_cyto3_step01.1675.1675.1	1.7469	0.2656	1275.58	1	5450.0%	1	R.ELISNASDALDK.I
	TK120303_NMyc_cyto3_step02.2748.2748.1	1.8521	0.1899	1238.79	12	5560.0%	1	R.RAPFDLFENK.K
	TK120303_NMyc_cyto3_step01.3018.3018.1	1.6816	0.1775	1454.78	13	3180.0%	1	K.CLELFSELAEDK.E
	TK120303_NMyc_cyto3_step01.2272.2272.1	1.8891	0.3811	1351.7	1	6250.0%	4	R.TLTLVDTGIGMTK.A
US3B1_MOUSE99.6%6611.3%13041458167.1(Q99NB9) Splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit) 
	TK120303_NMyc_cyto3_step09.3191.3191.3	1.7074	0.0436	3526.45	119	1250.0%	1	R.QNRVCTTVAIAIVAETCSPFTVLPALMNEYR.V
	TK120303_NMyc_cyto3_step12.2690.2690.3	3.8675	0.4991	3518.02	1	2420.0%	1	K.KPGYHAPVALLNDIPQSTEQYDPFAEHRPPK.I
	TK120303_NMyc_cyto3_step01.1354.1354.1	1.1064	0.0522	614.46	2	7500.0%	1	K.DLLPR.L
	TK120303_NMyc_cyto3_step04.1144.1144.2	1.3074	0.0412	1289.89	121	4230.0%	1	R.AKGSETPGATPGSK.I
	TK120303_NMyc_cyto3_step09.2457.2457.3	2.0502	0.1431	3372.8	13	1550.0%	1	R.NRPLSDEELDAMFPEGYKVLPPPAGYVPIR.T
	TK120303_NMyc_cyto3_step11.3650.3650.3	1.8637	0.1065	3947.99	20	1290.0%	1	K.LEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGK.R
UAATC_MOUSE99.6%3313.8%412461007.2(P05201) Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-1) 
*	TK120303_NMyc_cyto3_step03.3260.3260.2	4.2634	0.5966	1993.0	1	5560.0%	1	-.APPSVFAQVPQAPPVLVFK.L
*	TK120303_NMyc_cyto3_step02.2901.2901.2	1.3934	0.0513	2639.74	8	2170.0%	1	K.NTPIYVSSPTWENHNAVFSAAGFK.D
*	TK120303_NMyc_cyto3_step04.2804.2804.2	1.6173	0.0028	1656.82	12	3080.0%	1	R.TDESQPWVLPVVRK.V
UCOTR_MOUSE99.6%3311.5%418468805.2(P07759) Contrapsin precursor 
	TK120303_NMyc_cyto3_step05.3184.3184.3	1.266	0.0028	3123.51	25	1610.0%	1	K.LSVSQVVHKAVLDVAETGTEAAAATGVIGGIR.K
	TK120303_NMyc_cyto3_step09.1775.1775.1	2.2757	0.2965	1126.69	2	6110.0%	1	K.KLSVSQVVHK.A
	TK120303_NMyc_cyto3_step04.2727.2727.2	3.2428	0.4761	1862.4	1	5360.0%	1	R.HFRDEELSCSVLELK.Y
UQ99KQ299.6%71917.2%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) 
	TK120303_NMyc_cyto3_step05.2113.2113.2	1.1503	0.0426	2204.17	4	2630.0%	4	R.LVSNHSLHETSSVFVDSLTK.V
*	TK120303_NMyc_cyto3_step03.1338.1338.2	2.3491	0.3939	1819.44	1	3890.0%	1	K.VATVPQHATSGPGPADVSK.V
	TK120303_NMyc_cyto3_step11.4142.4142.2	1.9372	0.3523	2834.79	1	2600.0%	1	K.GAIDAKVHSPSGALEECYVTEIDQDK.Y
	TK120303_NMyc_cyto3_step12.2535.2535.2	3.7358	0.5629	2306.51	1	4320.0%	1	K.GQHVPGSPFQFTVGPLGEGGAHK.V
UPRS4_HUMAN99.6%2213.4%440491856.2(Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) 
	TK120303_NMyc_cyto3_step06.2597.2597.3	1.6465	0.1798	4049.85	22	1350.0%	1	R.GTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDK.D
	TK120303_NMyc_cyto3_step02.3368.3368.2	3.356	0.3483	2255.27	1	4250.0%	1	R.VAEEHAPSIVFIDEIDAIGTK.R
UCC37_MOUSE99.6%337.7%379445935.3(Q61081) Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) 
	TK120303_NMyc_cyto3_step01.1683.1683.1	1.5142	0.0078	913.58	93	5830.0%	1	R.QFFTKIK.T
	TK120303_NMyc_cyto3_step02.3295.3295.2	2.9837	0.3637	2425.13	1	3810.0%	1	K.RLGPGGLDPVEVYESLPEELQK.C
	TK120303_NMyc_cyto3_step01.3404.3404.2	4.3501	0.6976	2270.27	1	5500.0%	1	R.LGPGGLDPVEVYESLPEELQK.C
UTPP2_MOUSE99.6%9914.3%12621398786.6(Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) 
*	TK120303_NMyc_cyto3_step04.1362.1362.3	1.336	0.0434	1679.33	95	3080.0%	1	K.AYDYLIQNTSFANR.L
	TK120303_NMyc_cyto3_step11.4237.4237.3	1.5598	0.0837	3927.91	37	1120.0%	1	K.LPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLR.G
*	TK120303_NMyc_cyto3_step04.2990.2990.2	3.546	0.4886	2176.61	1	4740.0%	1	R.LSNTLSLDIHENHSLALLGK.K
	TK120303_NMyc_cyto3_step02.3185.3185.2	1.3692	0.0302	2620.0	43	1670.0%	1	R.GPSADGALGVSISAPGGAIASVPNWTLR.G
*	TK120303_NMyc_cyto3_step04.1628.1628.1	1.0136	0.0288	1257.66	73	4500.0%	1	K.KETGASSFLCR.Y
*	TK120303_NMyc_cyto3_step06.2428.2428.3	1.8444	0.1582	2703.5	5	2160.0%	1	K.YEDLAPCITLKSWVQTLRPVNAK.T
*	TK120303_NMyc_cyto3_step04.2352.2352.1	1.2305	0.047	1555.65	14	3750.0%	1	K.ETYPAYLPLYVAR.L
*	TK120303_NMyc_cyto3_step02.3588.3588.3	2.1617	0.1293	4019.75	3	1380.0%	1	R.GTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVR.R
	TK120303_NMyc_cyto3_step07.2753.2753.2	4.3465	0.6887	2560.31	1	5000.0%	1	K.VNESSHYDLAFTDVHFKPGQIR.R
USH3L_MOUSE99.6%3511.4%114128114.9(Q9JJU8) SH3 domain-binding glutamic acid-rich-like protein 
*	TK120303_NMyc_cyto3_step02.2771.2771.1	3.0415	0.4601	1594.67	1	5420.0%	2	K.KQQDVLCFLEANK.I
UQ8R01699.6%101618.5%455525116.5(Q8R016) Similar to bleomycin hydrolase 
*	TK120303_NMyc_cyto3_step06.2791.2791.2	1.463	0.1336	2375.15	1	3240.0%	1	K.FNIEEFEFSQSYLFFWDK.V
	TK120303_NMyc_cyto3_step07.1233.1233.2	0.7748	0.0605	983.6	1	5000.0%	1	R.MNDILNHK.M
	TK120303_NMyc_cyto3_step02.1377.1377.1	2.095	0.4224	1394.48	1	5910.0%	1	R.VENSWGEDHGHK.G
*	TK120303_NMyc_cyto3_step10.1902.1902.2	0.988	0.0343	2730.04	33	1670.0%	2	R.ATVQGAQHVFQHVVPQEGKPVTNQK.S
	TK120303_NMyc_cyto3_step03.1320.1320.1	1.8707	0.3371	928.53	1	7500.0%	2	R.NLVHSGATK.G
*	TK120303_NMyc_cyto3_step08.1908.1908.2	2.5891	0.4009	1511.98	2	5450.0%	1	K.ICFVNDPRPQHK.Y
UBAG3_MOUSE99.6%468.5%577618287.5(Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) 
*	TK120303_NMyc_cyto3_step07.1631.1631.2	2.5462	0.403	2300.18	1	4170.0%	2	K.THYPAQQGEYQPQQPVYHK.I
*	TK120303_NMyc_cyto3_step11.1998.1998.2	1.8386	0.1	2228.2	1	2730.0%	1	K.VSSAPIPCPSPSPAPSAVPSPPK.N
*	TK120303_NMyc_cyto3_step04.2199.2199.3	1.839	0.0856	2971.07	21	1640.0%	1	K.VSSAPIPCPSPSPAPSAVPSPPKNVAAEQK.A
UQ91VW399.6%41635.5%93104775.1(Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3 
*	TK120303_NMyc_cyto3_step09.3608.3608.3	4.2325	0.4713	3828.58	1	2340.0%	4	K.ATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLK.L
UO1525099.6%112.4%623698595.6(O15250) Aminopeptidase P-like (EC 3.4.11.9) (XAA-PRO aminopeptidase) (X-PRO aminopeptidase) (Proline aminopeptidase) (Aminoacylproline aminopeptidase) (Soluble aminopeptidase P) 
*	TK120303_NMyc_cyto3_step04.2222.2222.1	2.7592	0.5583	1455.78	1	6430.0%	1	K.GHIAVSAAVFPTGTK.G
UTTHY_MOUSE99.6%85022.4%147157766.2(P07309) Transthyretin precursor (Prealbumin) 
*	TK120303_NMyc_cyto3_step01.1411.1411.1	1.3162	0.0656	942.73	1	5000.0%	1	R.GSPAVDVAVK.V
*	TK120303_NMyc_cyto3_step11.3114.3114.2	2.4471	0.4151	2520.81	1	3410.0%	7	K.TLGISPFHEFADVVFTANDSGHR.H
UPGK1_MOUSE99.6%131936.8%416444057.6(P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) 
	TK120303_NMyc_cyto3_step03.3330.3330.2	4.0177	0.4113	1770.55	1	5940.0%	1	K.ALESPERPFLAILGGAK.V
*	TK120303_NMyc_cyto3_step01.3502.3502.2	3.6522	0.5906	2783.04	1	3800.0%	1	K.DCVGPEVENACANPAAGTVILLENLR.F
	TK120303_NMyc_cyto3_step04.1872.1872.1	2.5576	0.2596	1369.64	1	6670.0%	3	R.AHSSMVGVNLPQK.A
*	TK120303_NMyc_cyto3_step01.2110.2110.1	1.5307	0.0781	1219.61	1	6000.0%	1	K.YSLEPVAAELK.S
	TK120303_NMyc_cyto3_step01.2218.2218.1	1.9008	0.1306	734.55	1	8000.0%	1	K.DVLFLK.D
*	TK120303_NMyc_cyto3_step05.2571.2571.3	2.1927	0.0199	3696.98	1	1590.0%	1	K.VNEMIIGGGMAFTFLKVLNNMEIGTSLYDEEGAK.I
	TK120303_NMyc_cyto3_step01.2983.2983.2	3.7948	0.5417	2023.44	1	5590.0%	1	K.ITLPVDFVTADKFDENAK.T
	TK120303_NMyc_cyto3_step03.1182.1182.2	1.873	0.0542	1202.73	20	6110.0%	1	K.IQLINNMLDK.V
	TK120303_NMyc_cyto3_step02.2444.2444.2	1.8514	0.1413	1740.56	1	4410.0%	1	K.VSHVSTGGGASLELLEGK.V
UQ6164699.6%2211.5%347387526.3(Q61646) Haptoglobin 
*	TK120303_NMyc_cyto3_step12.3751.3751.2	1.3116	0.0227	2347.68	188	1840.0%	1	K.LPECEAVCGKPKHPVDQVQR.I
*	TK120303_NMyc_cyto3_step04.3304.3304.2	3.7476	0.5447	2129.29	1	3680.0%	1	R.HGLTTGATLISDQWLLTTAK.N
UQ99K8899.6%4617.3%365381477.7(Q99K88) Hypothetical 38.1 kDa protein 
	TK120303_NMyc_cyto3_step10.1237.1237.3	1.3113	0.0296	2728.49	6	1800.0%	1	R.QASVGAGIPYSVPAWSCQMICGSGLK.A
	TK120303_NMyc_cyto3_step03.3290.3290.2	2.4839	0.2988	1308.42	1	7500.0%	2	R.ILVTLLHTLER.V
	TK120303_NMyc_cyto3_step08.3646.3646.2	3.6716	0.5272	2738.32	1	3800.0%	1	K.AGWSLEDVDLFEINEAFAAVSAAIAK.E
UQ9Z0P599.6%4614.0%349394716.8(Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) 
*	TK120303_NMyc_cyto3_step07.1972.1972.3	1.7037	0.1593	2384.11	21	2120.0%	1	K.HTHEGDALESVVFIYSMPGYK.C
	TK120303_NMyc_cyto3_step01.4500.4500.1	1.2578	0.0267	1226.88	121	4500.0%	1	K.MLYAATRATVK.K
	TK120303_NMyc_cyto3_step06.2680.2680.2	4.6629	0.6502	1935.79	1	6880.0%	2	K.HQTLQGLAFPLQPEAQR.A
UQ99K4799.6%225.7%557613267.5(Q99K47) Fibrinogen A alpha polypeptide 
*	TK120303_NMyc_cyto3_step01.2446.2446.2	2.8778	0.5414	2818.87	1	3400.0%	1	K.THSDSDILTNIEDPSSHVPEFSSSSK.T
*	TK120303_NMyc_cyto3_step04.2098.2098.1	1.4372	0.0199	799.66	3	7000.0%	1	R.RIEILR.R
UQ9D9F599.6%246.5%279307854.9(Q9D9F5) 1700082G03Rik protein 
	TK120303_NMyc_cyto3_step08.2847.2847.2	3.3067	0.4004	1951.86	1	5000.0%	2	K.RESHSILTPLVSLDTPGK.A
UACLY_MOUSE99.6%796.4%10911197287.4(Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) 
	TK120303_NMyc_cyto3_step09.2612.2612.2	2.2567	0.327	1872.75	1	3060.0%	1	K.GVTIIGPATVGGIKPGCFK.I
*	TK120303_NMyc_cyto3_step07.1935.1935.1	1.4384	0.1255	1158.52	1	6110.0%	1	R.HLLVHAPEDK.K
*	TK120303_NMyc_cyto3_step11.1411.1411.1	1.197	0.0030	1314.67	433	3000.0%	1	K.RHLLVHAPEDK.K
*	TK120303_NMyc_cyto3_step02.1225.1225.1	1.5831	0.2279	913.42	1	6250.0%	2	R.LGHEATVGK.A
*	TK120303_NMyc_cyto3_step01.3012.3012.1	2.3594	0.3481	1385.85	1	5380.0%	1	K.LGLVGVNLSLDGVK.S
	TK120303_NMyc_cyto3_step02.3427.3427.2	2.8035	0.5591	1972.12	1	4380.0%	1	K.QHFPATPLLDYALEVEK.I
UQ9D89299.6%51719.2%198219465.9(Q9D892) 2010016I08Rik protein 
*	TK120303_NMyc_cyto3_step09.3561.3561.2	1.1474	0.153	2683.66	11	1900.0%	1	R.DFGWDPCFQPDGYEQTYAEMPK.S
	TK120303_NMyc_cyto3_step08.3070.3070.2	3.4884	0.543	1796.77	1	5670.0%	4	K.LKPEGLHQLLAGFEDK.S
UQ91VH699.6%5739.1%297336927.2(Q91VH6) CGI-27 protein (C21orf19-like protein) 
	TK120303_NMyc_cyto3_step03.2688.2688.3	2.8737	0.4566	2999.32	1	1900.0%	2	R.SIEHLDKMGMSIIEQLDPVSFSNYLK.K
	TK120303_NMyc_cyto3_step02.3397.3397.3	4.2363	0.5058	3335.13	1	2500.0%	1	R.EASHAGSWYTASGPQLNAQLEGWLSQVQSTK.R
	TK120303_NMyc_cyto3_step04.1823.1823.3	1.7786	0.0631	2537.63	50	1590.0%	1	K.DEFTIIPVLVGALSESKEQEFGK.L
*	TK120303_NMyc_cyto3_step12.3587.3587.3	2.1441	0.1897	4001.64	4	1500.0%	1	K.NGMNMSFSFLNYAQSSQCRSWQDSSVSYAAGALTVH.-
UENOA_MOUSE99.6%7193146.0%433470106.8(P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) 
	TK120303_NMyc_cyto3_step01.1936.1936.1	1.5912	0.0546	817.89	11	6670.0%	1	K.EALELLK.T
*	TK120303_NMyc_cyto3_step01.3590.3590.2	3.0894	0.3713	2974.09	1	3330.0%	2	K.SFVQNYPVVSIEDPFDQDDWGAWQK.F
*	TK120303_NMyc_cyto3_step01.4264.4264.2	2.9297	0.4732	2194.05	1	4740.0%	9	K.AGYTDQVVIGMDVAASEFYR.S
	TK120303_NMyc_cyto3_step01.1776.1776.1	1.6444	0.1754	1408.52	2	4170.0%	2	R.GNPTVEVDLYTAK.G
*	TK120303_NMyc_cyto3_step03.4358.4358.2	3.6258	0.0262	3026.33	1	2930.0%	18	R.HIADLAGNPEVILPVPAFNVINGGSHAGNK.L
*	TK120303_NMyc_cyto3_step01.0274.0274.1	1.3382	0.2206	944.4	6	5710.0%	1	K.VNVVEQEK.I
	TK120303_NMyc_cyto3_step01.0066.0066.2	0.4999	0.0129	1495.79	79	830.0%	1	K.LMIEMDGTENKSK.F
	TK120303_NMyc_cyto3_step01.0863.0863.1	1.1605	0.0391	542.18	1	7500.0%	1	R.NPLAK.-
	TK120303_NMyc_cyto3_step02.1591.1591.1	1.8821	0.1251	1145.67	5	5560.0%	1	R.IGAEVYHNLK.N
	TK120303_NMyc_cyto3_step01.0786.0786.1	1.0854	0.0137	473.31	3	8330.0%	1	K.NVIK.E
	TK120303_NMyc_cyto3_step06.1633.1633.2	1.2351	0.0526	1736.19	1	4060.0%	1	K.SKFGANAILGVSLAVCK.A
*	TK120303_NMyc_cyto3_step01.2527.2527.1	1.7319	0.1788	1439.75	1	5000.0%	1	R.YITPDQLADLYK.S
	TK120303_NMyc_cyto3_step03.4240.4240.2	3.8224	0.4783	2356.63	1	4050.0%	21	R.SGETEDTFIADLVVGLCTGQIK.T
*	TK120303_NMyc_cyto3_step02.1243.1243.1	2.1486	0.2627	1074.67	2	6250.0%	2	K.KVNVVEQEK.I
	TK120303_NMyc_cyto3_step02.2187.2187.1	1.7122	0.0234	1542.68	1	3850.0%	1	K.LAQSNGWGVMVSHR.S
U143T_MOUSE99.6%5720.0%245277784.8(P35216) 14-3-3 protein tau (14-3-3 protein theta) 
	TK120303_NMyc_cyto3_step01.1603.1603.1	2.1566	0.1882	1320.57	1	6360.0%	1	K.YLIANATNPESK.V
	TK120303_NMyc_cyto3_step01.3495.3495.2	4.3781	0.558	2146.22	1	6110.0%	1	K.TAFDEAIAELDTLNEDSYK.D
	TK120303_NMyc_cyto3_step01.3662.3662.1	1.533	0.0262	1391.79	16	4090.0%	1	R.SICTTVLELLDK.Y
	TK120303_NMyc_cyto3_step05.1907.1907.1	1.6442	0.0234	744.45	2	8000.0%	2	K.KLQLIK.D
UTALI_MOUSE99.6%274117.2%25412698316.1(P26039) Talin 
	TK120303_NMyc_cyto3_step03.3331.3331.2	2.9448	0.396	1774.76	1	4380.0%	1	K.RVAGSVTELIQAAEAMK.G
	TK120303_NMyc_cyto3_step09.1207.1207.1	0.8606	0.029	1224.85	40	3000.0%	1	K.VKADQDSEAMK.R
	TK120303_NMyc_cyto3_step07.1676.1676.2	1.3566	0.0219	3162.8	1	1850.0%	1	R.AVTDSINQLITMCTQQAPGQKECDNALR.Q
	TK120303_NMyc_cyto3_step04.1351.1351.1	1.1519	0.0479	743.5	42	6000.0%	1	K.IFQAHK.N
*	TK120303_NMyc_cyto3_step02.1568.1568.1	1.9559	0.3174	1498.55	1	5000.0%	1	R.VQELGHGCSALVTK.A
	TK120303_NMyc_cyto3_step02.2564.2564.2	4.319	0.4896	1721.41	1	8080.0%	1	K.LHTDDELNWLDHGR.T
	TK120303_NMyc_cyto3_step01.3956.3956.2	4.8942	0.6438	2470.56	1	5620.0%	1	R.GVAALTSDPAVQAIVLDTASDVLDK.A
	TK120303_NMyc_cyto3_step09.2365.2365.3	1.4928	0.0606	2314.31	1	2500.0%	1	K.VGAIPANALDDGQWSQGLISAAR.M
	TK120303_NMyc_cyto3_step06.3399.3399.3	2.0374	0.0285	4303.48	2	1490.0%	1	K.SFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKK.K
	TK120303_NMyc_cyto3_step05.2088.2088.1	2.3562	0.3149	1337.89	4	4170.0%	3	K.VSHVLAALQAGNR.G
	TK120303_NMyc_cyto3_step10.2240.2240.3	1.7766	0.1338	4229.09	14	1100.0%	1	K.AVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGK.M
	TK120303_NMyc_cyto3_step01.4255.4255.3	1.8162	0.0737	4179.05	4	1320.0%	1	K.SFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILK.K
*	TK120303_NMyc_cyto3_step11.2395.2395.2	1.4473	0.0057	2454.87	42	1820.0%	1	R.IPEALAGPPNDFGLFLSDDDPKK.G
	TK120303_NMyc_cyto3_step01.3560.3560.1	1.8173	0.3304	1524.86	1	4620.0%	2	K.TLAESALQLLYTAK.E
*	TK120303_NMyc_cyto3_step06.2087.2087.3	1.7124	0.0998	3118.71	6	1670.0%	1	K.AQEACGPLEMDSALSVVQNLEKDLQEIK.A
	TK120303_NMyc_cyto3_step01.2616.2616.1	1.233	0.0554	1492.52	1	3460.0%	1	K.AVAEQIPLLVQGVR.G
*	TK120303_NMyc_cyto3_step02.3112.3112.2	4.5915	0.6135	2150.72	1	5000.0%	1	K.LLAALLEDEGGNGRPLLQAAK.G
*	TK120303_NMyc_cyto3_step07.2900.2900.2	1.0561	0.0957	2616.65	81	1540.0%	1	R.LEHAAKQAAASATQTIAAAQHAASAPK.A
	TK120303_NMyc_cyto3_step06.2328.2328.2	1.3688	0.0161	1936.9	9	2650.0%	1	R.QFVQSAKEVANSTANLVK.T
	TK120303_NMyc_cyto3_step02.3571.3571.3	1.9699	0.0687	4404.44	1	1500.0%	1	R.ANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCR.L
	TK120303_NMyc_cyto3_step03.3782.3782.2	4.8503	0.6685	2091.98	1	6000.0%	3	R.GVGAAATAVTQALNELLQHVK.A
	TK120303_NMyc_cyto3_step03.2488.2488.1	2.0776	0.3217	1380.75	1	5000.0%	1	K.VEHGSVALPAIMR.S
UAPA4_MOUSE99.6%101831.1%395450295.6(P06728) Apolipoprotein A-IV precursor (Apo-AIV) 
*	TK120303_NMyc_cyto3_step08.1842.1842.3	1.3947	0.0872	3053.41	2	1760.0%	1	K.TDVTQQLSTLFQDKLGDASTYADGVHNK.L
*	TK120303_NMyc_cyto3_step01.4335.4335.3	1.8831	0.0146	4154.83	5	1250.0%	1	K.AAVLTLALVAITGTRAEVTSDQVANVVWDYFTQLSNNAK.E
*	TK120303_NMyc_cyto3_step06.1256.1256.1	1.7908	0.4158	682.35	1	7000.0%	3	K.GHLTPR.A
*	TK120303_NMyc_cyto3_step03.3511.3511.2	4.238	0.6109	2023.59	1	6180.0%	1	K.LVPFVVQLSGHLAKETER.V
*	TK120303_NMyc_cyto3_step01.1831.1831.1	2.1517	0.4101	1243.56	1	6360.0%	2	R.SLAPLTVGVQEK.L
*	TK120303_NMyc_cyto3_step01.1959.1959.1	1.4937	0.076	1312.85	1	5450.0%	1	K.NLAPLVEDVQSK.V
*	TK120303_NMyc_cyto3_step01.1179.1179.1	1.2987	0.0865	978.47	7	5710.0%	1	K.EAVEQFQK.T
UQ9DAJ699.6%4625.0%152171826.0(Q9DAJ6) 1500026J17Rik protein 
	TK120303_NMyc_cyto3_step02.3007.3007.2	4.3883	0.5922	2196.86	1	6050.0%	1	R.YFHVVIAGPQDSPFEGGTFK.L
	TK120303_NMyc_cyto3_step01.1900.1900.1	1.4224	8.0E-4	1037.7	1	5560.0%	1	R.LLAEPVPGIK.A
	TK120303_NMyc_cyto3_step03.1372.1372.1	1.5005	0.0029	987.62	7	5710.0%	2	K.IYHPNVDK.L
USAHH_MOUSE99.6%5518.3%431475576.5(P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) 
	TK120303_NMyc_cyto3_step01.3879.3879.2	1.4418	5.0E-4	2252.17	2	3250.0%	1	K.DGPLNMILDDGGDLTNLIHTK.Y
*	TK120303_NMyc_cyto3_step02.4276.4276.2	1.335	0.1204	2134.32	1	3160.0%	1	K.MMSNGILKVPAINVNDSVTK.S
	TK120303_NMyc_cyto3_step03.1783.1783.1	2.3903	0.4832	1380.64	1	5830.0%	1	K.KLDEAVAEAHLGK.L
	TK120303_NMyc_cyto3_step07.2492.2492.1	1.6734	0.0251	1158.51	1	5560.0%	1	K.YPVGVHFLPK.K
*	TK120303_NMyc_cyto3_step12.3924.3924.2	1.1175	0.0075	2525.78	11	1820.0%	1	R.GISEETTTGVHNLYKMMSNGILK.V
UCRKL_HUMAN99.6%116.3%303337776.7(P46109) Crk-like protein 
*	TK120303_NMyc_cyto3_step07.3300.3300.2	3.6227	0.411	2312.86	1	3610.0%	1	K.KGEILVIIEKPEEQWWSAR.N
UQ9EPL899.6%222.7%10391195864.8(Q9EPL8) RanBP7/importin 7 
	TK120303_NMyc_cyto3_step01.2154.2154.1	1.1552	0.0729	1274.46	35	4000.0%	1	-.MDPNTIIEALR.G
	TK120303_NMyc_cyto3_step02.3025.3025.2	3.5839	0.5501	2056.29	1	6250.0%	1	R.NPVWYQALTHGLNEEQR.K
UQ8VC3099.6%5524.2%578596916.9(Q8VC30) Similar to DKFZP586B1621 protein 
*	TK120303_NMyc_cyto3_step08.1538.1538.3	1.3628	0.1115	3208.1	31	1130.0%	1	K.NMEAGAGRASYISSAQLDQPDPGAVAAAAIFR.A
	TK120303_NMyc_cyto3_step09.2359.2359.2	4.7963	0.654	1962.19	1	5250.0%	1	R.VALLSGGGSGHEPAHAGFIGK.G
*	TK120303_NMyc_cyto3_step09.2092.2092.2	1.2697	0.0168	1930.48	8	2810.0%	1	K.NYTGDRLNFGLAMEQAK.A
*	TK120303_NMyc_cyto3_step02.4465.4465.3	1.6727	0.1483	4740.19	2	1250.0%	1	R.VSVIAKTMGTLGVSLSSCSVPGATHTFELAADEIELGLGIHGEAGVR.R
	TK120303_NMyc_cyto3_step04.2855.2855.2	1.2917	0.0099	2254.17	47	1820.0%	1	R.MGGSSGALYGLFLTAAAQPLKAK.T
UQ8VDD599.6%16228.4%19602263555.7(Q8VDD5) Nonmuscle heavy chain myosin II-A 
*	TK120303_NMyc_cyto3_step03.1135.1135.1	1.6407	0.148	810.6	2	7500.0%	1	K.HLAAENR.L
*	TK120303_NMyc_cyto3_step02.1877.1877.1	1.4048	0.3331	1456.68	1	5420.0%	1	K.QIATLHAQVTDMK.K
	TK120303_NMyc_cyto3_step03.0966.0966.2	1.0137	0.0481	2999.44	5	1800.0%	1	K.ADEWLMKNMDPLNDNIATLLHQSSDK.F
	TK120303_NMyc_cyto3_step01.4603.4603.2	1.3167	0.1097	2618.25	154	1300.0%	2	R.KLEGDSTDLSDQIAELQAQIAELK.M
	TK120303_NMyc_cyto3_step02.1408.1408.1	1.8457	0.3262	1242.59	1	6670.0%	1	K.THEAQIQEMR.Q
	TK120303_NMyc_cyto3_step09.2243.2243.2	1.6355	0.054	1870.51	3	3440.0%	1	K.EEVGEEAIVELVENGKK.V
	TK120303_NMyc_cyto3_step03.2992.2992.1	2.9023	0.5012	1573.79	1	6150.0%	2	K.VSHLLGINVTDFTR.G
	TK120303_NMyc_cyto3_step02.2184.2184.1	1.7204	0.0955	1223.71	29	4500.0%	1	R.AGVLAHLEEER.D
*	TK120303_NMyc_cyto3_step03.2408.2408.1	1.6971	0.3298	1159.76	1	6110.0%	1	R.RGDLPFVVTR.R
	TK120303_NMyc_cyto3_step08.4215.4215.2	1.3984	0.0141	3017.67	152	1200.0%	1	K.NMDPLNDNIATLLHQSSDKFVSELWK.D
*	TK120303_NMyc_cyto3_step01.3200.3200.1	1.7222	0.2144	1461.82	1	4230.0%	1	R.VISGVLQLGNIAFK.K
	TK120303_NMyc_cyto3_step02.1976.1976.1	1.8723	0.1411	1414.88	23	4090.0%	2	K.KVEAQLQELQVK.F
UHMG1_MOUSE99.6%153322.0%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) 
	TK120303_NMyc_cyto3_step01.1671.1671.1	1.1931	0.0054	1496.76	6	4090.0%	1	K.MSSYAFFVQTCR.E
	TK120303_NMyc_cyto3_step01.1316.1316.1	1.3845	0.1318	708.64	1	7000.0%	2	K.DIAAYR.A
	TK120303_NMyc_cyto3_step01.4722.4722.1	1.5974	0.0034	1464.72	1	3330.0%	2	K.HPDASVNFSEFSK.K
	TK120303_NMyc_cyto3_step07.2175.2175.2	3.4551	0.4751	1524.57	1	6430.0%	3	K.IKGEHPGLSIGDVAK.K
	TK120303_NMyc_cyto3_step07.2160.2160.1	2.6715	0.5025	1280.53	1	5830.0%	1	K.GEHPGLSIGDVAK.K
	TK120303_NMyc_cyto3_step07.2227.2227.2	1.6053	0.0096	1596.1	1	4620.0%	2	K.KHPDASVNFSEFSK.K
UPDI_MOUSE99.6%145415.7%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) 
	TK120303_NMyc_cyto3_step01.2692.2692.1	1.2937	0.1522	1203.46	3	5560.0%	1	R.EADDIVNWLK.K
	TK120303_NMyc_cyto3_step07.3660.3660.2	3.6485	0.5689	2987.68	1	3100.0%	6	R.TGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK120303_NMyc_cyto3_step05.3067.3067.2	3.4255	0.5315	1965.63	1	5620.0%	3	K.HNQLPLVIEFTEQTAPK.I
	TK120303_NMyc_cyto3_step05.1920.1920.1	1.2949	0.0224	931.22	2	6430.0%	2	K.VHSFPTLK.F
	TK120303_NMyc_cyto3_step02.3280.3280.2	3.445	0.4942	1834.27	1	5360.0%	2	K.ILFIFIDSDHTDNQR.I
UHMG4_MOUSE99.6%116.5%199228798.4(O54879) High mobility group protein 4 (HMG-4) (High mobility group protein 2a) (HMG-2a) 
	TK120303_NMyc_cyto3_step01.2324.2324.1	1.9081	0.4439	1478.61	1	4170.0%	1	K.NPEVPVNFAEFSK.K
UFBL1_MOUSE99.6%469.5%705780575.2(Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) 
*	TK120303_NMyc_cyto3_step09.2797.2797.2	1.7582	0.278	1909.12	1	3750.0%	2	R.DPVHTVSHTVISLPTFR.E
	TK120303_NMyc_cyto3_step06.3620.3620.2	1.2331	0.0032	2963.71	13	1600.0%	1	R.GYHLNEEGTRCVDVDECAPPAEPCGK.G
*	TK120303_NMyc_cyto3_step11.3303.3303.3	2.1091	0.0308	2936.15	1	2280.0%	1	R.DQTCEPIVMISYQCGLVFRACCVK.A
UPSD7_MOUSE99.6%4419.3%321365406.8(P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) 
	TK120303_NMyc_cyto3_step03.1423.1423.1	1.547	0.1545	1009.54	1	5620.0%	1	R.ITNQVHGLK.G
	TK120303_NMyc_cyto3_step10.4149.4149.2	1.6562	0.1149	1946.12	16	2810.0%	1	K.VVVHPLVLLSVVDHFNR.I
	TK120303_NMyc_cyto3_step04.2288.2288.1	1.8488	0.2379	1321.57	19	3640.0%	1	R.SVVALHNLINNK.I
	TK120303_NMyc_cyto3_step02.3119.3119.2	4.9165	0.5853	2682.1	1	6090.0%	1	K.TFEHVTSEIGAEEAEEVGVEHLLR.D
UQ8R2X099.6%6816.5%443500256.4(Q8R2X0) Similar to EH-domain containing 2 
*	TK120303_NMyc_cyto3_step04.1990.1990.1	2.1463	0.2886	1304.62	1	5910.0%	1	K.LEGHGLPTNLPR.R
	TK120303_NMyc_cyto3_step04.2167.2167.2	3.6305	0.5254	2022.3	1	5000.0%	2	K.IQLEHHISPGDFPDCQK.M
	TK120303_NMyc_cyto3_step12.3887.3887.2	1.531	0.132	2148.96	193	1760.0%	1	R.VYIGSFWSQPLLVPDNRR.L
*	TK120303_NMyc_cyto3_step02.2669.2669.2	1.3649	0.0162	2816.49	2	2000.0%	1	K.LMPLLRQEELESVEAGVQGGAFEGTR.M
UANX5_MOUSE99.6%145824.1%319357525.0(P48036) Annexin V (Lipocortin V) (Endonexin II) (Calphobindin I) (CBP-I) (Placental anticoagulant protein I) (PAP-I) (PP4) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) (Anchorin CII) 
*	TK120303_NMyc_cyto3_step02.3279.3279.2	2.2601	0.4033	2677.13	1	2290.0%	7	R.DPDTAIDDAQVELDAQALFQAGELK.W
	TK120303_NMyc_cyto3_step01.0476.0476.1	0.9706	0.0213	508.21	3	8330.0%	1	R.VFDK.Y
	TK120303_NMyc_cyto3_step01.1704.1704.1	1.4103	0.1885	1014.65	19	5710.0%	1	R.LYDAYELK.H
	TK120303_NMyc_cyto3_step01.1979.1979.1	0.9455	0.0625	1404.58	8	3640.0%	1	R.KNFATSLYSMIK.G
*	TK120303_NMyc_cyto3_step10.4149.4149.3	1.9136	0.1028	2918.67	281	1460.0%	1	K.QVYEEEYGSNLEDDVVGDTSGYYQR.M
	TK120303_NMyc_cyto3_step01.0767.0767.1	0.8034	0.0872	451.34	1	10000.0%	1	K.EFR.K
URBB9_MOUSE99.6%51710.8%186209126.0(O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) 
*	TK120303_NMyc_cyto3_step08.2779.2779.2	1.7925	0.1035	2344.54	9	2370.0%	1	R.GHFQNTEFHELISVVKSMLK.G
*	TK120303_NMyc_cyto3_step08.2870.2870.2	4.4866	0.5098	1886.68	1	6000.0%	4	R.GHFQNTEFHELISVVK.S
UQ9DD2199.6%115.9%303344927.3(Q9DD21) 0610006A11Rik protein 
	TK120303_NMyc_cyto3_step08.3591.3591.2	4.0051	0.5678	2285.82	1	4710.0%	1	R.VLHEEHIELLMEEFEFLK.R
UWDR1_MOUSE99.6%7720.8%606664076.6(O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) 
	TK120303_NMyc_cyto3_step02.2851.2851.2	4.6481	0.5829	2585.96	1	4170.0%	1	K.AHDGGIYAISWSPDSTHLLSASGDK.T
*	TK120303_NMyc_cyto3_step01.0638.0638.1	1.1353	0.1045	702.4	3	7500.0%	1	K.ILGGDPK.G
	TK120303_NMyc_cyto3_step11.2631.2631.2	3.3524	0.383	2784.07	1	3750.0%	1	R.LHHVSSLAWLDEHTLVTTSHDASVK.E
*	TK120303_NMyc_cyto3_step03.2591.2591.2	3.1369	0.4181	2420.56	1	3570.0%	1	R.NIDNPAIADIYTEHAHQVVVAK.Y
*	TK120303_NMyc_cyto3_step12.1326.1326.2	1.6204	0.0266	1904.61	1	3530.0%	1	K.YAPSGFYIASGDISGKLR.I
*	TK120303_NMyc_cyto3_step01.0263.0263.1	1.1226	0.0436	863.36	54	4290.0%	1	K.VCALGESK.A
*	TK120303_NMyc_cyto3_step10.1233.1233.2	1.1192	0.0415	2223.97	73	1750.0%	1	K.FGAVFLWDTGSSVGEITGHNK.V
UQ9CR9899.6%1113.0%138156747.6(Q9CR98) 2010309E21Rik protein 
*	TK120303_NMyc_cyto3_step04.3166.3166.2	3.7963	0.6024	1995.31	1	5880.0%	1	R.CHAPLAQAQALVTSELER.F
UA2HS_MOUSE99.6%2933151.6%345373266.5(P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) 
*	TK120303_NMyc_cyto3_step02.2083.2083.2	4.3194	0.6062	1829.65	1	7190.0%	1	K.ANLMHNLGGEEVSVACK.L
*	TK120303_NMyc_cyto3_step04.1390.1390.2	3.748	0.6398	1970.59	1	6560.0%	1	R.VMHTQCHSTPDSAEDVR.K
*	TK120303_NMyc_cyto3_step05.1208.1208.1	1.1135	0.2433	778.46	10	5000.0%	1	K.QHGFCK.A
*	TK120303_NMyc_cyto3_step09.2731.2731.3	1.5795	0.0195	4029.4	9	1250.0%	1	K.LFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPR.G
*	TK120303_NMyc_cyto3_step02.0912.0912.2	0.8671	0.0103	2745.86	9	1820.0%	1	R.QLTEHAVEGDCDFHILKQDGQFR.V
*	TK120303_NMyc_cyto3_step10.3622.3622.2	2.4228	0.4664	2548.77	1	3480.0%	17	R.AQNVPLPVSTLVEFVIAATDCTAK.E
*	TK120303_NMyc_cyto3_step03.4244.4244.3	1.8564	0.126	3288.23	1	1960.0%	1	R.ELACDDPEAEQVALLAVDYLNNHLLQGFK.Q
*	TK120303_NMyc_cyto3_step06.2367.2367.2	5.1644	0.565	2141.87	1	6250.0%	6	R.HAFSPVASVESASGETLHSPK.V
UMDHC_MOUSE99.6%71915.9%333363466.6(P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) 
	TK120303_NMyc_cyto3_step01.1331.1331.1	0.8414	0.0682	699.51	18	5000.0%	1	K.SAPSIPK.E
*	TK120303_NMyc_cyto3_step01.3178.3178.1	1.624	0.3038	1373.68	15	3330.0%	1	K.DLDVAVLVGSMPR.R
	TK120303_NMyc_cyto3_step04.2268.2268.2	4.4601	0.6334	2281.85	1	5260.0%	4	K.NVIIWGNHSSTQYPDVNHAK.V
	TK120303_NMyc_cyto3_step05.1813.1813.2	1.1869	0.0107	1661.17	5	4170.0%	1	K.ENFSCLTRLDHNR.A
UK1CJ_HUMAN99.6%142030.4%593595195.2(P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) 
	TK120303_NMyc_cyto3_step02.3229.3229.2	2.5644	0.3395	1798.21	1	5670.0%	1	R.NVQALEIELQSQLALK.Q
	TK120303_NMyc_cyto3_step04.1170.1170.1	1.5102	0.0858	1159.4	78	4380.0%	1	K.YYKTIDDLK.N
*	TK120303_NMyc_cyto3_step05.3651.3651.3	1.7644	0.0148	4122.65	4	1070.0%	1	K.QSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIR.A
	TK120303_NMyc_cyto3_step11.1367.1367.1	1.279	0.0126	1264.61	43	3460.0%	1	R.SLLEGEGSSGGGGR.G
	TK120303_NMyc_cyto3_step02.1689.1689.1	1.7003	0.1802	1234.88	1	6110.0%	1	R.LKYENEVALR.Q
	TK120303_NMyc_cyto3_step01.3718.3718.2	1.9038	0.2831	2875.52	1	2120.0%	2	R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S
*	TK120303_NMyc_cyto3_step02.2233.2233.1	1.2362	0.0888	1187.9	33	4440.0%	1	R.RVLDELTLTK.A
*	TK120303_NMyc_cyto3_step04.3818.3818.2	3.1084	0.3486	2097.62	1	4710.0%	1	K.ADLEMQIESLTEELAYLK.K
*	TK120303_NMyc_cyto3_step05.3651.3651.2	4.1534	0.3354	2748.77	1	4090.0%	2	R.YCVQLSQIQAQISALEEQLQQIR.A
	TK120303_NMyc_cyto3_step02.3267.3267.2	4.5395	0.5823	2368.06	1	5250.0%	2	K.NQILNLTTDNANILLQIDNAR.L
	TK120303_NMyc_cyto3_step12.4020.4020.2	1.2048	0.0554	1711.33	58	2780.0%	1	K.GSLGGGFSSGGFSGGSFSR.G
UQ9D09699.6%2413.0%177193188.2(Q9D096) 2610034N03Rik protein 
	TK120303_NMyc_cyto3_step06.3551.3551.2	3.2897	0.5118	2449.14	1	3640.0%	2	R.TGIIVTTSEAVLLQLVADKDHPK.F
UTCPD_MOUSE99.6%4411.1%539580668.0(P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) 
	TK120303_NMyc_cyto3_step02.2229.2229.1	1.3038	4.0E-4	1183.66	9	4440.0%	1	R.SIHDALCVIR.C
	TK120303_NMyc_cyto3_step04.2279.2279.1	2.7992	0.4452	1457.69	1	5830.0%	1	K.GIHPTIISESFQK.A
	TK120303_NMyc_cyto3_step01.4014.4014.2	3.6348	0.5164	3032.79	1	3210.0%	1	R.AFADAMEVIPSTLAENAGLNPISTVTELR.N
	TK120303_NMyc_cyto3_step01.1016.1016.1	1.2956	0.042	839.34	1	7140.0%	1	R.FSNISAAK.A
UGDIR_MOUSE99.6%4625.0%204234075.2(Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) 
*	TK120303_NMyc_cyto3_step01.3807.3807.2	2.9709	0.3557	2580.75	2	2830.0%	2	R.LTLVCSTAPGPLELDLTGDLESFK.K
	TK120303_NMyc_cyto3_step02.3127.3127.2	3.2422	0.4747	2364.75	1	4170.0%	1	R.FTDDDKTDHLSWEWNLTIK.K
*	TK120303_NMyc_cyto3_step01.0218.0218.1	1.0849	0.0504	927.43	57	4290.0%	1	R.GSYNIKSR.F
UPHS3_HUMAN99.6%5117.5%843966966.9(P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) 
*	TK120303_NMyc_cyto3_step07.1691.1691.2	1.4661	0.1261	2001.13	62	2190.0%	1	R.RWLLLCNPGLADTIVEK.I
	TK120303_NMyc_cyto3_step11.1442.1442.3	1.8856	0.072	3078.07	1	2000.0%	1	R.VSLAEKVIPAADLSQQISTAGTEASGTGNMK.F
*	TK120303_NMyc_cyto3_step04.2699.2699.2	4.2853	0.5165	1663.66	1	7140.0%	3	R.HLDHVAALFPGDVDR.L
UCYPH_MOUSE99.6%2111536.2%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) 
	TK120303_NMyc_cyto3_step03.1180.1180.1	0.894	0.1649	690.58	154	4000.0%	1	K.GSSFHR.I
	TK120303_NMyc_cyto3_step07.2881.2881.2	2.7878	0.255	2794.83	1	2690.0%	7	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
	TK120303_NMyc_cyto3_step04.1635.1635.1	1.8023	0.3374	688.62	1	8000.0%	6	K.HVVFGK.V
	TK120303_NMyc_cyto3_step01.2314.2314.1	1.5007	0.1191	1280.74	1	5000.0%	2	K.EGMNIVEAMER.F
	TK120303_NMyc_cyto3_step01.2716.2716.1	2.003	0.3	1058.04	1	7500.0%	5	R.VSFELFADK.V
UVTDB_MOUSE99.6%2210.4%472530865.3(P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment) 
*	TK120303_NMyc_cyto3_step01.4084.4084.2	3.5001	0.5183	2442.4	1	4290.0%	1	K.VPTANLENVLPLAEDFTEILSR.C
*	TK120303_NMyc_cyto3_step11.2143.2143.3	2.228	0.0569	3022.08	6	1730.0%	1	R.TSELSVKSCESDAPFPVHPGTPECCTK.E
UCAPB_MOUSE99.6%2214.8%277313455.7(P47757) F-actin capping protein beta subunit (CapZ beta) 
	TK120303_NMyc_cyto3_step02.1921.1921.2	1.0417	0.0075	1926.24	24	2670.0%	1	K.IKGCWDSIHVVEVQEK.S
	TK120303_NMyc_cyto3_step01.4098.4098.2	3.3291	0.522	2784.43	1	3330.0%	1	K.NLSDLIDLVPSLCEDLLSSVDQPLK.I
US142_MOUSE99.6%3311.7%403463007.1(Q99J08) SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) 
*	TK120303_NMyc_cyto3_step08.2608.2608.3	1.5556	0.0348	3448.58	30	1430.0%	1	K.QQYEHTVQVSRGSSHQVEYEILFPGCVLR.W
	TK120303_NMyc_cyto3_step04.3268.3268.2	4.5364	0.5784	2094.64	1	5590.0%	1	R.GSSHQVEYEILFPGCVLR.W
*	TK120303_NMyc_cyto3_step12.3788.3788.2	1.5293	0.0121	2072.88	128	2060.0%	1	K.IISWQPPEVIQQYLSGGR.C
UQ9D1G199.6%41024.9%201221875.7(Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) 
	TK120303_NMyc_cyto3_step07.2605.2605.2	1.6118	0.2119	2281.88	8	2250.0%	3	R.GAHGIIVVYDVTDQESYANVK.Q
*	TK120303_NMyc_cyto3_step09.3383.3383.2	1.267	0.0177	2870.84	41	1430.0%	1	R.MGPGAASGGERPNLKIDSTPVKPASGGCC.-
UKCRB_MOUSE99.6%81220.2%381427135.7(Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) 
	TK120303_NMyc_cyto3_step01.3506.3506.1	1.3346	0.0513	1557.87	31	3750.0%	1	R.FCTGLTQIETLFK.S
*	TK120303_NMyc_cyto3_step10.3493.3493.2	1.9257	0.1807	2045.05	1	3420.0%	1	R.AIEKLAVEALSSLDGDLSGR.Y
	TK120303_NMyc_cyto3_step02.1544.1544.1	1.5052	0.208	984.72	1	6430.0%	2	R.GIWHNDNK.T
*	TK120303_NMyc_cyto3_step03.2443.2443.2	3.2177	0.5151	2188.28	1	4720.0%	1	R.FPAEDEFPDLSSHNNHMAK.V
*	TK120303_NMyc_cyto3_step03.1212.1212.1	2.1518	0.3365	1254.62	2	6500.0%	1	R.HGGYQPSDEHK.T
*	TK120303_NMyc_cyto3_step09.1676.1676.1	1.1702	0.0653	666.48	1	6000.0%	2	K.LPHLGK.H
UO7037999.6%3314.9%289322515.0(O70379) Thioredoxin-related protein 
	TK120303_NMyc_cyto3_step01.3035.3035.2	3.1382	0.5695	2570.45	1	3860.0%	1	R.SEPTQALELTEDDIKEDGIVPLR.Y
	TK120303_NMyc_cyto3_step01.1088.1088.1	1.23	0.0851	1146.28	1	4500.0%	1	K.FQGPDNGQGPK.Y
	TK120303_NMyc_cyto3_step10.4312.4312.3	1.2001	0.2105	2783.27	73	1300.0%	1	R.SMDFEEAERSEPTQALELTEDDIK.E
UTAG2_MOUSE99.6%179535.4%212235977.1(Q9WVA4) Transgelin 2 
	TK120303_NMyc_cyto3_step01.2995.2995.1	1.7254	0.1641	1596.8	6	3460.0%	2	R.DDGLFSGDPNWFPK.K
*	TK120303_NMyc_cyto3_step01.1862.1862.1	2.2179	0.3612	1528.62	1	4620.0%	1	K.LINSLYPEGQAPVK.K
	TK120303_NMyc_cyto3_step01.4427.4427.2	2.446	0.4037	2102.91	1	4410.0%	8	R.YGINTTDIFQTVDLWEGK.N
	TK120303_NMyc_cyto3_step06.3615.3615.2	3.4443	0.452	2396.37	1	4720.0%	5	K.QYDADLEQILIQWITTQCR.E
*	TK120303_NMyc_cyto3_step04.1888.1888.1	1.5245	0.2198	1110.52	1	6110.0%	1	K.KIQASSMAFK.Q
UNED4_MOUSE99.6%7911.0%9571099685.6(P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) 
*	TK120303_NMyc_cyto3_step03.1434.1434.2	2.5587	0.5005	2171.84	1	4250.0%	1	R.LAVCGNPATSQPVTSSNHSSR.G
*	TK120303_NMyc_cyto3_step03.3375.3375.2	1.2888	0.0829	2241.19	2	2810.0%	1	K.YKNGYSMNHQVIHWFWK.A
	TK120303_NMyc_cyto3_step03.3116.3116.2	3.5913	0.4262	2084.82	1	5940.0%	2	R.FIIDEELFGQTHQHELK.T
*	TK120303_NMyc_cyto3_step03.1048.1048.2	1.2301	0.0592	1239.63	8	4440.0%	1	R.ANILEDSYRR.I
	TK120303_NMyc_cyto3_step12.1252.1252.2	1.7521	0.1239	2027.52	2	2940.0%	1	R.LWIEFDGEKGLDYGGVAR.E
*	TK120303_NMyc_cyto3_step01.3164.3164.2	1.5003	0.1002	2573.12	18	2380.0%	1	K.RPSPDDDLTDEDNDDMQLQAQR.A
UQ8VDP399.6%446.3%10481167856.1(Q8VDP3) Similar to hypothetical protein FLJ11937 
*	TK120303_NMyc_cyto3_step01.4284.4284.3	1.7241	0.0642	3954.25	39	1180.0%	1	-.MASPASTNPAHDHFETFVQAQLCQDVLSSFQGLCR.A
*	TK120303_NMyc_cyto3_step04.3011.3011.2	3.3678	0.5049	2386.7	1	3700.0%	1	K.NTSHSSGLVSQPSGTPSAILFLGK.L
*	TK120303_NMyc_cyto3_step12.4496.4496.1	0.6118	0.0522	445.2	3	5000.0%	1	R.EMPA.-
*	TK120303_NMyc_cyto3_step12.1288.1288.3	1.8839	0.1165	2787.03	23	1920.0%	1	K.NTSHSSGLVSQPSGTPSAILFLGKLQR.S
UA2MG_MOUSE99.6%162412.5%14951658276.7(Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) 
*	TK120303_NMyc_cyto3_step02.2103.2103.1	1.7277	0.0216	1188.75	7	6670.0%	1	K.RSELLESLNK.D
*	TK120303_NMyc_cyto3_step05.1407.1407.1	1.605	0.0799	880.45	1	6430.0%	1	K.NLKPAPIK.V
*	TK120303_NMyc_cyto3_step05.3267.3267.2	2.0935	0.3099	2603.39	1	2610.0%	2	K.HSLGDNDAHSIFQSVGINIFTNSK.I
*	TK120303_NMyc_cyto3_step04.2932.2932.3	1.9602	0.1666	2879.5	45	1880.0%	1	R.KYFPETWIWDLVPLDVSGDGELAVK.V
*	TK120303_NMyc_cyto3_step04.3087.3087.2	3.2119	0.3932	2347.56	1	3750.0%	1	K.VNTNYRPGLPFSGQVLLVDEK.G
*	TK120303_NMyc_cyto3_step06.1752.1752.1	1.5515	0.1399	1117.72	10	5620.0%	2	K.KIEHSFEVK.E
*	TK120303_NMyc_cyto3_step04.1420.1420.1	1.6911	0.2283	1033.56	6	5620.0%	2	K.TFHVNSGNR.L
*	TK120303_NMyc_cyto3_step06.3168.3168.2	1.1322	0.0010	2399.79	30	1820.0%	1	K.QQNSDGGLLLTQDTVVALQALSK.Y
*	TK120303_NMyc_cyto3_step06.2735.2735.3	1.6941	0.0177	2844.45	5	1800.0%	1	R.APSAEVEMTAYVLLAYLTSESSRPTR.D
*	TK120303_NMyc_cyto3_step02.2696.2696.1	3.1022	0.2665	1392.34	1	6500.0%	2	R.IHYLLNEDIMK.N
*	TK120303_NMyc_cyto3_step04.2442.2442.2	2.4279	0.5036	2348.14	1	3500.0%	1	K.AESPVFVQTDKPIYKPGQIVK.F
U2AAA_HUMAN99.6%4610.5%588650925.1(P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) 
	TK120303_NMyc_cyto3_step10.2276.2276.2	3.3182	0.5629	2214.24	1	4470.0%	2	R.AISHEHSPSDLEAHFVPLVK.R
*	TK120303_NMyc_cyto3_step05.1993.1993.2	2.1185	0.2346	2117.26	1	3160.0%	1	-.AAADGDDSLYPIAVLIDELR.N
	TK120303_NMyc_cyto3_step09.2657.2657.2	1.0633	0.0819	2498.61	22	1670.0%	1	R.LAIIEYMPLLAGQLGVEFFDEK.L
UQ922D899.6%5511.3%9351012567.1(Q922D8) Similar to C1-tetrahydrofolate synthase 
	TK120303_NMyc_cyto3_step05.1260.1260.1	0.9697	0.1938	737.35	37	5000.0%	1	R.HAVVVGR.S
*	TK120303_NMyc_cyto3_step04.3330.3330.2	3.2472	0.5547	1638.82	1	6000.0%	1	K.STTTIGLVQALGAHLR.Q
	TK120303_NMyc_cyto3_step07.1723.1723.1	1.7681	0.2251	1390.54	1	5000.0%	1	K.THLSLSHNPEQK.G
*	TK120303_NMyc_cyto3_step11.3498.3498.2	1.2766	0.0046	3084.98	9	1480.0%	1	R.TAQFDISVASEIMAVLALTSSLEDMRER.L
	TK120303_NMyc_cyto3_step09.4223.4223.3	2.4109	0.1221	4681.43	3	1190.0%	1	R.ASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF.-
UQ9CQM999.6%5716.3%337377785.6(Q9CQM9) Thioredoxin-like 2 
	TK120303_NMyc_cyto3_step02.3221.3221.2	4.7113	0.5881	2072.27	1	6880.0%	1	K.HNIQFSSFDIFSDEEVR.Q
*	TK120303_NMyc_cyto3_step09.2683.2683.2	1.415	0.1424	1481.15	18	3750.0%	1	K.ELKDNGELLPILK.G
*	TK120303_NMyc_cyto3_step08.1934.1934.1	1.3258	0.0774	1080.56	1	5620.0%	1	K.EHPHVSFVK.L
*	TK120303_NMyc_cyto3_step07.1857.1857.2	2.1376	0.3404	1709.97	2	4000.0%	2	R.HVSSGAFPPSTNEHLK.E
UQ9CR8699.6%3910.8%148160628.2(Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) 
	TK120303_NMyc_cyto3_step05.2961.2961.2	4.0102	0.5978	1677.72	1	6670.0%	3	K.LQAVEVVITHLAPGTK.H
UHDGF_MOUSE99.6%41010.5%237262694.8(P51859) Hepatoma-derived growth factor (HDGF) 
	TK120303_NMyc_cyto3_step05.3263.3263.2	3.2847	0.4192	1990.41	1	5310.0%	3	K.YQVFFFGTHETAFLGPK.D
	TK120303_NMyc_cyto3_step02.1081.1081.1	1.1823	0.078	886.52	24	5000.0%	1	K.LVIDEPAK.E
UUBC7_HUMAN99.6%5548.7%154178628.5(P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) 
	TK120303_NMyc_cyto3_step06.1857.1857.2	0.9864	0.2783	2223.34	9	1940.0%	1	K.GAFRIEINFPAEYPFKPPK.I
	TK120303_NMyc_cyto3_step02.3687.3687.2	4.7324	0.601	2484.12	1	4290.0%	1	K.TDQVIQSLIALVNDPQPEHPLR.A
	TK120303_NMyc_cyto3_step01.4142.4142.2	1.4297	0.0091	2854.52	1	2500.0%	1	R.NIQVDEANLLTWQGLIVPDNPPYDK.G
	TK120303_NMyc_cyto3_step02.1504.1504.1	1.6872	0.1748	1128.64	1	6880.0%	1	K.IYHPNIDEK.G
	TK120303_NMyc_cyto3_step02.2983.2983.2	3.212	0.3936	1790.17	1	6790.0%	1	R.IEINFPAEYPFKPPK.I
UK6PF_MOUSE99.6%5516.6%779851378.0(P47857) 6-phosphofructokinase, muscle type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme A) (PFK-A) 
	TK120303_NMyc_cyto3_step05.2804.2804.3	2.1492	0.0103	3432.64	8	1530.0%	1	K.SSYLNIVGLVGSIDNDFCGTDMTIGTDSALHR.I
*	TK120303_NMyc_cyto3_step04.2902.2902.2	5.1607	0.6572	2159.95	1	7220.0%	1	R.VFFVHEGYQGLVDGGEHIR.E
	TK120303_NMyc_cyto3_step12.4454.4454.3	1.4288	0.033	3994.86	5	1390.0%	1	R.VFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIR.D
*	TK120303_NMyc_cyto3_step12.3880.3880.2	1.3125	0.0061	2915.64	65	1400.0%	1	R.IVEIVDAITTTAQSHQRTFVLEVMGR.H
	TK120303_NMyc_cyto3_step04.1672.1672.3	1.5489	0.0066	1759.66	409	2140.0%	1	R.LPLMECVQVTKDVTK.A
UIF6_MOUSE99.6%5742.0%245265114.7(O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP)) 
*	TK120303_NMyc_cyto3_step09.3233.3233.2	1.0313	0.0274	2362.14	9	2140.0%	1	K.LNEAKPSTIATSMRDSLIDSLT.-
*	TK120303_NMyc_cyto3_step10.3126.3126.3	1.5864	0.0467	4188.02	4	1320.0%	1	K.LTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCR.I
	TK120303_NMyc_cyto3_step01.3555.3555.2	2.2485	0.3196	2586.54	1	2830.0%	1	K.TSIEDQDELSSLLQVPLVAGTVNR.G
	TK120303_NMyc_cyto3_step07.2447.2447.2	4.6073	0.5935	2087.11	1	7060.0%	2	R.HGLLVPNNTTDQELQHIR.N
UPPI1_MOUSE99.6%5720.4%270317626.4(P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) 
	TK120303_NMyc_cyto3_step02.2123.2123.1	1.672	0.2174	1422.69	1	4170.0%	1	R.MLAPEGALNIHEK.A
	TK120303_NMyc_cyto3_step04.1522.1522.1	1.7972	0.0768	888.59	2	6670.0%	1	K.IYHLQSK.V
*	TK120303_NMyc_cyto3_step12.3271.3271.2	1.1763	0.028	2059.88	92	1760.0%	1	K.HVEAIYIDIADRSQVLSK.D
	TK120303_NMyc_cyto3_step05.1947.1947.2	3.061	0.4876	2033.4	1	4380.0%	2	K.IETWHKPDLGTQENVHK.L
UPDX2_MOUSE99.6%114329.3%198217795.4(Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) 
	TK120303_NMyc_cyto3_step06.3307.3307.2	2.2146	0.2166	2700.72	1	3040.0%	3	K.LGCEVLGVSVDSQFTHLAWINTPR.K
*	TK120303_NMyc_cyto3_step01.2704.2704.1	1.7609	0.3095	1599.61	1	4330.0%	5	K.SAPDFTATAVVDGAFK.E
*	TK120303_NMyc_cyto3_step03.3530.3530.2	4.8112	0.6368	1838.94	1	7060.0%	3	R.KEGGLGPLNIPLLADVTK.S
UQ9QYB199.6%4420.2%253287295.6(Q9QYB1) Intracellular chloride channel protein 
	TK120303_NMyc_cyto3_step12.2592.2592.2	1.4667	0.201	2624.15	12	1960.0%	1	R.KPADLQNLAPGTHPPFITFNSEVK.T
	TK120303_NMyc_cyto3_step01.3240.3240.1	1.7599	0.1789	1589.66	1	5000.0%	1	K.EEDKEPLIELFVK.A
	TK120303_NMyc_cyto3_step02.2201.2201.1	2.1493	0.2004	1517.53	1	4230.0%	1	K.HPESNTAGMDIFAK.F
UHS74_MOUSE99.6%6813.7%841941335.2(Q61316) Heat shock 70-related protein APG-2 
	TK120303_NMyc_cyto3_step03.3935.3935.3	1.0775	0.0094	3391.6	12	1580.0%	1	R.SVMDATQIAGLNCLRLMNETTAVALAYGIYK.Q
*	TK120303_NMyc_cyto3_step09.4255.4255.3	1.9186	0.073	3701.47	1	1670.0%	2	R.VNVHGIFSVSSAALVEVHKSEESEEPMETDQNAK.E
	TK120303_NMyc_cyto3_step04.1444.1444.1	1.9328	0.3819	871.54	1	7140.0%	1	K.NHAAPFSK.V
*	TK120303_NMyc_cyto3_step02.2727.2727.2	4.1333	0.6117	2168.99	1	5560.0%	1	K.KPVVDCVVSVPSFYTDAER.R
	TK120303_NMyc_cyto3_step04.2275.2275.3	1.9681	0.1072	2816.57	1	2390.0%	1	K.LEDTENWLYEDGEDQPKQVYVDK.L
USBP2_MOUSE99.6%467.2%472526286.2(Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56) 
	TK120303_NMyc_cyto3_step03.2342.2342.1	1.7753	0.1449	1304.61	4	4550.0%	2	K.EPLGPALAHELR.Y
*	TK120303_NMyc_cyto3_step03.2619.2619.2	3.2843	0.4953	2405.61	1	4520.0%	1	R.FLHDPSATQGFVGCALSSNIQR.F
UCAP1_MOUSE99.6%91128.7%474515757.5(P40124) Adenylyl cyclase-associated protein 1 (CAP 1) 
	TK120303_NMyc_cyto3_step03.2768.2768.2	2.9471	0.3123	1929.38	1	4120.0%	2	R.SALFAQINQGESITHALK.H
	TK120303_NMyc_cyto3_step07.2375.2375.3	1.5327	0.043	4029.05	115	1000.0%	1	K.NSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFK.T
	TK120303_NMyc_cyto3_step01.3284.3284.2	1.706	0.2589	2813.92	1	2500.0%	1	K.SSEMNVLIPTEGGDFNEFPVPEQFK.T
*	TK120303_NMyc_cyto3_step01.2208.2208.1	1.729	0.2483	1099.85	1	6670.0%	1	K.EPALLELEGK.K
*	TK120303_NMyc_cyto3_step03.4419.4419.3	2.0532	0.0818	3633.76	12	1320.0%	1	K.ELSGLPSGPSVGSGPPPPPPGPPPPPIPTSSGSDDSASR.S
*	TK120303_NMyc_cyto3_step09.3652.3652.2	4.1	0.5441	1959.22	1	5880.0%	1	K.LGLVFDDVVGIVEIINSR.D
	TK120303_NMyc_cyto3_step01.0668.0668.1	1.2536	0.1269	542.41	4	6250.0%	1	K.NPALK.A
	TK120303_NMyc_cyto3_step07.1720.1720.1	1.7071	0.2982	1122.42	1	6670.0%	1	K.HAEMVHTGLK.L
UPLSL_MOUSE99.6%71113.6%627702025.4(Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65) 
	TK120303_NMyc_cyto3_step05.2583.2583.2	3.0119	0.512	2539.94	1	3570.0%	2	K.YPALHKPENQDIDWGALEGETR.E
	TK120303_NMyc_cyto3_step02.2489.2489.1	2.2115	0.1062	1432.58	1	4550.0%	1	K.AYYHLLEQVAPK.G
*	TK120303_NMyc_cyto3_step05.1601.1601.1	1.4484	0.2217	700.55	1	6000.0%	1	K.VFHGLK.T
	TK120303_NMyc_cyto3_step01.4083.4083.2	2.5223	0.4566	2700.78	2	2290.0%	1	K.ISTSLPVLDLIDAIQPGSINYDLLK.T
	TK120303_NMyc_cyto3_step11.3463.3463.2	2.1485	0.1959	2369.66	1	3950.0%	2	R.VNHLYSDLSDALVIFQLYEK.I
UK22E_HUMAN99.6%142423.6%645658658.0(P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e) 
*	TK120303_NMyc_cyto3_step02.1079.1079.2	1.3004	0.2153	2315.49	10	1850.0%	1	K.HSSGGGSRGGSSSGGGYGSGGGGSSSVK.G
*	TK120303_NMyc_cyto3_step08.3603.3603.2	1.9999	0.1031	2653.89	4	2000.0%	2	R.SLVGLGGTKSISISVAGGGGGFGAAGGFGGR.G
*	TK120303_NMyc_cyto3_step01.3183.3183.1	1.9594	0.0651	1459.88	7	4550.0%	1	K.VDLLNQEIEFLK.V
*	TK120303_NMyc_cyto3_step02.1444.1444.1	1.3744	0.1205	994.7	76	4380.0%	1	R.LQGEIAHVK.K
*	TK120303_NMyc_cyto3_step09.2373.2373.2	1.147	0.0020	1893.77	436	1590.0%	1	R.YGSGGGSKGGSISGGGYGSGGGK.H
*	TK120303_NMyc_cyto3_step01.2187.2187.1	1.6548	0.1518	1372.62	2	5000.0%	1	K.LNDLEEALQQAK.E
*	TK120303_NMyc_cyto3_step02.1464.1464.1	2.195	0.3769	1391.59	1	6360.0%	2	R.SKEEAEALYHSK.Y
*	TK120303_NMyc_cyto3_step07.1775.1775.1	1.5927	0.0922	1322.58	1	4000.0%	3	R.HGGGGGGFGGGGFGSR.S
	TK120303_NMyc_cyto3_step02.1605.1605.1	1.3538	0.0851	1108.82	4	6250.0%	1	K.AQYEEIAQR.S
UTBBX_HUMAN99.6%2011018.7%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain 
	TK120303_NMyc_cyto3_step02.3539.3539.2	6.005	0.6637	1963.0	1	8240.0%	6	K.GHYTEGAELVDSVLDVVR.K
	TK120303_NMyc_cyto3_step01.2912.2912.3	1.8399	0.2442	3107.15	33	1540.0%	1	K.FWEVISDEHGIDPTGTYHGDSDLQLDR.I
	TK120303_NMyc_cyto3_step05.3301.3301.3	5.9085	0.5903	2802.36	1	3700.0%	2	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK120303_NMyc_cyto3_step01.1535.1535.1	1.7424	0.448	1301.62	1	5450.0%	1	R.ISVYYNEATGGK.Y
UQ8VD7899.6%227.0%483507716.9(Q8VD78) Hypothetical 50.8 kDa protein 
*	TK120303_NMyc_cyto3_step03.1647.1647.2	3.6982	0.5568	1861.59	1	5560.0%	1	R.GAVEAAHQAAPGWGAQSPR.A
*	TK120303_NMyc_cyto3_step04.1891.1891.2	1.4381	0.0071	1583.86	10	3930.0%	1	R.ARAGLLWALAAALER.R
UQ9CRK799.6%3528.8%118128626.8(Q9CRK7) 9430095H01Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step02.1481.1481.1	2.4867	0.3575	1452.73	1	5000.0%	1	R.VGQAVDVVGQAGKPK.T
	TK120303_NMyc_cyto3_step10.2080.2080.2	3.6591	0.5677	2082.01	1	5280.0%	2	K.TITGFQTHTTPVLLAHGER.A
UDHCA_MOUSE99.6%3511.2%276305977.8(P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) 
*	TK120303_NMyc_cyto3_step02.2091.2091.1	2.0083	0.2914	1583.63	1	5420.0%	1	R.FHQLDIDNPQSIR.A
*	TK120303_NMyc_cyto3_step06.2045.2045.2	2.6801	0.5084	1933.91	1	4120.0%	2	K.KGVHAEEGWPNSAYGVTK.I
UHMG2_MOUSE99.6%81623.4%209240317.3(P30681) High mobility group protein 2 (HMG-2) 
	TK120303_NMyc_cyto3_step02.2049.2049.1	1.9836	0.0744	1466.68	1	5000.0%	1	K.HPDSSVNFAEFSK.K
*	TK120303_NMyc_cyto3_step02.1683.1683.1	1.8906	0.0479	1337.95	1	5420.0%	1	K.IEHPGLSIGDTAK.K
*	TK120303_NMyc_cyto3_step07.2152.2152.1	1.935	0.145	1579.8	1	5000.0%	3	K.IKIEHPGLSIGDTAK.K
	TK120303_NMyc_cyto3_step07.1098.1098.1	1.1332	0.1674	856.91	2	5000.0%	2	K.GPGRPTGSK.K
	TK120303_NMyc_cyto3_step02.1885.1885.1	2.6974	0.3997	1394.66	1	5000.0%	1	K.KLGEMWSEQSAK.D
UQ9D1L099.6%1115.7%153156619.6(Q9D1L0) Ethanol induced 6 
*	TK120303_NMyc_cyto3_step12.1144.1144.2	4.5377	0.6507	2153.78	1	5870.0%	1	R.RAPAAQPPAAAAPSAVGSPAAAPR.Q
UPMG1_MOUSE99.6%111737.2%253287017.2(Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) 
	TK120303_NMyc_cyto3_step01.4624.4624.2	2.2978	0.2158	3024.99	2	2120.0%	1	K.HLEGLSEEAIMELNLPTGIPIVYELDK.N
	TK120303_NMyc_cyto3_step04.1875.1875.1	1.4496	0.0786	1150.6	5	5000.0%	1	R.VLIAAHGNSLR.G
	TK120303_NMyc_cyto3_step01.0278.0278.1	1.537	0.118	977.46	1	7220.0%	2	K.AMEAVAAQGK.V
	TK120303_NMyc_cyto3_step04.1787.1787.1	2.9846	0.4472	1061.5	1	7780.0%	2	R.HYGGLTGLNK.A
	TK120303_NMyc_cyto3_step02.1697.1697.1	1.8477	0.358	1314.56	1	5000.0%	2	R.HGESAWNLENR.F
	TK120303_NMyc_cyto3_step07.1160.1160.1	1.0913	0.0777	757.42	1	6670.0%	1	K.RGGQALR.D
	TK120303_NMyc_cyto3_step10.2342.2342.2	3.4172	0.5227	2115.52	1	5590.0%	1	K.NLKPIKPMQFLGDEETVR.K
UQ99LJ399.6%4610.0%400459185.0(Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) 
	TK120303_NMyc_cyto3_step03.2971.2971.2	4.2388	0.5797	1981.54	1	6250.0%	1	R.ISIEMHGTLEDQLSHLR.Q
	TK120303_NMyc_cyto3_step03.1268.1268.1	1.3657	0.0173	1325.55	4	4500.0%	1	R.RDQALTEEHAR.Q
	TK120303_NMyc_cyto3_step02.2349.2349.1	1.9999	0.0988	1295.34	1	5450.0%	2	R.LAILGIHNEVSK.I
UCOF1_MOUSE99.6%3343950.0%166185608.1(P18760) Cofilin, non-muscle isoform 
	TK120303_NMyc_cyto3_step01.1626.1626.1	1.4659	0.1221	917.47	1	7140.0%	1	K.NIILEEGK.E
*	TK120303_NMyc_cyto3_step08.3490.3490.2	5.0207	0.6154	2021.29	1	5940.0%	20	K.KEDLVFIFWAPENAPLK.S
	TK120303_NMyc_cyto3_step01.2724.2724.1	1.3382	0.2714	1343.27	1	4620.0%	4	K.LGGSAVISLEGKPL.-
	TK120303_NMyc_cyto3_step05.1391.1391.1	1.462	0.1468	661.59	1	7000.0%	4	K.KLTGIK.H
*	TK120303_NMyc_cyto3_step01.2827.2827.2	4.7307	0.4142	2199.05	1	6050.0%	1	K.EILVGDVGQTVDDPYTTFVK.M
	TK120303_NMyc_cyto3_step01.0360.0360.1	1.3266	0.0735	802.39	3	6670.0%	1	K.MIYASSK.D
	TK120303_NMyc_cyto3_step01.1698.1698.1	1.9045	0.2573	1339.73	1	4500.0%	2	R.YALYDATYETK.E
UK1CI_HUMAN99.6%102811.7%622619875.2(P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9) 
*	TK120303_NMyc_cyto3_step01.1708.1708.1	2.366	0.3112	1316.82	1	5910.0%	1	K.DQIVDLTVGNNK.T
*	TK120303_NMyc_cyto3_step03.2954.2954.2	4.6685	0.4648	1841.0	1	7000.0%	4	R.HGVQELEIELQSQLSK.K
*	TK120303_NMyc_cyto3_step05.1179.1179.1	1.1643	0.0879	812.51	8	5710.0%	3	K.KGPAAIQK.N
*	TK120303_NMyc_cyto3_step07.1664.1664.3	1.5751	0.0722	2144.96	2	2500.0%	1	R.QFSSSYLTSGGGGGGGLGSGGSIR.S
*	TK120303_NMyc_cyto3_step01.3820.3820.2	2.5076	0.4143	2904.35	1	2920.0%	1	K.NYSPYYNTIDDLKDQIVDLTVGNNK.T
UUBA1_MOUSE99.6%162615.5%10581178095.7(Q02053) Ubiquitin-activating enzyme E1 1 
*	TK120303_NMyc_cyto3_step01.4006.4006.2	4.1883	0.5409	2615.22	1	5230.0%	1	R.IYDDDFFQNLDGVANALDNIDAR.M
	TK120303_NMyc_cyto3_step06.2939.2939.2	2.017	0.1609	2528.22	2	2500.0%	2	R.QLLHNFPPDQLTSSGAPFWSGPK.R
	TK120303_NMyc_cyto3_step02.2223.2223.1	1.2453	0.053	1288.65	1	5500.0%	1	R.QLYVLGHEAMK.M
	TK120303_NMyc_cyto3_step08.2444.2444.3	1.9238	0.0077	3109.2	21	1500.0%	1	K.LAYVAAGDLAPINAFIGGLAAQEVMKACSGK.F
	TK120303_NMyc_cyto3_step03.1908.1908.1	2.7539	0.4561	1245.64	1	7270.0%	3	R.KPLLESGTLGTK.G
	TK120303_NMyc_cyto3_step01.1828.1828.1	1.8137	0.0491	813.67	6	7140.0%	1	K.NIILGGVK.A
	TK120303_NMyc_cyto3_step11.2314.2314.2	1.1075	2.0E-4	2613.27	1	2860.0%	1	K.SIPICTLKNFPNAIEHTLQWAR.D
*	TK120303_NMyc_cyto3_step01.3683.3683.3	1.8981	0.072	3335.07	38	1550.0%	1	K.NIILGGVKAVTLHDQGTTQWADLSSQFYLR.E
	TK120303_NMyc_cyto3_step03.3083.3083.2	2.7837	0.4132	1697.99	1	6150.0%	2	K.NFPNAIEHTLQWAR.D
	TK120303_NMyc_cyto3_step02.1367.1367.1	1.7263	0.3364	1401.69	1	5000.0%	1	K.VVQGHQQLDSYK.N
UMPK4_MOUSE99.6%4411.3%397441148.1(P47809) Dual specificity mitogen-activated protein kinase kinase 4 (EC 2.7.1.-) (MAP kinase kinase 4) (MAPKK 4) (MAPK/ERK kinase 4) (JNK activating kinase 1) (C-JUN N-terminal kinase kinase 1) (JNK kinase 1) (JNKK 1) (SAPK/ERK kinase 1) (SEK1) 
	TK120303_NMyc_cyto3_step02.2139.2139.1	1.6626	0.0934	1216.9	18	5000.0%	1	R.LRTHSIESSGK.L
*	TK120303_NMyc_cyto3_step03.2052.2052.2	3.2906	0.4584	1940.11	1	5000.0%	1	R.FTLNPNTTGVQNPHIER.L
	TK120303_NMyc_cyto3_step01.0854.0854.1	1.0878	0.0841	760.42	16	5830.0%	1	K.DLGEIGR.G
*	TK120303_NMyc_cyto3_step04.0433.0433.1	0.745	0.0338	1230.31	3	3890.0%	1	R.TVEVACYVCK.I
UARI1_MOUSE99.6%112.6%469555677.2(Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment) 
	TK120303_NMyc_cyto3_step06.1989.1989.1	2.3436	0.4382	1451.68	1	5000.0%	1	R.VLLQHVHEGYEK.D
UQ9D7H199.6%2227.1%140153635.6(Q9D7H1) 2010016I08Rik protein 
*	TK120303_NMyc_cyto3_step08.2351.2351.3	1.3864	0.0158	4272.71	94	900.0%	1	K.LEEVIQILGDNFPCTLEAQKIDLPEYQGEPDEISIQK.C
*	TK120303_NMyc_cyto3_step02.3449.3449.2	3.2885	0.4593	2445.51	1	4250.0%	1	K.KLEEVIQILGDNFPCTLEAQK.I
UO0913299.6%4420.6%350401656.8(O09132) A6 gene product 
	TK120303_NMyc_cyto3_step06.2357.2357.1	2.9869	0.482	1454.87	1	6250.0%	1	K.HQTLQGVAFPISR.D
*	TK120303_NMyc_cyto3_step02.3131.3131.3	1.9499	0.0261	3995.89	10	1320.0%	1	K.ISIENEQLVVGSCSPPSDSWEQDYDSFVLPLLEDK.Q
	TK120303_NMyc_cyto3_step03.2500.2500.2	2.027	0.269	1720.72	5	3670.0%	1	K.EFGGGHIKDEVFGTVK.E
	TK120303_NMyc_cyto3_step12.2955.2955.2	1.2987	0.0254	2359.41	12	2000.0%	1	K.HQTLQGVAFPISRDAFQALEK.L
UHBA_MOUSE99.6%162410695.7%141149548.2(P01942) Hemoglobin alpha chain 
*	TK120303_NMyc_cyto3_step01.0380.0380.1	1.8498	0.1926	749.41	1	7500.0%	2	-.VLSGEDK.S
	TK120303_NMyc_cyto3_step01.2235.2235.1	1.504	0.1907	1254.69	1	5450.0%	2	K.FLASVSTVLTSK.Y
	TK120303_NMyc_cyto3_step12.2938.2938.3	2.1042	0.1816	3852.92	1	1470.0%	1	R.VDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDK.F
	TK120303_NMyc_cyto3_step01.0970.0970.1	1.2735	0.0494	534.46	1	6250.0%	5	K.AAWGK.I
	TK120303_NMyc_cyto3_step01.1894.1894.1	1.4364	0.2189	1031.53	1	5000.0%	4	R.MFASFPTTK.T
	TK120303_NMyc_cyto3_step01.1439.1439.1	1.2921	0.1343	819.45	1	6670.0%	1	R.VDPVNFK.L
	TK120303_NMyc_cyto3_step03.2135.2135.1	1.4711	0.0187	1089.77	95	5000.0%	1	K.LRVDPVNFK.L
	TK120303_NMyc_cyto3_step02.1873.1873.1	2.5238	0.147	1533.59	1	5000.0%	40	K.IGGHGAEYGAEALER.M
	TK120303_NMyc_cyto3_step10.2066.2066.2	3.3326	0.6511	1823.93	1	5670.0%	39	K.TYFPHFDVSHGSAQVK.G
	TK120303_NMyc_cyto3_step12.3099.3099.2	4.5612	0.6894	3055.04	1	3700.0%	20	K.LLSHCLLVTLASHHPADFTPAVHASLDK.F
*	TK120303_NMyc_cyto3_step04.4318.4318.2	1.742	0.0926	2969.3	1	2410.0%	9	K.KVADALASAAGHLDDLPGALSALSDLHAHK.L
	TK120303_NMyc_cyto3_step10.2034.2034.2	2.6093	0.4891	2200.78	1	3160.0%	1	K.TYFPHFDVSHGSAQVKGHGK.K
	TK120303_NMyc_cyto3_step09.2847.2847.3	2.376	0.2427	2829.4	11	1770.0%	1	R.MFASFPTTKTYFPHFDVSHGSAQVK.G
*	TK120303_NMyc_cyto3_step02.3248.3248.3	2.3359	0.1247	2836.05	1	2230.0%	1	K.VADALASAAGHLDDLPGALSALSDLHAHK.L
URTC1_MOUSE99.6%41010.1%366392267.9(Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase) 
*	TK120303_NMyc_cyto3_step11.1927.1927.2	1.8721	0.0945	1879.24	4	3440.0%	1	R.STPGLRPQHLSGLEMVR.D
*	TK120303_NMyc_cyto3_step09.2879.2879.2	1.8634	0.2062	2157.23	1	3160.0%	3	K.TGSVTLHTQTAIHFAEQLAK.A
UA1T1_MOUSE99.6%124619.9%413460035.7(P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) 
	TK120303_NMyc_cyto3_step02.1535.1535.1	1.5915	0.2281	1214.75	1	6110.0%	1	K.MQHLEQTLSK.E
	TK120303_NMyc_cyto3_step08.2547.2547.2	4.3462	0.5262	2200.4	1	5560.0%	5	K.NHYQAEVFSVNFAESEEAK.K
	TK120303_NMyc_cyto3_step08.3354.3354.3	3.1408	0.4527	3503.43	1	2250.0%	4	K.SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK.L
	TK120303_NMyc_cyto3_step01.3403.3403.2	5.8126	0.5847	2409.0	1	6430.0%	2	K.DQSPASHEIATNLGDFAISLYR.E
URAC1_HUMAN99.6%117.3%192214508.5(P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) 
	TK120303_NMyc_cyto3_step11.1838.1838.1	2.5545	0.4235	1586.58	1	4620.0%	1	R.HHCPNTPIILVGTK.L
UHS9A_MOUSE99.6%297324.9%732846575.0(P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) 
	TK120303_NMyc_cyto3_step04.2772.2772.2	3.6385	0.5355	1788.81	1	7140.0%	2	K.HLEINPDHSIIETLR.Q
	TK120303_NMyc_cyto3_step03.1764.1764.1	1.8167	0.2285	1077.54	1	7140.0%	1	K.KFYEQFSK.N
	TK120303_NMyc_cyto3_step01.2192.2192.1	2.0225	0.3454	1515.73	1	3850.0%	2	R.GVVDSEDLPLNISR.E
	TK120303_NMyc_cyto3_step01.0307.0307.1	1.5356	0.1088	662.32	3	8000.0%	2	K.VTVITK.H
*	TK120303_NMyc_cyto3_step02.2224.2224.1	2.3741	0.399	1210.67	1	6670.0%	2	K.HIYFITGETK.D
	TK120303_NMyc_cyto3_step05.3327.3327.2	3.1863	0.5498	1779.56	1	5710.0%	2	K.HSQFIGYPITLFVEK.E
	TK120303_NMyc_cyto3_step02.1324.1324.1	1.708	0.1185	1168.54	1	6110.0%	1	K.LGIHEDSQNR.K
	TK120303_NMyc_cyto3_step03.2816.2816.1	1.9413	0.2977	1264.69	1	6110.0%	1	R.RAPFDLFENR.K
	TK120303_NMyc_cyto3_step01.3064.3064.2	1.4196	0.1491	2258.99	12	2370.0%	1	K.HNDDEQYAWESSAGGSFTVR.T
	TK120303_NMyc_cyto3_step05.1951.1951.1	1.2639	0.2393	724.66	9	6000.0%	5	K.VILHLK.E
	TK120303_NMyc_cyto3_step01.1383.1383.1	1.8785	0.1092	1151.46	6	6880.0%	1	K.YIDQEELNK.T
*	TK120303_NMyc_cyto3_step02.2467.2467.1	2.3667	0.2307	1165.48	15	5560.0%	2	K.ELHINLIPSK.Q
	TK120303_NMyc_cyto3_step04.3151.3151.2	1.0839	0.0696	2900.4	162	1200.0%	1	K.VTVITKHNDDEQYAWESSAGGSFTVR.T
	TK120303_NMyc_cyto3_step01.1532.1532.1	1.7032	0.0352	1291.68	2	5450.0%	1	R.ELISNSSDALDK.I
	TK120303_NMyc_cyto3_step01.2272.2272.1	1.8891	0.3811	1351.7	1	6250.0%	4	R.TLTIVDTGIGMTK.A
*	TK120303_NMyc_cyto3_step12.1442.1442.2	1.103	0.0824	2875.83	124	1520.0%	1	K.SLTNDWEEHLAVKHFSVEGQLEFR.A
UPEBP_MOUSE99.6%3323.0%187208605.4(P70296) Phosphatidylethanolamine-binding protein (PEBP) 
*	TK120303_NMyc_cyto3_step01.3150.3150.2	3.8639	0.4925	2712.67	1	4050.0%	1	R.YVWLVYEQEQPLSCDEPILSNK.S
	TK120303_NMyc_cyto3_step01.2350.2350.1	1.0755	0.0041	1560.98	9	3080.0%	1	K.LYTLVLTDPDAPSR.K
*	TK120303_NMyc_cyto3_step03.1923.1923.1	1.914	0.3209	926.83	1	8330.0%	1	K.FKVETFR.K
UQ9D1P499.6%4613.0%331373517.9(Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) 
	TK120303_NMyc_cyto3_step08.2342.2342.2	3.9124	0.5006	1849.41	1	6330.0%	2	K.FQEHIIQAPKPVEAIK.R
*	TK120303_NMyc_cyto3_step09.2315.2315.3	2.0678	0.0743	2772.56	2	1850.0%	1	K.ELSELKPKFQEHIIQAPKPVEAIK.R
	TK120303_NMyc_cyto3_step05.4292.4292.2	1.1237	0.0352	2177.39	26	2780.0%	1	R.HNSEKPPEPVKPEVKTTEK.K
UTES_MOUSE99.6%358.7%423479838.3(P47226) Testin (TES1/TES2) 
	TK120303_NMyc_cyto3_step06.1655.1655.2	4.3437	0.6137	2204.82	1	5830.0%	2	K.NHAVVCQGCHNAIDPEVQR.V
*	TK120303_NMyc_cyto3_step07.2139.2139.2	1.4835	0.1268	2088.75	15	2650.0%	1	K.QLPAHDQDPSKCHELSPK.E
USBP1_MOUSE99.6%141837.7%472523526.4(P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56) 
	TK120303_NMyc_cyto3_step01.3038.3038.1	1.8071	0.1782	1542.14	1	4230.0%	1	K.GSFVLLDGETFEVK.G
	TK120303_NMyc_cyto3_step10.2278.2278.2	3.7261	0.5646	1711.11	1	5670.0%	1	K.RIPGGPQMIQLSLDGK.R
	TK120303_NMyc_cyto3_step02.1344.1344.1	1.5707	0.2672	1347.74	2	4500.0%	2	R.QYDISNPQKPR.L
	TK120303_NMyc_cyto3_step03.1490.1490.2	2.7657	0.2726	1215.0	1	8330.0%	1	K.SPQYSQVIHR.L
	TK120303_NMyc_cyto3_step02.3489.3489.2	2.4183	0.4178	2222.57	1	3890.0%	1	R.HEIIQTLQMTDGLIPLEIR.F
*	TK120303_NMyc_cyto3_step01.4543.4543.1	1.2178	0.0278	1071.14	6	5560.0%	1	K.LILPGLISSR.I
*	TK120303_NMyc_cyto3_step06.3719.3719.2	0.8562	0.0201	2511.23	44	1590.0%	1	K.VKGWMLPGVPGLITDILLSLDDR.F
*	TK120303_NMyc_cyto3_step05.3673.3673.2	1.0067	0.0015	2626.08	14	1960.0%	1	K.EPLGAALAHELRYPGGDCSSDIWI.-
	TK120303_NMyc_cyto3_step12.1820.1820.2	1.0385	0.0457	1832.07	2	3330.0%	2	R.HNVMVSTEWAAPNVFK.D
*	TK120303_NMyc_cyto3_step02.3311.3311.3	1.6412	0.0066	3738.01	71	1250.0%	1	R.LAGQIFLGGSIVRGGSVQVLEDQELTCQPEPLVVK.G
*	TK120303_NMyc_cyto3_step05.3600.3600.2	1.3412	0.112	2661.44	20	1740.0%	1	R.QYDISNPQKPRLAGQIFLGGSIVR.G
UNAL1_HUMAN99.6%13457.4%14731658656.8(Q9C000) NACHT-, LRR- and PYD-containing protein 2 (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) (Caspase recruitment domain protein 7) 
*	TK120303_NMyc_cyto3_step11.1626.1626.3	1.4548	0.0348	3180.64	4	1980.0%	1	K.ELWALCLVPWVSWLACTCLMQQMKR.K
*	TK120303_NMyc_cyto3_step03.4410.4410.3	1.4021	0.0375	1726.44	13	2860.0%	1	K.ELDLQQNNLDDVGVR.L
*	TK120303_NMyc_cyto3_step11.2742.2742.3	1.7213	0.0671	3189.69	10	1550.0%	1	R.SSSGETPAQPEKTSGMEVASYLVAQYGEQR.A
*	TK120303_NMyc_cyto3_step06.3071.3071.2	3.4595	0.2214	2283.25	1	4210.0%	6	R.IAVPSPLDAPQLLHFVDQYR.E
*	TK120303_NMyc_cyto3_step11.3631.3631.2	1.1176	0.0387	2043.57	78	2220.0%	1	K.ELDLSGNSLSHSAVKSLCK.T
UGMDS_HUMAN99.6%2214.5%372419507.3(O60547) GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) (GMD) 
*	TK120303_NMyc_cyto3_step02.2644.2644.3	1.9798	0.0602	3526.03	84	1140.0%	1	R.GSGDGEMGKPRNVALITGITGQDGSYLAEFLLEK.G
*	TK120303_NMyc_cyto3_step04.2563.2563.2	3.4429	0.5211	2254.37	1	4740.0%	1	K.IINEVKPTEIYNLGAQSHVK.I
UPMGE_MOUSE99.6%247.4%258298477.1(P15327) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM) 
*	TK120303_NMyc_cyto3_step06.2457.2457.2	3.6254	0.2151	1993.35	1	6110.0%	2	R.AVGPHQFLGNQEAIQAAIK.K
UCLP2_MOUSE99.6%359.8%305331567.6(Q08093) Calponin H2, smooth muscle 
	TK120303_NMyc_cyto3_step03.0462.0462.1	1.1089	0.0628	1494.6	1	3460.0%	1	K.CASQVGMTAPGTRR.H
	TK120303_NMyc_cyto3_step05.3116.3116.2	2.0599	0.2992	1990.51	1	3330.0%	2	R.SMQNWHQLENLSNFIK.A
UEF1G_MOUSE99.6%71320.4%437500616.7(Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) 
	TK120303_NMyc_cyto3_step10.3253.3253.2	1.881	0.1731	2577.66	1	3040.0%	1	K.NAFASVILFGTNNSSSISGVWVFR.G
*	TK120303_NMyc_cyto3_step04.1386.1386.1	1.0826	0.0083	934.36	8	5000.0%	1	K.FAESQPKK.D
*	TK120303_NMyc_cyto3_step02.2863.2863.1	1.3359	0.0899	1122.69	2	6110.0%	1	R.ILGLLDTHLK.T
*	TK120303_NMyc_cyto3_step04.3210.3210.3	1.6714	0.0274	3982.32	26	1290.0%	1	K.DGWSLWYAEYRFPEELTQTFMSCNLITGMFQR.L
	TK120303_NMyc_cyto3_step12.2059.2059.2	3.0676	0.5634	1711.06	1	5710.0%	3	R.VLSAPPHFHFGQTNR.T
UPSA5_MOUSE99.6%2217.0%241264114.8(Q9Z2U1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome zeta chain) (EC 3.4.25.1) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) 
	TK120303_NMyc_cyto3_step03.2918.2918.2	1.8006	0.0086	2474.48	1	2860.0%	1	K.LNATNIELATVQPGQNFHMFTK.E
	TK120303_NMyc_cyto3_step02.2639.2639.2	3.6447	0.5502	2164.83	1	5280.0%	1	K.GPQLFHMDPSGTFVQCDAR.A
UADHA_MOUSE99.6%3824839.0%374396408.1(P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) 
*	TK120303_NMyc_cyto3_step10.3573.3573.2	1.5175	0.072	2873.03	5	2000.0%	1	K.GKQIHNFISTSTFSQYTVVDDIAVAK.I
*	TK120303_NMyc_cyto3_step01.2498.2498.1	1.4673	0.0315	1090.85	50	5000.0%	1	K.INEAFDLLR.S
*	TK120303_NMyc_cyto3_step01.1724.1724.1	1.2383	0.0111	831.49	8	5830.0%	1	R.SDLLMPR.G
	TK120303_NMyc_cyto3_step01.2144.2144.1	1.7796	0.095	798.36	10	6430.0%	1	K.GAIFGGFK.S
*	TK120303_NMyc_cyto3_step03.1294.1294.1	1.2999	0.106	1135.5	1	5620.0%	3	K.HPESNFCSR.S
	TK120303_NMyc_cyto3_step01.1660.1660.1	1.8797	0.1787	885.74	1	7860.0%	1	R.IIAVDINK.D
*	TK120303_NMyc_cyto3_step07.3279.3279.2	4.5154	0.5259	2507.41	1	4760.0%	4	K.AAVLWELHKPFTIEDIEVAPPK.A
*	TK120303_NMyc_cyto3_step10.3930.3930.2	1.9362	0.3583	1898.26	1	5330.0%	12	K.KFPLDPLITHVLPFEK.I
*	TK120303_NMyc_cyto3_step02.3635.3635.3	3.1485	0.2581	4086.11	1	1620.0%	6	R.SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK.V
*	TK120303_NMyc_cyto3_step05.3063.3063.2	2.8625	0.3389	2687.13	1	3260.0%	6	K.QIHNFISTSTFSQYTVVDDIAVAK.I
UCAZ1_MOUSE99.6%4619.4%284327525.6(P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment) 
	TK120303_NMyc_cyto3_step03.2846.2846.2	3.2549	0.6183	2091.25	1	5290.0%	1	K.FITHAPPGEFNEVFNDVR.L
	TK120303_NMyc_cyto3_step05.2015.2015.2	3.433	0.4667	2030.93	1	5000.0%	2	K.IQVHYYEDGNVQLVSHK.D
	TK120303_NMyc_cyto3_step06.3056.3056.2	1.4084	0.1247	2314.29	6	2370.0%	1	K.TIDGQQTIIACIESHQFQPK.N
UDHAM_MOUSE99.6%5911.6%519565387.6(P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2) 
	TK120303_NMyc_cyto3_step03.1552.1552.3	1.7033	0.0595	2723.26	27	1700.0%	2	R.HEPVGVCGQIIPWNFPLLMQAWK.L
*	TK120303_NMyc_cyto3_step04.0418.0418.2	0.9281	0.0181	1495.43	51	3080.0%	1	K.ILGYIKSGQQEGAK.L
*	TK120303_NMyc_cyto3_step02.3227.3227.2	4.9086	0.5486	2287.65	1	5230.0%	2	K.VAFTGSTEVGHLIQVAAGSSNLK.R
UHBB1_MOUSE99.6%111110789.0%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major) 
	TK120303_NMyc_cyto3_step02.4415.4415.1	2.2938	0.2569	1138.71	1	6360.0%	15	K.VVAGVATALAHK.Y
	TK120303_NMyc_cyto3_step01.2371.2371.2	4.0082	0.4902	1760.63	1	7000.0%	6	K.VITAFNDGLNHLDSLK.G
	TK120303_NMyc_cyto3_step01.4571.4571.1	2.481	0.5144	1467.74	1	5420.0%	11	K.GTFASLSELHCDK.L
	TK120303_NMyc_cyto3_step09.2201.2201.2	2.6839	0.4099	1436.67	1	6540.0%	1	K.VVAGVATALAHKYH.-
*	TK120303_NMyc_cyto3_step01.1815.1815.1	1.3852	0.0834	993.67	1	6250.0%	2	K.AAVSCLWGK.V
	TK120303_NMyc_cyto3_step01.1616.1616.1	2.2677	0.1658	1296.66	1	5450.0%	3	K.DFTPAAQAAFQK.V
	TK120303_NMyc_cyto3_step05.2784.2784.2	3.3808	0.6222	2576.13	1	4520.0%	9	K.GTFASLSELHCDKLHVDPENFR.L
	TK120303_NMyc_cyto3_step02.1323.1323.1	1.9562	0.3858	915.49	1	7140.0%	15	-.VHLTDAEK.A
	TK120303_NMyc_cyto3_step02.2839.2839.2	1.8015	0.1924	1887.44	1	4060.0%	11	K.KVITAFNDGLNHLDSLK.G
	TK120303_NMyc_cyto3_step02.1720.1720.1	1.3559	0.0094	1129.92	22	4380.0%	9	K.LHVDPENFR.L
	TK120303_NMyc_cyto3_step12.4174.4174.2	3.2559	0.4991	1715.77	1	4670.0%	12	R.LLGNMIVIVLGHHLGK.D
	TK120303_NMyc_cyto3_step01.2864.2864.2	4.748	0.6603	1984.63	1	5280.0%	4	R.YFDSFGDLSSASAIMGNAK.V
	TK120303_NMyc_cyto3_step01.1403.1403.1	1.7754	0.3123	1304.65	1	5000.0%	2	K.VNSDEVGGEALGR.L
UH11_MOUSE99.6%4615.1%2122165410.9(P43275) Histone H1.1 (H1 VAR.3) (H1A) 
*	TK120303_NMyc_cyto3_step07.0248.0248.1	0.7284	0.0557	1250.67	2	2270.0%	1	K.KSLAAAGYDVEK.N
*	TK120303_NMyc_cyto3_step12.2747.2747.2	3.835	0.4987	2015.04	1	4470.0%	2	R.KKPAGPSVSELIVQAVSSSK.E
*	TK120303_NMyc_cyto3_step07.3113.3113.2	2.347	0.3862	1885.05	1	3330.0%	1	K.KPAGPSVSELIVQAVSSSK.E
UHBB2_MOUSE99.6%2217050.7%146157478.1(P02089) Hemoglobin beta-2 chain (B2) (Minor) 
*	TK120303_NMyc_cyto3_step03.2134.2134.1	2.3016	0.2664	1221.66	1	6500.0%	2	K.KVITAFNEGLK.N
*	TK120303_NMyc_cyto3_step12.4247.4247.2	3.0804	0.5158	1656.21	1	5670.0%	12	R.LLGNAIVIVLGHHLGK.D
*	TK120303_NMyc_cyto3_step01.1918.1918.1	1.7871	0.1621	1023.67	1	6250.0%	1	K.SAVSCLWAK.V
	TK120303_NMyc_cyto3_step01.0838.0838.1	1.3952	0.0418	718.43	16	7000.0%	4	K.NLDNLK.G
*	TK120303_NMyc_cyto3_step01.1512.1512.1	2.313	0.348	1314.65	1	5000.0%	2	K.VNPDEVGGEALGR.L
*	TK120303_NMyc_cyto3_step01.2886.2886.2	4.6854	0.601	2008.08	1	6940.0%	1	R.YFDSFGDLSSASAIMGNPK.V
UANX1_MOUSE99.6%3512.8%345386037.4(P10107) Annexin I (Lipocortin I) (Calpactin II) (Chromobindin 9) (P35) (Phospholipase A2 inhibitory protein) 
*	TK120303_NMyc_cyto3_step05.1480.1480.3	2.007	0.1224	2315.48	8	2500.0%	1	R.QQIKAAYLQENGKPLDEVLR.K
*	TK120303_NMyc_cyto3_step03.2639.2639.2	1.8001	0.1737	2345.87	8	2170.0%	2	K.GGPGSAVSPYPSFNVSSDVAALHK.A
UTCPH_MOUSE99.6%71113.4%544596527.8(P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) 
	TK120303_NMyc_cyto3_step02.2344.2344.1	1.6019	0.264	1156.02	1	5560.0%	1	R.SLHDAIMIVR.R
	TK120303_NMyc_cyto3_step05.3632.3632.2	3.8359	0.575	2893.43	1	3040.0%	2	R.VHTVEDYQAIVDAEWNILYDKLEK.I
	TK120303_NMyc_cyto3_step04.3833.3833.2	2.9579	0.2686	2289.83	1	3100.0%	1	R.INALTAASEAACLIVSVDETIK.N
	TK120303_NMyc_cyto3_step08.2599.2599.2	2.731	0.4524	2020.73	1	4380.0%	2	K.QVKPYVEEGLHPQIIIR.A
UDPP3_MOUSE99.6%121622.8%738829115.3(Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) 
*	TK120303_NMyc_cyto3_step02.1988.1988.1	1.988	0.4374	1525.64	1	4090.0%	1	R.YEFQGNHFQVTR.G
	TK120303_NMyc_cyto3_step07.3135.3135.2	4.8353	0.6756	2035.77	1	5790.0%	2	K.GPSFDVQVGLHELLGHGSGK.L
*	TK120303_NMyc_cyto3_step05.1067.1067.2	1.2038	0.1515	1912.47	3	2810.0%	1	K.EGVTTYFSGDCTMEDAK.L
	TK120303_NMyc_cyto3_step08.1499.1499.2	1.3842	0.1474	1452.1	8	3330.0%	1	K.SFGDTKFVPNLPK.D
*	TK120303_NMyc_cyto3_step03.3404.3404.2	3.5477	0.4428	3139.1	1	3330.0%	1	K.AYAANSHQEQMLAQYVESFTQGSIEAHK.R
	TK120303_NMyc_cyto3_step10.4097.4097.3	2.1696	0.1299	3239.81	1	1960.0%	1	R.AAWYGGLAVLLQTSPEAPYIYALLSRLFR.A
*	TK120303_NMyc_cyto3_step06.1985.1985.1	1.2239	0.0079	799.45	75	4170.0%	1	K.GAFNFDK.E
*	TK120303_NMyc_cyto3_step05.3191.3191.2	1.1605	0.0957	2829.63	320	1520.0%	1	K.GAFNFDKETVINPETGEQIQSWYR.S
*	TK120303_NMyc_cyto3_step09.2113.2113.2	2.2893	0.2633	1682.81	1	5420.0%	2	K.RYEFQGNHFQVTR.G
*	TK120303_NMyc_cyto3_step11.1689.1689.3	1.6503	0.0951	2649.12	5	2070.0%	1	K.SHYEVRLASVLNTDPALDSELTSK.L
UK6A1_MOUSE99.6%4413.3%724815958.1(P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) 
	TK120303_NMyc_cyto3_step12.2988.2988.3	2.0683	0.1784	4624.27	35	940.0%	1	K.RQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTR.I
*	TK120303_NMyc_cyto3_step09.2263.2263.2	2.9771	0.4553	1744.6	1	4330.0%	1	R.TTQAPLHSVVQQLHGK.N
	TK120303_NMyc_cyto3_step03.2156.2156.2	3.694	0.3531	1734.68	1	6430.0%	1	K.LPQSQLSHQDLQLVK.G
*	TK120303_NMyc_cyto3_step08.4263.4263.2	1.1269	0.0309	2741.65	7	1960.0%	1	R.EASFVLHTISKTVEYLHSQGVVHR.D
UO3549999.6%6616.9%773839544.4(O35499) Nuclear autoantigenic sperm protein 
*	TK120303_NMyc_cyto3_step02.1768.1768.2	0.8863	0.0166	2127.17	6	2060.0%	1	R.DEQMKEGEETEGSEEEDR.E
	TK120303_NMyc_cyto3_step08.2091.2091.2	1.1517	0.024	2370.28	60	1670.0%	1	R.MENGVLGNALEGVHVEEEEGEK.T
	TK120303_NMyc_cyto3_step02.3747.3747.2	2.8107	0.4664	2790.97	1	3260.0%	1	K.SLQENEEEEIGNLELAWDMLDLAK.I
	TK120303_NMyc_cyto3_step03.2255.2255.2	4.8185	0.6927	2144.76	1	6580.0%	1	R.KPTDGASSSNCVTDISHLVR.K
	TK120303_NMyc_cyto3_step04.4067.4067.2	0.9699	0.0929	1620.13	1	2810.0%	1	K.QEPEVNGGSGDAVSSGK.E
	TK120303_NMyc_cyto3_step08.3550.3550.3	2.4087	0.1973	3065.09	6	1810.0%	1	K.LLGLGQKHLVMGDIPAAVNAFQEAASLLGK.K
UPUR9_MOUSE99.6%6811.5%592641576.8(Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] 
*	TK120303_NMyc_cyto3_step12.2415.2415.2	1.5606	0.0451	2554.47	3	2290.0%	1	K.TVASPDVTVEAAVEQIDIGGVTLLR.A
*	TK120303_NMyc_cyto3_step02.1955.1955.2	4.6922	0.5736	1862.9	1	7500.0%	1	K.HVSPAGAAVGVPLSEDEAR.V
	TK120303_NMyc_cyto3_step12.1758.1758.1	3.0907	0.4064	1357.79	1	6250.0%	2	K.TLHPAVHAGILAR.N
*	TK120303_NMyc_cyto3_step08.2852.2852.2	1.4326	0.0981	2541.58	15	1960.0%	1	K.TLHPAVHAGILARNIPEDAADMAR.L
UQ91W8999.6%449.7%10391156886.5(Q91W89) Similar to mannosidase, alpha, class 2C, member 1 
*	TK120303_NMyc_cyto3_step03.3199.3199.3	2.0426	0.2143	3539.09	25	1450.0%	1	R.LQEFACRGQFVPVGGTWVEMDGNLPSGEAMVR.Q
*	TK120303_NMyc_cyto3_step12.2132.2132.2	1.1632	0.0322	2683.61	2	2000.0%	1	K.GRTNHSGFLFGFGDGGGGPTQTMLDR.L
	TK120303_NMyc_cyto3_step07.2325.2325.2	3.0204	0.5418	1825.91	1	4440.0%	1	R.KPVLGQAGTLAVGTEGGLR.G
*	TK120303_NMyc_cyto3_step10.2622.2622.2	1.331	0.0117	2603.33	67	1520.0%	1	R.LSNTDGLPRVQLSSPGQLFTALER.D
UACTA_HUMAN99.6%2613231.6%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) 
	TK120303_NMyc_cyto3_step01.2428.2428.2	3.5109	0.4839	1791.6	1	7330.0%	1	K.SYELPDGQVITIGNER.F
	TK120303_NMyc_cyto3_step02.2659.2659.2	3.6048	0.3602	1961.37	1	5330.0%	1	K.YPIEHGIITNWDDMEK.I
	TK120303_NMyc_cyto3_step01.2302.2302.1	1.9743	0.1601	1000.68	1	7140.0%	2	R.DLTDYLMK.I
	TK120303_NMyc_cyto3_step01.0282.0282.1	1.9991	0.3618	1198.37	1	7000.0%	1	K.DSYVGDEAQSK.R
	TK120303_NMyc_cyto3_step11.1949.1949.1	2.4423	0.461	1501.61	1	6000.0%	1	K.IWHHSFYNELR.V
	TK120303_NMyc_cyto3_step01.1863.1863.1	1.1754	0.1048	644.68	1	7000.0%	1	R.GILTLK.Y
	TK120303_NMyc_cyto3_step01.1679.1679.1	2.1451	0.1664	1164.58	1	6500.0%	2	K.EITALAPSTMK.I
	TK120303_NMyc_cyto3_step01.0400.0400.1	0.8255	0.1209	516.19	8	6670.0%	1	R.EIVR.D
	TK120303_NMyc_cyto3_step02.2351.2351.2	2.0432	0.3902	1958.49	1	5000.0%	1	R.VAPEEHPTLLTEAPLNPK.A
	TK120303_NMyc_cyto3_step07.1711.1711.1	3.009	0.4584	1174.4	1	7000.0%	10	R.HQGVMVGMGQK.D
	TK120303_NMyc_cyto3_step01.4467.4467.1	1.1366	0.1447	795.64	4	6670.0%	1	K.IIAPPER.K
UAAC2_MOUSE99.6%5710.4%8941036535.5(Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) 
	TK120303_NMyc_cyto3_step06.1753.1753.2	4.4664	0.6401	1754.61	1	7500.0%	2	R.KHEAFESDLAAHQDR.V
	TK120303_NMyc_cyto3_step01.2662.2662.1	1.2528	0.0205	1252.85	25	4000.0%	1	K.ASTHETWAYGK.E
	TK120303_NMyc_cyto3_step11.3389.3389.3	1.6692	0.0326	4454.5	3	1350.0%	1	R.IMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFR.I
	TK120303_NMyc_cyto3_step12.1850.1850.3	1.8827	0.1746	3183.09	8	1830.0%	1	R.SSIQITGALEDQMNQLKQYEHNIINYK.N
UHBAZ_MOUSE99.6%6831.2%141161047.6(P06467) Hemoglobin zeta chain 
*	TK120303_NMyc_cyto3_step01.1560.1560.1	1.2494	0.0162	1005.57	7	4440.0%	1	K.IMTAVGDAVK.S
	TK120303_NMyc_cyto3_step01.0911.0911.1	1.2216	0.1022	478.3	8	8330.0%	1	-.SLMK.N
*	TK120303_NMyc_cyto3_step10.1476.1476.3	1.6783	0.1622	3112.14	15	1770.0%	1	R.LFCSYPQTKTYFPHFDLHHGSQQLR.A
*	TK120303_NMyc_cyto3_step11.2179.2179.2	3.3109	0.4939	1984.11	1	6000.0%	2	K.TYFPHFDLHHGSQQLR.A
*	TK120303_NMyc_cyto3_step05.1169.1169.1	1.3464	0.4523	559.3	1	7500.0%	1	R.AHGFK.I
UST13_MOUSE99.6%6816.4%371416565.3(Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) 
	TK120303_NMyc_cyto3_step05.2899.2899.2	4.9619	0.6101	1934.85	1	6880.0%	2	R.LLGHWEEAAHDLALACK.L
*	TK120303_NMyc_cyto3_step10.3701.3701.3	1.5747	0.0326	3316.03	12	1520.0%	1	R.LLGHWEEAAHDLALACKLDYDEDASAMLR.E
	TK120303_NMyc_cyto3_step01.2615.2615.1	1.8364	0.2633	1107.77	1	6110.0%	1	K.AIDLFTDAIK.L
*	TK120303_NMyc_cyto3_step04.1094.1094.1	0.9866	0.0195	749.41	1	5830.0%	1	K.VPPATHK.A
*	TK120303_NMyc_cyto3_step02.1937.1937.1	3.396	0.5307	1557.63	1	5710.0%	1	K.KGAAIEALNDGELQK.A
UQ9DAR799.6%5726.3%338389886.5(Q9DAR7) 1700001E16Rik protein (RIKEN cDNA 1700001E16 gene) 
*	TK120303_NMyc_cyto3_step03.3486.3486.2	5.3473	0.5652	1850.19	1	8000.0%	1	R.AHLLAQVIENLECDPK.H
*	TK120303_NMyc_cyto3_step03.3786.3786.3	1.7669	0.0405	2857.11	16	1740.0%	2	R.TITLPYLESQSLSIQWVYNILDKK.A
*	TK120303_NMyc_cyto3_step09.3097.3097.3	1.8779	0.0202	3729.54	71	1210.0%	1	R.LRVYLHYLPSYYHLHVHFTALGFEAPGSGVER.A
	TK120303_NMyc_cyto3_step03.3359.3359.2	3.7715	0.5697	2187.61	1	5000.0%	1	K.WNQQQLDDLYLIAICHR.R
UQ9Z1R299.6%9912.6%11541210375.7(Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) 
	TK120303_NMyc_cyto3_step10.1150.1150.3	1.7472	0.0029	2028.56	7	2810.0%	1	R.LVMAQHMIRDIQTLLSR.M
*	TK120303_NMyc_cyto3_step09.1836.1836.3	1.492	0.0318	2819.9	39	1580.0%	1	R.APPQTQLPSGASSGTGSASATHGGAPLPGTR.G
	TK120303_NMyc_cyto3_step11.1990.1990.2	2.7597	0.5081	2218.23	1	4440.0%	1	R.SFFHQHYLGGQEPTPSNIR.M
	TK120303_NMyc_cyto3_step05.3564.3564.1	1.4696	0.0223	1136.62	9	5000.0%	1	K.KLQEYNVGGK.V
*	TK120303_NMyc_cyto3_step01.2968.2968.3	1.7301	0.0988	4621.25	12	990.0%	1	R.GPPPAPEGGSRDEQDGASADAEPWAAAVPPEWVPIIQQDIQSQR.K
*	TK120303_NMyc_cyto3_step01.4332.4332.3	1.8787	0.0963	3622.43	38	1170.0%	1	R.DEQDGASADAEPWAAAVPPEWVPIIQQDIQSQR.K
*	TK120303_NMyc_cyto3_step11.4193.4193.2	1.5186	0.018	2514.61	25	2170.0%	1	R.TSPEPQRENASPAPGTTAEEAMSR.G
UGCB_MOUSE99.6%3512.5%336366597.4(P01866) Ig gamma-2B chain C region 
	TK120303_NMyc_cyto3_step07.2053.2053.2	4.1324	0.5547	1996.02	1	5290.0%	2	K.KLEPSGPISTINPCPPCK.E
	TK120303_NMyc_cyto3_step03.2635.2635.3	1.703	0.1198	2707.9	410	1520.0%	1	K.ECHKCPAPNLEGGPSVFIFPPNIK.D
UQ925K499.6%227.9%454499475.7(Q925K4) Copine 1 protein (Fragment) 
*	TK120303_NMyc_cyto3_step03.2922.2922.2	3.3877	0.5316	2250.94	1	4210.0%	1	R.FSVSLQHFCGGDLSTPIQVR.C
	TK120303_NMyc_cyto3_step08.2840.2840.2	1.2979	0.0377	1784.36	35	2670.0%	1	R.LYGPTNFAPIINHVAR.F
UQ9D8S999.6%1116.1%137143798.8(Q9D8S9) 1810037G04Rik protein 
*	TK120303_NMyc_cyto3_step07.2985.2985.2	5.0575	0.6541	2297.95	1	5240.0%	1	R.LVHEALSEELAGPVHALAIQAK.T
UQ9D81999.6%2218.7%289326675.6(Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene) 
	TK120303_NMyc_cyto3_step04.3394.3394.2	3.7064	0.5877	1695.51	1	6540.0%	1	R.LKPGYLEATVDWFR.R
*	TK120303_NMyc_cyto3_step12.3416.3416.3	2.4064	0.2832	4552.96	2	1350.0%	1	K.GYIWNYGAIPQTWEDPGHSDKHTGCCGDNDPIDVCEIGSK.V
ULGUL_MOUSE99.6%3319.1%183206785.5(Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) 
	TK120303_NMyc_cyto3_step01.2762.2762.1	1.3283	0.0356	1265.75	2	5000.0%	1	K.DFLLQQTMLR.I
	TK120303_NMyc_cyto3_step02.1701.1701.1	1.9702	0.1331	977.82	6	7140.0%	1	K.RFEELGVK.F
	TK120303_NMyc_cyto3_step03.2751.2751.2	3.4509	0.5374	1792.6	1	5000.0%	1	R.GFGHIGIAVPDVYSACK.R
UQ9DCT899.6%2230.3%208227278.6(Q9DCT8) 0610010I23Rik protein (Cysteine-rich protein 2) 
*	TK120303_NMyc_cyto3_step02.2832.2832.3	6.0378	0.6415	3326.3	1	3310.0%	1	K.GVNIGGAGSYIYEKPQTEAPQVTGPIEVPVVR.T
*	TK120303_NMyc_cyto3_step06.2432.2432.3	1.6559	0.0245	3528.61	159	1170.0%	1	R.CNKTLTPGGHAEHDGKPFCHKPCYATLFGPK.G
UKC21_MOUSE99.6%4415.3%391451628.0(Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37) 
	TK120303_NMyc_cyto3_step07.3168.3168.2	1.1929	0.1057	2829.19	39	1430.0%	1	R.EYWDYESHVVEWGNQDDYQLVR.K
	TK120303_NMyc_cyto3_step02.0492.0492.1	1.0555	0.1354	1313.59	2	3750.0%	1	R.GGPNIITLADIVK.D
	TK120303_NMyc_cyto3_step06.2273.2273.2	1.7026	0.2114	1866.64	60	2350.0%	1	R.GGPNIITLADIVKDPVSR.T
	TK120303_NMyc_cyto3_step04.3155.3155.2	3.4955	0.4837	2325.08	1	5260.0%	1	R.FVHSENQHLVSPEALDFLDK.L
UG3P_MOUSE99.6%4225053.0%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) 
*	TK120303_NMyc_cyto3_step01.1494.1494.1	2.2231	0.3607	1371.66	1	4640.0%	2	R.GAAQNIIPASTGAAK.A
	TK120303_NMyc_cyto3_step10.2452.2452.2	3.5709	0.5253	2370.82	1	4290.0%	1	K.RVIISAPSADAPMFVMGVNHEK.Y
	TK120303_NMyc_cyto3_step02.2912.2912.2	3.8097	0.5565	2217.48	1	4250.0%	3	R.VIISAPSADAPMFVMGVNHEK.Y
*	TK120303_NMyc_cyto3_step02.3633.3633.3	2.0782	0.0411	4054.31	1	1420.0%	3	K.GILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVK.L
*	TK120303_NMyc_cyto3_step03.3159.3159.2	1.0721	0.0263	2869.39	4	1920.0%	1	K.WGEAGAEYVVESTGVFTTMEKAGAHLK.G
*	TK120303_NMyc_cyto3_step03.3148.3148.2	1.8729	0.2216	2294.3	1	3000.0%	10	K.WGEAGAEYVVESTGVFTTMEK.A
	TK120303_NMyc_cyto3_step01.0940.0940.1	1.3466	0.0492	829.51	2	5710.0%	1	K.QASEGPLK.G
	TK120303_NMyc_cyto3_step01.2124.2124.1	2.4756	0.2776	1557.75	1	5000.0%	1	R.VPTPNVSVVDLTCR.L
*	TK120303_NMyc_cyto3_step01.0472.0472.1	0.8592	0.076	666.2	13	6000.0%	1	K.FNGTVK.A
*	TK120303_NMyc_cyto3_step02.2801.2801.2	2.4378	0.5204	1630.91	1	5380.0%	2	K.LVINGKPITIFQER.D
	TK120303_NMyc_cyto3_step04.1111.1111.1	1.0795	0.0829	598.48	3	6000.0%	1	K.AGAHLK.G
	TK120303_NMyc_cyto3_step01.0350.0350.1	0.892	0.0388	760.48	1	5000.0%	1	K.TVDGPSGK.L
	TK120303_NMyc_cyto3_step06.3609.3609.2	4.9729	0.5918	2599.81	1	5000.0%	9	K.VIHDNFGIVEGLMTTVHAITATQK.T
UAMPL_MOUSE99.6%357.2%487526197.0(Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) 
	TK120303_NMyc_cyto3_step02.3331.3331.2	4.6308	0.5697	1848.16	1	7000.0%	1	R.LILADALCYAHTFNPK.V
	TK120303_NMyc_cyto3_step03.3254.3254.2	1.83	0.3188	2066.08	1	3060.0%	2	R.TFYGLHQDFPSVVVVGLGK.R
UPAK2_HUMAN99.6%92716.4%524580056.0(Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) 
	TK120303_NMyc_cyto3_step09.2057.2057.3	1.7465	0.1571	2760.02	13	1980.0%	1	K.ELLQHPFLKLAKPLSSLTPLIMAAK.E
*	TK120303_NMyc_cyto3_step10.1458.1458.2	0.8991	0.0748	2060.29	1	3330.0%	4	K.DPLSANHSLKPLPSVPEEK.K
*	TK120303_NMyc_cyto3_step12.4444.4444.2	0.9555	0.1338	2555.7	1	2080.0%	1	K.SIYTRSVIDPVPAPVGDSHVDGAAK.S
*	TK120303_NMyc_cyto3_step07.2911.2911.2	2.888	0.5754	2080.61	1	5310.0%	3	R.ECLQALEFLHANQVIHR.D
UITH2_MOUSE99.6%121417.9%9461059287.3(Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) 
*	TK120303_NMyc_cyto3_step11.2470.2470.3	2.2606	0.0685	3463.7	1	1750.0%	1	K.ITKTILQMSLDHHIVTPLTAMVIENDAGDER.M
*	TK120303_NMyc_cyto3_step11.3434.3434.3	1.8248	0.0137	3292.72	112	1330.0%	1	K.IEISTETITLSSGSSTSRLSWSDTAHLGNSR.V
*	TK120303_NMyc_cyto3_step10.2648.2648.2	4.2585	0.5749	2257.95	1	5790.0%	2	R.FLHVPDTFEGHFQGVPVISK.G
*	TK120303_NMyc_cyto3_step07.4343.4343.2	1.1047	0.0052	3123.83	19	1480.0%	1	K.TILQMSLDHHIVTPLTAMVIENDAGDER.M
*	TK120303_NMyc_cyto3_step07.1228.1228.1	0.9667	0.1276	960.47	2	5000.0%	1	R.KLGSYEHK.I
	TK120303_NMyc_cyto3_step11.1311.1311.1	2.4619	0.4054	1469.73	1	4580.0%	1	K.AHVSFKPTVAQQR.K
*	TK120303_NMyc_cyto3_step08.2720.2720.2	1.3554	0.0088	2617.19	277	1590.0%	1	R.VHGLLGQFMQEPAIHIFNERPGK.E
*	TK120303_NMyc_cyto3_step05.1389.1389.1	1.467	0.334	792.47	1	7500.0%	1	K.IHLQPGK.L
*	TK120303_NMyc_cyto3_step01.4600.4600.2	1.4142	0.0662	2734.71	15	1740.0%	1	K.QSIQDNISLFSLGIGFDVDYDFLK.R
*	TK120303_NMyc_cyto3_step11.2910.2910.3	1.9425	0.1357	3903.07	53	1100.0%	1	R.VHGLLGQFMQEPAIHIFNERPGKEPGKPEASMEVK.G
UQ9Z1Y499.6%3315.6%480509347.3(Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) 
*	TK120303_NMyc_cyto3_step02.4451.4451.3	1.441	0.0231	3588.13	26	1480.0%	1	R.CGGCGEDVVGDGAGVVALDRVFHIGCFVCSTCR.A
*	TK120303_NMyc_cyto3_step12.1368.1368.2	3.2914	0.4912	1779.51	1	5590.0%	1	R.GALGPPTAHGATLQPHPR.V
	TK120303_NMyc_cyto3_step01.3824.3824.2	1.4914	0.1187	2759.12	3	1960.0%	1	R.GLDGIPFTVDATSQIHCIEDFHRK.F
UNDKB_MOUSE99.6%4816.4%152173637.5(Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18) 
*	TK120303_NMyc_cyto3_step02.3408.3408.2	3.8561	0.4606	1962.53	1	6430.0%	2	K.EIHLWFKPEELIDYK.S
	TK120303_NMyc_cyto3_step03.2658.2658.1	2.2496	0.3432	1177.73	1	7220.0%	2	K.DRPFFPGLVK.Y
US23A_HUMAN99.6%112.2%765861477.1(Q15436) Protein transport protein Sec23A (SEC23-related protein A) 
*	TK120303_NMyc_cyto3_step04.2895.2895.2	4.0527	0.5298	1942.47	1	6560.0%	1	R.HLLQAPVDDAQEILHSR.F
UPOSC_MOUSE99.6%4616.4%274300498.3(Q9Z2Y8) Proline synthetase co-transcribed bacterial homolog protein 
	TK120303_NMyc_cyto3_step06.4351.4351.3	1.0994	0.085	3323.8	28	980.0%	1	K.TKPADMVIEAYGHGQRTFGENYVQELLEK.A
	TK120303_NMyc_cyto3_step12.3935.3935.2	1.3441	0.0321	1771.55	28	2670.0%	2	K.TKPADMVIEAYGHGQR.T
*	TK120303_NMyc_cyto3_step08.2947.2947.2	3.536	0.5971	1743.81	1	5670.0%	1	K.HGLLPSETIAVVEHIK.A
USPCN_HUMAN99.6%885.9%24722842815.3(Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) 
*	TK120303_NMyc_cyto3_step11.3066.3066.3	1.3132	0.0107	3940.89	11	1250.0%	1	R.EANQQQQFNRNVEDIELWLYEVEGHLASDDYGK.D
	TK120303_NMyc_cyto3_step06.2615.2615.2	1.0306	0.0744	2189.06	2	2500.0%	1	R.LEAELAAHEPAIQGVLDTGKK.L
*	TK120303_NMyc_cyto3_step02.0384.0384.1	0.8337	0.04	1306.01	18	3000.0%	1	K.VLETAEDIQER.R
*	TK120303_NMyc_cyto3_step04.4315.4315.2	1.1609	0.0911	2406.21	14	2050.0%	1	K.SADESGQALLAAGHYASDEVREK.L
*	TK120303_NMyc_cyto3_step08.2083.2083.3	1.9886	0.04	2911.42	30	1700.0%	1	K.HEALMSDLSAYGSSIQALREQAQSCR.Q
*	TK120303_NMyc_cyto3_step03.0394.0394.1	1.1743	0.1489	1162.24	3	4000.0%	1	R.ITKEAGSVSLR.M
	TK120303_NMyc_cyto3_step09.3563.3563.2	1.4193	0.0765	2296.12	5	2500.0%	1	R.EAFLNTEDKGDSLDSVEALIK.K
	TK120303_NMyc_cyto3_step03.2718.2718.2	3.7529	0.6132	2222.02	1	4000.0%	1	K.RLEAELAAHEPAIQGVLDTGK.K
UGSHC_MOUSE99.6%248.5%201222827.2(P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase) 
*	TK120303_NMyc_cyto3_step03.3132.3132.2	3.4647	0.4446	1959.31	1	5000.0%	2	K.YVRPGGGFEPNFTLFEK.C
UQ9CV3199.6%3514.4%284321105.0(Q9CV31) 2310014J01Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step06.4284.4284.3	1.9441	0.0185	2737.19	218	1550.0%	1	K.CIENLEELQSLRELDLYDNQIK.K
	TK120303_NMyc_cyto3_step02.2833.2833.2	3.7096	0.5346	2211.0	1	5000.0%	2	K.IENISNLHQLQMLELGSNR.I
USYD_MOUSE99.6%6812.6%501571176.5(Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) 
*	TK120303_NMyc_cyto3_step12.1723.1723.3	1.7427	0.0344	3138.87	4	2040.0%	1	R.LPLQLDDAIRPEVEGEEDGRATVNQDTR.L
	TK120303_NMyc_cyto3_step06.2404.2404.1	1.4619	0.1687	1232.48	13	3890.0%	1	R.LQSGICHLFR.E
	TK120303_NMyc_cyto3_step09.1996.1996.2	2.2899	0.4403	1436.71	4	4290.0%	2	R.FGAPPHAGGGIGLER.V
	TK120303_NMyc_cyto3_step07.1896.1896.1	1.7746	0.2835	1132.48	1	6670.0%	1	R.ALHHGIDLEK.I
UQ9Z1K199.6%5726.5%396437695.0(Q9Z1K1) HS1 binding protein 3 
*	TK120303_NMyc_cyto3_step10.1229.1229.2	3.2907	0.482	1834.87	1	5000.0%	1	R.KPTLPASVGPSEPGSGPQK.Q
*	TK120303_NMyc_cyto3_step06.2869.2869.3	1.7988	0.2082	3897.89	2	1320.0%	2	R.RPLETTQDSLKLFDDPDLGGAVSLGDPLLLPAASESR.G
*	TK120303_NMyc_cyto3_step07.2989.2989.3	1.7559	0.0075	3130.61	36	1440.0%	1	K.DVEKSLVGEEEEEEEEEEVLDPLGIMR.S
*	TK120303_NMyc_cyto3_step03.2710.2710.2	1.144	0.0339	2443.76	1	2860.0%	1	R.QVQNAHTGLDLSVPQHQEVRGK.M
UQ9CRY599.6%5738.6%251294695.2(Q9CRY5) 3010001M15Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step11.3853.3853.3	2.2216	0.2345	3494.04	1	1900.0%	2	-.ESSQLYLETCLPALGDVFCIAQSYRAEQSR.T
	TK120303_NMyc_cyto3_step03.1984.1984.2	1.7387	0.3233	1639.73	1	5000.0%	1	K.YGTCPHGGYGLGLER.F
*	TK120303_NMyc_cyto3_step07.2743.2743.3	2.0888	0.2726	4104.04	3	1590.0%	1	R.HLAEFTHVEAECPFLTFEDLLNRLEDLVCDVVDR.V
*	TK120303_NMyc_cyto3_step04.3184.3184.2	3.7986	0.5108	2000.56	1	4710.0%	1	K.SPVASIVYELNPNFKPPK.R
UCRKL_MOUSE99.6%3319.8%303338176.7(P47941) Crk-like protein 
*	TK120303_NMyc_cyto3_step08.3551.3551.3	2.1169	0.2082	4512.86	17	1120.0%	1	R.YPSPPVGSVSAPNLPTAEENLEYVRTLYDFPGNDAEDLPFK.K
*	TK120303_NMyc_cyto3_step07.3300.3300.2	3.6227	0.411	2312.86	1	3610.0%	1	K.KGELLVIIEKPEEQWWSAR.T
	TK120303_NMyc_cyto3_step10.1205.1205.3	1.4647	0.0252	1845.92	8	3330.0%	1	R.TLYDFPGNDAEDLPFK.K
UATOX_MOUSE99.6%2227.9%6873386.5(O08997) Copper transport protein ATOX1 (Metal transport protein ATX1) 
*	TK120303_NMyc_cyto3_step07.3344.3344.2	1.5306	0.0554	2003.81	73	2350.0%	1	K.VCIDSEHSSDTLLATLNK.T
*	TK120303_NMyc_cyto3_step03.2546.2546.2	5.157	0.5851	2131.66	1	6670.0%	1	K.KVCIDSEHSSDTLLATLNK.T
UFETA_MOUSE99.6%94133033.2%605673375.9(P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) 
*	TK120303_NMyc_cyto3_step02.2572.2572.2	3.9523	0.6436	1685.36	1	7000.0%	2	R.KAPQLTSAELIDLTGK.M
*	TK120303_NMyc_cyto3_step01.2892.2892.1	1.1176	0.0713	1010.45	5	6430.0%	1	R.LCITSFLR.D
*	TK120303_NMyc_cyto3_step01.0944.0944.1	1.1034	0.0627	694.44	3	7000.0%	3	K.ALQTMK.Q
*	TK120303_NMyc_cyto3_step09.2675.2675.2	1.4631	0.3194	1349.4	1	5000.0%	7	R.THPNLPVSVILR.I
*	TK120303_NMyc_cyto3_step01.4028.4028.2	2.1384	0.3052	3086.1	3	1920.0%	4	K.NSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK120303_NMyc_cyto3_step01.1592.1592.1	2.0869	0.4225	1497.59	2	4170.0%	2	R.DETYAPPPFSEDK.F
*	TK120303_NMyc_cyto3_step01.0374.0374.1	1.6022	0.0647	919.3	6	5710.0%	1	K.DLCQAQGK.A
*	TK120303_NMyc_cyto3_step01.0359.0359.1	0.8622	0.0051	780.44	1	7000.0%	1	K.IAECCK.L
*	TK120303_NMyc_cyto3_step01.2012.2012.1	1.2456	0.067	1547.62	1	4170.0%	1	K.QSCALYQTLGDYK.L
*	TK120303_NMyc_cyto3_step06.1605.1605.1	1.349	0.1469	899.58	13	5000.0%	4	R.HQCLLAR.K
*	TK120303_NMyc_cyto3_step01.1699.1699.1	1.8442	0.2517	915.69	1	6670.0%	1	R.FIYEVSR.R
*	TK120303_NMyc_cyto3_step01.2411.2411.1	2.4915	0.4899	1558.91	1	5360.0%	4	K.APQLTSAELIDLTGK.M
*	TK120303_NMyc_cyto3_step01.1595.1595.1	1.6703	0.1682	1188.54	2	5560.0%	2	R.NFAQFSSEEK.I
*	TK120303_NMyc_cyto3_step04.3958.3958.2	1.6644	0.2005	2684.55	4	1960.0%	32	K.NVLSIATITFTQFVPEATEEEVNK.M
*	TK120303_NMyc_cyto3_step10.3218.3218.2	1.6227	0.1771	2965.73	4	1800.0%	2	K.QKPELTEEQLAAVTADFSGLLEKCCK.A
*	TK120303_NMyc_cyto3_step01.3687.3687.2	3.3847	0.6334	2521.51	1	3860.0%	8	K.QKPELTEEQLAAVTADFSGLLEK.C
*	TK120303_NMyc_cyto3_step01.1362.1362.1	1.9737	0.1198	1143.53	1	6670.0%	5	K.HIEESQALSK.Q
	TK120303_NMyc_cyto3_step01.0658.0658.1	1.0801	2.0E-4	460.29	1	8330.0%	2	K.LISK.T
	TK120303_NMyc_cyto3_step01.0659.0659.1	0.7866	0.0052	466.3	1	8330.0%	2	K.FGSR.N
UEF1B_MOUSE99.6%3315.2%224245774.6(O70251) Elongation factor 1-beta (EF-1-beta) 
	TK120303_NMyc_cyto3_step01.0486.0486.1	0.9752	0.0278	946.59	11	4380.0%	1	K.LVPVGYGIK.K
	TK120303_NMyc_cyto3_step01.2059.2059.1	1.4691	0.234	1349.34	3	3750.0%	1	R.SIQADGLVWGSSK.L
	TK120303_NMyc_cyto3_step02.2008.2008.1	2.7841	0.4489	1475.64	1	5450.0%	1	K.KLQIQCVVEDDK.V
UTKT_MOUSE99.6%3221621.8%623676317.5(P40142) Transketolase (EC 2.2.1.1) (TK) (P68) 
	TK120303_NMyc_cyto3_step04.1546.1546.1	1.3835	0.1241	981.64	1	5000.0%	3	K.HQPTAIIAK.T
*	TK120303_NMyc_cyto3_step02.2840.2840.2	3.5122	0.4486	2487.93	1	4000.0%	1	R.CEAFGWHTIIVDGHSVEELCK.A
	TK120303_NMyc_cyto3_step01.1575.1575.1	1.5396	0.1248	945.65	1	6880.0%	1	R.IIALDGDTK.N
	TK120303_NMyc_cyto3_step04.1624.1624.1	2.4742	0.5099	1394.65	1	5830.0%	2	R.KISSDLDGHPVPK.Q
*	TK120303_NMyc_cyto3_step01.3692.3692.2	1.9296	0.3023	3192.47	1	2330.0%	4	R.ILTVEDHYYEGGIGEAVSAAVVGEPGVTVTR.L
	TK120303_NMyc_cyto3_step01.0790.0790.1	1.8623	0.3417	916.42	1	6880.0%	1	K.AVELAANTK.G
*	TK120303_NMyc_cyto3_step03.3654.3654.2	4.3725	0.5367	2626.66	1	4400.0%	13	K.SKDDQVTVIGAGVTLHEALAAAESLK.K
*	TK120303_NMyc_cyto3_step08.1691.1691.1	2.2957	0.3063	1164.52	1	6670.0%	3	K.EAWHGKPLPK.N
*	TK120303_NMyc_cyto3_step01.1387.1387.1	1.1295	0.0177	843.48	2	6430.0%	1	K.DAIVQAVK.G
*	TK120303_NMyc_cyto3_step01.4039.4039.2	1.6973	0.2215	2410.62	3	2390.0%	2	K.DDQVTVIGAGVTLHEALAAAESLK.K
UCLI5_HUMAN99.6%51711.6%251281105.8(Q9NZA1) Chloride intracellular channel protein 5 
*	TK120303_NMyc_cyto3_step12.2584.2584.2	3.5581	0.5398	2590.72	1	3040.0%	4	R.KPADLHNLAPGTHPPFLTFNGDVK.T
*	TK120303_NMyc_cyto3_step09.2780.2780.3	1.8945	0.1029	3143.86	4	1700.0%	1	R.KPADLHNLAPGTHPPFLTFNGDVKTDVNK.I
UPTPA_MOUSE99.6%3315.5%323367106.4(P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) 
	TK120303_NMyc_cyto3_step03.3150.3150.2	3.7709	0.5598	2458.21	1	4520.0%	1	K.TGPFAEHSNQLWNISAVPSWSK.V
*	TK120303_NMyc_cyto3_step08.1123.1123.1	0.9327	0.0067	915.99	15	5000.0%	1	K.KLTFDYK.V
	TK120303_NMyc_cyto3_step05.2804.2804.2	2.0438	0.3229	2288.76	15	2250.0%	1	R.SQAYADYIGFILTLNEGVKGK.K
UQ8VEH599.6%51110.1%606700965.9(Q8VEH5) Similar to KIAA0766 gene product 
	TK120303_NMyc_cyto3_step07.2875.2875.2	2.6567	0.5188	2249.99	1	3890.0%	3	R.NQHTLSQPLTDEHLQALFR.V
*	TK120303_NMyc_cyto3_step02.3168.3168.2	1.1384	0.0223	2180.92	1	2780.0%	1	R.YLVVEPAEGDGALCLVCRR.L
*	TK120303_NMyc_cyto3_step12.3803.3803.2	1.5667	0.0909	2572.54	239	1360.0%	1	R.EVLPDHVGVLEGIDLSPEITRQR.I
UFSC1_MOUSE99.6%81218.5%492542746.7(Q61553) Fascin (Singed-like protein) 
	TK120303_NMyc_cyto3_step01.4416.4416.2	2.6642	0.503	2061.09	1	4710.0%	1	R.DVPWGVDSLITLAFQDQR.Y
	TK120303_NMyc_cyto3_step02.1268.1268.1	1.3527	0.19	796.59	8	5710.0%	1	K.GDHAGVLK.A
	TK120303_NMyc_cyto3_step01.2535.2535.1	1.517	0.2128	1147.77	1	6670.0%	1	K.YLTAEAFGFK.V
*	TK120303_NMyc_cyto3_step05.2789.2789.2	3.3029	0.3908	1805.05	1	6000.0%	2	R.LVARPEPATGFTLEFR.S
*	TK120303_NMyc_cyto3_step01.2420.2420.1	1.4412	0.2262	1094.84	1	6250.0%	1	R.YSVQTSDHR.F
*	TK120303_NMyc_cyto3_step10.3849.3849.3	1.9319	0.0274	3492.64	1	1900.0%	2	K.YWTLTATGGVQSTASTKNASCYFDIEWCDR.R
UNTF2_HUMAN99.6%72521.3%127144785.4(P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) 
	TK120303_NMyc_cyto3_step08.3296.3296.3	3.3431	0.5001	3007.89	1	2400.0%	4	K.IQHSITAQDHQPTPDSCIISMVVGQLK.A
UQ9D7P799.6%4621.7%207235516.5(Q9D7P7) 2300003G24Rik protein 
*	TK120303_NMyc_cyto3_step05.1992.1992.2	4.2733	0.5474	1626.55	1	6920.0%	2	R.APLDHELAQEPHLR.E
	TK120303_NMyc_cyto3_step10.2006.2006.1	0.9684	0.0205	1465.13	3	3750.0%	1	K.GVPFTLTTVDTRR.A
*	TK120303_NMyc_cyto3_step02.2916.2916.2	1.3172	0.0501	1949.42	7	2650.0%	1	K.DFAPGSQLPILLYDGDVK.T
UPSA1_MOUSE99.6%7928.9%263295476.4(Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) 
	TK120303_NMyc_cyto3_step04.2627.2627.2	1.6414	0.0374	1333.35	1	5500.0%	1	R.FVFDRPLPVSR.L
	TK120303_NMyc_cyto3_step07.1436.1436.2	1.353	0.0203	1689.64	4	2860.0%	1	R.ALRETLPAEQDLTTK.N
	TK120303_NMyc_cyto3_step02.2193.2193.1	1.8317	0.0632	1431.65	1	5000.0%	1	R.IHQIEYAMEAVK.Q
	TK120303_NMyc_cyto3_step07.2989.2989.2	4.4254	0.6123	2087.41	1	5260.0%	1	K.ILHVDNHIGISIAGLTADAR.L
	TK120303_NMyc_cyto3_step04.2186.2186.1	1.8208	0.2461	953.54	1	6880.0%	2	K.THAVLVALK.R
	TK120303_NMyc_cyto3_step01.0314.0314.1	1.0288	0.0147	860.43	93	4380.0%	1	K.QGSATVGLK.S
UQ9CY0299.6%1118.6%102118324.7(Q9CY02) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041L04, full insert sequence (Erythroid differentiation related factor) 
*	TK120303_NMyc_cyto3_step01.3895.3895.2	4.1615	0.6305	2132.06	1	5280.0%	1	R.AMTEFQQELSTLGSQFLAK.Y
UCYTB_MOUSE99.6%3921.4%98110467.4(Q62426) Cystatin B (Stefin B) 
*	TK120303_NMyc_cyto3_step11.1983.1983.2	4.1444	0.5247	2445.46	1	4500.0%	3	R.VFQPLPHENKPLTLSSYQTNK.E
UHS47_MOUSE99.6%113.6%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) 
*	TK120303_NMyc_cyto3_step03.2727.2727.2	3.7955	0.393	1737.79	1	6430.0%	1	K.LRDEEVHTGLGELLR.S
UAPA1_MOUSE99.6%132740.9%264305875.9(Q00623) Apolipoprotein A-I precursor (Apo-AI) 
*	TK120303_NMyc_cyto3_step02.1371.1371.1	1.5653	0.0492	1333.66	1	4000.0%	2	K.SNPTLNEYHTR.A
*	TK120303_NMyc_cyto3_step02.1360.1360.1	1.6723	0.3348	1299.61	1	5000.0%	3	R.TQLAPHSEQMR.E
*	TK120303_NMyc_cyto3_step02.1313.1313.1	1.4238	0.1744	829.48	5	6670.0%	1	R.THVDSLR.T
*	TK120303_NMyc_cyto3_step01.1848.1848.1	2.3012	0.027	1268.66	2	6670.0%	1	K.VQPYLDEFQK.K
*	TK120303_NMyc_cyto3_step01.1734.1734.1	1.6511	0.1622	1341.72	1	4580.0%	1	K.VAPLGAELQESAR.Q
*	TK120303_NMyc_cyto3_step04.1900.1900.1	1.1381	0.1177	1040.81	24	5000.0%	1	K.ARPALEDLR.H
*	TK120303_NMyc_cyto3_step02.3821.3821.3	2.8518	0.1318	4101.96	3	1430.0%	3	R.DYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQER.L
*	TK120303_NMyc_cyto3_step01.2078.2078.1	1.9099	0.1177	1240.62	1	6000.0%	1	K.DFANVYVDAVK.D
UDCUP_MOUSE99.6%2216.6%367405986.7(P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD) 
*	TK120303_NMyc_cyto3_step04.3426.3426.3	2.0558	0.0176	4127.62	19	1180.0%	1	K.AGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPK.K
*	TK120303_NMyc_cyto3_step08.3598.3598.2	3.414	0.607	2365.18	1	4520.0%	1	R.LRDPAAAASELGYVFQAITLTR.Q
U143Z_MOUSE99.6%5920.4%245277714.8(P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) 
	TK120303_NMyc_cyto3_step01.3004.3004.1	1.5804	0.1051	1422.12	1	4550.0%	2	R.DICNDVLSLLEK.F
	TK120303_NMyc_cyto3_step04.2534.2534.2	1.912	0.1959	2169.49	1	3330.0%	1	K.KGIVDQSQQAYQEAFEISK.K
	TK120303_NMyc_cyto3_step01.3810.3810.2	5.5736	0.7185	2135.82	1	6390.0%	2	K.TAFDEAIAELDTLSEESYK.D
UALFA_MOUSE99.6%142832.2%363392258.1(P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) 
*	TK120303_NMyc_cyto3_step01.4103.4103.2	1.7839	0.3437	3046.04	17	1550.0%	1	R.TVPPAVTGVTFLSGGQSEEEASINLNAINK.C
	TK120303_NMyc_cyto3_step01.1534.1534.1	1.3986	0.3191	763.59	1	8330.0%	1	K.VLAAVYK.A
	TK120303_NMyc_cyto3_step02.3144.3144.2	4.1125	0.5394	2109.97	1	5790.0%	3	K.IGEHTPSALAIMENANVLAR.Y
	TK120303_NMyc_cyto3_step01.2950.2950.2	3.0318	0.4972	3024.03	1	3080.0%	1	R.YASICQQNGIVPIVEPEILPDGDHDLK.R
	TK120303_NMyc_cyto3_step01.1396.1396.1	1.4356	0.2479	630.51	1	7500.0%	1	K.GGVVGIK.V
	TK120303_NMyc_cyto3_step01.1404.1404.1	1.0119	0.0352	801.59	2	5710.0%	1	R.ALQASALK.A
*	TK120303_NMyc_cyto3_step06.1727.1727.1	1.9906	0.2947	1379.56	1	5450.0%	3	-.PHPYPALTPEQK.K
	TK120303_NMyc_cyto3_step01.0923.0923.1	1.1209	0.0886	584.38	1	7000.0%	1	R.IVAPGK.G
UAOP2_MOUSE99.6%3510.3%223247396.0(O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) 
	TK120303_NMyc_cyto3_step01.2552.2552.1	2.2007	0.4389	1021.76	1	7500.0%	1	R.VVFIFGPDK.K
	TK120303_NMyc_cyto3_step01.4064.4064.1	2.7076	0.5064	1529.84	1	5380.0%	2	R.DLAILLGMLDPVEK.D
UQ9QYS999.6%51711.7%341376718.5(Q9QYS9) QKI-5 protein 
	TK120303_NMyc_cyto3_step09.3177.3177.2	3.5499	0.424	2829.31	1	4130.0%	4	R.GKPNWEHLNEDLHVLITVEDAQNR.A
	TK120303_NMyc_cyto3_step10.3865.3865.2	1.3079	0.1676	1947.13	132	2330.0%	1	K.LYVPVKEYPDFNFVGR.I
UPTB_MOUSE99.6%3310.8%527564788.3(P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) 
	TK120303_NMyc_cyto3_step02.3123.3123.2	4.7281	0.6032	2246.63	1	5530.0%	1	K.NNQFQALLQYADPVSAQHAK.L
	TK120303_NMyc_cyto3_step01.0252.0252.1	1.1763	0.1802	567.38	1	6250.0%	1	R.VSFSK.S
	TK120303_NMyc_cyto3_step12.1199.1199.3	2.0904	0.1031	3477.07	4	1530.0%	1	K.KPGSKNFQNIFPPSATLHLSNIPPSVSEDDLK.S
UTCPB_MOUSE99.6%131523.4%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) 
	TK120303_NMyc_cyto3_step02.3211.3211.1	3.1682	0.4255	1556.71	1	5000.0%	2	R.SLHDALCVLAQTVK.D
	TK120303_NMyc_cyto3_step02.3548.3548.2	2.1932	0.2956	2292.29	4	2380.0%	1	R.VQDDEVGDGTTSVTVLAAELLR.E
	TK120303_NMyc_cyto3_step02.2023.2023.1	1.5116	0.0692	1237.64	9	4550.0%	1	K.GSGNLEAIHVIK.K
	TK120303_NMyc_cyto3_step02.0579.0579.1	0.8106	0.2017	1179.88	3	3000.0%	1	K.GMDKILLSSGR.D
	TK120303_NMyc_cyto3_step04.1956.1956.1	2.5659	0.4567	1538.59	1	5360.0%	1	R.AAHSEGHITAGLDMK.E
	TK120303_NMyc_cyto3_step11.2627.2627.2	1.2821	0.08	2351.18	8	2380.0%	1	R.MLPTIIADNAGYDSADLVAQLR.A
	TK120303_NMyc_cyto3_step01.2328.2328.1	1.1296	0.0118	1128.86	233	3120.0%	1	K.HGINCFINR.Q
	TK120303_NMyc_cyto3_step11.1121.1121.1	0.9576	0.0328	748.48	83	5000.0%	1	K.LLTHHK.D
	TK120303_NMyc_cyto3_step01.1132.1132.1	1.2275	1.0E-4	755.51	13	6670.0%	1	K.IGVNQPK.R
	TK120303_NMyc_cyto3_step08.2568.2568.3	2.0033	0.0502	3091.58	6	1790.0%	1	K.VLVDMSRVQDDEVGDGTTSVTVLAAELLR.E
UENPL_MOUSE99.6%688.0%802924764.8(P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) 
	TK120303_NMyc_cyto3_step01.0756.0756.1	0.9434	0.0357	753.39	77	6000.0%	1	K.KSDYIK.L
	TK120303_NMyc_cyto3_step02.2220.2220.1	2.0523	0.1917	1513.72	1	4230.0%	1	K.NLLHVTDTGVGMTR.E
	TK120303_NMyc_cyto3_step07.3503.3503.2	1.0988	0.0141	2289.17	211	1580.0%	1	K.ESDDPMAYIHFTAEGEVTFK.S
*	TK120303_NMyc_cyto3_step03.2378.2378.2	4.4027	0.6467	2251.11	1	5830.0%	1	R.FQSSHHSTDITSLDQYVER.M
	TK120303_NMyc_cyto3_step07.1597.1597.1	1.2881	0.1233	637.23	1	7500.0%	2	R.HPLIR.D
UMDHM_MOUSE99.6%2210.1%338355968.6(P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37) 
*	TK120303_NMyc_cyto3_step02.3203.3203.2	3.3929	0.4886	2394.92	1	4290.0%	1	R.LTLYDIAHTPGVAADLSHIETR.A
	TK120303_NMyc_cyto3_step04.1946.1946.1	1.6104	0.3013	1150.63	5	4550.0%	1	R.VNVPVIGGHAGK.T
UAPA2_MOUSE99.6%2232.4%102113197.2(P09813) Apolipoprotein A-II precursor (Apo-AII) 
*	TK120303_NMyc_cyto3_step03.1902.1902.1	2.1562	0.4785	1194.82	1	6110.0%	1	K.THEQLTPLVR.S
*	TK120303_NMyc_cyto3_step11.2462.2462.2	1.1987	0.0786	2676.02	17	1820.0%	1	R.QADGPDMQSLFTQYFQSMTEYGK.D
UQ8R31299.6%3510.2%246285815.2(Q8R312) Hypothetical 28.6 kDa protein 
*	TK120303_NMyc_cyto3_step03.2975.2975.2	3.7492	0.0766	2072.41	1	4720.0%	2	K.IQDLEHHLGLALSEVQAAK.K
	TK120303_NMyc_cyto3_step05.1180.1180.1	1.0734	0.0665	690.53	1	7000.0%	1	K.QQTANK.V
UIQG1_MOUSE99.6%132712.2%16571887556.5(Q9JKF1) Ras GTPase-activating-like protein IQGAP1 
	TK120303_NMyc_cyto3_step04.1174.1174.1	1.3595	0.1192	999.34	3	6880.0%	1	K.MLQHAASNK.M
*	TK120303_NMyc_cyto3_step12.3338.3338.2	1.5669	0.1175	3165.74	44	1480.0%	1	K.NPNAMLVNLEEGLAPTYQDVLYQAKQDK.M
*	TK120303_NMyc_cyto3_step07.2877.2877.3	1.7712	0.119	3524.93	3	1830.0%	2	K.GGYHYYHNLETQAGGWAEPPDFVQNSVQLSR.E
*	TK120303_NMyc_cyto3_step09.1976.1976.2	1.767	0.0891	1541.67	7	4170.0%	1	R.LAYLHSHKDEVVK.I
*	TK120303_NMyc_cyto3_step01.3104.3104.2	2.4203	0.2675	2870.29	1	2920.0%	1	R.FQPGETLTEILETPATNEQEAEHQR.A
*	TK120303_NMyc_cyto3_step12.4492.4492.2	0.7461	0.0045	2213.66	17	2220.0%	1	K.LPYDVTPEQALSHEEVKTR.L
*	TK120303_NMyc_cyto3_step07.3515.3515.3	4.5452	0.5179	3869.91	1	2420.0%	4	K.AQAHAENNAFITWNDIQACVDHVNLVVHEEHER.I
*	TK120303_NMyc_cyto3_step02.3549.3549.2	2.341	0.2943	2846.52	1	3120.0%	1	K.AQETQDESAVLWLDEIQGGIWQSNK.D
*	TK120303_NMyc_cyto3_step06.2023.2023.2	1.3973	0.1468	1894.35	21	2500.0%	1	R.FALGISAINEAVDSGDVGR.T
UTCPZ_MOUSE99.6%92315.1%531580047.1(P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) 
	TK120303_NMyc_cyto3_step01.3524.3524.2	3.7452	0.4631	2545.82	1	4170.0%	1	K.VATAQDDITGDGTTSNVLIIGELLK.Q
*	TK120303_NMyc_cyto3_step06.3665.3665.2	3.3041	0.4966	2236.3	1	5000.0%	4	K.VHAELADVLTEAVVDSILAIR.K
	TK120303_NMyc_cyto3_step04.1519.1519.1	1.4577	0.1694	841.47	12	5830.0%	1	K.HTLTQIK.D
	TK120303_NMyc_cyto3_step05.2773.2773.2	3.5637	0.4576	2317.47	1	3500.0%	2	K.DGNVLLHEMQIQHPTASLIAK.V
	TK120303_NMyc_cyto3_step06.2005.2005.1	1.5104	5.0E-4	744.36	11	7000.0%	1	K.KIIELK.K
UKPY2_MOUSE99.6%3712347.7%530577567.5(P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) 
	TK120303_NMyc_cyto3_step01.0658.0658.1	1.0801	2.0E-4	460.29	1	8330.0%	2	K.IISK.I
	TK120303_NMyc_cyto3_step10.1441.1441.2	4.6239	0.6364	1888.03	1	6000.0%	8	R.LNFSHGTHEYHAETIK.N
	TK120303_NMyc_cyto3_step01.2914.2914.1	1.3263	0.0041	1469.71	8	4500.0%	2	K.CDENILWLDYK.N
	TK120303_NMyc_cyto3_step02.3761.3761.2	2.1441	0.2981	1861.8	1	3670.0%	3	K.FGVEQDVDMVFASFIR.K
	TK120303_NMyc_cyto3_step07.2585.2585.3	1.4022	0.0112	3499.36	1	1520.0%	1	R.AEGSDVANAVLDGADCIMLSGETAKGDYPLEAVR.M
	TK120303_NMyc_cyto3_step01.1854.1854.1	1.3267	0.1289	1143.44	1	5500.0%	1	R.GDLGIEIPAEK.V
*	TK120303_NMyc_cyto3_step01.1720.1720.1	1.6857	0.1696	1173.67	1	5500.0%	1	R.LDIDSAPITAR.N
	TK120303_NMyc_cyto3_step05.1557.1557.1	1.4243	0.1263	870.6	3	6670.0%	3	R.MQHLIAR.E
	TK120303_NMyc_cyto3_step01.0443.0443.1	1.2129	0.2794	717.43	1	5830.0%	1	K.VVEVGSK.I
	TK120303_NMyc_cyto3_step01.2463.2463.1	1.2864	0.1865	933.83	7	5710.0%	1	R.GIFPVLCK.D
	TK120303_NMyc_cyto3_step01.1602.1602.1	1.4469	0.376	840.71	3	5000.0%	1	R.APIIAVTR.N
*	TK120303_NMyc_cyto3_step01.2855.2855.1	1.2528	0.0064	1586.84	5	3850.0%	1	K.DAVLNAWAEDVDLR.V
	TK120303_NMyc_cyto3_step03.2448.2448.2	4.3195	0.6067	1765.6	1	6760.0%	1	K.KGVNLPGAAVDLPAVSEK.D
*	TK120303_NMyc_cyto3_step01.3000.3000.2	3.8494	0.6392	2145.88	1	6430.0%	1	R.LAPITSDPTEAAAVGAVEASFK.C
	TK120303_NMyc_cyto3_step06.3192.3192.2	1.3357	0.1789	1933.93	3	3670.0%	4	R.EAEAAIYHLQLFEELR.R
	TK120303_NMyc_cyto3_step01.2876.2876.1	1.5421	0.0642	1465.06	5	3750.0%	2	K.IYVDDGLISLQVK.E
	TK120303_NMyc_cyto3_step01.1530.1530.1	1.5651	0.0828	705.51	6	8000.0%	1	K.VFLAQK.M
	TK120303_NMyc_cyto3_step04.0408.0408.1	1.098	0.0459	768.64	3	5830.0%	1	R.SAHQVAR.Y
*	TK120303_NMyc_cyto3_step02.3004.3004.2	4.2376	0.6488	2301.41	1	5450.0%	1	R.RLAPITSDPTEAAAVGAVEASFK.C
*	TK120303_NMyc_cyto3_step01.3090.3090.2	3.6523	0.5991	2496.24	1	3860.0%	1	R.EATESFASDPILYRPVAVALDTK.G
UQ9UQE699.6%3516.9%237273264.9(Q9UQE6) Protein phosphatase-1 regulatory subunit 7 beta2 
	TK120303_NMyc_cyto3_step08.1800.1800.2	0.9447	0.0333	2461.96	20	2000.0%	1	K.IENLEALTELEILDISFNLLR.N
	TK120303_NMyc_cyto3_step02.2833.2833.2	3.7096	0.5346	2211.0	1	5000.0%	2	K.IENLSNLHQLQMLELGSNR.I
USRC8_MOUSE99.6%358.2%546612605.4(Q60598) Src substrate cortactin 
	TK120303_NMyc_cyto3_step10.1154.1154.2	3.2658	0.369	1685.74	1	6070.0%	2	K.TVQGSGHQEHINIHK.L
	TK120303_NMyc_cyto3_step07.2788.2788.3	1.8881	0.2381	3252.29	6	1720.0%	1	K.KQTPPASPSPQPIEDRPPSSPIYEDAAPFK.A
UQ9DCC499.6%359.1%274286947.3(Q9DCC4) 1110058B13Rik protein 
	TK120303_NMyc_cyto3_step07.1319.1319.1	1.1102	0.0708	721.46	1	7000.0%	1	K.HPAQLR.T
	TK120303_NMyc_cyto3_step06.2579.2579.2	3.6966	0.5367	2003.01	1	4720.0%	2	R.TDVLTPAGTTIHGLHALER.G
UANX2_MOUSE99.6%227.1%338385457.7(P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV) 
	TK120303_NMyc_cyto3_step04.3815.3815.2	4.2837	0.5231	1651.53	1	6670.0%	1	K.SALSGHLETVILGLLK.T
*	TK120303_NMyc_cyto3_step04.0462.0462.1	1.0004	0.0527	888.23	16	4290.0%	1	K.KELPSALK.S
UO0879599.6%114.0%521587934.5(O08795) Alpha glucosidase II, beta subunit 
	TK120303_NMyc_cyto3_step06.2531.2531.2	3.5726	0.6144	2150.07	1	5000.0%	1	K.HGGSPTSLGTWGSWAGPDHDK.F
UFKB1_MOUSE99.6%2415.9%107117918.2(P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) 
	TK120303_NMyc_cyto3_step08.2176.2176.2	3.2644	0.4536	1952.05	1	5310.0%	2	K.RGQTCVVHYTGMLEDGK.K
UMCM6_MOUSE99.6%6810.5%821928675.5(P97311) DNA replication licensing factor MCM6 (Mis5 homolog) 
	TK120303_NMyc_cyto3_step12.2260.2260.2	1.1901	0.0272	2449.42	28	1960.0%	1	K.TTGEGTSLRGDINVCIVGDPSTAK.S
	TK120303_NMyc_cyto3_step07.3088.3088.2	4.5406	0.5085	1951.76	1	6880.0%	2	R.LTHYDHVLIELTQAGLK.G
*	TK120303_NMyc_cyto3_step12.2002.2002.2	1.2739	0.0333	2301.08	1	2620.0%	1	K.ATLNARTSILAAANPVSGHYDR.S
	TK120303_NMyc_cyto3_step11.1157.1157.1	1.2509	0.1089	996.51	79	4290.0%	1	R.RIVDLHSR.I
	TK120303_NMyc_cyto3_step06.1120.1120.3	1.5198	0.0537	1694.4	98	2500.0%	1	R.IQETQAELPRGSIPR.S
UIDE_MOUSE99.6%449.0%10191177726.5(Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) 
*	TK120303_NMyc_cyto3_step11.2963.2963.3	1.6986	0.0276	4322.64	4	1400.0%	1	K.FFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELLK.D
	TK120303_NMyc_cyto3_step07.2397.2397.2	3.3825	0.3743	1845.81	1	7140.0%	1	R.FIIQSEKPPHYLESR.V
*	TK120303_NMyc_cyto3_step06.2780.2780.2	2.5966	0.4326	2216.42	1	5000.0%	1	K.NVPLPEFPEHPFQEEHLR.Q
*	TK120303_NMyc_cyto3_step10.2546.2546.2	1.1979	0.0254	2537.07	25	2170.0%	1	K.SNPGYYLGHLIGHEGPGSLLSELK.S
UCLH1_HUMAN99.6%225611.6%16751916135.7(Q00610) Clathrin heavy chain 1 (CLH-17) 
*	TK120303_NMyc_cyto3_step04.3809.3809.2	3.4879	0.4011	2200.42	1	5290.0%	1	K.YHEQLSTQSLIELFESFK.S
*	TK120303_NMyc_cyto3_step01.0791.0791.1	0.7419	0.0523	696.29	48	5000.0%	1	K.MYDAAK.L
*	TK120303_NMyc_cyto3_step09.2889.2889.2	1.5744	0.1065	2129.77	11	2500.0%	1	R.ANVPNKVIQCFAETGQVQK.I
*	TK120303_NMyc_cyto3_step02.2880.2880.2	1.6253	0.0184	2354.73	15	2050.0%	1	R.ISGETIFVTAPHEATAGIIGVNR.K
*	TK120303_NMyc_cyto3_step04.1418.1418.2	3.0271	0.5355	1369.76	1	6820.0%	1	K.NNRPSEGPLQTR.L
	TK120303_NMyc_cyto3_step05.1035.1035.1	0.632	0.0079	749.38	30	5000.0%	1	R.VKNFLK.E
*	TK120303_NMyc_cyto3_step08.3580.3580.2	4.953	0.5367	2370.08	1	5250.0%	4	R.KFDVNTSAVQVLIEHIGNLDR.A
*	TK120303_NMyc_cyto3_step01.0358.0358.1	0.9039	0.102	670.37	5	6670.0%	1	K.VAANAPK.G
*	TK120303_NMyc_cyto3_step02.4216.4216.3	1.4172	0.0492	2359.36	41	2020.0%	2	K.MEGNAEESTLFCFAVRGQAGGK.L
*	TK120303_NMyc_cyto3_step08.2524.2524.2	4.1041	0.6748	1949.14	1	5880.0%	5	K.LHIIEVGTPPTGNQPFPK.K
*	TK120303_NMyc_cyto3_step12.3494.3494.2	1.535	0.0934	2442.14	203	1300.0%	1	R.GQAGGKLHIIEVGTPPTGNQPFPK.K
*	TK120303_NMyc_cyto3_step12.2267.2267.3	2.3379	0.2186	3733.72	2	1620.0%	1	K.VGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASK.V
	TK120303_NMyc_cyto3_step03.1458.1458.1	1.2823	0.0323	1058.68	7	5710.0%	1	K.QLLEKWLK.E
UPIR_MOUSE99.6%2215.5%290320667.1(Q9D711) Pirin 
*	TK120303_NMyc_cyto3_step03.2050.2050.2	3.4649	0.517	2157.63	1	5530.0%	1	K.IEPHHTAVLGEGDAVQLENK.D
*	TK120303_NMyc_cyto3_step10.3232.3232.3	1.7418	0.0468	2917.83	13	1770.0%	1	R.GILHAEMPCSEEPAHGLQLWVNLRR.S
UEF2_MOUSE99.6%349229.2%857951836.8(P58252) Elongation factor 2 (EF-2) 
	TK120303_NMyc_cyto3_step01.2514.2514.1	1.3188	0.2418	1310.73	3	4090.0%	1	K.DSVVAGFQWATK.E
	TK120303_NMyc_cyto3_step06.2013.2013.2	3.3689	0.5603	1617.09	1	5380.0%	2	K.TGTITTFEHAHNMR.V
	TK120303_NMyc_cyto3_step04.1882.1882.1	2.2994	0.4965	1309.58	1	5910.0%	4	R.NMSVIAHVDHGK.S
	TK120303_NMyc_cyto3_step06.1499.1499.1	1.3182	0.1042	882.63	9	5830.0%	2	K.KVEDMMK.K
	TK120303_NMyc_cyto3_step03.0464.0464.1	0.7305	0.0175	1049.17	50	3120.0%	1	K.KSDPVVSYR.E
	TK120303_NMyc_cyto3_step03.3780.3780.2	4.321	0.5557	2601.5	1	4570.0%	1	R.WLPAGDALLQMITIHLPSPVTAQK.Y
	TK120303_NMyc_cyto3_step01.3016.3016.1	1.6432	0.0634	1331.72	1	5910.0%	1	K.EGIPALDNFLDK.L
	TK120303_NMyc_cyto3_step11.1635.1635.3	1.8977	0.0194	3149.79	19	1850.0%	1	K.IWCFGPDGTGPNILTDITKGVQYLNEIK.D
	TK120303_NMyc_cyto3_step01.3656.3656.1	1.3088	0.1733	1448.64	3	3750.0%	1	K.EGIPALDNFLDKL.-
	TK120303_NMyc_cyto3_step02.1440.1440.1	1.1638	0.1316	784.64	2	6670.0%	1	K.EGKPLLK.A
	TK120303_NMyc_cyto3_step01.3636.3636.1	2.5679	0.3018	1497.84	1	5910.0%	1	R.TFCQLILDPIFK.V
	TK120303_NMyc_cyto3_step05.1715.1715.1	0.9255	0.0425	446.34	2	8330.0%	1	R.KGLK.E
	TK120303_NMyc_cyto3_step02.3911.3911.2	1.2386	0.0119	2579.44	16	1740.0%	2	R.VTDGALVVVDCVSGVCVQTETVLR.Q
	TK120303_NMyc_cyto3_step01.3683.3683.2	2.5241	0.3121	2223.72	6	2650.0%	2	R.ALLELQLEPEELYQTFQR.I
	TK120303_NMyc_cyto3_step02.2536.2536.2	4.2399	0.4715	2145.38	1	5530.0%	5	K.ARPFPDGLAEDIDKGEVSAR.Q
*	TK120303_NMyc_cyto3_step01.4079.4079.2	1.7494	0.2645	2820.44	2	2120.0%	4	K.DGSGFLINLIDSPGHVDFSSEVTAALR.V
	TK120303_NMyc_cyto3_step05.3659.3659.2	3.8589	0.5987	2205.44	1	5560.0%	3	K.STAISLFYELSENDLNFIK.Q
UQ9JJH099.6%5719.8%359399947.1(Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase 
	TK120303_NMyc_cyto3_step04.1868.1868.1	2.6732	0.4282	1305.39	1	7220.0%	2	R.HLEFSHDQYK.E
	TK120303_NMyc_cyto3_step02.3740.3740.3	1.9669	0.056	4038.32	12	1400.0%	1	K.ELQSYAQEIGIFFTASGMDEMAVEFLHELNVPFFK.V
	TK120303_NMyc_cyto3_step08.4200.4200.3	2.3504	0.0251	2892.05	72	1600.0%	1	R.WVGGKHPCFIIAEIGQNHQGDIDVAK.R
	TK120303_NMyc_cyto3_step08.2743.2743.2	2.0735	0.2468	2364.6	2	3000.0%	1	K.HPCFIIAEIGQNHQGDIDVAK.R
UQ9D0E199.6%467.0%729776498.6(Q9D0E1) 2610023M21Rik protein 
	TK120303_NMyc_cyto3_step07.2393.2393.2	3.3607	0.5843	2036.49	1	3640.0%	2	R.GNFGGSFAGSFGGAGGHAPGVAR.K
	TK120303_NMyc_cyto3_step04.4218.4218.1	0.6669	0.0012	750.66	54	3000.0%	1	R.AIEMER.G
*	TK120303_NMyc_cyto3_step05.2967.2967.2	1.4604	0.1012	2027.73	3	2620.0%	1	K.QGGGGAGGSVPGIERMGPGIDR.I
UALBU_MOUSE99.6%8133356.4%608686936.1(P07724) Serum albumin precursor 
*	TK120303_NMyc_cyto3_step01.3202.3202.2	4.4238	0.5868	2954.48	1	4000.0%	2	K.CCAEANPPACYGTVLAEFQPLVEEPK.N
	TK120303_NMyc_cyto3_step01.0874.0874.1	1.0823	0.0618	474.45	3	8330.0%	1	K.NLVK.T
	TK120303_NMyc_cyto3_step02.1511.1511.1	1.9123	0.1781	1077.55	4	6430.0%	1	R.NECFLQHK.D
*	TK120303_NMyc_cyto3_step03.4419.4419.2	1.6466	0.1476	2422.84	1	2620.0%	1	R.LSQTFPNADFAEITKLATDLTK.V
*	TK120303_NMyc_cyto3_step02.1573.1573.1	1.9351	0.0977	1376.62	4	5500.0%	1	K.LQTCCDKPLLK.K
*	TK120303_NMyc_cyto3_step03.3656.3656.1	2.1447	0.2664	1481.63	1	5420.0%	3	K.GLVLIAFSQYLQK.C
*	TK120303_NMyc_cyto3_step01.1352.1352.1	1.3371	0.09	1431.3	6	3640.0%	1	K.YMCENQATISSK.L
*	TK120303_NMyc_cyto3_step01.2426.2426.2	1.6038	0.1109	2540.72	1	2620.0%	1	K.DDNPSLPPFERPEAEAMCTSFK.E
*	TK120303_NMyc_cyto3_step03.3339.3339.2	1.8537	0.174	1881.69	8	2940.0%	1	K.APQVSTPTLVEAARNLGR.V
*	TK120303_NMyc_cyto3_step01.1692.1692.1	1.2898	0.2071	1598.73	1	3460.0%	2	K.DTCFSTEGPNLVTR.C
*	TK120303_NMyc_cyto3_step01.1814.1814.1	2.0332	0.3826	1151.56	1	6670.0%	2	K.LVQEVTDFAK.T
*	TK120303_NMyc_cyto3_step01.1515.1515.1	1.696	0.2518	1252.49	1	5000.0%	2	R.YNDLGEQHFK.G
*	TK120303_NMyc_cyto3_step03.1678.1678.1	1.9038	0.0789	900.49	4	8330.0%	1	R.VCLLHEK.T
*	TK120303_NMyc_cyto3_step01.2484.2484.1	1.6559	0.0824	1482.73	3	3750.0%	3	K.LGEYGFQNAILVR.Y
*	TK120303_NMyc_cyto3_step01.3826.3826.2	3.9875	0.537	1663.78	1	7690.0%	1	R.LPCVEDYLSAILNR.V
*	TK120303_NMyc_cyto3_step05.1593.1593.2	2.4143	0.2181	2046.22	1	4120.0%	1	K.TPVSEHVTKCCSGSLVER.R
*	TK120303_NMyc_cyto3_step10.2185.2185.1	1.7889	0.2494	1457.95	1	5000.0%	6	R.RHPDYSVSLLLR.L
*	TK120303_NMyc_cyto3_step05.2811.2811.2	3.2695	0.61	1905.73	1	6000.0%	5	K.ENPTTFMGHYLHEVAR.R
*	TK120303_NMyc_cyto3_step01.1302.1302.1	1.33	0.1357	763.52	1	7500.0%	3	K.LATDLTK.V
*	TK120303_NMyc_cyto3_step03.2763.2763.1	1.5463	0.2648	1303.19	1	5500.0%	7	R.HPDYSVSLLLR.L
*	TK120303_NMyc_cyto3_step02.2400.2400.2	1.6586	0.3189	2154.98	13	2350.0%	1	K.AETFTFHSDICTLPEKEK.Q
	TK120303_NMyc_cyto3_step02.2239.2239.1	1.9701	0.4195	1019.64	1	7500.0%	4	K.SLHTLFGDK.L
*	TK120303_NMyc_cyto3_step08.3380.3380.3	1.8155	0.1093	3626.9	9	1450.0%	2	K.KAHCLSEVEHDTMPADLPAIAADFVEDQEVCK.N
*	TK120303_NMyc_cyto3_step05.2525.2525.2	3.2125	0.5321	1886.81	1	5330.0%	3	R.RPCFSALTVDETYVPK.E
*	TK120303_NMyc_cyto3_step03.2191.2191.1	2.1023	0.2214	1102.65	1	6110.0%	3	K.KQTALAELVK.H
*	TK120303_NMyc_cyto3_step01.1678.1678.1	1.8416	0.4529	1441.84	1	5000.0%	2	K.APQVSTPTLVEAAR.N
*	TK120303_NMyc_cyto3_step02.1348.1348.1	2.0393	0.1526	983.78	1	7140.0%	3	K.KYEATLEK.C
*	TK120303_NMyc_cyto3_step02.1177.1177.1	1.2486	0.0736	999.6	2	5620.0%	2	K.TPVSEHVTK.C
UQ923D299.6%62018.4%206221977.0(Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein) 
*	TK120303_NMyc_cyto3_step04.1955.1955.2	3.2479	0.5115	1757.77	1	5940.0%	2	R.LPSEGPQPAHVVVGDVR.Q
*	TK120303_NMyc_cyto3_step04.3847.3847.2	1.2765	0.074	2194.14	1	3000.0%	4	R.TGLTTLAQAVQAGYEVTVLVR.D
UTPIS_MOUSE99.6%122237.9%248265817.3(P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) 
	TK120303_NMyc_cyto3_step01.1115.1115.1	2.1607	0.272	1468.67	2	4580.0%	1	K.TATPQQAQEVHEK.L
	TK120303_NMyc_cyto3_step01.0228.0228.1	1.6181	0.1801	760.4	1	8330.0%	3	K.VIADNVK.D
	TK120303_NMyc_cyto3_step01.4502.4502.1	2.3127	0.3877	1459.82	1	5000.0%	1	R.HVFGESDELIGQK.V
	TK120303_NMyc_cyto3_step06.2163.2163.2	3.5452	0.4903	1616.19	1	6540.0%	2	R.RHVFGESDELIGQK.V
	TK120303_NMyc_cyto3_step01.3691.3691.2	1.6848	0.0615	3032.57	2	1790.0%	2	K.ELASQPDVDGFLVGGASLKPEFVDIINAK.Q
	TK120303_NMyc_cyto3_step01.1516.1516.1	2.1334	0.2947	1327.55	1	6670.0%	1	R.IIYGGSVTGATCK.E
*	TK120303_NMyc_cyto3_step03.3158.3158.2	4.8762	0.6169	1824.14	1	7060.0%	1	K.VSHALAEGLGVIACIGEK.L
UQ9CVA399.6%3332.3%161183749.1(Q9CVA3) 2210415M20Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step12.1376.1376.1	1.2875	0.1196	1312.75	9	4090.0%	1	K.IVVHLHPAPSNK.E
	TK120303_NMyc_cyto3_step10.1473.1473.3	1.384	0.049	2796.33	42	1770.0%	1	K.NNECCMAIPLSQIVFIEEQAAGIGK.S
	TK120303_NMyc_cyto3_step03.1958.1958.2	3.236	0.4899	1775.0	1	5360.0%	1	R.RWETVPVSQSLQTNK.G
UFKB3_MOUSE99.6%3318.8%224251489.3(Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) 
*	TK120303_NMyc_cyto3_step06.2801.2801.3	1.3602	0.0088	3131.21	6	1480.0%	1	K.KGDVVHCWYTGTLPDGTVFDTNIQTSSK.K
*	TK120303_NMyc_cyto3_step03.2543.2543.2	4.144	0.6229	1687.14	1	8080.0%	1	K.DHLVNAYNHLFESK.R
UCGC8_MOUSE99.6%1112.9%163176675.0(Q9D187) Hypothetical protein CGI-128 homolog 
	TK120303_NMyc_cyto3_step02.3192.3192.2	4.7669	0.5842	2308.7	1	5000.0%	1	R.VAAALENTHLLEVVNQCLSAR.S
UXDH_MOUSE99.6%81011.7%13351465187.6(Q00519) Xanthine dehydrogenase/oxidase [Includes: Xanthine dehydrogenase (EC 1.1.1.204) (XD); Xanthine oxidase (EC 1.1.3.22) (XO) (Xanthine oxidoreductase)] 
*	TK120303_NMyc_cyto3_step11.3907.3907.2	1.4003	0.1697	2487.07	1	2500.0%	2	K.DEVTCVGHIIGAVVADTPEHAHR.A
*	TK120303_NMyc_cyto3_step03.0492.0492.1	0.7316	0.0067	1224.44	40	2270.0%	1	R.AARAQHGDSNAK.Q
*	TK120303_NMyc_cyto3_step02.2797.2797.3	1.8605	0.1031	3379.1	2	1670.0%	1	K.IVHFSVNACLTPICSLHHVAVTTVEGIGNTK.K
*	TK120303_NMyc_cyto3_step11.2307.2307.2	1.101	0.0274	2646.58	12	1740.0%	1	K.GEAGEMELFVSTQNTMKTQSFIAK.M
*	TK120303_NMyc_cyto3_step04.3610.3610.3	2.2315	0.0616	2937.9	40	1570.0%	1	K.VGFMKTGTIVALEVAHFSNGGNSEDLSR.S
	TK120303_NMyc_cyto3_step05.3396.3396.2	1.3024	0.2095	1982.05	32	2940.0%	1	R.GPSTYKIPAFGSIPIEFR.V
*	TK120303_NMyc_cyto3_step06.1385.1385.3	1.7077	0.0566	2204.78	59	2110.0%	1	R.GVKITYEDLPAIITIQDAIK.N
UQ9DAW999.6%2218.5%330364295.7(Q9DAW9) 1600014M03Rik protein 
	TK120303_NMyc_cyto3_step06.3559.3559.3	1.7814	0.1511	4450.32	7	1120.0%	1	K.AIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTK.G
	TK120303_NMyc_cyto3_step03.3431.3431.2	3.8773	0.558	2330.65	1	4470.0%	1	K.KVNESSLNWPQLENIGNFIK.A
UO7014099.6%51120.2%247283187.8(O70140) Calcyclin binding protein (Fragment) 
	TK120303_NMyc_cyto3_step06.2433.2433.3	1.4957	0.0419	3487.08	2	1810.0%	1	K.IYITLTGVHQVPTENVQVHFTERSFDLLVK.N
	TK120303_NMyc_cyto3_step07.2887.2887.2	3.8987	0.6275	2681.88	1	4550.0%	3	K.IYITLTGVHQVPTENVQVHFTER.S
*	TK120303_NMyc_cyto3_step02.3323.3323.2	2.054	0.1822	2223.81	1	3950.0%	1	K.NYSMIVNNLLKPISVESSSK.K
UQ9QXD899.6%242.8%668714216.4(Q9QXD8) LIM domains containing protein 1 
*	TK120303_NMyc_cyto3_step06.2204.2204.2	4.6564	0.5937	2329.55	1	6110.0%	2	K.IHLQQQQQQQLLQEEALPR.A
UMGN_HUMAN99.6%3318.5%146171646.1(P50606) Mago nashi protein homolog (P50606) Mago nashi protein homolog 
	TK120303_NMyc_cyto3_step04.3171.3171.2	3.6988	0.5608	1855.98	1	6430.0%	1	K.FGHEFLEFEFRPDGK.L
	TK120303_NMyc_cyto3_step01.1947.1947.1	1.429	0.1773	952.77	18	5000.0%	1	R.YYVGHKGK.F
	TK120303_NMyc_cyto3_step02.0997.0997.1	0.4103	0.1701	468.46	15	5000.0%	1	K.IKPI.-
UACTB_HUMAN99.6%72130234.4%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) 
	TK120303_NMyc_cyto3_step01.3550.3550.3	2.4104	0.168	3991.06	1	1590.0%	1	R.CPEALFQPSFLGMESCGIHETTFNSIMKCDVDIR.K
	TK120303_NMyc_cyto3_step11.1982.1982.2	3.3283	0.5801	1519.7	1	7000.0%	15	K.IWHHTFYNELR.V
	TK120303_NMyc_cyto3_step01.1458.1458.1	1.1934	0.0868	1516.72	2	3750.0%	1	K.QEYDESGPSIVHR.K
	TK120303_NMyc_cyto3_step01.4735.4735.2	1.6531	0.2585	1956.25	1	3820.0%	5	R.VAPEEHPVLLTEAPLNPK.A
	TK120303_NMyc_cyto3_step02.3923.3923.2	2.8872	0.3254	2553.77	1	3860.0%	26	K.LCYVALDFEQEMATAASSSSLEK.S
	TK120303_NMyc_cyto3_step03.4294.4294.2	2.458	0.3543	3187.96	1	1900.0%	3	R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L
UP9731599.6%108214.0%193205838.6(P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) 
	TK120303_NMyc_cyto3_step01.0271.0271.1	2.053	0.2101	1127.42	1	5560.0%	1	R.CSQAVYAAEK.V
	TK120303_NMyc_cyto3_step10.0618.0618.2	1.6518	0.246	1846.89	7	3440.0%	9	K.HEEAPGHRPTTNPNASK.F
UHXB3_MOUSE99.6%2629826.6%433443539.2(P09026) Homeobox protein Hox-B3 (Hox-2.7) (MH-23) 
*	TK120303_NMyc_cyto3_step12.3130.3130.3	2.1109	0.1681	2595.77	5	2170.0%	2	K.GHQNAYALPSNYQPPLKGCGAPQK.Y
*	TK120303_NMyc_cyto3_step10.3382.3382.2	1.7354	0.1164	3124.62	1	1830.0%	16	K.LKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDK.S
*	TK120303_NMyc_cyto3_step11.3637.3637.2	1.3168	0.142	2883.71	11	1280.0%	1	K.NSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDK.S
*	TK120303_NMyc_cyto3_step10.3686.3686.3	1.8256	0.2533	4721.79	11	990.0%	1	K.ELNGSCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPPK.C
UQ6116799.6%114.4%225256785.7(Q61167) APC-binding protein EB2 (Fragment) 
	TK120303_NMyc_cyto3_step05.1892.1892.1	2.6033	0.3941	1329.88	1	6670.0%	1	K.LEHEYIHNFK.V
U6PGD_MOUSE99.5%6814.7%482531167.2(Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 
	TK120303_NMyc_cyto3_step01.3298.3298.2	2.9014	0.2299	2164.3	1	4210.0%	1	K.LVPLLDTGDIIIDGGNSEYR.D
	TK120303_NMyc_cyto3_step03.2336.2336.1	2.4972	0.3313	1522.8	1	4580.0%	2	R.HEMLPANLIQAQR.D
	TK120303_NMyc_cyto3_step01.1443.1443.1	1.0519	0.071	862.45	10	5000.0%	1	K.VVQLEGSK.K
	TK120303_NMyc_cyto3_step10.4054.4054.3	1.4607	0.111	2634.74	19	2070.0%	1	K.LVPLLDTGDIIIDGGNSEYRDTTR.R
	TK120303_NMyc_cyto3_step03.2239.2239.3	1.4563	0.0278	2852.38	5	2000.0%	1	R.VISTGVQAGIPMPCFTTALSFYDGYR.H
UQ9CZP199.5%4422.0%305337995.4(Q9CZP1) 2700038L12Rik protein 
	TK120303_NMyc_cyto3_step07.4235.4235.2	1.1903	0.0066	2679.45	3	2170.0%	1	K.YNGNGSKIVSVGDDQEIHVYDCPI.-
	TK120303_NMyc_cyto3_step04.2980.2980.2	3.0982	0.4945	2118.53	1	5310.0%	1	R.TCIHTFFDHQDQVWGVK.Y
	TK120303_NMyc_cyto3_step12.2892.2892.2	1.4866	0.0663	2256.27	11	2500.0%	1	K.QEQAHDDAIWSVAWETNKK.E
	TK120303_NMyc_cyto3_step09.1456.1456.1	1.0482	0.0034	882.53	158	4170.0%	1	K.EYSLDTR.G
UADA_MOUSE99.5%114.5%352399925.7(P03958) Adenosine deaminase (EC 3.5.4.4) (Adenosine aminohydrolase) 
*	TK120303_NMyc_cyto3_step05.2027.2027.2	3.1726	0.4369	1875.03	1	5670.0%	1	R.VGHGYHTIEDEALYNR.L
UUGDH_MOUSE99.5%114.3%493548327.6(O70475) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc dehydrogenase) (UDP-GlcDH) (UDPGDH) 
*	TK120303_NMyc_cyto3_step02.3623.3623.2	3.1423	0.4472	2300.25	1	4250.0%	1	R.VLDGLHSELQTIGFQIETIGK.K
UAMBP_MOUSE99.4%113.4%349390706.3(Q07456) AMBP protein precursor [Contains: Alpha-1-microglobulin; Inter-alpha-trypsin inhibitor light chain (ITI-LC) (Bikunin) (HI-30)] 
	TK120303_NMyc_cyto3_step12.1223.1223.1	2.1618	0.4062	1289.46	1	5450.0%	1	K.SSHHHGLTITAK.L
UQ9CRE799.4%3315.3%354399855.5(Q9CRE7) 2410174K12Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step06.2552.2552.2	2.2417	0.3672	1524.54	1	5420.0%	1	R.LLHPIIPEQSTFK.V
*	TK120303_NMyc_cyto3_step01.3999.3999.2	2.9478	0.5072	2509.03	1	2950.0%	1	R.LFQSFSDALIDGDPQAALEELTK.A
*	TK120303_NMyc_cyto3_step07.2281.2281.2	1.3961	0.0519	2130.48	20	2350.0%	1	K.QFTADVKNMYPSSSHYTR.N
UIF2A_HUMAN99.4%116.4%314359815.1(P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) 
*	TK120303_NMyc_cyto3_step03.3147.3147.2	2.9075	0.5001	2435.7	1	3950.0%	1	R.HVAEVLEYTKDEQLESLFQR.T
UEGF_MOUSE99.4%2015812.2%12171331446.5(P01132) Pro-epidermal growth factor precursor (EGF) [Contains: Epidermal growth factor] 
*	TK120303_NMyc_cyto3_step11.1203.1203.3	1.78	0.1736	3338.25	7	1700.0%	1	R.LFWVQDSGEGSHAYIHSCDYEGGSVRLIR.H
*	TK120303_NMyc_cyto3_step12.2594.2594.3	1.8992	0.1013	3695.13	95	1210.0%	1	K.NPCDEPSGSVSSSGPDSSSGAAVASCPQPWFVVLEK.H
*	TK120303_NMyc_cyto3_step11.3305.3305.3	1.922	0.037	2984.91	5	1920.0%	3	R.IDPDGTNHQQLVVDAGISADMDIHYKK.E
*	TK120303_NMyc_cyto3_step03.2140.2140.1	1.6924	0.0017	1448.56	12	3750.0%	1	K.CSHGCVLTSDGPR.C
*	TK120303_NMyc_cyto3_step04.3567.3567.3	1.8143	0.0368	2857.04	4	2000.0%	12	R.IDPDGTNHQQLVVDAGISADMDIHYK.K
*	TK120303_NMyc_cyto3_step05.1213.1213.2	1.2258	0.125	1828.43	1	3210.0%	1	R.RPTWLLLAFLLVFLK.I
*	TK120303_NMyc_cyto3_step10.3478.3478.3	2.1086	0.0565	3038.04	75	1480.0%	1	R.LQGSMLKPSSLVVVHPLAKPGADPCLYR.N
UILK1_HUMAN99.4%3316.8%452514198.1(Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) 
	TK120303_NMyc_cyto3_step12.3202.3202.3	2.3497	0.2024	3806.99	28	1250.0%	1	R.EVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCK.L
	TK120303_NMyc_cyto3_step12.2354.2354.2	2.9444	0.5076	2144.36	1	3950.0%	1	K.VALEGLRPTIPPGISPHVCK.L
	TK120303_NMyc_cyto3_step10.3286.3286.3	2.121	0.2068	4511.83	10	1190.0%	1	K.ADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNK.Y
UQ8VDM699.4%225.8%859960026.6(Q8VDM6) Similar to E1B-55 kDa-associated protein 5 
	TK120303_NMyc_cyto3_step11.3207.3207.3	2.0524	0.1227	3826.81	1	1560.0%	1	R.SPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVAR.D
*	TK120303_NMyc_cyto3_step06.2177.2177.2	2.7326	0.5164	2109.95	1	3440.0%	1	R.RPLDMEPQQQVYHPELK.T
UM2GD_HUMAN99.4%114.8%866968077.6(Q9UI17) Dimethylglycine dehydrogenase, mitochondrial precursor (EC 1.5.99.2) (ME2GLYDH) 
*	TK120303_NMyc_cyto3_step09.2619.2619.3	3.0483	0.4251	4700.51	1	1400.0%	1	R.NYWVAIGFGYGIIHAGGVGKYLSDWILHGEPPFDLIELDPNR.Y
UPGMU_MOUSE99.4%3313.4%561613866.8(Q9D0F9) Phosphoglucomutase (EC 5.4.2.2) (Glucose phosphomutase) (PGM) 
	TK120303_NMyc_cyto3_step12.2335.2335.3	1.7642	0.1093	3321.9	8	1670.0%	1	K.QQFDLENKFKPFTVEIVDSVEAYATMLR.N
	TK120303_NMyc_cyto3_step10.2948.2948.2	1.227	0.0084	2351.19	14	2140.0%	1	K.FNISNGGPAPEAITDKIFQISK.T
*	TK120303_NMyc_cyto3_step01.4096.4096.2	2.7657	0.5177	2798.05	1	3330.0%	1	K.VFQSNANYAENFIQSIVSTVEPALR.Q
UROA2_MOUSE99.4%122627.6%341359938.6(O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) 
	TK120303_NMyc_cyto3_step04.1452.1452.1	2.135	0.4015	1413.58	1	5910.0%	4	K.YHTINGHNAEVR.K
	TK120303_NMyc_cyto3_step03.2808.2808.2	2.3258	0.4041	1852.91	1	4670.0%	1	K.RGFGFVTFDDHDPVDK.I
	TK120303_NMyc_cyto3_step08.1523.1523.2	1.0783	0.1565	1311.9	138	2500.0%	1	R.SGRGGNFGFGDSR.G
	TK120303_NMyc_cyto3_step03.1328.1328.1	1.7075	0.2343	1340.67	1	5000.0%	2	R.EESGKPGAHVTVK.K
	TK120303_NMyc_cyto3_step05.2616.2616.2	1.3353	0.0736	2191.48	1	2710.0%	1	R.NMGGPYGGGNYGPGGSGGSGGYGGR.S
	TK120303_NMyc_cyto3_step04.2007.2007.3	2.201	0.1764	2372.11	11	2290.0%	1	R.GGNFGFGDSRGGGGNFGPGPGSNFR.G
UTEBP_MOUSE99.4%3325.6%160187214.5(Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23) 
	TK120303_NMyc_cyto3_step08.3885.3885.2	0.7361	0.1712	1444.17	15	2080.0%	1	K.LTFSCLGGSDNFK.H
	TK120303_NMyc_cyto3_step02.2888.2888.2	2.9559	0.4968	2067.64	1	5620.0%	1	K.HLNEIDLFHCIDPNDSK.H
	TK120303_NMyc_cyto3_step03.1031.1031.2	1.1779	0.1153	1351.52	12	4000.0%	1	-.MQPASAKWYDR.R
UPUR8_MOUSE99.4%227.6%484548087.3(P54822) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylosuccinase) (ASL) (ASASE) 
*	TK120303_NMyc_cyto3_step02.3100.3100.2	2.9506	0.5019	2242.96	1	3750.0%	1	R.ADLPTLGFTHFQPAQLTTVGK.R
*	TK120303_NMyc_cyto3_step06.1952.1952.2	1.1441	0.0060	1855.11	6	3000.0%	1	K.SNLNNIDFQMAAEEEK.R
UQ9DCG999.4%119.6%125141415.3(Q9DCG9) 0610038D11Rik protein 
	TK120303_NMyc_cyto3_step11.1925.1925.1	2.217	0.4042	1390.79	1	5000.0%	1	K.LLTHNLLSSHVR.G
UUBCH_HUMAN99.4%118.2%183206554.7(P37286) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19) (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) (P37286) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19) (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) 
	TK120303_NMyc_cyto3_step02.3273.3273.2	2.5491	0.5104	1655.76	1	5000.0%	1	K.HEVTILGGLNEFVVK.F
UCDC2_MOUSE99.4%4610.8%297341078.4(P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) 
	TK120303_NMyc_cyto3_step07.2964.2964.2	3.097	0.4914	1802.98	1	6070.0%	1	K.KPLFHGDSEIDQLFR.I
*	TK120303_NMyc_cyto3_step07.0187.0187.1	0.5995	0.0034	798.89	2	2000.0%	2	-.MEDYIK.I
	TK120303_NMyc_cyto3_step11.1505.1505.1	1.0578	0.0587	1209.6	2	5500.0%	1	K.WKPGSLASHVK.N
UQ9CSN899.4%228.1%369422218.5(Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) 
	TK120303_NMyc_cyto3_step11.1538.1538.2	3.1532	0.4174	1793.83	1	5710.0%	1	K.LITQTFNHHNQLAQK.A
	TK120303_NMyc_cyto3_step02.2843.2843.2	1.3709	0.0788	1827.6	19	2860.0%	1	K.QDAEDEEDEEDEKDK.G
UGSH1_MOUSE99.4%6814.3%636725985.8(P97494) Glutamate--cysteine ligase catalytic subunit (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS heavy chain) 
	TK120303_NMyc_cyto3_step04.1911.1911.3	2.0384	0.1999	3615.95	6	1480.0%	1	R.LGCPGFTLPEHRPNPEEGGASKSLFFPDEAINK.H
	TK120303_NMyc_cyto3_step08.2244.2244.2	2.8596	0.4937	2354.35	1	3100.0%	2	R.LGCPGFTLPEHRPNPEEGGASK.S
	TK120303_NMyc_cyto3_step06.2637.2637.3	1.9398	0.023	3973.69	13	1330.0%	1	R.DPLTLFEEKIHLDDANESDHFENIQSTNWQTMR.F
	TK120303_NMyc_cyto3_step05.0450.0450.1	0.7009	0.1093	511.47	5	6250.0%	1	K.YSGGK.S
	TK120303_NMyc_cyto3_step07.4310.4310.2	1.5015	0.0295	2214.04	10	2630.0%	1	K.VQLLLNGGDVLETLQEKGER.T
UQ1418599.4%889.4%18652153747.6(Q14185) DOCK180 protein 
*	TK120303_NMyc_cyto3_step04.1668.1668.2	0.8239	0.1284	2527.13	86	1750.0%	1	K.NLIGKNVYPFDWVIMNMVQNK.V
*	TK120303_NMyc_cyto3_step09.1539.1539.3	1.2567	0.0375	1937.2	75	2080.0%	1	K.GHSATGKSMQSLGSCTISK.D
*	TK120303_NMyc_cyto3_step11.1623.1623.3	1.3126	0.0464	3355.76	30	1340.0%	1	R.GADELSLQIGDTVHILETYEGWYRGYTLR.K
*	TK120303_NMyc_cyto3_step12.3727.3727.2	1.2963	0.0338	3087.77	221	1070.0%	1	K.GSVADYGNLMENQDLLGSPTPPPPPPHQR.H
*	TK120303_NMyc_cyto3_step02.3673.3673.2	3.1339	0.443	2418.8	1	3330.0%	1	K.GQHETVIPGDLPLIQEVTTTLR.E
*	TK120303_NMyc_cyto3_step04.2984.2984.2	1.7753	0.1407	2492.47	5	2370.0%	1	R.QEDLEACCQLLSHILEVLYR.K
*	TK120303_NMyc_cyto3_step10.3602.3602.2	1.3743	0.0493	2541.66	29	1900.0%	1	K.QHFIPFQPVAGENDFLQTVINK.V
*	TK120303_NMyc_cyto3_step02.2505.2505.2	1.5139	0.0551	1571.97	13	3850.0%	1	R.LHNLRAVFTDLGSK.D
UDPY1_MOUSE99.4%4412.2%572621687.1(P97427) Dihydropyrimidinase related protein-1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (ULIP3 protein) 
	TK120303_NMyc_cyto3_step04.2166.2166.2	1.5105	0.0891	2160.37	2	2890.0%	1	K.AVGKDNFTLIPEGVNGIEER.M
	TK120303_NMyc_cyto3_step01.2086.2086.1	2.3055	0.3791	1325.67	1	5420.0%	1	K.QIGENLIVPGGVK.T
	TK120303_NMyc_cyto3_step04.4127.4127.2	0.9826	0.1764	2950.61	2	1920.0%	1	R.ILEMGITGPEGHALSRPEELEAEAVFR.A
	TK120303_NMyc_cyto3_step03.1179.1179.1	1.2749	0.0056	1203.65	29	3890.0%	1	R.EELEVLVQDK.G
UKPYR_MOUSE99.4%5713.2%574623097.1(P53657) Pyruvate kinase, isozymes R/L (EC 2.7.1.40) (L-PK) 
*	TK120303_NMyc_cyto3_step10.1812.1812.2	2.8066	0.4942	2182.71	1	4440.0%	1	R.LNFSHGSHEYHAESIANIR.E
*	TK120303_NMyc_cyto3_step04.3668.3668.2	1.8041	0.1579	1687.29	1	5000.0%	2	R.QVHLSRGVFPLLYR.E
	TK120303_NMyc_cyto3_step10.2905.2905.2	1.9627	0.2202	2540.07	1	2500.0%	1	R.AETSDVANAVLDGADCIMLSGETAK.G
*	TK120303_NMyc_cyto3_step04.2960.2960.2	1.9847	0.2936	2014.25	1	3530.0%	1	K.TVWVDYHNITQVVAVGGR.I
UIF41_HUMAN99.3%338.4%406461545.5(P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) 
	TK120303_NMyc_cyto3_step02.2073.2073.1	2.2799	0.3833	1020.67	1	7140.0%	1	R.KVDWLTEK.M
	TK120303_NMyc_cyto3_step01.1644.1644.1	1.4687	0.3064	1140.89	1	6000.0%	1	K.ATQALVLAPTR.E
	TK120303_NMyc_cyto3_step04.2396.2396.2	3.0179	0.3488	1619.37	1	6070.0%	1	K.LQMEAPHIIVGTPGR.V
UQ9QZE799.3%116.9%290329266.6(Q9QZE7) Translin associated protein X (Translin-associated factor X) 
*	TK120303_NMyc_cyto3_step02.3515.3515.2	3.0438	0.4835	2267.82	1	3950.0%	1	R.AVTTGLQEYVEAVSFQHFIK.T
UQ96B9499.3%114.6%745832975.8(Q96B94) Similar to KIAA0807 protein 
*	TK120303_NMyc_cyto3_step01.4178.4178.3	3.1148	0.4076	3879.59	4	1740.0%	1	R.DSSPRSMASPCGPFASTWVTPMSTPCTIWCGTWR.M
UQ6116699.3%3317.2%268300165.2(Q61166) APC-binding protein EB1 homolog 
*	TK120303_NMyc_cyto3_step03.2224.2224.2	2.2661	0.5327	1992.41	3	2630.0%	1	R.QGQETAVAPSLVAPALSKPK.K
*	TK120303_NMyc_cyto3_step12.1152.1152.2	2.4537	0.2537	1879.69	1	4120.0%	1	K.KPLGSSTAAPQRPIATQR.T
*	TK120303_NMyc_cyto3_step11.1542.1542.3	1.9377	0.0606	2894.09	43	1670.0%	1	K.EYDPVAARQGQETAVAPSLVAPALSKPK.K
URIK1_MOUSE99.3%226.1%656748546.5(Q60855) Receptor-interacting serine/threonine protein kinase 2 (EC 2.7.1.-) (Serine/threonine protein kinase RIP) (Cell death protein RIP) (Receptor interacting protein) 
*	TK120303_NMyc_cyto3_step03.2124.2124.2	1.094	0.025	2326.25	64	2110.0%	1	R.IIVEAIEGMCYLHDKGVIHK.D
*	TK120303_NMyc_cyto3_step03.2596.2596.2	3.1342	0.3823	2322.16	1	5790.0%	1	R.HQAIFDNTTSLTDEHLNPIR.E
UPSD1_HUMAN99.3%335.1%9531058665.4(Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) 
*	TK120303_NMyc_cyto3_step07.1556.1556.1	0.9132	0.0641	1072.55	198	3890.0%	1	K.QAIGIALETR.R
*	TK120303_NMyc_cyto3_step02.2957.2957.2	3.0787	0.4453	2399.17	1	4250.0%	1	R.TPEQCPSVVSLLSESYNPHVR.Y
*	TK120303_NMyc_cyto3_step12.4194.4194.2	1.5089	0.1381	2034.55	220	2060.0%	1	K.LNAVVNDFWAEISESVDK.I
UQ9D9F999.3%118.3%218252267.9(Q9D9F9) C330027I04Rik protein 
	TK120303_NMyc_cyto3_step05.3072.3072.2	3.0963	0.449	2310.46	1	5000.0%	1	K.ELTELFHHYYPIEIDPHR.T
UQ922P199.3%41023.3%116129094.1(Q922P1) RIKEN cDNA 2010012F05 gene 
	TK120303_NMyc_cyto3_step10.2788.2788.2	1.6191	0.2676	2771.73	65	1540.0%	3	K.NLLEISGPETVPLPNVPSVALPSKPAK.K
UWDR1_HUMAN99.3%224.8%606661946.7(O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1) 
*	TK120303_NMyc_cyto3_step03.2591.2591.2	3.1369	0.4181	2420.56	1	3570.0%	1	R.NIDNPALADIYTEHAHQVVVAK.Y
*	TK120303_NMyc_cyto3_step01.0638.0638.1	1.1353	0.1045	702.4	3	7500.0%	1	K.IIGGDPK.G
UMGD1_HUMAN99.3%394.9%778861515.8(Q9Y5V3) Melanoma-associated antigen D1 (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) (PRO2292) 
*	TK120303_NMyc_cyto3_step04.3594.3594.3	2.3419	0.3347	4110.47	5	1280.0%	3	R.SAPVPVTTQNPPGAPPNVLWQTPLAWQNPSGWQNQTAR.Q
UH105_MOUSE99.3%447.5%858964935.6(Q61699) Heat-shock protein 105 kDa (Heat shock-related 100 kDa protein E7I) (HSP-E7I) (Heat shock 110 kDa protein) (42 degrees C-HSP) 
*	TK120303_NMyc_cyto3_step03.3004.3004.2	1.3932	0.0816	1942.6	125	2350.0%	1	K.FFGKDVSTTLNADEAVAR.G
	TK120303_NMyc_cyto3_step02.3164.3164.2	2.5865	0.492	2168.62	1	4170.0%	1	K.KPVTDCVISVPSFFTDAER.R
	TK120303_NMyc_cyto3_step10.1215.1215.2	1.0747	0.0547	1455.11	113	2920.0%	1	R.CTPSVISFGSKNR.T
*	TK120303_NMyc_cyto3_step03.0748.0748.2	1.1045	0.1539	2980.14	8	1480.0%	1	K.DVSTTLNADEAVARGCALQCAILSPAFK.V
UPUR6_MOUSE99.3%112.4%425470707.2(Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)] 
*	TK120303_NMyc_cyto3_step03.1254.1254.1	1.9065	0.382	1147.6	1	6110.0%	1	K.RNPGVQEGYK.F
UQ9D3B799.3%3315.7%445519396.3(Q9D3B7) 6330404L05Rik protein 
	TK120303_NMyc_cyto3_step01.4078.4078.1	2.4352	0.3588	1559.72	2	4620.0%	1	R.SFFSEIISSISDVK.F
	TK120303_NMyc_cyto3_step03.3832.3832.3	1.6866	0.104	3879.48	75	1100.0%	1	K.INNSFLRDHSYATEADIISTVEFNHTGELLATGDK.G
	TK120303_NMyc_cyto3_step03.2839.2839.3	1.5894	0.0057	2694.31	1	2500.0%	1	K.VWDLNMENRPIETYQVHDYLR.S
UQ9D1L499.3%1126.6%154164536.3(Q9D1L4) 0610039D01Rik protein (RIKEN cDNA 0610039D01 gene) 
*	TK120303_NMyc_cyto3_step11.3541.3541.3	3.2498	0.3816	4454.99	1	1560.0%	1	R.SVHPYEVAEVIALPVEQGNPPYLHWVHQVTESVSNSGTALP.-
URECK_HUMAN99.3%8189.1%9711064576.7(O95980) Reversion-inducing cysteine-rich protein with Kazal motifs precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) 
*	TK120303_NMyc_cyto3_step08.3514.3514.3	2.0859	0.0549	4319.7	1	1400.0%	2	K.EAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVR.A
*	TK120303_NMyc_cyto3_step10.3345.3345.3	3.1132	0.1591	3122.38	1	2270.0%	2	R.GALLLLLAVAGVAEVAGGLAPGSAGALCCNHSK.D
*	TK120303_NMyc_cyto3_step06.2152.2152.1	1.4904	0.0713	1551.03	11	4170.0%	1	K.KPITVLEILQKIR.M
UIC1_MOUSE99.2%5524.4%504556386.4(P97290) Plasma protease C1 inhibitor precursor (C1 Inh) (C1Inh) 
	TK120303_NMyc_cyto3_step02.2980.2980.2	2.9473	0.4637	1827.54	1	5000.0%	1	K.GVTSVSQIFHSPDLAIR.D
*	TK120303_NMyc_cyto3_step12.2740.2740.3	2.7398	0.2129	3182.83	1	2210.0%	1	K.LEFFDFTYDLNLCGLTEDPDLQVSAMK.H
*	TK120303_NMyc_cyto3_step05.3605.3605.2	1.0817	0.0275	2324.04	48	1750.0%	1	K.VGQLQLSHNLSFVIVVPVFPK.H
*	TK120303_NMyc_cyto3_step03.2784.2784.3	1.9838	0.0427	3449.43	11	1450.0%	1	R.DDSWSPPEPTVLPSTWPTTSVAITITNDTMGK.V
*	TK120303_NMyc_cyto3_step12.1652.1652.3	1.6917	0.1718	2876.96	209	1500.0%	1	R.VLGPDSAANLELINTWVAENTNHKIR.K
UQ9D6U599.2%1113.9%173197596.2(Q9D6U5) 2310057C03Rik protein 
	TK120303_NMyc_cyto3_step05.3640.3640.2	2.9414	0.4741	2742.38	1	3040.0%	1	R.SVEGWILFVTGVHEEATEEDIHDK.F
UQOR_MOUSE99.2%3314.8%331352698.1(P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin) 
*	TK120303_NMyc_cyto3_step09.3239.3239.3	1.8326	0.0139	3918.16	187	1030.0%	1	K.GDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFR.Q
*	TK120303_NMyc_cyto3_step03.1439.1439.1	2.3761	0.3754	1433.63	1	5770.0%	1	K.AAQAHEDIIHGSGK.T
UHP28_HUMAN99.2%116.1%181206308.9(Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) 
*	TK120303_NMyc_cyto3_step02.1619.1619.1	2.3651	0.3536	1213.96	1	6500.0%	1	K.KVTQLDLDGPK.E
UO3572799.2%3310.9%597656386.9(O35727) Factor XII 
*	TK120303_NMyc_cyto3_step02.2055.2055.3	1.4826	0.0188	3423.68	35	1300.0%	1	R.RPGSRPWCATTPNFDENQQWGYCLEPKK.V
*	TK120303_NMyc_cyto3_step06.2880.2880.2	2.8686	0.4726	2100.63	1	5000.0%	1	R.LHEGFSSITYQHDLALLR.L
*	TK120303_NMyc_cyto3_step11.3363.3363.2	1.1665	0.0034	1996.16	42	2500.0%	1	R.GLSYRGQAGTTQSGAPCQR.W
UQ96SC399.2%7273.0%26732910216.6(Q96SC3) Fibulin-6 (Fragment) 
	TK120303_NMyc_cyto3_step09.3641.3641.3	1.6088	0.0584	3784.79	49	1210.0%	1	R.YSILENGFLHIQSAHVTDTGRYLCMATNAAGTDR.R
	TK120303_NMyc_cyto3_step05.3211.3211.3	2.6647	0.0386	2671.65	2	2500.0%	5	K.LQIARSQHSDSGNYTCIASNMEGK.A
	TK120303_NMyc_cyto3_step06.2673.2673.2	1.6982	0.1745	2325.7	8	2380.0%	1	R.AQVSDVAVYTCVASNRAGVDNK.H
UQ91XF099.2%3314.9%261301148.2(Q91XF0) Similar to pyridoxine 5'-phosphate oxidase (Expressed sequence AI415282) 
*	TK120303_NMyc_cyto3_step02.2724.2724.2	3.0503	0.4532	2655.35	1	3480.0%	1	R.GLATGDSPLGPMTHHGEEDWVYER.L
*	TK120303_NMyc_cyto3_step05.2157.2157.2	1.378	0.0157	1843.11	12	3210.0%	1	K.LPEKEAENYFHSRPK.S
*	TK120303_NMyc_cyto3_step04.1644.1644.1	2.1297	0.1823	1378.54	1	6000.0%	1	K.EAENYFHSRPK.S
UZ219_HUMAN99.2%16827.3%722768769.5(Q9P2Y4) Zinc finger protein 219 
*	TK120303_NMyc_cyto3_step09.3460.3460.3	2.5098	0.035	3053.04	8	1810.0%	7	R.APQPPDLGLLAYEPLGPALLLAPAPTPAER.R
*	TK120303_NMyc_cyto3_step09.2159.2159.3	1.4779	0.0274	2274.41	7	2050.0%	1	R.YSNGPAVSAGSLGMGAVSWSESR.A
UQ99KS199.2%1116.0%144165117.8(Q99KS1) Hypothetical 16.5 kDa protein (Fragment) 
	TK120303_NMyc_cyto3_step10.2957.2957.2	2.7913	0.4691	2553.14	1	2950.0%	1	K.NELHNLLDKPQLQGIPVLVLGNK.R
UTCP1_MOUSE99.2%484.1%556603416.1(P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) 
	TK120303_NMyc_cyto3_step05.1881.1881.1	2.0797	0.2835	1231.62	3	5000.0%	2	K.IHPTSVISGYR.L
	TK120303_NMyc_cyto3_step02.1364.1364.1	2.3022	0.3611	1413.63	1	5450.0%	2	R.AFHNEAQVNPER.K
UG3P1_HUMAN99.1%356.9%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) 
*	TK120303_NMyc_cyto3_step01.1494.1494.1	2.2231	0.3607	1371.66	1	4640.0%	2	R.GAAQNLIPASTGAAK.A
*	TK120303_NMyc_cyto3_step01.1526.1526.1	1.1247	0.0496	870.52	5	5710.0%	1	K.VIPELDGK.L
UMCM2_MOUSE99.1%10409.1%9041020475.8(P97310) DNA replication licensing factor MCM2 
*	TK120303_NMyc_cyto3_step08.1962.1962.2	1.3357	0.0256	1471.58	9	4090.0%	1	R.VRPKLNQMDQDK.V
	TK120303_NMyc_cyto3_step05.1244.1244.1	0.9804	0.0043	623.31	47	6250.0%	1	R.KTFAR.Y
*	TK120303_NMyc_cyto3_step07.3557.3557.2	1.9589	0.0125	2028.43	1	3750.0%	6	R.QINIHNLSAFYDSDLFK.F
	TK120303_NMyc_cyto3_step09.1713.1713.1	1.9788	0.3589	1377.78	2	4090.0%	1	R.THVDSHGHNVFK.E
	TK120303_NMyc_cyto3_step11.4071.4071.3	1.5644	0.0736	4168.82	2	1500.0%	1	R.EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDR.I
UMCM7_MOUSE99.1%355.1%719812116.4(Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) 
*	TK120303_NMyc_cyto3_step03.3474.3474.2	3.0375	0.4575	2019.16	1	3890.0%	2	R.IAQPGDHVSVTGIFLPVLR.T
*	TK120303_NMyc_cyto3_step06.1947.1947.2	1.1007	0.0508	1842.31	19	2650.0%	1	K.ALLLLLVGGVDQSPQGMK.I
UGLYG_MOUSE99.1%51114.2%332372715.3(Q9R062) Glycogenin-1 (EC 2.4.1.186) 
*	TK120303_NMyc_cyto3_step02.4280.4280.2	1.1638	0.0020	2963.1	7	1730.0%	1	K.VLETVFDDVIMVDVLDSGDSAHLTLMK.R
	TK120303_NMyc_cyto3_step01.1860.1860.1	1.1948	0.107	944.83	26	4440.0%	1	K.GALVLGSSLK.Q
*	TK120303_NMyc_cyto3_step05.2075.2075.1	2.1583	0.3601	1129.68	1	6670.0%	3	K.RPELGITLTK.L
UPPI2_MOUSE99.1%2211.5%270313566.9(P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) 
	TK120303_NMyc_cyto3_step04.1522.1522.1	1.7972	0.0768	888.59	2	6670.0%	1	K.IYHLKSK.V
	TK120303_NMyc_cyto3_step06.2903.2903.2	2.7275	0.4874	2802.24	1	3480.0%	1	K.IETWHKPDLGTLENVHGLDPNTWK.T
UGYG2_HUMAN99.1%4106.2%501552125.1(O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) 
*	TK120303_NMyc_cyto3_step05.2075.2075.1	2.1583	0.3601	1129.68	1	6670.0%	3	K.RPELGLTLTK.L
*	TK120303_NMyc_cyto3_step11.2078.2078.2	1.3325	0.0695	2414.61	298	1750.0%	1	K.QFGSSAKVVHFLGSMKPWNYK.Y
ULAS1_MOUSE99.1%243.4%263299947.0(Q61792) LIM and SH3 domain protein 1 (LASP-1) (MLN 50) 
	TK120303_NMyc_cyto3_step02.1233.1233.1	2.1655	0.3625	1214.48	1	6880.0%	2	K.ACFHCETCK.M
UQ921L099.1%4412.1%655709828.4(Q921L0) Similar to phosphatidylinositol binding clathrin assembly protein 
	TK120303_NMyc_cyto3_step02.1287.1287.1	2.2034	0.3561	1456.84	1	5000.0%	1	R.ITAAQHSVTGSAVSK.T
	TK120303_NMyc_cyto3_step09.1173.1173.3	1.4742	0.0012	2612.29	265	1350.0%	1	K.DSTAASRATTLSNAVSSLASTGLSLTK.V
	TK120303_NMyc_cyto3_step03.0344.0344.1	0.8048	0.0382	1215.33	1	4000.0%	1	K.KLTGGSNWQPK.V
	TK120303_NMyc_cyto3_step08.2362.2362.3	1.7517	0.0305	3137.81	2	2000.0%	1	K.HLDYLIQCTNEMNVNIPQLADSLFER.T
UFLNA_HUMAN99.1%11137.5%26472807596.1(P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) 
*	TK120303_NMyc_cyto3_step03.1174.1174.1	1.5464	0.2781	1079.52	1	7000.0%	1	R.VNVGAGSHPNK.V
*	TK120303_NMyc_cyto3_step11.1353.1353.2	1.1155	0.0385	1794.22	66	2670.0%	1	R.FVPAEMGTHTVSVKYK.G
	TK120303_NMyc_cyto3_step08.0855.0855.1	0.2434	0.0	552.91	2	1250.0%	1	K.HVGSR.L
*	TK120303_NMyc_cyto3_step11.1102.1102.2	2.6799	0.4638	1636.36	1	5330.0%	1	R.VHGPGIQSGTTNKPNK.F
*	TK120303_NMyc_cyto3_step04.1355.1355.1	1.4914	0.1176	1110.82	4	5000.0%	1	R.ALTQTGGPHVK.A
*	TK120303_NMyc_cyto3_step11.2486.2486.3	2.0336	0.1679	3058.86	11	1700.0%	1	R.SAGQGEVLVYVEDPAGHQEEAKVTANNDK.N
*	TK120303_NMyc_cyto3_step12.4027.4027.3	2.2612	0.0779	4289.08	1	1530.0%	1	K.AIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAK.K
*	TK120303_NMyc_cyto3_step03.2442.2442.2	1.3615	0.0044	2329.52	168	1840.0%	2	K.GEYTLVVKWGHEHIPGSPYR.V
*	TK120303_NMyc_cyto3_step09.4315.4315.2	0.879	0.0047	2448.68	25	1670.0%	1	K.IVGPSGAAVPCKVEPGLGADNSVVR.F
*	TK120303_NMyc_cyto3_step01.3983.3983.2	2.9224	0.3682	2894.24	1	3040.0%	1	K.VGSAADIPINISETDLSLLTATVVPPSGR.E
UVINC_MOUSE99.1%122011.2%10651166745.9(Q64727) Vinculin (Metavinculin) 
*	TK120303_NMyc_cyto3_step01.1306.1306.1	1.874	0.3319	1497.55	1	4290.0%	1	R.DPNASPGDAGEQAIR.Q
	TK120303_NMyc_cyto3_step01.1539.1539.1	1.0435	0.0679	1149.48	7	5000.0%	1	R.LANVMMGPYR.Q
	TK120303_NMyc_cyto3_step11.2974.2974.2	1.5752	0.0284	1905.36	150	2110.0%	1	K.AAAVGTANKSTVEGIQASVK.T
	TK120303_NMyc_cyto3_step12.3851.3851.2	2.0606	0.3826	3028.23	2	2590.0%	3	R.LTDELAPPKPPLPEGEVPPPRPPPPEEK.D
	TK120303_NMyc_cyto3_step02.1336.1336.1	1.1509	0.0319	838.64	11	5000.0%	1	R.GLVAEGHR.L
	TK120303_NMyc_cyto3_step12.4402.4402.3	2.8454	0.3443	4027.43	1	2000.0%	1	R.LTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQK.A
*	TK120303_NMyc_cyto3_step01.2106.2106.1	1.4996	0.1195	1091.7	20	4500.0%	1	R.SLGEIAALTSK.L
	TK120303_NMyc_cyto3_step01.1852.1852.1	0.9323	9.0E-4	963.56	58	5000.0%	1	K.RALASIDSK.L
*	TK120303_NMyc_cyto3_step02.1188.1188.1	1.9843	0.3587	1104.54	1	6110.0%	2	R.AANFENHSGR.L
UQ9CYD699.1%223.7%403445805.1(Q9CYD6) 5730525G14Rik protein 
	TK120303_NMyc_cyto3_step07.1099.1099.1	0.5116	0.0977	822.21	32	3000.0%	1	K.QQEEYK.K
	TK120303_NMyc_cyto3_step08.1440.1440.1	1.7464	0.3697	1033.57	1	6880.0%	1	K.VHAAEHTLR.N
UHBD_HUMAN99.1%2625815.1%146159248.0(P02042) Hemoglobin delta chain 
*	TK120303_NMyc_cyto3_step01.1958.1958.1	2.1279	0.2445	1523.79	5	3750.0%	11	K.GTFSQLSELHCDK.L
*	TK120303_NMyc_cyto3_step06.2733.2733.2	2.7309	0.4339	2633.62	1	3330.0%	11	K.GTFSQLSELHCDKLHVDPENFR.L
UIF4G_HUMAN99.1%686.7%13951533615.2(Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) 
*	TK120303_NMyc_cyto3_step05.2509.2509.3	1.6812	0.0391	3380.16	11	1610.0%	1	R.LQALVVTLEQPPNLLRMFFDALYDEDVVK.E
	TK120303_NMyc_cyto3_step02.1257.1257.1	2.1493	0.3625	1477.74	1	5000.0%	1	K.IHNAENIQPGEQK.Y
	TK120303_NMyc_cyto3_step11.1202.1202.3	1.153	0.0593	3212.44	11	1700.0%	1	K.TPLRPLDPTRLQGINCGPDFTPSFANLGR.T
	TK120303_NMyc_cyto3_step04.2118.2118.2	2.1186	0.3245	1976.19	1	3610.0%	2	K.ITKPGSIDSNNQLFAPGGR.L
	TK120303_NMyc_cyto3_step08.1843.1843.3	1.5029	0.0927	2060.81	7	2340.0%	1	K.IHNAENIQPGEQKYEYK.S
UVAA1_MOUSE99.1%579.4%617682685.9(P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) 
	TK120303_NMyc_cyto3_step02.2291.2291.1	2.312	0.2856	1309.78	1	6360.0%	1	R.VGHSELVGEIIR.L
	TK120303_NMyc_cyto3_step02.2575.2575.1	1.3066	0.0319	1147.58	1	6250.0%	1	K.HFTEFVPLR.T
	TK120303_NMyc_cyto3_step11.2778.2778.3	2.3296	0.1113	3958.4	11	1460.0%	1	R.VGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLR.T
	TK120303_NMyc_cyto3_step10.1420.1420.1	1.3308	0.1401	1316.73	14	4090.0%	2	K.LPANHPLLTGQR.V
UCT11_MOUSE99.1%118.6%139162178.8(Q9D269) Cystatin 11 precursor 
*	TK120303_NMyc_cyto3_step01.2147.2147.1	2.0173	0.3637	1292.47	1	5910.0%	1	R.IEEVSALESSVK.E
URET1_MOUSE99.1%1111.9%134157155.2(Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI) 
	TK120303_NMyc_cyto3_step02.3375.3375.2	2.6398	0.487	2001.41	1	6000.0%	1	R.GWTQWIEGDELHLEMR.A
UGELS_MOUSE99.1%352.7%730807465.8(P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) 
	TK120303_NMyc_cyto3_step03.1623.1623.1	1.8024	0.3761	1277.78	1	5500.0%	2	K.HVVPNEVVVQR.L
	TK120303_NMyc_cyto3_step04.1486.1486.1	1.5851	0.2941	850.48	1	6880.0%	1	K.KGGVASGFK.H
UPP1A_HUMAN99.1%3316.4%330375126.3(P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) 
	TK120303_NMyc_cyto3_step04.2336.2336.3	2.0397	0.0577	2598.68	1	2620.0%	1	R.LFEYGGFPPESNYLFLGDYVDR.G
	TK120303_NMyc_cyto3_step02.1152.1152.1	1.6756	0.3585	1157.52	1	6110.0%	1	R.GNHECASINR.I
	TK120303_NMyc_cyto3_step05.1937.1937.2	1.4786	0.0598	2318.06	8	2380.0%	1	K.YGQFSGLNPGGRPITPPRNSAK.A
UQ9Z33299.0%242.2%553593357.9(Q9Z332) Keratin 6 alpha 
	TK120303_NMyc_cyto3_step01.3214.3214.1	2.4849	0.3391	1306.03	3	5000.0%	2	R.SLDLDSIIAEVK.A
UQ8R34699.0%4618.8%367393188.2(Q8R346) Similar to alanyl-tRNA synthetase (H. sapiens) 
*	TK120303_NMyc_cyto3_step03.3267.3267.3	2.0895	0.1218	3430.71	1	1940.0%	1	K.AEEIVNGMIEAAKPVYTQDCPLAAAKAIQGLR.A
	TK120303_NMyc_cyto3_step09.3384.3384.2	2.3434	0.1933	2119.58	1	4170.0%	1	K.NVGCLQEALQLATSFAQLR.L
	TK120303_NMyc_cyto3_step07.2809.2809.2	1.5327	0.1079	1845.55	1	3530.0%	2	R.NSSHAGAFVIVTEEAIAK.G
UQ6208499.0%2217.7%203211345.8(Q62084) PNG protein 
	TK120303_NMyc_cyto3_step11.1235.1235.3	1.6351	0.074	2584.88	31	2020.0%	1	K.ELLVDCYKPTEAFISGLLDKIR.G
	TK120303_NMyc_cyto3_step09.3611.3611.2	2.9506	0.4481	1813.85	1	6150.0%	1	K.RLNLEEWILEQLTR.L
UTERA_MOUSE99.0%141814.6%806893085.3(Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] 
	TK120303_NMyc_cyto3_step04.1092.1092.3	1.879	0.0551	1802.2	6	2860.0%	1	R.LDQLIYIPLPDEKSR.V
	TK120303_NMyc_cyto3_step02.2269.2269.1	1.6597	0.2346	1095.61	1	7500.0%	1	R.LEILQIHTK.N
	TK120303_NMyc_cyto3_step04.1603.1603.1	1.5336	0.3091	1190.52	2	5000.0%	1	R.RDHFEEAMR.F
	TK120303_NMyc_cyto3_step09.4155.4155.3	1.9132	0.1423	3105.95	3	1920.0%	2	K.MDLIDLEDETIDAEVMNSLAVTMDDFR.W
	TK120303_NMyc_cyto3_step01.3020.3020.1	2.5982	0.1473	1558.81	1	5830.0%	1	R.LDQLIYIPLPDEK.S
	TK120303_NMyc_cyto3_step07.1932.1932.1	1.4388	0.1799	712.66	1	8000.0%	2	R.HPALFK.A
	TK120303_NMyc_cyto3_step07.1516.1516.2	1.4356	0.1746	838.28	7	5000.0%	1	K.AIGVKPPR.G
	TK120303_NMyc_cyto3_step11.2785.2785.2	1.6043	0.1657	2521.22	6	2050.0%	1	K.NVFIIGATNRPDIIDPAILRPGR.L
	TK120303_NMyc_cyto3_step01.3228.3228.2	1.9214	0.263	2343.43	1	3250.0%	1	R.ETVVEVPQVTWEDIGGLEDVK.R
UROG_MOUSE98.9%82811.6%3884223410.0(O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G) 
	TK120303_NMyc_cyto3_step08.1235.1235.1	1.5981	0.3624	875.56	2	5710.0%	5	R.RGPPPPPR.S
	TK120303_NMyc_cyto3_step11.1463.1463.2	1.269	0.1281	2038.29	13	2780.0%	1	R.GPPPSYGGSSRYDDYSSSR.D
*	TK120303_NMyc_cyto3_step08.1939.1939.2	1.7655	0.1437	1867.21	1	3820.0%	1	R.GFAFVTLESPADAKDAAR.D
UQ9NR9998.9%15176.5%28283122938.3(Q9NR99) Adlican 
*	TK120303_NMyc_cyto3_step11.1029.1029.3	1.5685	0.1071	2423.35	8	2380.0%	1	R.METEYGPSVTSIPVIVIAYPPR.I
*	TK120303_NMyc_cyto3_step10.4053.4053.2	1.4243	0.0369	2391.04	62	1900.0%	1	R.VHASHQLTRVPAKPILPTATVR.L
*	TK120303_NMyc_cyto3_step04.2650.2650.2	1.6532	0.0037	2271.74	30	2250.0%	1	R.CVAVNQQGADHFTVGITVTKK.G
*	TK120303_NMyc_cyto3_step08.1726.1726.1	1.3462	0.3469	1104.44	6	5000.0%	1	K.EPETNVAEGR.R
*	TK120303_NMyc_cyto3_step03.3864.3864.2	1.0914	0.0401	2502.91	9	2050.0%	1	K.GMKEMSQTLQGGNMLEGDPTHSR.S
*	TK120303_NMyc_cyto3_step10.1697.1697.2	0.9341	0.0163	1940.31	21	2500.0%	1	K.SMEPSDSGLYQCIAQVR.D
*	TK120303_NMyc_cyto3_step01.2402.2402.1	1.2664	0.0835	1298.78	17	4090.0%	1	K.INGNPNPITTVR.E
*	TK120303_NMyc_cyto3_step01.2551.2551.1	0.868	0.0704	1079.82	36	5000.0%	1	K.TKDDAINGDK.K
*	TK120303_NMyc_cyto3_step01.1584.1584.1	1.3614	0.0177	848.64	19	5000.0%	1	K.DDAINGDK.K
*	TK120303_NMyc_cyto3_step05.4192.4192.2	0.7171	0.0599	905.54	26	2860.0%	1	K.VIPGSYNR.I
*	TK120303_NMyc_cyto3_step07.1739.1739.1	2.0495	0.3523	1445.46	1	4550.0%	2	R.RVWQTVSPVESR.I
*	TK120303_NMyc_cyto3_step09.2031.2031.1	0.9955	0.0237	1289.46	9	4000.0%	1	R.VWQTVSPVESR.I
*	TK120303_NMyc_cyto3_step03.4463.4463.2	0.9415	0.021	2901.9	9	1540.0%	1	K.ASESPSIFWVLPDGSILKAPMDDPDSK.F
UPRSX_HUMAN98.8%445.1%389441737.5(Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) 
	TK120303_NMyc_cyto3_step02.2036.2036.1	1.6189	0.1959	1306.75	4	4500.0%	1	K.IHIDLPNEQAR.L
	TK120303_NMyc_cyto3_step08.2183.2183.2	2.7412	0.463	1434.54	1	6820.0%	1	R.KIHIDLPNEQAR.L
	TK120303_NMyc_cyto3_step06.1439.1439.1	1.768	0.3449	838.71	1	7140.0%	1	K.IHAGPITK.H
UQ9DCL898.8%4630.6%206231194.8(Q9DCL8) 0610025N14Rik protein 
	TK120303_NMyc_cyto3_step02.1200.1200.1	1.5803	0.1568	1100.62	4	4500.0%	1	K.KLAAAEGSEPK.Y
*	TK120303_NMyc_cyto3_step08.3316.3316.3	1.8147	0.0936	4598.32	24	1040.0%	2	K.DLHDDDEDEEMAETADGDSMNVEESSQGSTTSDHLQHKSQSS.-
	TK120303_NMyc_cyto3_step03.1888.1888.1	2.324	0.3446	1200.54	1	7220.0%	1	K.LHYNEGLNIK.L
UQ9Y37298.7%116.2%325350809.7(Q9Y372) CGI-62 protein 
	TK120303_NMyc_cyto3_step12.1362.1362.2	2.492	0.4718	2172.24	2	2630.0%	1	R.AEGTDIPTVKPLKPRPEPPK.K
UCDNC_MOUSE98.7%117.5%348373324.3(P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2) 
	TK120303_NMyc_cyto3_step02.2503.2503.2	3.0143	0.4372	2583.61	1	3600.0%	1	K.DQPLSGIPGRPAPGTAAANANDFFAK.R
UQ8VD3698.7%8265.1%546620965.9(Q8VD36) Similar to hypothetical protein FLJ12168 
	TK120303_NMyc_cyto3_step10.3405.3405.3	2.6383	0.0219	3066.16	6	1940.0%	4	R.RSKPGLSWAYLVLVTQAGGSLPALHFHR.G
	TK120303_NMyc_cyto3_step05.3363.3363.3	3.3875	0.2379	2909.26	4	2210.0%	1	R.SKPGLSWAYLVLVTQAGGSLPALHFHR.G
UQ9H85398.7%485.0%241275468.4(Q9H853) Hypothetical protein FLJ13940 
*	TK120303_NMyc_cyto3_step03.4260.4260.1	1.5936	0.0617	1411.92	1	5000.0%	2	R.QIFHPEQLITGK.E
UQ8VHX898.6%1124.3%115126634.5(Q8VHX8) Filamin A (Fragment) 
*	TK120303_NMyc_cyto3_step04.3015.3015.2	2.7449	0.4554	2964.36	1	2960.0%	1	R.FGGEHVPNSPFQVTALAGDQPTVQTPLR.S
USG2N_MOUSE98.6%335.4%796871505.3(Q9ERG2) Cell-cycle autoantigen SG2NA (S/G2 antigen) 
	TK120303_NMyc_cyto3_step08.2268.2268.2	2.4943	0.3366	1872.83	1	4060.0%	1	R.VVSHPTLPVTITAHEDR.H
	TK120303_NMyc_cyto3_step04.3062.3062.2	2.9861	0.4304	2273.98	1	4000.0%	1	R.ALAFHPVEPVLVTASEDHTLK.L
	TK120303_NMyc_cyto3_step03.1239.1239.1	1.2114	0.0996	638.44	18	6250.0%	1	K.DAFRK.T
ULEG3_MOUSE98.6%229.9%263273848.4(P16110) Galectin-3 (Galactose-specific lectin 3) (MAC-2 antigen) (IgE-binding protein) (35 kDa lectin) (Carbohydrate binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-34 galactoside-binding lectin) 
	TK120303_NMyc_cyto3_step01.1726.1726.1	1.2959	0.0484	1427.67	96	3180.0%	1	R.RGNDVAFHFNPR.F
	TK120303_NMyc_cyto3_step05.1960.1960.2	2.5324	0.4609	1651.47	1	4230.0%	1	K.VAVNDAHLLQYNHR.M
UKCRB_HUMAN98.6%112.9%381426445.6(P12277) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) 
*	TK120303_NMyc_cyto3_step03.1212.1212.1	2.1518	0.3365	1254.62	2	6500.0%	1	R.HGGYKPSDEHK.T
UMCM3_MOUSE98.6%575.8%812915465.6(P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) 
	TK120303_NMyc_cyto3_step07.1929.1929.1	1.9699	0.313	1423.64	1	4170.0%	2	R.SLAPSIHGHDYVK.K
*	TK120303_NMyc_cyto3_step08.3579.3579.2	1.8033	0.2555	2924.03	1	2600.0%	1	K.AALLEVFQEAHEQSVGMLHLTESINR.N
*	TK120303_NMyc_cyto3_step09.1985.1985.3	1.3836	0.0852	3192.99	6	1850.0%	1	K.AALLEVFQEAHEQSVGMLHLTESINRNR.E
	TK120303_NMyc_cyto3_step04.1463.1463.1	0.8336	0.026	730.44	13	5000.0%	1	K.YIHVAK.I
UQ91X9498.6%468.2%257292839.3(Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) 
	TK120303_NMyc_cyto3_step11.1223.1223.1	1.2682	0.066	1395.42	14	3640.0%	1	K.ESESVDKVMDQK.E
	TK120303_NMyc_cyto3_step10.1185.1185.1	1.7979	0.193	1045.85	1	6250.0%	1	K.KYHNVGLSK.C
	TK120303_NMyc_cyto3_step04.1434.1434.1	1.9975	0.3308	919.41	1	7860.0%	2	K.YHNVGLSK.C
UQ6081798.6%228.8%215233844.6(Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) 
	TK120303_NMyc_cyto3_step01.1082.1082.1	0.9617	0.0066	588.58	38	6250.0%	1	K.AKQSR.S
	TK120303_NMyc_cyto3_step01.2118.2118.1	1.818	0.3379	1484.75	1	3850.0%	1	K.SPASDTYIVFGEAK.I
UTCPQ_MOUSE98.6%578.9%548595565.6(P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta) 
	TK120303_NMyc_cyto3_step04.3734.3734.1	1.4602	0.0687	1348.74	10	4500.0%	1	K.YNIMLVRLNSK.W
	TK120303_NMyc_cyto3_step03.2320.2320.1	1.9643	0.2035	1567.68	7	3080.0%	1	K.HEKEDGAISTIVLR.G
	TK120303_NMyc_cyto3_step01.1779.1779.1	1.6835	0.3007	1354.72	1	5380.0%	1	R.LVPGGGATEIELAK.Q
*	TK120303_NMyc_cyto3_step02.1349.1349.1	2.2137	0.3185	1176.71	2	5560.0%	2	K.LYSVHQEGNK.N
URADI_MOUSE98.6%7913.0%583684526.1(P26043) Radixin 
*	TK120303_NMyc_cyto3_step09.1163.1163.1	1.1044	0.0148	753.71	2	7000.0%	1	R.EVLHQK.Q
	TK120303_NMyc_cyto3_step07.1717.1717.2	1.6683	0.173	1414.3	9	4550.0%	1	K.EIHKPGYLANDR.L
	TK120303_NMyc_cyto3_step06.1808.1808.2	0.9394	0.0424	2360.9	33	1500.0%	1	K.GTELWLGVDALGLNIYEHDDK.L
	TK120303_NMyc_cyto3_step02.2035.2035.1	1.2991	0.0086	1496.67	5	3750.0%	2	K.KTQNDVLHAENVK.A
	TK120303_NMyc_cyto3_step05.1427.1427.1	1.9647	0.3433	1249.56	1	6250.0%	1	R.IQNWHEEHR.G
	TK120303_NMyc_cyto3_step09.1967.1967.2	0.9091	0.0149	1663.08	56	2500.0%	1	K.NQEQLAAELAEFTAK.I
UKAC_MOUSE98.6%2410.4%106117785.4(P01837) Ig kappa chain C region 
	TK120303_NMyc_cyto3_step04.1246.1246.1	2.0018	0.194	1349.52	1	6000.0%	2	R.HNSYTCEATHK.T
U143G_HUMAN98.6%6148.1%246281714.9(P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) 
	TK120303_NMyc_cyto3_step09.1476.1476.1	1.9547	0.3501	1247.55	1	6670.0%	3	K.EHMQPTHPIR.L
	TK120303_NMyc_cyto3_step01.1524.1524.1	1.5349	0.1632	1080.53	4	5000.0%	1	R.YLAEVATGEK.R
UTRAL_MOUSE98.6%101820.0%706802096.7(Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) 
	TK120303_NMyc_cyto3_step05.1761.1761.1	1.0428	0.1094	536.33	25	6250.0%	3	R.AMVGR.L
*	TK120303_NMyc_cyto3_step11.3269.3269.2	1.6137	0.0311	3143.34	2	2080.0%	1	R.INTLQAIWMMDPKDISEFQHEEFYR.Y
*	TK120303_NMyc_cyto3_step04.2875.2875.2	1.566	0.1036	2382.12	40	1740.0%	1	R.GPTQSLASGISAGQLYSTQAAEDK.E
*	TK120303_NMyc_cyto3_step01.3679.3679.3	2.149	0.0047	3986.2	14	1280.0%	1	K.VEVYSRSAAPESPGYQWLSDGSGVFEIAEASGVRPGTK.I
*	TK120303_NMyc_cyto3_step05.2932.2932.2	1.6412	0.0942	2317.77	1	3250.0%	1	K.VTFRLDTHPAMVTVLEMGAAR.H
*	TK120303_NMyc_cyto3_step05.1455.1455.2	1.3754	0.0717	1688.05	24	3460.0%	1	R.FTLHYKTDAPLNIR.S
	TK120303_NMyc_cyto3_step01.2192.2192.1	2.0225	0.3454	1515.73	1	3850.0%	2	R.GVVDSEDIPLNLSR.E
UGC1_MOUSE98.6%51123.5%324357057.4(P01868) Ig gamma-1 chain C region 
	TK120303_NMyc_cyto3_step05.3357.3357.2	2.0096	0.2686	2847.45	1	3040.0%	3	K.DDPEVQFSWFVDDVEVHTAQTQPR.E
	TK120303_NMyc_cyto3_step01.4383.4383.2	1.6531	0.2048	2550.13	11	2140.0%	1	K.NTQPIMNTNGSYFVYSKLNVQK.S
	TK120303_NMyc_cyto3_step12.3872.3872.2	1.4482	0.1056	3059.85	10	1550.0%	1	-.AKTTPPSVYPLAPGSAAQTNSMVTLGCLVK.G
UQ8R3V998.6%41012.8%469519767.9(Q8R3V9) Hypothetical 52.0 kDa protein 
*	TK120303_NMyc_cyto3_step05.3357.3357.2	2.0096	0.2686	2847.45	1	3040.0%	3	K.DDPEVQFSWFVDDVEVHTAQTKPR.E
*	TK120303_NMyc_cyto3_step11.2701.2701.3	1.7979	0.0581	3956.76	44	1290.0%	1	K.LWLNWIFLVTLLNGIQCEVNLVESGGGLVQPGGSLR.L
UDJA1_MOUSE98.5%227.3%397448687.1(P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) 
	TK120303_NMyc_cyto3_step02.3372.3372.2	3.0925	0.3614	2723.88	1	3750.0%	1	K.ITFHGEGDQEPGLEPGDIIIVLDQK.D
	TK120303_NMyc_cyto3_step01.0916.0916.1	1.0428	0.0353	515.31	2	8330.0%	1	R.KIVR.E
URPGR_HUMAN98.5%224.3%815902455.0(Q92834) X-linked retinitis pigmentosa GTPase regulator 
*	TK120303_NMyc_cyto3_step01.3108.3108.2	1.0684	0.0453	2554.86	117	1590.0%	1	K.LGLPNQLLGNHRTPQLVSEIPEK.V
*	TK120303_NMyc_cyto3_step08.1762.1762.1	1.5613	0.3907	1311.66	2	4550.0%	1	R.TNDDSSAETIEK.K
UQ921X898.5%3314.7%483558416.6(Q921X8) Unknown (Protein for MGC:11985) 
	TK120303_NMyc_cyto3_step02.4297.4297.2	1.5539	0.1007	1970.69	1	3670.0%	1	K.YDDEDISEDIKFLLEK.L
*	TK120303_NMyc_cyto3_step08.2742.2742.3	2.2398	0.0116	3363.95	1	1850.0%	1	R.GSGVAVETGTISSSDSSQYVQCVAGCLQLMLR.V
	TK120303_NMyc_cyto3_step01.3499.3499.2	2.8839	0.4378	2496.6	1	3640.0%	1	K.LLEVSDDPQVLAVAAHDVGEYVR.H
UADHX_MOUSE98.5%2213.9%373395027.5(P28474) Alcohol dehydrogenase class III (EC 1.1.1.1) (Alcohol dehydrogenase 2) (Glutathione-dependent formaldehyde dehydrogenase) (EC 1.2.1.1) (FDH) (FALDH) (Alcohol dehydrogenase-B2) (ADH-B2) 
*	TK120303_NMyc_cyto3_step11.2161.2161.2	1.0178	0.0777	2626.35	5	1740.0%	1	K.SVFHFMGTSTFSEYTVVADISVAK.I
*	TK120303_NMyc_cyto3_step01.3716.3716.2	2.2639	0.4716	3156.39	1	2410.0%	1	K.VDEFVTGNLSFDQINQAFDLMHSGDSIR.T
UHBB0_MOUSE98.5%4430.1%146162818.6(P04443) Hemoglobin beta-H0 chain 
	TK120303_NMyc_cyto3_step02.1699.1699.1	1.6379	0.2532	1098.78	1	5620.0%	1	K.LHVDPENFK.L
*	TK120303_NMyc_cyto3_step04.3026.3026.2	2.592	0.4458	1496.27	1	5770.0%	1	K.LVVGVATALSHKYH.-
	TK120303_NMyc_cyto3_step02.2029.2029.1	1.7541	0.1856	1587.51	4	3750.0%	1	K.ETFAHLSELHCDK.L
	TK120303_NMyc_cyto3_step02.1435.1435.1	1.8117	0.1092	960.74	1	7860.0%	1	-.VHFTAEEK.A
UDYJ2_HUMAN98.4%115.5%492540996.4(O43237) Dynein light intermediate chain 2, cytosolic (LIC53/55) (LIC-2) 
	TK120303_NMyc_cyto3_step08.3131.3131.2	2.5748	0.4504	3142.8	1	2690.0%	1	K.IAILHENFTTVKPEDAYEDFIVKPPVR.K
UQ9DCZ798.3%3315.9%339376354.8(Q9DCZ7) WD40 protein Ciao1 
	TK120303_NMyc_cyto3_step06.2652.2652.2	2.407	0.4577	2382.28	2	2500.0%	1	K.HVVWHPSQELLASASYDDTVK.L
	TK120303_NMyc_cyto3_step10.2352.2352.2	1.1947	0.1427	2752.46	20	1670.0%	1	K.EPGLLASCSDDGEVAFWEYHQPAGL.-
*	TK120303_NMyc_cyto3_step07.3064.3064.1	1.1582	0.063	951.65	1	6430.0%	1	R.LASCNDDR.T
UATC4_HUMAN98.3%102413.1%9631050376.0(O75185) Probable calcium-transporting ATPase KIAA0703 (EC 3.6.3.8) 
*	TK120303_NMyc_cyto3_step04.3523.3523.2	2.1592	0.0819	2724.29	1	2920.0%	1	R.LGKQLTLFSFGIIGLIMLIGWSQGK.Q
*	TK120303_NMyc_cyto3_step06.0593.0593.2	0.9412	0.054	2377.66	12	1900.0%	1	R.NIGLCNGKLQAMSGEEVDSVEK.G
*	TK120303_NMyc_cyto3_step10.3724.3724.2	1.4596	0.0359	3094.46	39	1540.0%	2	K.GALEEVIRYCTMYNNGGIPLPLTPQQR.S
*	TK120303_NMyc_cyto3_step02.2663.2663.3	1.8656	0.0241	3317.39	2	1810.0%	1	K.EAANMILVDDDFSAIMNAVEEGKGIFYNIK.N
*	TK120303_NMyc_cyto3_step05.3367.3367.2	1.8433	0.0015	2426.44	1	2860.0%	4	K.QLTLFSFGIIGLIMLIGWSQGK.Q
*	TK120303_NMyc_cyto3_step04.4393.4393.2	1.2932	0.0919	2387.21	130	1430.0%	1	K.LQHLLARELVPGDVVSLSIGDR.I
USTN1_MOUSE98.3%4620.9%148171436.0(P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) 
	TK120303_NMyc_cyto3_step06.3097.3097.1	1.0524	5.0E-4	961.37	62	4380.0%	1	K.DPADETEAD.-
	TK120303_NMyc_cyto3_step01.1175.1175.1	1.594	0.3379	1166.25	1	5000.0%	2	K.AIEENNNFSK.M
*	TK120303_NMyc_cyto3_step01.2119.2119.1	1.6389	0.2257	1314.72	1	5000.0%	1	K.ESVPDFPLSPPK.K
USTN2_MOUSE98.3%245.6%179208288.3(P55821) Stathmin 2 (SCG10 protein) (Superior cervical ganglion-10 protein) 
	TK120303_NMyc_cyto3_step01.1175.1175.1	1.594	0.3379	1166.25	1	5000.0%	2	K.ALEENNNFSK.M
UQ9WTM598.2%229.5%463511135.6(Q9WTM5) DNA helicase 
	TK120303_NMyc_cyto3_step07.2683.2683.2	0.9677	0.0119	2941.18	178	1350.0%	1	R.IKEETEIIEGEVVEIQIDRPATGTGSK.V
	TK120303_NMyc_cyto3_step04.2595.2595.2	2.4898	0.4491	1948.65	1	4060.0%	1	K.EVVHTVSLHEIDVINSR.T
UCDK4_MOUSE98.2%5728.4%303337516.6(P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) 
	TK120303_NMyc_cyto3_step07.2253.2253.2	3.0204	0.3773	1466.73	1	6820.0%	1	R.RLEAFEHPNVVR.L
	TK120303_NMyc_cyto3_step08.2488.2488.3	1.442	0.1188	3494.6	2	1500.0%	2	R.GPRPVQSVVPEMEESGAQLLLEMLTFNPHKR.I
	TK120303_NMyc_cyto3_step11.3202.3202.3	2.3512	0.0022	3050.03	32	1700.0%	1	K.LADFGLARIYSYQMALTPVVVTLWYR.A
*	TK120303_NMyc_cyto3_step08.2014.2014.2	1.5459	0.078	1511.75	7	3120.0%	1	R.VPNGGAAGGGLPVSTVR.E
UCLI1_MOUSE98.2%61215.8%241270135.2(Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) 
	TK120303_NMyc_cyto3_step08.1347.1347.1	0.6053	0.0027	470.53	30	5000.0%	1	R.GVHR.Y
	TK120303_NMyc_cyto3_step05.1988.1988.1	2.1788	0.3273	1097.5	1	7500.0%	3	K.LHIVQVVCK.K
	TK120303_NMyc_cyto3_step03.0648.0648.3	1.215	0.1082	3012.72	1	1300.0%	1	K.FLDGNELTLADCNLLPKLHIVQVVCK.K
	TK120303_NMyc_cyto3_step04.0514.0514.1	0.8445	0.0728	1407.6	32	2270.0%	1	R.GVHRYLSNAYAR.E
UQ9D6E698.2%2216.3%172198614.8(Q9D6E6) 2900073G15Rik protein 
	TK120303_NMyc_cyto3_step04.2310.2310.1	1.97	0.3259	1389.4	1	5500.0%	1	K.KGNFNYIEFTR.I
	TK120303_NMyc_cyto3_step10.1035.1035.3	1.1784	0.0242	2073.12	47	2340.0%	1	R.FTDEEVDELYREAPIDK.K
UO0881798.2%337.8%653704088.8(O08817) CW17 protein 
	TK120303_NMyc_cyto3_step11.2750.2750.2	1.8141	0.2872	2924.09	1	2000.0%	1	R.HTLITEMVALNPDFKPPADYKPPATR.V
	TK120303_NMyc_cyto3_step02.1256.1256.1	1.9752	0.3256	1473.66	1	4580.0%	1	K.FQRPGDPQSAQDK.A
	TK120303_NMyc_cyto3_step03.0479.0479.1	0.976	0.073	1231.44	4	3640.0%	1	K.CGGAGHIASDCK.F
ULDHA_MOUSE98.2%81022.4%331363677.7(P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) 
*	TK120303_NMyc_cyto3_step12.1526.1526.1	1.4733	0.1388	1183.65	2	6670.0%	1	R.RVHPISTMIK.G
	TK120303_NMyc_cyto3_step01.1719.1719.1	1.3382	0.0124	734.54	1	8000.0%	1	R.NVNIFK.F
*	TK120303_NMyc_cyto3_step05.1919.1919.1	1.667	0.3252	1027.53	3	5000.0%	2	R.VHPISTMIK.G
*	TK120303_NMyc_cyto3_step06.3096.3096.3	1.9087	0.1229	4031.52	19	1320.0%	1	K.GLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEAR.L
*	TK120303_NMyc_cyto3_step09.1697.1697.3	1.2936	0.0941	3912.63	6	1290.0%	1	R.VHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVK.V
*	TK120303_NMyc_cyto3_step01.2786.2786.1	1.9804	0.131	1057.91	5	6250.0%	1	K.DQLIVNLLK.E
	TK120303_NMyc_cyto3_step07.1540.1540.2	1.0884	0.019	1249.68	12	4090.0%	1	R.VIGSGCNLDSAR.F
UTHIO_MOUSE98.2%102864.4%104115444.9(P10639) Thioredoxin (ATL-derived factor) (ADF) 
*	TK120303_NMyc_cyto3_step01.2364.2364.1	1.3316	0.1015	1223.62	1	6250.0%	1	K.CMPTFQFYK.K
*	TK120303_NMyc_cyto3_step01.1930.1930.1	1.6606	0.1986	1322.71	1	4580.0%	1	K.EAFQEALAAAGDK.L
*	TK120303_NMyc_cyto3_step12.4204.4204.3	1.8901	1.0E-4	4293.4	4	1430.0%	1	K.MIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCEVK.C
	TK120303_NMyc_cyto3_step01.1219.1219.1	1.564	0.1989	909.51	1	6250.0%	3	K.VGEFSGANK.E
*	TK120303_NMyc_cyto3_step04.3883.3883.2	2.0574	0.1548	2790.49	1	2830.0%	4	K.YSNVVFLEVDVDDCQDVAADCEVK.C
UQ8R2L798.1%2224.3%173187305.1(Q8R2L7) Similar to hypothetical protein MGC5395 
*	TK120303_NMyc_cyto3_step06.1756.1756.3	1.9432	0.0287	2345.85	74	2020.0%	1	R.DDGVFVQEVMQNSPAARTGVVK.E
	TK120303_NMyc_cyto3_step03.2991.2991.2	2.4594	0.4534	2177.56	1	3420.0%	1	R.ELLLPNWQGSGSHGLTIAQR.D
URGSA_MOUSE98.1%4439.2%181211516.8(Q9CQE5) Regulator of G-protein signaling 10 (RGS10) 
*	TK120303_NMyc_cyto3_step12.2215.2215.2	1.2956	0.028	1931.48	13	2810.0%	1	K.RTEEEEEEPPDAQTAAK.R
*	TK120303_NMyc_cyto3_step10.3530.3530.2	1.2616	0.1013	1953.36	242	2000.0%	1	R.LTEKILEEPHPLMFQK.L
	TK120303_NMyc_cyto3_step07.3616.3616.2	1.7184	0.2492	2166.37	150	1880.0%	1	K.EFSEENVLFWLACEDFK.K
*	TK120303_NMyc_cyto3_step07.1448.1448.2	2.4417	0.4488	2165.71	1	3750.0%	1	K.RPPSDIHDGDGSSSSGHQSLK.S
UO3529598.1%249.6%324339015.4(O35295) Vascular actin single-stranded DNA-binding factor 2 p44 component 
*	TK120303_NMyc_cyto3_step02.3215.3215.2	2.4821	0.4143	2857.55	1	2500.0%	2	R.GGGGFGGGPGPGGLQSGQTIALPAQGLIEFR.D
UQ91YL698.1%116.7%300340484.8(Q91YL6) Hypothetical 34.0 kDa protein 
*	TK120303_NMyc_cyto3_step07.2240.2240.2	2.615	0.4396	2261.85	1	2890.0%	1	R.LAAAEQYHQILCPGPSHDPR.H
UPHS_HUMAN98.1%1112.6%103118686.8(P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) 
	TK120303_NMyc_cyto3_step05.2539.2539.2	3.0034	0.3727	1699.5	1	7080.0%	1	K.LDHHPEWFNVYNK.V
UPCK7_MOUSE98.0%4107.8%770844156.2(Q61139) Proprotein convertase subtilisin/kexin type 7 precursor (EC 3.4.21.-) (Proprotein convertase PC7) (Subtilisin/kexin-like protease PC7) (Prohormone convertase PC7) (Subtilisin-like proprotein convertase 7) (SPC7) 
	TK120303_NMyc_cyto3_step11.0105.0105.3	1.7941	0.0133	4558.23	22	1070.0%	3	R.QGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGR.M
*	TK120303_NMyc_cyto3_step04.3048.3048.2	1.0112	0.0038	1949.88	365	2190.0%	1	K.AVPRSPHSLEVLWNVSR.T
UQ9CXZ298.0%4813.5%163174037.1(Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence 
	TK120303_NMyc_cyto3_step01.1790.1790.1	1.8054	0.2822	890.52	1	6250.0%	2	K.AAVSGLWGK.V
	TK120303_NMyc_cyto3_step01.1478.1478.1	2.2717	0.3236	1289.65	1	4580.0%	2	K.VNADEVGGEALGR.L
UGTM5_MOUSE98.0%1110.3%224266357.2(P48774) Glutathione S-transferase Mu 5 (EC 2.5.1.18) (GST class-mu 5) (Fibrous sheath component 2) (Fsc2) 
*	TK120303_NMyc_cyto3_step06.2628.2628.2	2.9487	0.4107	2801.21	1	3640.0%	1	R.LCYNSNHENLKPQYLEQLPAQLK.Q
UQ9D6D498.0%1118.5%184209376.5(Q9D6D4) 2900092C05Rik protein 
*	TK120303_NMyc_cyto3_step12.3794.3794.3	3.221	0.3212	3789.31	3	1520.0%	1	R.RPGLVHVISVSSIAFVIALLCGLMLSYVIYRLVK.V
UQ99JY998.0%117.2%418473575.9(Q99JY9) Hypothetical 47.4 kDa protein 
	TK120303_NMyc_cyto3_step01.3243.3243.2	3.1169	0.2655	3062.14	1	2760.0%	1	R.TLTGTVIDSGDGVTHVIPVAEGYVIGSCIK.H
UQ8VCM798.0%226.2%436493915.9(Q8VCM7) Similar to fibrinogen, gamma polypeptide 
	TK120303_NMyc_cyto3_step01.4222.4222.2	1.5003	0.0051	3045.79	5	1730.0%	1	K.ELIKAIQVYYNPDQPPKPGMIDSATQK.S
	TK120303_NMyc_cyto3_step02.2133.2133.2	2.9468	0.4023	2562.62	1	3860.0%	1	K.AIQVYYNPDQPPKPGMIDSATQK.S
UHBB_HUMAN98.0%5119.6%146158677.3(P02023) Hemoglobin beta chain 
	TK120303_NMyc_cyto3_step04.2454.2454.1	1.1937	0.0111	1451.69	15	3460.0%	1	K.VVAGVANALAHKYH.-
	TK120303_NMyc_cyto3_step01.3094.3094.1	2.5554	0.151	1151.99	2	5000.0%	3	K.VVAGVANALAHK.Y
UIMD1_MOUSE97.9%224.5%514552946.8(P50096) Inosine-5'-monophosphate dehydrogenase 1 (EC 1.1.1.205) (IMP dehydrogenase 1) (IMPDH-I) (IMPD 1) 
*	TK120303_NMyc_cyto3_step03.2928.2928.2	3.0829	0.1553	1893.69	1	5000.0%	1	R.FGVPVIADGGIQTVGHVVK.A
	TK120303_NMyc_cyto3_step01.0188.0188.1	0.9695	0.1646	474.39	1	8330.0%	1	K.ITLK.T
UNDKA_MOUSE97.9%61027.0%152172087.4(P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) 
	TK120303_NMyc_cyto3_step02.2064.2064.1	1.6687	0.3221	1346.74	1	5000.0%	2	R.TFIAIKPDGVQR.G
	TK120303_NMyc_cyto3_step02.1433.1433.1	2.395	0.3118	1071.53	1	7780.0%	2	R.NIIHGSDSVK.S
*	TK120303_NMyc_cyto3_step12.2472.2472.2	1.3427	0.1106	2329.08	186	1670.0%	1	K.SAEKEISLWFQPEELVEYK.S
UDEST_MOUSE97.9%4620.6%165185228.0(Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) 
*	TK120303_NMyc_cyto3_step04.3739.3739.2	1.8436	0.379	2078.03	1	4060.0%	1	R.KEELMFFLWAPEQAPLK.S
	TK120303_NMyc_cyto3_step03.2188.2188.1	2.4114	0.2736	1059.5	1	6880.0%	2	K.HFVGMLPEK.D
	TK120303_NMyc_cyto3_step06.1795.1795.1	1.4002	0.0438	964.68	1	5710.0%	1	K.CSTPEEIK.K
UMLEN_MOUSE97.9%3315.6%141157314.9(Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) 
	TK120303_NMyc_cyto3_step01.1546.1546.1	1.567	0.0261	1354.7	13	3750.0%	1	R.ALGQNPTNAEVLK.V
	TK120303_NMyc_cyto3_step03.1931.1931.1	2.3935	0.2992	997.65	1	7500.0%	1	R.HVLVTLGEK.M
UQ8TBK297.9%2210.6%473530215.2(Q8TBK2) Similar to hypothetical protein FLJ21148 
	TK120303_NMyc_cyto3_step04.2160.2160.2	1.3523	0.0648	2291.71	98	1750.0%	1	R.VAGPVDGGDLDPVACFLSWCR.R
*	TK120303_NMyc_cyto3_step05.2827.2827.3	2.8947	0.4296	3248.43	1	1880.0%	1	K.DLANISSEYQSIVLPFMEAHPDLFSLGVR.S
UO0042997.8%444.6%736818916.8(O00429) Dynamin-like protein 
	TK120303_NMyc_cyto3_step09.1912.1912.2	1.3574	0.2775	1395.71	2	3750.0%	1	K.SKPIPIMPASPQK.G
	TK120303_NMyc_cyto3_step01.0583.0583.1	1.7041	0.0429	1493.48	22	3330.0%	1	K.DTLQSELVGQLYK.S
	TK120303_NMyc_cyto3_step07.2071.2071.1	1.1988	0.0371	947.71	20	5000.0%	1	K.KYPSLANR.N
UQ9H1T697.8%228.4%535572237.9(Q9H1T6) BA261P9.2 (Putative novel protein similar to fly CG7340 and human putative aminopeptidase ZK353.6 in chromosome 3 (EC 3.4.11.-)) (Fragment) 
*	TK120303_NMyc_cyto3_step04.3910.3910.3	1.6779	0.0964	3768.31	9	1410.0%	1	K.CGDLVHPLVYCPELHFSEFTSAVADMKNSVADR.D
	TK120303_NMyc_cyto3_step11.1390.1390.1	1.8495	0.3238	1337.59	1	5000.0%	1	R.HNSPSAAHFITR.L
UPRO1_MOUSE97.8%6843.2%139148268.3(P10924) Profilin I 
	TK120303_NMyc_cyto3_step01.1760.1760.1	1.4948	0.1886	1215.61	2	4090.0%	2	K.DSPSVWAAVPGK.T
*	TK120303_NMyc_cyto3_step01.2550.2550.1	1.668	0.3237	1457.72	1	4230.0%	1	R.SSFFVNGLTLGGQK.C
*	TK120303_NMyc_cyto3_step07.2763.2763.2	1.2728	0.0145	2538.7	15	1670.0%	1	K.STGGAPTFNVTVTMTAKTLVLLMGK.E
	TK120303_NMyc_cyto3_step01.2475.2475.1	1.3724	0.2476	874.71	1	7140.0%	1	K.TLVLLMGK.E
	TK120303_NMyc_cyto3_step02.1588.1588.1	1.6015	0.1751	1166.62	1	6880.0%	1	K.CYEMASHLR.R
UQ9DAN197.8%141102.8%604694865.7(Q9DAN1) 1700007B13Rik protein 
*	TK120303_NMyc_cyto3_step06.3461.3461.1	1.5332	0.0187	1418.84	8	3640.0%	10	R.FHVILDSVLVFK.K
*	TK120303_NMyc_cyto3_step04.1019.1019.2	1.0839	0.072	1982.0	32	2500.0%	1	K.NSFGRFHVILDSVLVFK.K
UQ8R1K597.8%115.4%222216349.4(Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) 
	TK120303_NMyc_cyto3_step03.1380.1380.1	2.0163	0.3195	1472.59	1	4550.0%	1	K.YHTINGHNCEVK.K
UA1T3_MOUSE97.8%5255.3%413458545.5(Q00896) Alpha-1-antitrypsin 1-3 precursor (Serine protease inhibitor 1-3) (Alpha-1 protease inhibitor 3) 
	TK120303_NMyc_cyto3_step10.3914.3914.2	2.2346	0.3032	2652.3	1	2860.0%	5	R.FDHPFLFIIFEEHTQSPLFVGK.V
UA1T2_MOUSE97.8%82810.2%413459145.5(P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT) 
	TK120303_NMyc_cyto3_step01.0211.0211.1	1.4595	0.0019	658.35	1	8000.0%	1	K.IVEAVK.E
	TK120303_NMyc_cyto3_step03.1539.1539.1	2.2864	0.2511	1241.58	1	6110.0%	1	K.MQHLEQTLNK.E
	TK120303_NMyc_cyto3_step03.0955.0955.1	0.4913	0.0068	454.3	1	6670.0%	1	K.AVHK.A
	TK120303_NMyc_cyto3_step10.3914.3914.2	2.2346	0.3032	2652.3	1	2860.0%	5	R.FDHPFLFIIFEEHTQSPIFVGK.V
UUB5B_HUMAN97.6%3340.1%147167357.8(P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) (P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) 
	TK120303_NMyc_cyto3_step11.2959.2959.2	1.2503	0.0461	2777.16	31	1740.0%	1	K.VAFTTRIYHPNINSNGSICLDILR.S
	TK120303_NMyc_cyto3_step07.2873.2873.3	1.4125	0.0668	3904.61	6	1400.0%	1	R.SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIAR.I
	TK120303_NMyc_cyto3_step02.2871.2871.2	2.7974	0.4134	2100.56	1	5000.0%	1	R.IYHPNINSNGSICLDILR.S
UP9741297.5%18346.7%37884252896.6(P97412) Lysosomal trafficking regulator (CHS1 homolog) 
*	TK120303_NMyc_cyto3_step11.2167.2167.3	1.8327	0.1875	4254.9	1	1390.0%	1	R.EITFPKSNKPIISLTFSCDGHHLYTANSEGTVIAWCR.K
*	TK120303_NMyc_cyto3_step12.4371.4371.3	1.7674	0.1078	4601.16	10	1350.0%	2	K.CGMYFVEDNASDAVESSSLQGELEPASFSWTYEEIKEVHR.R
*	TK120303_NMyc_cyto3_step01.2884.2884.1	1.3271	0.0742	1583.77	70	2690.0%	1	K.NVHGEISIWVSGQR.K
*	TK120303_NMyc_cyto3_step09.4251.4251.3	2.0172	0.1633	4050.54	1	1640.0%	1	K.WSVIPVLGLIETSLYDNVLLHNALLLLLQVLNSCSK.V
*	TK120303_NMyc_cyto3_step08.1696.1696.3	1.3962	0.0779	2480.84	326	1840.0%	1	K.VDLSASRHWQECIQQLTHDR.A
*	TK120303_NMyc_cyto3_step01.2934.2934.1	1.2093	0.02	1252.91	5	4550.0%	1	R.DGVPSEAAEHLK.A
*	TK120303_NMyc_cyto3_step10.4114.4114.2	2.6527	0.4292	2583.5	1	2830.0%	4	R.IIQADILLVLVNHPSPAIQQGVIK.L
	TK120303_NMyc_cyto3_step05.1100.1100.1	0.8164	0.0285	629.62	23	5000.0%	1	R.KSTHR.Y
*	TK120303_NMyc_cyto3_step06.3496.3496.2	1.4099	0.0183	2025.27	25	2670.0%	1	R.TCSEDLTLLWRIFLEK.S
	TK120303_NMyc_cyto3_step05.0263.0263.1	1.1387	0.096	1451.5	9	3180.0%	1	K.TVNNNQQSLFQR.L
*	TK120303_NMyc_cyto3_step08.3183.3183.2	1.5384	0.0127	2034.86	8	2810.0%	2	K.GSWQKTVNNNQQSLFQR.L
*	TK120303_NMyc_cyto3_step02.4388.4388.3	2.1482	0.0513	3822.65	5	1480.0%	1	K.AVSLAQVESQENIFFPSKWQHLVLTYIQHPQGK.K
UQ91V4197.5%4428.4%215238976.2(Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) 
	TK120303_NMyc_cyto3_step11.3399.3399.3	1.6615	0.0638	3240.56	8	1640.0%	1	K.QFAEENGLLFLEASAKTGENVEDAFLEAAK.K
	TK120303_NMyc_cyto3_step12.1180.1180.2	1.2159	0.0022	1620.16	21	3570.0%	1	K.TGENVEDAFLEAAKK.I
	TK120303_NMyc_cyto3_step04.2184.2184.3	2.6622	0.2434	3151.72	1	2590.0%	1	K.IYQNIQDGSLDLNAAESGVQHKPSAPQGGR.L
UEPA3_HUMAN97.5%5510.5%9831100866.8(P29320) Ephrin type-A receptor 3 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor ETK1) (HEK) (HEK4) 
*	TK120303_NMyc_cyto3_step11.3175.3175.2	1.351	0.0404	2548.44	3	2380.0%	1	K.SKPVMIVTEYMENGSLDSFLRK.H
*	TK120303_NMyc_cyto3_step04.4433.4433.2	0.9652	0.0896	1674.56	1	4230.0%	1	K.IPIRWTSPEAIAYR.K
*	TK120303_NMyc_cyto3_step01.2996.2996.2	1.399	0.092	2705.38	16	1880.0%	1	K.IITSAAARPSNLLLDQSNVDISTFR.T
*	TK120303_NMyc_cyto3_step02.2469.2469.3	2.2121	0.2148	4301.81	3	1210.0%	1	R.KFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIK.A
*	TK120303_NMyc_cyto3_step04.2234.2234.3	3.0236	0.3521	3300.12	1	2330.0%	1	R.NPGSLKIITSAAARPSNLLLDQSNVDISTFR.T
UACBP_MOUSE97.4%1118.6%8698698.8(P31786) Acyl-CoA-binding protein (ACBP) (Diazepam binding inhibitor) (DBI) (Endozepine) (EP) 
*	TK120303_NMyc_cyto3_step02.3200.3200.2	2.7858	0.396	1986.08	1	4330.0%	1	K.TQPTDEEMLFIYSHFK.Q
UQ9WVQ597.4%3514.1%241269496.9(Q9WVQ5) MMRP19 (Monocyte macrophage 19) 
	TK120303_NMyc_cyto3_step09.1392.1392.1	2.264	0.3121	1079.54	2	4500.0%	2	R.GAGAVIHTHSK.A
*	TK120303_NMyc_cyto3_step11.2461.2461.2	1.5625	0.0886	2591.93	70	1820.0%	1	R.IQPEDMFVCDINEQDISGPPASK.K
UGTM2_MOUSE97.4%3316.1%217255857.4(P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5) 
*	TK120303_NMyc_cyto3_step02.3717.3717.2	3.0465	0.3568	1983.92	1	4670.0%	1	K.VTYVDFLVYDVLDQHR.I
	TK120303_NMyc_cyto3_step05.1452.1452.1	0.9534	0.0657	737.55	12	5830.0%	1	R.GLAHAIR.L
*	TK120303_NMyc_cyto3_step05.1987.1987.1	2.24	0.1256	1431.69	1	5450.0%	1	K.KKPEYLEGLPEK.M
UPSDB_HUMAN97.3%243.1%422474646.5(O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) 
*	TK120303_NMyc_cyto3_step02.2640.2640.1	2.1134	0.2032	1529.51	1	4580.0%	2	R.YQEALHLGSQLLR.E
UUBCI_HUMAN97.3%41024.1%158180078.7(P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) 
	TK120303_NMyc_cyto3_step11.2071.2071.2	1.5742	0.1839	3179.82	2	1920.0%	3	K.CKFEPPLFHPNVYPSGTVCLSILEEDK.D
	TK120303_NMyc_cyto3_step04.2676.2676.2	2.6829	0.4141	1220.11	1	7000.0%	1	K.KGTPWEGGLFK.L
UPYRG_MOUSE97.3%338.6%591667116.6(P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) 
	TK120303_NMyc_cyto3_step10.4076.4076.2	1.1905	0.0745	1890.94	42	2670.0%	1	R.VPLLLEEQGVVDYFLR.R
	TK120303_NMyc_cyto3_step06.1745.1745.1	2.1691	0.3147	1304.61	1	5450.0%	1	K.ALEHSALAINHK.L
	TK120303_NMyc_cyto3_step09.2671.2671.2	1.2322	0.1507	2808.23	4	2050.0%	1	K.ISMFCHVEPEQVICVHDVSSIYR.V
UCNBP_MOUSE97.2%2212.4%170187427.7(P53996) Cellular nucleic acid binding protein (CNBP) 
	TK120303_NMyc_cyto3_step02.1589.1589.1	2.0762	0.3116	1485.55	1	5450.0%	1	K.CYSCGEFGHIQK.D
	TK120303_NMyc_cyto3_step02.1101.1101.1	1.3413	0.2031	986.65	14	5000.0%	1	R.CGESGHLAR.E
UFAS_MOUSE97.2%7711.3%838912137.7(P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) 
	TK120303_NMyc_cyto3_step09.4198.4198.3	2.0606	0.0427	3050.3	25	1630.0%	1	R.ISSCMEVLDLFLNQPHAVLSSFVLAEK.K
	TK120303_NMyc_cyto3_step09.3609.3609.2	2.4989	0.337	2450.1	1	3750.0%	1	K.NVTFHGILLDALFEEANDSWR.E
	TK120303_NMyc_cyto3_step04.1876.1876.1	1.7158	0.3165	1262.55	1	5500.0%	1	K.VSVHIIEGDHR.T
*	TK120303_NMyc_cyto3_step04.0586.0586.1	0.6419	0.1915	1046.37	261	1500.0%	1	R.GSATLISAISK.T
	TK120303_NMyc_cyto3_step07.1161.1161.1	0.5993	0.0426	425.28	2	7500.0%	1	K.HIR.E
	TK120303_NMyc_cyto3_step07.2015.2015.2	1.5955	0.0691	1495.73	1	5000.0%	1	K.LQASVRCLAQHGR.F
	TK120303_NMyc_cyto3_step01.2778.2778.1	1.2626	0.0983	995.94	2	6250.0%	1	K.VLEALLPLK.S
UQ96MP797.2%91710.3%757840745.7(Q96MP7) Hypothetical protein FLJ32070 
*	TK120303_NMyc_cyto3_step04.1831.1831.1	1.1104	0.0047	1031.63	133	4380.0%	1	-.MDVAESPER.D
*	TK120303_NMyc_cyto3_step02.2891.2891.2	1.5532	0.0661	2722.83	2	2390.0%	1	R.FFMKDVVTPLSTLLPPISNSIPFR.G
	TK120303_NMyc_cyto3_step11.1073.1073.1	1.5267	0.3609	1301.89	3	4170.0%	3	K.KPAPPPAPPQATK.T
*	TK120303_NMyc_cyto3_step02.2772.2772.3	2.3372	0.234	2391.05	1	2500.0%	1	R.DPHSPEDEEQPQGLSDDDILR.D
	TK120303_NMyc_cyto3_step10.1906.1906.1	1.1491	0.0245	1194.66	12	4000.0%	1	R.SSRHSSFSGSR.S
USERC_MOUSE97.1%71114.9%370404738.0(Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) 
*	TK120303_NMyc_cyto3_step11.1609.1609.1	1.5297	0.0676	1242.98	1	5000.0%	2	K.KFGTVNIVHPK.L
*	TK120303_NMyc_cyto3_step03.3270.3270.2	1.3897	0.1447	2548.21	1	2250.0%	1	K.SQMIYEIIDNSQGFYVCPVER.Q
	TK120303_NMyc_cyto3_step07.2577.2577.1	2.3148	0.1587	1278.71	1	7000.0%	2	K.LPHSVLLEIQK.Q
*	TK120303_NMyc_cyto3_step11.1074.1074.1	0.7543	0.1	1242.48	1	3180.0%	1	R.IGNAKGDEALEK.R
*	TK120303_NMyc_cyto3_step04.2032.2032.1	1.5968	0.0188	1111.67	1	6110.0%	1	K.FGTVNIVHPK.L
UQ9JIX497.1%467.4%743831078.7(Q9JIX4) DNA binding protein DESRT 
*	TK120303_NMyc_cyto3_step03.4395.4395.2	1.5125	0.1029	2013.54	27	2220.0%	1	K.LIARARPVLGFVPGPPQPK.L
*	TK120303_NMyc_cyto3_step05.2303.2303.1	2.3022	0.2899	1392.15	1	5830.0%	2	K.QPLASPSTQMDSK.Q
*	TK120303_NMyc_cyto3_step07.3421.3421.2	1.2039	0.1392	2417.07	5	2270.0%	1	K.EAEEMGDKGLAPLLPSPPLPPEK.D
UCIA1_HUMAN97.1%1717513.6%339378405.0(O76071) WD-repeat containing protein Ciao 1 
*	TK120303_NMyc_cyto3_step05.1995.1995.3	2.0116	0.1479	2828.14	13	1880.0%	1	K.EPGLLASCSDDGEVAFWKYQRPEGL.-
*	TK120303_NMyc_cyto3_step06.3131.3131.2	2.534	0.2891	2412.15	1	4000.0%	13	R.CWFLAWNPAGTLLASCGGDRR.I
*	TK120303_NMyc_cyto3_step08.1552.1552.2	1.6293	0.2099	2251.43	6	2370.0%	1	R.CWFLAWNPAGTLLASCGGDR.R
UPSD3_MOUSE97.0%111.9%530606998.2(P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen) 
	TK120303_NMyc_cyto3_step05.1457.1457.1	1.5176	0.3808	1055.46	1	6670.0%	1	K.APQHTAVGFK.Q
UO8905597.0%3333.8%157181775.4(O89055) Nonmuscle myosin heavy chain-A (Fragment) 
	TK120303_NMyc_cyto3_step09.2621.2621.2	1.2032	0.1108	2248.21	29	2250.0%	1	K.VTKLQVELDSVTGLLSQSDSK.S
*	TK120303_NMyc_cyto3_step09.1200.1200.1	1.1926	0.0834	1292.64	12	4000.0%	1	K.VEAHLQELQVK.F
	TK120303_NMyc_cyto3_step01.3258.3258.2	3.0051	0.3471	2495.44	1	4000.0%	1	K.DFSALESQLQDTQELLQEENR.Q
UQ8VBV797.0%116.2%209232565.2(Q8VBV7) Hypothetical 23.3 kDa protein (Similar to COP9 homolog) (Expressed sequence AA408242) 
*	TK120303_NMyc_cyto3_step03.1759.1759.1	2.2464	0.2908	1358.78	2	4580.0%	1	R.KPASGTLDVSLNR.F
UQ91WC396.9%226.9%697780177.3(Q91WC3) Similar to fatty-acid-coenzyme A ligase, long-chain 6 
*	TK120303_NMyc_cyto3_step05.3185.3185.3	1.813	0.0088	4190.58	74	1010.0%	1	K.SMQAIEDCGRENHHAPVPPRPDDLSIVCFTSGTTGNPK.G
	TK120303_NMyc_cyto3_step06.1135.1135.1	1.5129	0.3573	1125.91	1	5000.0%	1	K.GPNVFKGYLK.D
ULCFA_HUMAN96.9%111.4%699783487.8(P41215) Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (Long-chain acyl-CoA synthetase 1) (LACS 1) (Palmitoyl-CoA ligase) 
	TK120303_NMyc_cyto3_step06.1135.1135.1	1.5129	0.3573	1125.91	1	5000.0%	1	K.GPNVFQGYLK.D
UQ8VED596.9%3511.3%547591807.4(Q8VED5) Similar to keratin 6A (Fragment) 
	TK120303_NMyc_cyto3_step01.3204.3204.1	2.201	0.2988	1331.86	1	5910.0%	2	R.NLDLDSIIAEVK.A
*	TK120303_NMyc_cyto3_step08.3494.3494.3	1.9385	0.028	4764.82	29	870.0%	1	K.LLESEESRMSGDCPSAISISVTGNSTSVCAGGTAGFGNGLSLGGAGGASK.G
UPLSI_HUMAN96.9%9657.6%629703535.5(Q14651) I-plastin (Intestine-specific plastin) 
*	TK120303_NMyc_cyto3_step11.3699.3699.3	1.9647	0.0926	3919.33	10	1360.0%	1	K.LNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESK.E
*	TK120303_NMyc_cyto3_step01.3702.3702.1	1.7988	0.2965	1547.8	3	3850.0%	8	R.EIVEKILSVADSNK.D
UP2G4_MOUSE96.9%7733.5%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) 
	TK120303_NMyc_cyto3_step09.3617.3617.3	1.8457	0.0914	4081.87	284	930.0%	1	R.LVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLK.Q
*	TK120303_NMyc_cyto3_step12.2695.2695.2	1.3256	0.1953	3193.56	1	1670.0%	1	K.IDLGVHVDGFIANVAHTFVIGVAQGTQVTGR.K
	TK120303_NMyc_cyto3_step03.3844.3844.2	2.1225	0.3317	2264.88	1	3750.0%	1	K.AEFEVHEVYAVDVLVSSGEGK.A
	TK120303_NMyc_cyto3_step07.2955.2955.2	1.787	0.1274	2350.1	52	2000.0%	1	K.GIAFPTSISVNNCVCHFSPLK.S
	TK120303_NMyc_cyto3_step03.1740.1740.1	1.9487	0.1697	1182.62	1	7000.0%	1	K.AAHLCAEAALR.L
	TK120303_NMyc_cyto3_step04.1834.1834.2	2.7238	0.4057	1927.42	1	5940.0%	1	R.LVKPGNQNTQVTEAWNK.V
	TK120303_NMyc_cyto3_step02.0472.0472.1	1.0026	0.0602	1367.13	11	2730.0%	1	R.ITSGPFEPDLYK.S
UZYX_MOUSE96.8%81017.0%564607906.9(Q62523) Zyxin 
	TK120303_NMyc_cyto3_step05.1444.1444.1	1.317	0.0517	676.47	3	7500.0%	1	K.NFHMK.C
*	TK120303_NMyc_cyto3_step11.1037.1037.2	1.8655	0.4038	1740.14	1	4290.0%	1	K.QHPQPPPAQNQNQVR.S
	TK120303_NMyc_cyto3_step01.0115.0115.3	1.2883	0.0278	3263.43	409	190.0%	1	K.CEDCGKPLSIEADDNGCFPLDGHVLCRK.C
	TK120303_NMyc_cyto3_step01.0316.0316.1	1.4681	0.2048	644.44	1	8000.0%	1	R.VVALDK.N
*	TK120303_NMyc_cyto3_step02.1341.1341.1	1.6482	0.2756	1165.7	1	5000.0%	2	R.GPLSQAPTPAPK.F
*	TK120303_NMyc_cyto3_step02.1640.1640.1	1.4526	0.1266	1025.85	1	4500.0%	1	R.SPGGPGPLTLK.E
*	TK120303_NMyc_cyto3_step03.1852.1852.2	3.0114	0.3354	1967.57	1	4440.0%	1	K.VNPFRPGDSEPPVAAGAQR.A
UGIPC_MOUSE96.8%3319.2%333361295.9(Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) 
*	TK120303_NMyc_cyto3_step12.3943.3943.3	1.4771	0.0506	4686.58	39	850.0%	1	R.SGLGVGEPGPLGGSAAGESQMGLPPPPAALRPRLVFHTQLAHGSPTGR.I
*	TK120303_NMyc_cyto3_step07.1383.1383.2	1.8628	0.4074	1436.61	1	4000.0%	1	R.SAGGHPGSGPQLGTGR.G
UPDA3_MOUSE96.8%144621.4%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) 
	TK120303_NMyc_cyto3_step08.3096.3096.2	1.8395	0.1164	2466.89	10	2380.0%	6	K.VDCTANTNTCNKYGVSGYPTLK.I
*	TK120303_NMyc_cyto3_step04.3078.3078.2	1.9765	0.1752	2282.35	1	2500.0%	1	K.KFIQDSIFGLCPHMTEDNK.D
	TK120303_NMyc_cyto3_step06.1640.1640.1	1.6636	0.0724	915.56	2	7140.0%	1	K.KFLDAGHK.L
*	TK120303_NMyc_cyto3_step01.2374.2374.1	1.9139	0.2655	1394.63	1	5450.0%	1	R.DLFSDGHSEFLK.A
	TK120303_NMyc_cyto3_step12.2622.2622.1	0.7841	0.0179	1474.76	100	1820.0%	1	K.FVMQEEFSRDGK.A
*	TK120303_NMyc_cyto3_step03.2308.2308.1	1.9106	0.3066	1261.83	1	6500.0%	2	R.FAHTNIESLVK.E
*	TK120303_NMyc_cyto3_step04.2434.2434.3	1.8049	0.1453	2729.87	112	1630.0%	1	R.VSDTGSAGLMLVEFFAPWCGHCKR.L
UQ9GZQ296.8%113.4%437488989.8(Q9GZQ2) DRC3 
*	TK120303_NMyc_cyto3_step02.1917.1917.1	1.8273	0.305	1520.91	4	3570.0%	1	-.MSPLSPGSPLPPLAR.A
UFSC1_HUMAN96.8%222.0%492543997.2(Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) 
	TK120303_NMyc_cyto3_step10.2282.2282.1	1.6493	0.0288	1241.79	1	6670.0%	1	K.LINRPIIVFR.G
UP2BA_MOUSE96.8%51112.1%521586445.9(P20652) Serine/threonine protein phosphatase 2B catalytic subunit, alpha isoform (EC 3.1.3.16) (Calmodulin-dependent calcineurin A subunit, alpha isoform) (CAM-PRP catalytic subunit) 
	TK120303_NMyc_cyto3_step10.2225.2225.2	1.2174	0.0269	2691.18	212	1350.0%	3	R.EESESVLTLKGLTPTGMLPSGVLSGGK.Q
	TK120303_NMyc_cyto3_step06.1456.1456.1	2.1356	0.302	1369.55	1	5000.0%	1	K.TQEHFTHNTVR.G
*	TK120303_NMyc_cyto3_step02.4209.4209.3	2.2047	0.076	4391.93	40	1210.0%	1	K.TQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILR.A
UCP2B_MOUSE96.7%91521.1%507562258.3(O35084) 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (EC 1.14.-.-) (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha) 
	TK120303_NMyc_cyto3_step11.0509.0509.1	0.589	0.0010	431.29	5	3330.0%	2	K.AVIK.E
*	TK120303_NMyc_cyto3_step10.4062.4062.3	1.5635	0.126	3690.29	238	1020.0%	2	R.LAELELQMALSQILTHFEVLPEPGALPIKPMTR.T
*	TK120303_NMyc_cyto3_step03.4046.4046.2	0.8746	0.0145	1443.91	96	2080.0%	1	R.YGPIWSGSFGTLR.T
*	TK120303_NMyc_cyto3_step09.2883.2883.3	2.9223	0.3895	3926.32	1	1570.0%	2	R.EKVSVQSIVGNVTELLLAGVDTVSNTLSWTLYELSR.H
*	TK120303_NMyc_cyto3_step06.4200.4200.3	1.9527	0.0856	3844.96	1	1590.0%	1	R.RLAELELQMALSQILTHFEVLPEPGALPIKPMTR.T
*	TK120303_NMyc_cyto3_step08.2043.2043.3	1.5992	0.0453	2180.6	17	2370.0%	1	R.SLSDIPGPSTLSFLAELFCK.G
UQ9Y2H996.7%467.5%15831722718.6(Q9Y2H9) Hypothetical protein KIAA0973 (Fragment) 
*	TK120303_NMyc_cyto3_step05.2477.2477.3	2.0639	0.235	3171.01	3	1960.0%	1	R.DPFPDVVHLEEQDSGGSNTPEQDDLSEGR.S
*	TK120303_NMyc_cyto3_step03.0744.0744.3	1.1664	0.0622	4757.01	120	760.0%	2	R.STPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHR.Q
*	TK120303_NMyc_cyto3_step02.0383.0383.3	1.7079	0.2135	4359.87	2	1070.0%	1	R.CKSAGNIPLSPLAHTPSPTQASPPPLPGHTVGSSHTTQSFPAK.L
UQ8VHA696.7%8345.8%467507006.0(Q8VHA6) SOCS box protein ASB-18 
*	TK120303_NMyc_cyto3_step04.3612.3612.2	2.3529	0.1136	2855.97	2	2880.0%	5	R.ELLEHGATVQLEGGPGRDTPLHVAAQR.G
UIDE_HUMAN96.7%6612.3%10181178906.8(P14735) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) 
*	TK120303_NMyc_cyto3_step12.2878.2878.2	2.9129	0.357	2512.66	1	3040.0%	1	K.SNPGHYLGHLIGHEGPGSLLSELK.S
*	TK120303_NMyc_cyto3_step07.3388.3388.3	1.6882	0.0608	4574.13	2	1120.0%	1	R.GYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDK.L
*	TK120303_NMyc_cyto3_step04.3829.3829.3	1.8607	0.1452	3137.36	21	1400.0%	1	K.LFSEVENKNVPLPEFPEHPFQEEHLK.Q
*	TK120303_NMyc_cyto3_step02.1325.1325.1	1.3528	0.0409	1239.61	53	4440.0%	1	K.MATFEIDEKR.F
*	TK120303_NMyc_cyto3_step04.3064.3064.2	1.4147	0.0784	2969.73	5	1920.0%	1	K.YYKSNPGHYLGHLIGHEGPGSLLSELK.S
*	TK120303_NMyc_cyto3_step04.4287.4287.2	1.8519	0.1921	2856.11	5	2270.0%	1	K.YWGEIISQQYNFDRDNTEVAYLK.T
UZ298_HUMAN96.7%14746.2%9511065178.5(P57071) Zinc finger protein 298 (PR-domain zinc finger protein 15) (Fragment) 
*	TK120303_NMyc_cyto3_step04.2546.2546.1	1.7726	0.1728	1410.81	1	5000.0%	6	R.FFSTNSNLSKHK.K
*	TK120303_NMyc_cyto3_step03.0579.0579.2	1.112	0.0809	1376.87	71	3640.0%	1	R.QPRAAPVQPPCR.L
*	TK120303_NMyc_cyto3_step12.2508.2508.3	1.6512	0.1005	3695.12	29	1250.0%	1	K.MDKPMLKQAGSGVHAAGTPENSAPVESEPSQWACK.V
UQ9JI0296.6%1133.0%112125904.5(Q9JI02) 11 kDa secreted protein 
*	TK120303_NMyc_cyto3_step11.2499.2499.3	3.2794	0.1948	3951.82	5	1320.0%	1	K.GTLLLLGLLVTGELSFQTTEACLPFFEGYASVLSGSR.V
UCAH1_MOUSE96.6%3521.2%260281897.0(P13634) Carbonic anhydrase I (EC 4.2.1.1) (Carbonate dehydratase I) (CA-I) 
*	TK120303_NMyc_cyto3_step08.2596.2596.2	2.6197	0.4015	1639.76	1	5770.0%	2	R.YSGELHLVHWNSAK.Y
*	TK120303_NMyc_cyto3_step09.3511.3511.3	2.107	0.1418	4769.45	2	1190.0%	1	K.RAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICK.D
UPSA2_MOUSE96.5%118.6%233257948.3(P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) 
	TK120303_NMyc_cyto3_step03.3742.3742.2	2.9459	0.3431	2357.65	1	4470.0%	1	K.RYNEDLELEDAIHTAILTLK.E
UU186_MOUSE96.4%1115.1%86101196.4(Q923D4) Hypothetical protein MGC11596 
	TK120303_NMyc_cyto3_step06.2063.2063.2	2.4902	0.4141	1584.37	1	6250.0%	1	R.YTIHSQLEHLQSK.Y
UROK_MOUSE96.3%336.5%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) 
	TK120303_NMyc_cyto3_step01.3208.3208.1	1.8858	0.2962	1342.11	1	5000.0%	1	K.IILDLISESPIK.G
	TK120303_NMyc_cyto3_step03.1739.1739.1	1.7005	0.2235	1054.74	3	5560.0%	1	R.VVLIGGKPDR.V
	TK120303_NMyc_cyto3_step01.0979.0979.1	1.5394	0.2476	729.42	2	7140.0%	1	K.NAGAVIGK.G
U143B_MOUSE96.3%122233.9%245279554.8(Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) 
	TK120303_NMyc_cyto3_step01.2022.2022.1	1.4469	0.039	909.76	2	7140.0%	1	R.NLLSVAYK.N
	TK120303_NMyc_cyto3_step12.2440.2440.3	1.576	0.0383	3332.8	5	1520.0%	1	K.TAFDEAIAELDTLNEESYKDSTLIMQLLR.D
*	TK120303_NMyc_cyto3_step01.1395.1395.1	1.5902	0.2161	1196.44	1	5000.0%	1	R.YLSEVASGENK.Q
	TK120303_NMyc_cyto3_step01.3271.3271.1	1.8156	0.3008	1192.11	1	6110.0%	2	K.DSTLIMQLLR.D
	TK120303_NMyc_cyto3_step02.1356.1356.1	1.8759	0.0678	1110.66	2	5620.0%	3	K.EMQPTHPIR.L
*	TK120303_NMyc_cyto3_step01.1992.1992.1	2.2087	0.183	1350.9	1	5910.0%	1	K.YLILNATQAESK.V
	TK120303_NMyc_cyto3_step01.1166.1166.1	1.5464	0.201	903.55	1	6430.0%	2	R.VISSIEQK.T
	TK120303_NMyc_cyto3_step01.0842.0842.1	1.4311	0.1513	615.48	9	8000.0%	1	K.NVVGAR.R
UQ9CXT496.3%81629.5%200231614.4(Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence 
	TK120303_NMyc_cyto3_step01.1798.1798.1	1.4682	0.023	1015.63	6	5000.0%	1	K.DLSTIEPLK.K
	TK120303_NMyc_cyto3_step04.1504.1504.1	2.0499	0.2168	884.55	1	7140.0%	3	K.HLNLSGNK.I
	TK120303_NMyc_cyto3_step02.1485.1485.1	1.6889	0.2414	990.81	9	6430.0%	2	K.KLELSENR.I
*	TK120303_NMyc_cyto3_step01.1264.1264.1	1.4656	0.0017	605.56	25	7500.0%	1	K.MIEGR.R
	TK120303_NMyc_cyto3_step08.3631.3631.3	2.1059	0.226	3210.04	1	2320.0%	1	K.IEGLTDEFEELEFLSTINVGLTSISNLPK.L
UCARE_HUMAN96.3%337.3%10041133005.9(Q9BXL6) Caspase recruitment domain protein 14 (CARD-containing MAGUK protein 2) (Carma 2) 
*	TK120303_NMyc_cyto3_step01.4615.4615.2	1.102	0.0060	2070.74	1	2940.0%	1	R.MDIFPIVIHVSVNEKMAK.K
*	TK120303_NMyc_cyto3_step10.4184.4184.3	2.0331	0.0358	4508.04	1	1250.0%	1	K.NGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLMETSK.L
*	TK120303_NMyc_cyto3_step01.1164.1164.1	1.8452	0.2993	1554.04	1	4620.0%	1	R.TASDQESGDEELNR.L
UDYL1_HUMAN96.3%1112.4%89103667.4(Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) 
	TK120303_NMyc_cyto3_step02.1604.1604.1	1.7474	0.2967	1283.98	2	4500.0%	1	R.NFGSYVTHETK.H
UUNRI_MOUSE96.3%114.0%351385135.1(Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) 
*	TK120303_NMyc_cyto3_step03.2622.2622.1	1.8129	0.293	1498.42	1	5000.0%	1	R.SIAFHSAVSLEPIK.S
UQ922S196.3%339.3%508576458.0(Q922S1) Similar to phenylalanine-tRNA synthetase-like 
	TK120303_NMyc_cyto3_step06.4204.4204.3	1.9147	0.0045	4386.99	48	1010.0%	1	R.LEVADGGLDSAELATQLGVEHQAVVGAVKSLQALGEVIEAELR.S
	TK120303_NMyc_cyto3_step02.2967.2967.2	2.7204	0.3872	3034.6	1	3100.0%	1	R.RLEVADGGLDSAELATQLGVEHQAVVGAVK.S
	TK120303_NMyc_cyto3_step05.2240.2240.2	1.2381	0.0018	1843.26	57	2500.0%	1	K.SLQALGEVIEAELRSTK.C
UDSC1_HUMAN96.3%4411.5%8941000455.4(Q08554) Desmocollin 1A/1B precursor (Desmosomal glycoprotein 2/3) (DG2/DG3) 
	TK120303_NMyc_cyto3_step04.3246.3246.3	1.347	0.0968	3458.93	20	1370.0%	1	K.AASSQTPTMCTTTVTVKIIDSDEGPECHPPVK.V
	TK120303_NMyc_cyto3_step11.1867.1867.2	1.4855	0.2961	2488.83	11	2140.0%	1	K.GVGQGDTGRYAYTDWQSFTQPR.L
	TK120303_NMyc_cyto3_step04.2942.2942.3	1.6175	0.0683	3229.59	2	1790.0%	1	K.CFPEDIAQQNLIVSNTEGPGEEVTEANIR.L
	TK120303_NMyc_cyto3_step08.2843.2843.2	2.7267	0.3904	2255.46	1	3420.0%	1	K.HFSIHPDTGVITTTTPFLDR.E
UQ9H3S696.3%114.5%577636505.2(Q9H3S6) TCAM-1 (Fragment) 
*	TK120303_NMyc_cyto3_step10.3814.3814.3	3.2061	0.1968	2890.64	1	2800.0%	1	R.CNSSCHAELDLSLQGGRLFQGSSPIR.I
UQ9D7P596.3%227.9%380404405.1(Q9D7P5) 2300004C15Rik protein 
	TK120303_NMyc_cyto3_step03.2900.2900.2	2.9442	0.3106	2502.28	1	3100.0%	1	K.LKDDQTLDFYGIQPGSTVHVLR.K
	TK120303_NMyc_cyto3_step08.1131.1131.1	0.7252	0.0421	960.5	88	3570.0%	1	K.VAALREFR.V
UQ9Y2V696.2%224.7%835928516.7(Q9Y2V6) Hypothetical protein 
*	TK120303_NMyc_cyto3_step01.2736.2736.3	2.8001	0.4208	2937.17	1	2210.0%	1	R.AGLPSHFHLQLSEIEFHEIIGSGSFGK.V
*	TK120303_NMyc_cyto3_step01.4464.4464.1	1.3164	0.1599	1336.58	1	4090.0%	1	R.NGFTALHLAVYK.D
UITA5_MOUSE96.1%468.6%10531150566.0(P11688) Integrin alpha-5 precursor (Fibronectin receptor alpha subunit) (Integrin alpha-F) (VLA-5) (CD49e) 
*	TK120303_NMyc_cyto3_step12.3412.3412.2	1.2938	0.0422	2187.84	4	2630.0%	1	K.AGTSLWGGLRFTVPHLQDTK.K
*	TK120303_NMyc_cyto3_step09.4156.4156.3	1.5255	0.0464	3969.9	80	1110.0%	1	K.ANTSQPGVLQGGAVYVCPWGTSPIQCTTIQFDSKGSR.I
*	TK120303_NMyc_cyto3_step11.1985.1985.3	3.1662	0.2628	3579.58	3	1740.0%	2	R.QASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPK.G
UATXX_MOUSE96.1%4413.1%475537075.2(P28658) Ataxin-10 (Spinocerebellar ataxia type 10 protein homolog) (Brain protein E46) 
*	TK120303_NMyc_cyto3_step07.1249.1249.3	1.2688	0.0134	2188.76	66	2110.0%	1	R.VIHEVGKESTNIFSPSDSLK.A
*	TK120303_NMyc_cyto3_step01.3875.3875.2	2.6685	0.3817	2333.75	1	3420.0%	1	R.DPSQVEHLASSLQLITECFR.C
	TK120303_NMyc_cyto3_step05.1399.1399.1	1.2287	0.0624	625.6	6	6250.0%	1	K.SHLIR.L
*	TK120303_NMyc_cyto3_step10.3518.3518.2	2.0124	0.2394	2038.09	1	3440.0%	1	K.HPASEWPFLIISDHFLK.S
UQ9H0R596.0%6147.6%563641275.6(Q9H0R5) Hypothetical protein 
	TK120303_NMyc_cyto3_step10.3749.3749.2	1.4845	0.0649	2982.17	4	2000.0%	3	K.QNQEASSDRCSALLQVIFSPLEEEVK.A
	TK120303_NMyc_cyto3_step03.0018.0018.2	0.9974	0.018	1852.3	88	2500.0%	1	K.EIEVECVKAESAQASAK.M
UQ96N7096.0%3535.9%181191386.6(Q96N70) Hypothetical protein FLJ31331 
*	TK120303_NMyc_cyto3_step08.2960.2960.2	2.6197	0.3859	2328.2	1	3520.0%	2	R.GAGAAAGAGPGSLPRGVGAGGLLGASFK.S
*	TK120303_NMyc_cyto3_step12.1831.1831.3	1.5436	0.0156	3662.48	21	1180.0%	1	-.MGTASSLVSPAGGEVIEDTYGAGGGEACEIPVEVKPK.A
UEF1D_MOUSE95.9%467.1%281312935.0(P57776) Elongation factor 1-delta (EF-1-delta) 
*	TK120303_NMyc_cyto3_step06.1383.1383.1	1.5219	0.048	756.5	1	7500.0%	2	K.KPTLVAK.S
	TK120303_NMyc_cyto3_step04.1364.1364.1	1.5473	0.168	1424.59	4	4170.0%	1	R.ATAPQTQHVSPMR.Q
UQ99LE795.9%115.0%378417827.5(Q99LE7) Similar to paxillin (Fragment) 
	TK120303_NMyc_cyto3_step10.1832.1832.2	2.567	0.3987	2410.53	1	4170.0%	1	K.TWHPEHFVCTHCQEEIGSR.N
UQ9EPF195.7%3310.6%648715125.8(Q9EPF1) L-gicerin/MUC18 
*	TK120303_NMyc_cyto3_step03.3274.3274.3	1.8802	0.1202	2623.88	24	2080.0%	1	K.QPVPTPDLVEAEVGSTALLKCGPSR.A
*	TK120303_NMyc_cyto3_step02.3133.3133.2	2.9087	0.1632	2291.27	1	4000.0%	1	R.LSLQDSVATLALSHVTPHDER.M
*	TK120303_NMyc_cyto3_step09.1580.1580.3	1.5958	0.1724	2469.89	11	2270.0%	1	R.VPGLNRTQLVSVGIFGSPWMALK.E
UCALU_MOUSE95.7%225.4%315370644.7(O35887) Calumenin precursor 
	TK120303_NMyc_cyto3_step06.1371.1371.1	1.7306	0.2894	1189.55	2	6670.0%	1	R.VHHEPQLSDK.V
	TK120303_NMyc_cyto3_step09.1328.1328.1	1.2463	0.0524	955.51	2	6670.0%	1	R.EQFVEFR.D
UO9477995.7%445.6%11001206866.4(O94779) HNB-2 
*	TK120303_NMyc_cyto3_step09.1457.1457.3	1.8146	0.0327	2948.81	20	1800.0%	1	K.SQAVLEIPNVQLDDAGIYECRAENSR.G
*	TK120303_NMyc_cyto3_step02.2301.2301.1	1.6544	0.2888	1500.87	3	3750.0%	1	R.FISQETGNLYISK.V
*	TK120303_NMyc_cyto3_step06.3077.3077.2	1.7615	0.2177	2518.06	1	2620.0%	1	R.KSQAVLEIPNVQLDDAGIYECR.A
*	TK120303_NMyc_cyto3_step06.2683.2683.2	1.0959	0.0684	2482.32	10	2140.0%	1	K.GTTVKMECFALGNPVPTITWMK.V
UO3573795.7%226.9%449491996.3(O35737) Heterogeneous nuclear ribonucleoprotein H 
	TK120303_NMyc_cyto3_step02.1688.1688.1	1.6926	0.2901	1092.8	1	6110.0%	1	R.VHIEIGPDGR.V
	TK120303_NMyc_cyto3_step06.2687.2687.2	1.4644	0.1752	2180.49	92	2000.0%	1	R.VTGEADVEFATHEDAVAAMSK.D
UTIE1_MOUSE95.7%6185.6%11341246996.8(Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112) 
*	TK120303_NMyc_cyto3_step04.2582.2582.3	1.6105	0.123	3524.53	1	1750.0%	1	R.LHYRPQDSTIAWSAIVVDPSENVTLMNLKPK.T
	TK120303_NMyc_cyto3_step02.2860.2860.2	2.8789	0.2631	2227.45	2	3330.0%	4	R.GFSKPSDLVGVFSCVGGAGARR.T
	TK120303_NMyc_cyto3_step04.1583.1583.1	1.1533	0.0541	1152.44	15	4000.0%	1	R.VSTSGGQDSRR.F
ULEG1_MOUSE95.6%4634.3%134147355.5(P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) 
	TK120303_NMyc_cyto3_step02.2009.2009.1	2.1529	0.2309	1488.72	1	4550.0%	2	K.DSNNLCLHFNPR.F
	TK120303_NMyc_cyto3_step08.3482.3482.2	1.414	0.0873	2925.93	4	1800.0%	1	R.EPAFPFQPGSITEVCITFDQADLTIK.L
	TK120303_NMyc_cyto3_step02.1499.1499.1	1.5262	0.1098	942.64	12	5710.0%	1	K.LPDGHEFK.F
UQ9NRD895.5%7116.6%15481753627.9(Q9NRD8) NADPH thyroid oxidase 2 
	TK120303_NMyc_cyto3_step05.2535.2535.2	1.081	0.0373	2070.75	3	2810.0%	1	K.IPKEYDLVLLFSSEEER.G
	TK120303_NMyc_cyto3_step04.2763.2763.3	1.4982	0.0137	3992.1	7	1410.0%	1	K.FYWWFFQTVPGMTGVLLLLVLAIMYVFASHHFR.R
	TK120303_NMyc_cyto3_step06.2979.2979.2	1.8084	4.0E-4	2452.19	10	2500.0%	2	R.VVQLQPLQQVNLILSNNRGCR.T
	TK120303_NMyc_cyto3_step09.1573.1573.1	1.0921	0.1093	1221.03	46	4380.0%	1	R.ERILEIFFR.H
*	TK120303_NMyc_cyto3_step11.2374.2374.2	1.7526	0.1711	2468.22	71	1670.0%	2	R.IPPGDPVFDPDQRGDVVLPFQR.S
UO8854495.4%5718.0%406462855.8(O88544) COP9 complex subunit 4 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 4) (ARABIDOPSIS) 
	TK120303_NMyc_cyto3_step10.3312.3312.3	1.5396	0.0196	2364.01	16	2110.0%	1	K.IARLYLEDDDPVQAEAYINR.A
	TK120303_NMyc_cyto3_step06.4344.4344.3	1.0482	0.132	4029.98	28	1140.0%	1	K.AFVEAMVNENVSLVISRQLLTDFCTHLPNLPDSTAK.E
	TK120303_NMyc_cyto3_step02.1992.1992.1	2.1559	0.2577	1283.78	1	5910.0%	2	R.AVIEHNLLSASK.L
	TK120303_NMyc_cyto3_step01.1795.1795.1	1.2725	0.0894	669.32	3	7500.0%	1	K.VCYAR.V
UQ9BW1895.4%244.3%588634717.7(Q9BW18) Similar to cleavage and polyadenylation specific factor 6, 68kD subunit 
	TK120303_NMyc_cyto3_step08.3638.3638.2	2.0284	0.358	2453.37	1	2920.0%	2	R.AVSDASAGDYGSAIETLVTAISLIK.Q
UQ8R1Q895.3%112.3%523566146.4(Q8R1Q8) Hypothetical 56.6 kDa protein 
	TK120303_NMyc_cyto3_step04.2682.2682.1	2.139	0.2501	1413.59	1	4550.0%	1	K.IGILHENFQTLK.V
UQ9CT1795.2%115.8%3653983311.8(Q9CT17) 2610019N13Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step03.2779.2779.2	2.2446	0.4212	2369.75	1	3500.0%	1	K.FHDPDSAVVAQHLTNTVFVDR.A
ULCFB_MOUSE95.2%468.0%699779237.1(P41216) Long-chain-fatty-acid--CoA ligase 2 (EC 6.2.1.3) (Long-chain acyl-CoA synthetase 2) (LACS 2) 
*	TK120303_NMyc_cyto3_step09.2481.2481.2	1.9484	0.0209	2119.84	25	2630.0%	2	K.VRLMITGAAPVSATVLTFLR.T
	TK120303_NMyc_cyto3_step05.1592.1592.1	1.1188	0.0474	544.33	3	6670.0%	1	K.HIFK.L
*	TK120303_NMyc_cyto3_step08.3339.3339.3	3.092	0.2868	3463.83	1	1690.0%	1	K.EAGLKPFEQVKGIAVHPELFSIDNGLLTPTLK.A
UQ9EQ0095.2%247.8%230259425.1(Q9EQ00) cAMP-dependent protein kinase regulatory subunit 
*	TK120303_NMyc_cyto3_step07.2840.2840.2	1.9235	0.0618	1944.01	18	2940.0%	2	K.FLALGCSSLGRTLNTAMK.N
UK2C1_MOUSE95.1%6811.8%627650928.8(P04104) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (67 kDa cytokeratin) 
	TK120303_NMyc_cyto3_step02.1740.1740.1	1.6706	0.0428	1423.39	20	4550.0%	2	K.RTNAENEFVTIK.K
*	TK120303_NMyc_cyto3_step01.1218.1218.1	1.0867	0.0287	753.52	15	5710.0%	1	K.SSGSSTVK.F
*	TK120303_NMyc_cyto3_step10.4041.4041.2	1.4426	0.1721	2128.23	5	2810.0%	1	R.TQNLDPFFENYISILRR.K
*	TK120303_NMyc_cyto3_step11.2997.2997.2	1.2279	0.1208	2167.21	1	2500.0%	1	R.SGGGGGGRFSGGGFCGSSGSGFGSK.S
*	TK120303_NMyc_cyto3_step01.1639.1639.1	1.9875	0.27	1475.75	1	5910.0%	1	R.FLEQQNKVLQTK.W
UQ9R0H595.1%225.5%524573837.0(Q9R0H5) Type II cytokeratin (Keratin protein K6irs) 
	TK120303_NMyc_cyto3_step01.1639.1639.1	1.9875	0.27	1475.75	1	5910.0%	1	R.FLEQQNQVLQTK.W
	TK120303_NMyc_cyto3_step07.1877.1877.2	1.7147	0.1357	1923.7	9	2810.0%	1	K.LDELEGALHQAKEELAR.M
UADDB_MOUSE95.0%222.6%725806426.2(Q9QYB8) Beta adducin (Erythrocyte adducin beta subunit) (Add97) 
	TK120303_NMyc_cyto3_step12.1230.1230.1	1.925	0.2876	1436.37	1	5450.0%	1	K.RVTMILQSPSFR.E
	TK120303_NMyc_cyto3_step08.1439.1439.1	0.9566	0.0472	809.62	1	5830.0%	1	K.TSEDTKK.T
UDYI2_MOUSE95.0%229.3%612683945.3(O88487) Dynein intermediate chain 2, cytosolic (DH IC-2) (Cytoplasmic dynein intermediate chain 2) 
*	TK120303_NMyc_cyto3_step02.3681.3681.3	1.8971	0.1054	4461.68	1	1580.0%	1	R.VVSCLDWSSQYPELLVASYNNNEEAPHEPDGVALVWNMK.Y
	TK120303_NMyc_cyto3_step04.3382.3382.2	2.6244	0.3683	2221.36	1	3530.0%	1	K.QQILHSEEFLSFFDHSTR.I
UGIT1_HUMAN94.9%5116.4%761843316.8(Q9Y2X7) ARF GTPase-activating protein GIT1 (G protein-coupled receptor kinase-interactor 1) 
*	TK120303_NMyc_cyto3_step01.2743.2743.1	1.8348	0.2786	1564.72	1	5000.0%	3	R.EFATLIIDILSEAK.R
*	TK120303_NMyc_cyto3_step11.3771.3771.2	1.4439	0.0861	2359.97	12	2140.0%	1	K.GPRAEVCADCSAPDPGWASISR.G
*	TK120303_NMyc_cyto3_step09.2229.2229.2	1.5206	0.0535	1594.01	318	2500.0%	1	R.EIHKLQAENLQLR.Q
UHAIR_MOUSE94.9%559.1%11821271837.4(Q61645) Hairless protein 
*	TK120303_NMyc_cyto3_step04.1944.1944.2	1.9751	0.2063	2796.14	1	2500.0%	1	R.SPLPCPSLCELLASTAVKLCLGHDR.I
*	TK120303_NMyc_cyto3_step04.1827.1827.1	1.7347	0.2842	949.6	1	7500.0%	1	K.EESSATGLR.A
*	TK120303_NMyc_cyto3_step11.3847.3847.3	2.0131	0.1422	3939.1	2	1430.0%	1	K.LNLASYLPLGLTLHPLEPQLWAAYGVNSHRGHLGTK.N
*	TK120303_NMyc_cyto3_step03.2831.2831.2	1.4719	0.1145	2575.43	29	1600.0%	1	K.QLEEEDSSATSEEGGGGPGPEASLNK.G
	TK120303_NMyc_cyto3_step01.4499.4499.1	1.1119	0.041	1274.32	13	4500.0%	1	R.ACPPSHHTKLK.K
UQ9ER4894.9%2415.9%6976119.4(Q9ER48) Stretch regulated skeletal muscle protein 
*	TK120303_NMyc_cyto3_step05.2020.2020.1	1.1384	0.0151	1324.5	348	3000.0%	2	K.KYFNSYTLTGK.M
UMKR3_MOUSE94.9%112.4%544594446.6(Q60764) Makorin 3 (Zinc-finger protein 127) 
*	TK120303_NMyc_cyto3_step01.3059.3059.1	1.6689	0.279	1391.93	2	4170.0%	1	R.GFTEAEIDNAGIR.S
UIMA5_MOUSE94.9%226.8%533596035.0(O35345) Importin alpha-6 subunit (Karyopherin alpha-5 subunit) (Importin alpha S2) 
*	TK120303_NMyc_cyto3_step12.2538.2538.3	1.8744	0.0046	2700.89	2	2500.0%	1	K.EPSPPIDEVINTPGVVDRFVEFLK.R
	TK120303_NMyc_cyto3_step07.2176.2176.1	1.806	0.2763	1374.71	1	5000.0%	1	K.IQAVIDSGVCRR.L
UQ9D1M294.9%118.4%143161995.3(Q9D1M2) 1110003E08Rik protein 
	TK120303_NMyc_cyto3_step02.1492.1492.1	1.7179	0.2833	1225.43	1	5000.0%	1	K.HAEATLGSGNLR.M
UMIF_MOUSE94.9%51714.0%114123737.3(P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) 
*	TK120303_NMyc_cyto3_step01.2400.2400.1	1.3285	0.0744	1048.81	24	5000.0%	1	K.LLCGLLSDR.L
*	TK120303_NMyc_cyto3_step04.1495.1495.1	1.4763	0.2267	839.48	1	7500.0%	4	R.LHISPDR.V
UQ922B694.9%391.3%594664877.0(Q922B6) Unknown (Protein for MGC:7807) 
	TK120303_NMyc_cyto3_step01.2315.2315.1	1.9827	0.2441	958.58	6	5000.0%	3	K.MNLEAHLK.E
UO9599694.9%442.9%23032439468.8(O95996) APCL protein 
*	TK120303_NMyc_cyto3_step09.2697.2697.1	1.3416	0.1074	1514.44	2	3930.0%	1	R.GPPPLARAVPEPGPR.G
*	TK120303_NMyc_cyto3_step07.3613.3613.2	1.9343	0.3706	2860.6	1	1960.0%	1	K.APISAPFVHEGLGVAVGGFPASRHGSPSR.S
*	TK120303_NMyc_cyto3_step08.1208.1208.1	1.7547	0.2822	707.51	2	6670.0%	1	R.GPPPLAR.A
*	TK120303_NMyc_cyto3_step06.3591.3591.2	1.5137	0.0090	2100.32	2	2620.0%	1	R.KRPPVTQAAGALPGPGASPVPK.T
UQ96BZ394.9%2210.8%2032214311.4(Q96BZ3) Similar to hypothetical protein MGC2605 
*	TK120303_NMyc_cyto3_step09.2003.2003.1	1.6333	0.2713	1354.65	1	4580.0%	1	R.SACSSAAVRGHPR.A
	TK120303_NMyc_cyto3_step03.1220.1220.1	1.2729	0.0354	1082.57	12	5000.0%	1	R.RLAHGEELR.V
UP9746294.8%3310.8%535599988.9(P97462) Embryonic ECTODERM development (Embryonic ECTODERM development protein) 
	TK120303_NMyc_cyto3_step06.1479.1479.1	0.9603	0.0301	794.51	5	6000.0%	1	R.RNMSER.E
*	TK120303_NMyc_cyto3_step05.1285.1285.1	1.5296	0.3121	887.32	1	6250.0%	1	K.QPGSRAGGR.A
	TK120303_NMyc_cyto3_step08.3426.3426.3	1.9662	0.0398	4489.64	13	1190.0%	1	K.LSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGR.K
UIL4R_HUMAN94.8%227.2%825896585.1(P24394) Interleukin-4 receptor alpha chain precursor (IL-4R-alpha) (CD124 antigen) 
*	TK120303_NMyc_cyto3_step03.3800.3800.2	1.0837	0.0137	3045.81	169	1300.0%	1	R.AWAQCYNTTWSEWSPSTKWHNSYR.E
*	TK120303_NMyc_cyto3_step10.2562.2562.3	2.8005	0.4128	3924.07	1	1690.0%	1	K.QCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLR.A
USTRN_MOUSE94.8%469.9%780860145.3(O55106) Striatin 
	TK120303_NMyc_cyto3_step05.3149.3149.2	2.1229	0.3535	2303.29	2	2500.0%	1	R.ALAFHPIEPVLITASEDHTLK.M
*	TK120303_NMyc_cyto3_step08.2762.2762.3	2.1717	0.1212	4014.94	1	1510.0%	2	K.SFIMGADEALESELGLGELAGLTVANEADSLAYDIANNK.D
*	TK120303_NMyc_cyto3_step09.2469.2469.2	2.8412	0.1827	1887.83	1	4690.0%	1	R.VISHPTLPISITAHEDR.H
UQ9D1L394.8%2210.2%244266825.9(Q9D1L3) 1110003N24Rik protein 
*	TK120303_NMyc_cyto3_step01.0467.0467.1	0.8967	9.0E-4	744.65	19	5000.0%	1	K.SGVPARR.L
	TK120303_NMyc_cyto3_step08.2300.2300.2	2.7031	0.3373	2143.13	1	4710.0%	1	R.RPEHSGPPELFYDQNEAR.K
UQ9CX8294.8%688.5%832944656.6(Q9CX82) 3100002B05Rik protein 
	TK120303_NMyc_cyto3_step12.2078.2078.2	1.0934	0.1516	3079.9	56	1480.0%	1	R.HLTTSITTLNHLHMLAGGVDSLEAMTRR.R
	TK120303_NMyc_cyto3_step01.2256.2256.1	1.2699	0.0615	1297.43	17	4090.0%	1	R.FSGCTLTDGTLK.K
	TK120303_NMyc_cyto3_step07.4284.4284.2	1.5105	0.0523	3080.5	6	2040.0%	1	K.RHLTTSITTLNHLHMLAGGVDSLEAMTR.R
*	TK120303_NMyc_cyto3_step06.3139.3139.3	1.6367	0.0862	3506.3	8	1470.0%	1	K.VVMAPHEPLVVFVDNYIKLLTDCNSETFQK.I
	TK120303_NMyc_cyto3_step04.4351.4351.3	2.1906	0.0499	2922.25	1	2400.0%	2	R.HLTTSITTLNHLHMLAGGVDSLEAMTR.R
UO4342394.6%115.6%234267624.2(O43423) Pp32r1 
*	TK120303_NMyc_cyto3_step02.1576.1576.1	2.2923	0.1921	1434.63	1	5420.0%	1	K.ELALDNSRSNEGK.L
UGCAA_MOUSE94.5%338.2%330363897.4(P01863) Ig gamma-2A chain C region, A allele 
	TK120303_NMyc_cyto3_step02.2499.2499.2	1.8759	0.2842	1799.28	2	3670.0%	1	R.VVSALPIQHQDWMSGK.E
	TK120303_NMyc_cyto3_step09.1364.1364.2	2.4929	0.2982	1256.79	1	6500.0%	1	R.GPTIKPCPPCK.C
UQ9JHJ394.5%3784912.9%404438046.1(Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) 
*	TK120303_NMyc_cyto3_step10.4033.4033.3	2.3429	0.0229	2655.93	2	2290.0%	1	R.GNHSLFGLEVATLGQGPDCPSVNER.N
*	TK120303_NMyc_cyto3_step05.4257.4257.2	2.0502	0.206	2882.18	3	2310.0%	28	R.LLEFDSTNASEGAQPPGKPYPPYSLAK.F
UR23B_MOUSE94.5%228.4%416435174.8(P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58) 
	TK120303_NMyc_cyto3_step07.1260.1260.2	1.5165	0.2233	1800.59	2	3330.0%	1	R.EQVIAALRASFNNPDR.A
	TK120303_NMyc_cyto3_step02.3516.3516.2	2.1604	0.421	2130.04	1	4720.0%	1	R.QIIQQNPSLLPALLQQIGR.E
UPSD5_HUMAN94.4%3311.1%504561965.5(Q16401) 26S proteasome non-ATPase regulatory subunit 5 (26S proteasome subunit S5B) (26S protease subunit S5 basic) 
*	TK120303_NMyc_cyto3_step12.2522.2522.3	1.726	0.0684	3734.59	2	1840.0%	1	K.VFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQK.T
*	TK120303_NMyc_cyto3_step08.1248.1248.1	1.1335	0.0379	895.65	55	5830.0%	1	R.YPIFVEK.V
*	TK120303_NMyc_cyto3_step11.1423.1423.1	1.962	0.2646	1513.73	2	3850.0%	1	-.MAAQALALLREVAR.L
UCYTC_MOUSE94.4%2227.9%140155319.0(P21460) Cystatin C precursor (Cystatin 3) 
*	TK120303_NMyc_cyto3_step04.2234.2234.2	2.3126	0.3975	2200.42	1	2940.0%	1	K.SQTNLTDCPFHDQPHLMR.K
*	TK120303_NMyc_cyto3_step01.3771.3771.2	1.3113	0.1905	2401.73	1	2750.0%	1	K.QLVAGVNYFLDVEMGRTTCTK.S
UALFA_HUMAN94.4%7373.3%363392898.1(P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1) 
*	TK120303_NMyc_cyto3_step05.1620.1620.1	1.7388	0.2618	1437.58	6	4550.0%	6	-.PYQYPALTPEQK.K
UFRZB_MOUSE94.4%111.9%323360118.3(P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3) 
	TK120303_NMyc_cyto3_step05.1469.1469.1	1.6174	0.2686	624.48	2	7000.0%	1	R.HLGLGK.T
UQ9EQJ094.3%241.8%817944968.5(Q9EQJ0) Calcium channel 
*	TK120303_NMyc_cyto3_step06.2371.2371.1	1.3538	0.036	1408.56	60	2860.0%	2	R.GSVPGPAAQQPPGSR.Q
UQ9P2D794.3%223.8%12011365425.8(Q9P2D7) Hypothetical protein KIAA1410 (Fragment) 
*	TK120303_NMyc_cyto3_step11.1325.1325.2	1.4046	0.1707	2234.12	2	2630.0%	1	R.LEDAGISGTNDSEDEEEEYK.Q
*	TK120303_NMyc_cyto3_step04.3753.3753.3	2.828	0.3743	2779.84	2	2100.0%	1	K.NLVDINFVCAMGPPGGGRNTVTPFSR.K
UO9578894.3%444.3%19802253076.2(O95788) Voltage-gated sodium channel alpha subunit 
	TK120303_NMyc_cyto3_step08.1986.1986.2	1.2926	0.018	1814.51	74	2500.0%	1	R.SSYSGYSGYSQGSRSSR.I
*	TK120303_NMyc_cyto3_step04.0309.0309.2	1.0571	0.0641	2927.74	32	1350.0%	1	-.MAARLLAPPGPDSFKPFTPESLANIER.R
	TK120303_NMyc_cyto3_step01.0416.0416.1	0.9936	0.0176	842.26	44	5000.0%	1	R.KPDEQPK.Y
	TK120303_NMyc_cyto3_step11.3910.3910.3	2.8283	0.3766	3579.24	1	1760.0%	1	R.NSTVDCNGVVSLIGGPGSHIGGRLLPEATTEVEIK.K
UQ9D8W994.3%2232.0%244268606.8(Q9D8W9) 1810027D10Rik protein 
	TK120303_NMyc_cyto3_step07.3668.3668.3	2.9209	0.367	4397.39	1	1510.0%	1	-.MIPQVVTSETVAMISPNGMSLPQTDKPQPFHQWQDSLKK.H
	TK120303_NMyc_cyto3_step03.2764.2764.3	1.318	0.0376	4464.45	100	990.0%	1	K.QSHSNIPGNVMFLPHSSNNDSNMESKVLCNPSYEEQLVC.-
UQ9EQC594.3%448.1%806891606.4(Q9EQC5) 105-kDa kinase-like protein 
*	TK120303_NMyc_cyto3_step08.2850.2850.2	1.4714	0.1892	2477.66	9	1900.0%	1	K.SLVTHYCELVGANPKVRPNPAR.F
*	TK120303_NMyc_cyto3_step11.1070.1070.2	1.2532	0.0762	1972.72	5	2630.0%	1	K.LGGLDYMYSAQGNGGGPPSK.G
*	TK120303_NMyc_cyto3_step03.1334.1334.1	1.198	0.0243	1117.33	22	4440.0%	1	R.AGQINHPDHK.S
	TK120303_NMyc_cyto3_step01.3564.3564.1	1.8381	0.266	1461.44	1	4580.0%	1	R.EQTVKSMLLLAPK.L
UILK_MOUSE94.2%6818.4%452513478.1(O55222) Integrin-linked protein kinase (EC 2.7.1.-) 
*	TK120303_NMyc_cyto3_step01.4535.4535.3	2.0125	0.0701	4499.98	25	1120.0%	2	K.ADTNAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNK.Y
	TK120303_NMyc_cyto3_step07.2145.2145.1	1.1746	0.0171	1185.55	13	5620.0%	1	-.MDDIFTQCR.E
	TK120303_NMyc_cyto3_step01.1208.1208.1	0.7127	0.0695	657.59	62	4000.0%	1	K.AKAPLR.E
	TK120303_NMyc_cyto3_step09.1920.1920.2	2.4531	0.3916	1583.73	1	6070.0%	1	R.GDDTPLHLAASHGHR.D
	TK120303_NMyc_cyto3_step06.1253.1253.2	1.1908	0.0504	1459.84	126	2730.0%	1	K.ICMNEDPAKRPK.F
UQ9EPK694.2%5253.2%465524035.2(Q9EPK6) Sil1 protein precursor 
*	TK120303_NMyc_cyto3_step07.2867.2867.2	1.9901	0.1434	1619.16	1	5710.0%	5	K.LLVILATNQPLPAKK.K
UQ99JJ294.1%2214.2%416450978.7(Q99JJ2) Hypothetical 45.1 kDa protein 
*	TK120303_NMyc_cyto3_step07.2987.2987.2	2.7828	0.1729	2324.03	1	3330.0%	1	K.STLLVNNGFAISAALLMACSLR.A
*	TK120303_NMyc_cyto3_step02.4441.4441.3	1.8649	0.019	3911.62	14	1390.0%	1	R.HGQPIDPDTLTLLWSVTVSIFAIGGLVGTLMVKMIGK.F
UQ99KJ994.1%5174.2%638732165.6(Q99KJ9) Hypothetical 73.2 kDa protein 
	TK120303_NMyc_cyto3_step07.0728.0728.1	0.7208	0.0439	572.4	1	8330.0%	1	K.YLKF.-
*	TK120303_NMyc_cyto3_step04.3708.3708.2	2.3253	0.1704	2709.92	3	2270.0%	4	R.KPLLVHVYGAYGMDLKMNFRPEK.R
UQ91VL394.1%579.6%9201028045.6(Q91VL3) Similar to Rho guanine nucleotide exchange factor (GEF) 1 
*	TK120303_NMyc_cyto3_step03.2288.2288.3	1.4887	0.029	2633.94	26	2020.0%	1	R.LMGMTPWEQELSLLEPWIGKDR.G
*	TK120303_NMyc_cyto3_step05.3503.3503.2	1.849	0.1014	2851.61	26	2040.0%	1	R.LRPLLSQLGGTLSPNLAAPERSAQTGLS.-
*	TK120303_NMyc_cyto3_step04.3632.3632.2	1.1005	0.0167	1981.87	19	2330.0%	1	K.EPRFCAFVQEAESRPR.C
*	TK120303_NMyc_cyto3_step06.3329.3329.2	2.4223	0.3915	2417.33	1	3330.0%	2	R.APGPVHTQEIEENLLSLEVAIR.Q
UQ9D3V694.1%112.4%382409519.9(Q9D3V6) 4933432H23Rik protein 
*	TK120303_NMyc_cyto3_step01.1294.1294.1	1.5924	0.2781	1065.53	3	6250.0%	1	R.ILHELLAKK.R
UO0879794.1%2211.2%374422595.4(O08797) Serine proteinase inhibitor 6 
*	TK120303_NMyc_cyto3_step08.3092.3092.3	1.6638	0.1135	3404.41	89	1420.0%	1	K.EVQAQVLVMPYEGMELSLVVLLPDEGVDLSK.V
*	TK120303_NMyc_cyto3_step01.2379.2379.1	1.5952	0.2742	1248.76	1	5000.0%	1	R.LGVVDVFQEDK.A
UPTNB_MOUSE94.0%114.1%585668167.0(P35235) Protein-tyrosine phosphatase, non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase SYP) 
	TK120303_NMyc_cyto3_step05.3339.3339.2	2.394	0.3915	2670.94	1	2830.0%	1	R.TWPDHGVPSDPGGVLDFLEEVHHK.Q
UAP19_MOUSE94.0%117.2%111121629.1(P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) 
	TK120303_NMyc_cyto3_step05.1288.1288.1	1.5478	0.292	829.41	2	5710.0%	1	R.KPSLVASK.L
UQ99NE694.0%3512.2%1481639710.0(Q99NE6) EDF-1 protein 
	TK120303_NMyc_cyto3_step08.1130.1130.1	0.959	0.1373	746.17	8	5000.0%	1	K.GPTAAQAK.S
	TK120303_NMyc_cyto3_step03.2014.2014.1	1.0699	0.0153	1128.81	129	2220.0%	2	K.QHSITKNTAK.L
US107_HUMAN93.8%2231.0%100113266.8(P31151) S100 calcium-binding protein A7 (Psoriasin) 
*	TK120303_NMyc_cyto3_step06.3633.3633.2	2.3362	0.3898	2314.19	1	3680.0%	1	K.KIDFSEFLSLLGDIATDYHK.Q
*	TK120303_NMyc_cyto3_step02.1553.1553.1	1.0377	0.0043	1257.59	113	3000.0%	1	K.GTNYLADVFEK.K
UAAC4_MOUSE93.7%101014.9%9121049775.4(P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) 
	TK120303_NMyc_cyto3_step04.1591.1591.1	1.9529	0.2583	1325.64	1	5500.0%	1	K.RDHALLEEQSK.Q
*	TK120303_NMyc_cyto3_step10.2870.2870.2	1.8956	0.2333	2523.29	6	2380.0%	1	R.QFASQANMVGPWIQTKMEEIGR.I
	TK120303_NMyc_cyto3_step04.1991.1991.2	2.3501	0.3052	1462.78	1	5830.0%	1	R.LSNRPAFMPSEGR.M
	TK120303_NMyc_cyto3_step07.2040.2040.1	1.5826	0.1128	1299.61	7	5560.0%	1	R.HRPELIEYDK.L
*	TK120303_NMyc_cyto3_step03.3128.3128.2	2.4441	0.1211	1857.15	1	4290.0%	1	K.QLETIDQLHLEYAKR.A
*	TK120303_NMyc_cyto3_step11.3875.3875.2	1.5126	0.0065	3036.22	48	1070.0%	1	R.MAPYQGPDAAPGALDYKSFSTALYGESDL.-
	TK120303_NMyc_cyto3_step01.3454.3454.1	1.8076	0.2298	1215.58	1	5560.0%	1	R.LASDLLEWIR.R
	TK120303_NMyc_cyto3_step07.1168.1168.2	1.3644	0.275	1779.13	5	3330.0%	1	K.DDPVTNLNNAFEVAEK.Y
	TK120303_NMyc_cyto3_step01.2796.2796.1	1.7528	0.042	1181.66	6	5000.0%	1	R.EREAILAIHK.E
UTCPG_MOUSE93.7%336.1%545606306.7(P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin) 
	TK120303_NMyc_cyto3_step01.2142.2142.1	1.4202	0.0793	1166.65	30	4000.0%	1	R.AVAQALEVIPR.T
	TK120303_NMyc_cyto3_step08.3259.3259.2	1.269	0.0133	2483.87	77	1590.0%	1	R.AVAQALEVIPRTLIQNCGASTIR.L
	TK120303_NMyc_cyto3_step02.1288.1288.1	1.9637	0.2548	1122.53	3	6110.0%	1	R.EIQVQHPAAK.S
UQ91YS893.5%229.6%374416245.4(Q91YS8) Similar to calcium/calmodulin-dependent protein kinase I 
	TK120303_NMyc_cyto3_step03.1476.1476.1	2.144	0.229	1283.6	1	6500.0%	1	K.NIHQSVSEQIK.K
	TK120303_NMyc_cyto3_step03.2346.2346.3	1.5235	0.0321	3011.87	4	1880.0%	1	K.LFEQILKAEYEFDSPYWDDISDSAK.D
UANM1_MOUSE93.5%2210.8%371424365.4(Q9JIF0) Protein arginine N-methyltransferase 1 (EC 2.1.1.-) 
	TK120303_NMyc_cyto3_step01.3096.3096.1	1.8834	0.2548	1399.82	1	5450.0%	1	K.WLAPDGLIFPDR.A
*	TK120303_NMyc_cyto3_step04.1703.1703.3	0.8573	0.0141	3405.07	168	740.0%	1	K.VDIIISEWMGYCLFYESMLNTVLHARDK.W
UOAT_MOUSE93.4%226.2%439483556.6(P29758) Ornithine aminotransferase, mitochondrial precursor (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) 
*	TK120303_NMyc_cyto3_step01.2714.2714.1	1.6629	0.0174	1325.51	1	5910.0%	1	K.GLLNAIVIRETK.D
	TK120303_NMyc_cyto3_step11.1893.1893.2	2.6303	0.3286	1737.78	1	5000.0%	1	K.YGAHNYHPLPVALER.G
UTCTP_MOUSE93.4%4620.9%172194624.9(P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein) 
	TK120303_NMyc_cyto3_step01.2628.2628.1	1.4166	0.0706	1435.54	2	4170.0%	1	R.EIADGLCLEVEGK.M
*	TK120303_NMyc_cyto3_step03.1278.1278.1	2.1123	0.1136	1216.6	1	5560.0%	2	K.GKLEEQKPER.V
	TK120303_NMyc_cyto3_step04.2154.2154.1	2.2747	0.0895	1419.63	1	5420.0%	1	R.VKPFMTGAAEQIK.H
UQ9CRI093.3%249.4%139160025.7(Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) 
	TK120303_NMyc_cyto3_step03.1564.1564.1	1.9696	0.1418	1382.7	1	5000.0%	2	R.EDSVKPGAHLTVK.K
UPSB5_MOUSE93.2%226.7%209229678.5(O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6) 
	TK120303_NMyc_cyto3_step04.1966.1966.2	2.6474	0.324	1585.5	1	5380.0%	1	K.RGPGLYYVDSEGNR.I
UBIN1_MOUSE93.2%227.8%588644705.0(O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) 
	TK120303_NMyc_cyto3_step07.1533.1533.1	2.1121	0.2299	1213.37	1	6670.0%	1	R.HHYESLQTAK.K
*	TK120303_NMyc_cyto3_step11.1598.1598.3	1.3869	0.0547	3515.56	10	1360.0%	1	K.SPSPPPDGSPAATPEIRVNHEPEPASGASPGATIPK.S
UTUL2_MOUSE93.2%225.1%564629146.7(P46686) Tubby related protein 2 (Tubby-like protein 2) (P4-6 protein) (Fragment) 
*	TK120303_NMyc_cyto3_step01.2568.2568.1	2.1092	0.2254	1320.79	1	6670.0%	1	K.LEQQRQLFEK.K
*	TK120303_NMyc_cyto3_step07.3347.3347.2	1.4253	0.1037	2111.89	17	2500.0%	1	R.SNVLGTKFTIFDNGVNPER.S
UY391_HUMAN93.2%3310.6%567654868.5(O15091) Hypothetical protein KIAA0391 
*	TK120303_NMyc_cyto3_step04.0486.0486.1	1.8209	0.2567	646.0	1	8000.0%	1	K.VITPSK.K
*	TK120303_NMyc_cyto3_step09.3392.3392.3	2.2188	0.126	3907.01	1	1640.0%	1	K.QASCFFADDISEDDPFLLYATLHSGNHCRFITR.D
*	TK120303_NMyc_cyto3_step06.1303.1303.3	1.3396	0.0017	2272.81	4	2500.0%	1	K.SLLAWVAAKNNGIVSYDLLVK.Y
UQ9CXG993.2%112.1%578652368.8(Q9CXG9) 3321402G02Rik protein 
	TK120303_NMyc_cyto3_step02.2180.2180.1	2.1564	0.2096	1427.49	1	5000.0%	1	K.QSCLVTFEDNSK.Y
UQ9JLP393.0%689.3%14611609906.7(Q9JLP3) Putative extracellular matrix protein MUSH2A 
*	TK120303_NMyc_cyto3_step04.3652.3652.3	1.6384	0.0178	3310.35	107	1210.0%	1	K.CDTCVPGASHLDVNNLLGCSKTPSQQPPPR.G
*	TK120303_NMyc_cyto3_step12.4134.4134.3	1.5394	0.0873	3767.47	7	1400.0%	1	R.TGESVPVFMAPPSVSPLSPHSLSVSWEKPAENFTR.G
*	TK120303_NMyc_cyto3_step12.3178.3178.3	1.9036	0.1094	4747.25	2	1280.0%	2	R.VSSAWASERTGESVPVFMAPPSVSPLSPHSLSVSWEKPAENFTR.G
*	TK120303_NMyc_cyto3_step09.1969.1969.3	2.9851	0.3399	3759.56	3	1480.0%	1	R.CRPCHCHVAGASNGTCDAVTGQCFCKEFVTGSK.C
*	TK120303_NMyc_cyto3_step04.2816.2816.2	1.4261	0.0029	2941.71	1	2140.0%	1	R.TYSFTVSLCDSVGCVTSALGSGQTLAAGK.-
UQ8WY2093.0%15278.1%31173509376.4(Q8WY20) Centrosome-associated protein 350 (Hypothetical protein KIAA0480) 
*	TK120303_NMyc_cyto3_step01.1951.1951.1	1.8041	0.2522	1377.78	1	5000.0%	1	K.DTIDVLNQISEK.Q
*	TK120303_NMyc_cyto3_step05.1152.1152.1	1.3303	0.0484	808.5	24	5830.0%	1	R.DKGEDDK.M
*	TK120303_NMyc_cyto3_step04.1551.1551.1	1.3657	0.0161	899.63	9	6670.0%	1	K.ERQLILK.Q
*	TK120303_NMyc_cyto3_step04.0322.0322.3	1.4575	0.1681	3290.53	46	1200.0%	1	K.DSTSIATEYSLKFDESMTEDEIEEQSFR.S
*	TK120303_NMyc_cyto3_step03.2016.2016.2	1.1558	0.1412	3116.49	59	1350.0%	1	R.EFLSALGDDQDWFDEDFGLSSSHKIQK.N
*	TK120303_NMyc_cyto3_step04.0647.0647.2	0.744	0.0699	2882.06	8	1200.0%	1	R.GILDDLQLDSTAHTAKQDTVELQNQK.S
*	TK120303_NMyc_cyto3_step12.4278.4278.3	2.2129	0.2655	4580.24	11	1150.0%	1	R.TGGQCHLPIKSHQHCYSWSDESLSMTQSETTSDQSDIEGR.I
*	TK120303_NMyc_cyto3_step10.2360.2360.3	2.0485	0.0827	4007.25	16	1180.0%	3	K.LDRGTSTSRPLNATATPLSGVSYEDDFVSSPGTGTSTEK.K
*	TK120303_NMyc_cyto3_step04.2015.2015.2	1.3868	0.1689	2040.06	6	2650.0%	1	K.DLVGLAIENLHKSEEMLK.E
*	TK120303_NMyc_cyto3_step11.1135.1135.1	1.1478	0.0641	1328.7	110	4090.0%	1	K.SCTSVSKQESSK.G
*	TK120303_NMyc_cyto3_step01.3460.3460.3	2.247	0.1706	4098.91	11	1250.0%	3	R.KNHNMASRPLTFTPQPYVTSPAAYTDALLKPSASQYK.S
UQ9UIS893.0%106613.6%3023174510.8(Q9UIS8) Testis-specific methyl-CpG binding protein 2 
	TK120303_NMyc_cyto3_step06.2224.2224.2	1.443	0.0148	1611.34	13	3670.0%	8	R.REPVPFPSGSAGPGPR.G
*	TK120303_NMyc_cyto3_step05.4344.4344.2	0.9027	0.0284	2637.95	96	1430.0%	1	R.CLLCLECAYPLPLHLVNSYSSK.T
	TK120303_NMyc_cyto3_step06.1679.1679.2	1.0217	0.0133	1762.09	1	3240.0%	1	R.EPVPFPSGSAGPGPRGPR.A
UUE3A_MOUSE92.9%112.1%8851011765.1(O08759) Ubiquitin-protein ligase E3A (EC 6.3.2.-) (Oncogenic protein-associated protein E6-AP) 
	TK120303_NMyc_cyto3_step06.3027.3027.2	2.4287	0.3771	2206.88	1	3060.0%	1	R.LPTSHTCFNVLLLPEYSSK.E
UO8846492.8%484.2%356417658.6(O88464) Heparan sulfate 2-sulfotransferase 
	TK120303_NMyc_cyto3_step03.1052.1052.1	0.8339	0.0501	555.37	65	3750.0%	2	R.AHAVR.E
	TK120303_NMyc_cyto3_step01.2575.2575.1	1.7843	0.257	1227.78	3	5560.0%	2	R.YHVLHINTTK.N
UMYO6_MOUSE92.8%9913.6%12651464098.8(Q64331) Myosin VI 
*	TK120303_NMyc_cyto3_step09.1884.1884.2	2.7368	0.2584	1848.58	1	5000.0%	1	R.LPQPSDQHFTSVVHQK.H
*	TK120303_NMyc_cyto3_step02.3313.3313.2	1.6178	0.0567	2925.61	11	1800.0%	1	K.SAPSLEYCAELLGLDQDDLRVSLTTR.V
*	TK120303_NMyc_cyto3_step02.3368.3368.3	1.9952	0.0647	3382.4	8	1380.0%	1	R.CGGIQYLQSAIESRQARPTYATAMLQNLLK.-
*	TK120303_NMyc_cyto3_step12.4346.4346.2	1.5583	0.0532	2608.09	3	2380.0%	1	K.KDVEDNCSLMYLNEATLLHNVK.V
	TK120303_NMyc_cyto3_step09.1885.1885.1	1.5796	0.0405	913.45	22	5710.0%	1	K.RGAEILPR.Q
	TK120303_NMyc_cyto3_step04.4277.4277.2	1.4152	0.0875	2598.49	11	2380.0%	1	K.DRIYTYVANILIAVNPYFDIPK.I
	TK120303_NMyc_cyto3_step01.0939.0939.1	0.6186	0.0131	679.39	16	5000.0%	1	R.DKFIR.A
*	TK120303_NMyc_cyto3_step01.1467.1467.1	1.7238	0.1506	1285.64	3	5500.0%	1	K.DGKPEVNRQIK.N
*	TK120303_NMyc_cyto3_step11.1825.1825.3	1.5583	0.0022	3406.74	75	1370.0%	1	K.NFDLFRVVAGVLHLGNIDLEEAGSTSGGCNLK.N
UQ6086492.8%465.0%543625826.8(Q60864) MSTI1 
	TK120303_NMyc_cyto3_step02.1329.1329.1	1.2837	0.2304	861.69	4	5830.0%	1	K.HYTEAIK.R
	TK120303_NMyc_cyto3_step01.2356.2356.1	2.1897	0.1988	1490.76	1	5420.0%	2	R.LAYINPDLALEEK.N
	TK120303_NMyc_cyto3_step01.1102.1102.1	1.6597	0.2029	769.46	1	7500.0%	1	K.NPVIAQK.I
UQ99K5192.7%339.7%630707425.6(Q99K51) Hypothetical 70.7 kDa protein 
	TK120303_NMyc_cyto3_step05.2808.2808.1	2.2358	0.1247	1415.49	1	5450.0%	1	K.AYFHLLNQIAPK.G
	TK120303_NMyc_cyto3_step02.2857.2857.3	1.9347	0.2506	2807.89	27	1800.0%	1	K.TISSSLAVVDLIDAIQPGCINYDLVK.S
	TK120303_NMyc_cyto3_step03.2767.2767.2	1.3469	0.0439	2712.09	10	1820.0%	1	K.ALENDPDCRHVIPMNPNTDDLFK.A
UO3594592.7%226.2%501545887.7(O35945) Aldehyde dehydrogenase Ahd-2-like 
*	TK120303_NMyc_cyto3_step01.2531.2531.1	1.1108	0.073	1112.81	22	4000.0%	1	K.VSFTGSTEVGK.L
*	TK120303_NMyc_cyto3_step05.2476.2476.2	2.5606	0.3607	2171.3	1	4470.0%	1	K.KYILGNPLNSGINQGPQIDK.E
UNDR2_MOUSE92.7%5923.7%371407895.4(Q9QYG0) NDRG2 protein (Ndr2 protein) 
	TK120303_NMyc_cyto3_step09.4192.4192.3	2.1684	0.1472	3908.34	40	1290.0%	2	K.EAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPK.R
*	TK120303_NMyc_cyto3_step06.3197.3197.2	2.5352	0.3455	2659.19	2	3100.0%	1	R.GIIQHAPNLENIELYWNSYNNR.R
*	TK120303_NMyc_cyto3_step09.1872.1872.3	1.4853	0.0037	3242.36	17	1380.0%	2	R.GGETTLKCPVMLVVGDQAPHEDAVVECNSK.L
UCAD2_HUMAN92.7%7277.5%906998514.8(P19022) Neural-cadherin precursor (N-cadherin) (Cadherin-2) 
*	TK120303_NMyc_cyto3_step10.3970.3970.2	1.5338	0.0391	3107.05	1	2240.0%	5	R.IAGALRTLLPLLLALLQASVEASGEIALCK.T
*	TK120303_NMyc_cyto3_step07.2865.2865.3	2.1558	0.0123	4037.16	2	1350.0%	1	R.YSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIAR.F
UQ96A9092.6%52512.0%217235738.5(Q96A90) G6b-C protein precursor 
*	TK120303_NMyc_cyto3_step11.3286.3286.3	2.6447	0.2016	3011.62	2	2200.0%	5	R.FDHSLDLLCPPHIAPLVKTEPQRPVK.E
UQ6084592.6%244.1%686789359.1(Q60845) Dystonin isoform 2 (Fragment) 
	TK120303_NMyc_cyto3_step04.2168.2168.3	1.8023	0.0236	3121.82	6	1670.0%	2	R.RPSSGNASYRCSMSSSADFSDEDDFSQK.S
UQ8R2Y692.6%4616.9%320354248.1(Q8R2Y6) Hypothetical 35.4 kDa protein 
	TK120303_NMyc_cyto3_step05.2325.2325.2	1.1903	0.1556	2401.4	12	2250.0%	1	K.TQMKFSVQTMCPIEGEGNIAR.F
	TK120303_NMyc_cyto3_step11.2942.2942.2	1.5827	0.1455	2442.71	91	1750.0%	1	K.HNAVTLTLIDSWVDIAMFQLR.E
	TK120303_NMyc_cyto3_step09.1547.1547.1	1.3147	0.1805	1296.07	1	5000.0%	2	R.VLSTVHTHSSVK.N
UQ9D8X592.6%254578.6%292335744.8(Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) 
	TK120303_NMyc_cyto3_step03.3440.3440.2	2.5608	0.1169	2881.89	1	2710.0%	21	K.FNLTEDMYSQDSIDLLANSGLQFQK.H
UQ91V2492.6%796.0%21592368817.3(Q91V24) ATP-binding cassette transporter sub-family A member 7 
	TK120303_NMyc_cyto3_step11.1606.1606.2	1.6106	0.1369	2133.06	3	2750.0%	1	R.LCLGIPPGECFGLLGVNGAGK.T
*	TK120303_NMyc_cyto3_step11.2871.2871.2	1.364	0.1027	3167.05	2	1610.0%	1	R.RLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGR.N
*	TK120303_NMyc_cyto3_step08.1279.1279.3	1.2408	0.0221	1775.24	14	2500.0%	1	K.VLVEEPPLGLVPGVSIR.G
*	TK120303_NMyc_cyto3_step05.2899.2899.3	2.8117	0.1165	2901.77	1	2600.0%	2	K.GWHAMVAFVNRANNGLLHALLPSGPVR.H
*	TK120303_NMyc_cyto3_step06.3469.3469.2	1.018	0.0331	2156.38	5	2380.0%	1	R.AVGGGARPQESDQPTSQGSVTK.L
*	TK120303_NMyc_cyto3_step05.1943.1943.1	1.5094	0.0566	1074.56	27	4440.0%	1	R.FGAGHTLTLR.V
UANX3_MOUSE92.5%354.6%323363715.5(O35639) Annexin III (Lipocortin III) (Placental anticoagulant protein III) (PAP-III) (35-alpha calcimedin) 
*	TK120303_NMyc_cyto3_step01.2838.2838.1	1.2472	0.0471	1072.88	22	5000.0%	1	K.TLINILTER.S
	TK120303_NMyc_cyto3_step05.1245.1245.1	2.1744	0.2044	711.69	2	8000.0%	2	R.LHQALK.G
UQ9JLN592.5%5711.0%592665568.7(Q9JLN5) Erythroid membrane-associated protein ERMAP 
*	TK120303_NMyc_cyto3_step12.2108.2108.2	1.4521	0.0745	2374.3	12	2370.0%	1	K.LLYEQAMEVESLLEDHAKEK.G
*	TK120303_NMyc_cyto3_step11.2521.2521.2	1.5913	0.1795	1774.13	194	2500.0%	1	R.DAHKESYILQISNVR.L
*	TK120303_NMyc_cyto3_step08.3582.3582.2	1.2839	0.0409	2603.5	14	1740.0%	1	R.ALLSLSEVHSLDENGLFRTAVSSR.I
*	TK120303_NMyc_cyto3_step05.1245.1245.1	2.1744	0.2044	711.69	2	8000.0%	2	R.LHKALK.K
UQ9D5V592.5%463.8%780909747.8(Q9D5V5) 4921514I20Rik protein 
	TK120303_NMyc_cyto3_step10.1111.1111.2	1.0969	0.0511	1529.94	36	2920.0%	1	K.INLIGRLQLTTER.M
	TK120303_NMyc_cyto3_step01.2010.2010.1	1.0633	0.149	1143.9	7	4500.0%	1	K.LALPADSVNIK.I
	TK120303_NMyc_cyto3_step05.1245.1245.1	2.1744	0.2044	711.69	2	8000.0%	2	K.IHQALK.E
UK2C8_MOUSE92.5%5716.0%488543185.6(P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A) 
	TK120303_NMyc_cyto3_step04.4441.4441.3	1.2289	0.0679	4295.13	8	1140.0%	1	R.GSMGTGVGLGGFGGAGVGGITAVTVNQSLLSPLKLEVDPNIQAVR.T
	TK120303_NMyc_cyto3_step01.0704.0704.2	1.4523	0.1221	1257.82	10	5000.0%	1	R.QLEALGQEKLK.L
	TK120303_NMyc_cyto3_step01.2483.2483.1	2.145	0.2022	1385.68	1	5910.0%	2	K.SLNNKFASFIDK.V
	TK120303_NMyc_cyto3_step05.1585.1585.1	1.1441	0.1185	1152.39	2	5560.0%	1	K.YEELQTLAGK.H
UMAP4_HUMAN92.5%446.2%11521210195.4(P27816) Microtubule-associated protein 4 (MAP 4) 
*	TK120303_NMyc_cyto3_step06.1336.1336.1	1.9787	0.2419	1347.59	1	5830.0%	1	K.HVPGGGNVQIQNK.K
*	TK120303_NMyc_cyto3_step12.0735.0735.2	1.1031	0.0359	2312.66	50	1900.0%	1	K.DMAQLPETEIAPAKDVAPSTVK.E
*	TK120303_NMyc_cyto3_step09.3041.3041.3	1.9071	0.0026	3354.68	40	1500.0%	1	K.MYHDDDLADLVFPSSATADTSIFAGQNDPLK.D
*	TK120303_NMyc_cyto3_step04.1076.1076.1	1.4243	0.1353	659.32	5	7000.0%	1	K.EVALVK.D
UOASL_MOUSE92.4%226.3%473546268.7(Q9Z2F2) 54 kDa 2'-5'-oligoadenylate synthetase like protein (EC 2.7.7.-) (p54 OASL) (p54OASL) (M1204) 
*	TK120303_NMyc_cyto3_step02.3180.3180.2	1.207	0.0321	1915.85	38	2190.0%	1	R.SKGYPGDFSPSFTELQR.H
*	TK120303_NMyc_cyto3_step12.1471.1471.1	2.2151	0.1358	1570.7	1	5420.0%	1	R.DELLLDQEVRVIK.V
UQ8R5L092.3%116.5%155175529.5(Q8R5L0) Age-related protein 
*	TK120303_NMyc_cyto3_step01.2916.2916.1	1.7023	0.2487	1112.62	5	5000.0%	1	K.GINKIVQVLK.V
UQ8WX1992.3%6814.2%698781547.4(Q8WX19) BA490F3.2.1 (Novel protein isoform 1) 
*	TK120303_NMyc_cyto3_step04.1764.1764.3	2.1691	0.0262	2757.64	10	1980.0%	1	K.VAIHCHAGLGRTGVLIACYLVFATR.M
*	TK120303_NMyc_cyto3_step05.2019.2019.2	1.1904	0.1052	1552.57	58	4230.0%	1	K.DNGSPIFHGRIIPK.E
*	TK120303_NMyc_cyto3_step08.2248.2248.3	2.5521	0.1772	2249.11	1	2890.0%	1	K.AFTKVNFDSENGPTVYNTLK.K
*	TK120303_NMyc_cyto3_step11.3174.3174.2	1.8913	0.0755	2509.6	46	1750.0%	2	K.IIHLVCKLLLDLAENRPVMMK.D
*	TK120303_NMyc_cyto3_step09.1920.1920.3	2.0321	0.0679	2375.09	25	2220.0%	1	R.EFTQFLTPLRNIFSCCDPK.A
UM1A2_HUMAN92.2%6362.3%641730047.6(O60476) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2) 
	TK120303_NMyc_cyto3_step07.3228.3228.2	2.149	0.0686	1823.69	1	5360.0%	6	K.MDRPNGLYPNYLNPR.T
UQ96AA292.2%13194.4%66207217015.8(Q96AA2) Obscurin 
*	TK120303_NMyc_cyto3_step12.3207.3207.2	1.2349	0.0735	2569.6	3	2270.0%	1	R.LTVRNVSADDDAVYICETPEGSR.T
*	TK120303_NMyc_cyto3_step07.3052.3052.2	1.3443	0.1003	3155.9	1	1960.0%	1	R.QVAAGEDVSLELEVVAEAGEVIWHKGMER.I
*	TK120303_NMyc_cyto3_step12.2375.2375.2	1.4187	0.1461	2386.06	33	1900.0%	1	R.GPMHTLTLSGLRPEDSGLMVFK.A
*	TK120303_NMyc_cyto3_step11.1413.1413.2	1.3093	0.023	1856.62	1	4060.0%	1	R.CLAENSMGVSSTKAELR.V
*	TK120303_NMyc_cyto3_step06.2271.2271.3	1.8421	0.0956	3269.42	319	1430.0%	1	K.ALDDLSAEERGTLALQCEVSDPEAHVVWR.K
*	TK120303_NMyc_cyto3_step08.3468.3468.3	1.4381	0.1627	3889.8	174	1000.0%	1	R.VVKFMSGLSTVVAEEGGEATFQCVVSPSDVAVVWFR.D
*	TK120303_NMyc_cyto3_step05.2771.2771.2	1.3253	0.0511	2555.09	14	1900.0%	1	R.EKESATFLCEVPQPSTEAAWFK.E
*	TK120303_NMyc_cyto3_step12.3591.3591.2	1.7148	0.0709	3019.73	12	1670.0%	3	K.AFVVSVGKDATLSCQIVGNPTPQVSWEK.D
*	TK120303_NMyc_cyto3_step07.2637.2637.3	1.7599	0.047	3144.43	2	1940.0%	1	R.GLQDVTVMEPAPAWFECETSIPSVRPPK.W
*	TK120303_NMyc_cyto3_step03.0002.0002.2	0.9042	0.0803	3149.58	8	1610.0%	1	K.EHEDIILTATLATPSAATVTWLKDGVEIR.R
*	TK120303_NMyc_cyto3_step01.4119.4119.2	2.0373	0.4204	3138.93	1	2240.0%	1	R.GVLWIGPDTPGYTVASSAQQHSLVLLDVGR.Q
UQ9H9U692.0%7377.1%616698666.2(Q9H9U6) Hypothetical protein FLJ12543 
*	TK120303_NMyc_cyto3_step09.3001.3001.2	2.003	0.0447	2300.07	2	3060.0%	6	R.QVLENIHFPLIPKNDLLHR.V
*	TK120303_NMyc_cyto3_step08.1616.1616.3	1.4617	0.0373	3033.04	8	2080.0%	1	R.ECEHDLLQAALQWLTQQPEREAHAR.Q
UADFP_HUMAN92.0%6818.5%437480756.8(Q99541) Adipophilin (Adipose differentiation-related protein) (ADRP) 
*	TK120303_NMyc_cyto3_step10.1817.1817.2	1.2884	0.1033	2294.7	40	1820.0%	1	R.LPILNQPSTQIVANAKGAVTGAK.D
*	TK120303_NMyc_cyto3_step03.3395.3395.2	1.0876	0.0196	2388.35	141	1430.0%	1	R.VVNLPLVSSTYDLMSSAYLSTK.D
*	TK120303_NMyc_cyto3_step05.2881.2881.2	2.6854	0.0561	2197.06	1	4720.0%	1	K.SQQTISQLHSTVHLIEFAR.K
*	TK120303_NMyc_cyto3_step12.2166.2166.2	1.1526	0.0688	2451.99	12	2000.0%	1	K.QKSQQTISQLHSTVHLIEFAR.K
*	TK120303_NMyc_cyto3_step03.3499.3499.3	1.9065	0.0147	3930.12	25	1180.0%	2	-.MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTK.D
URB1A_HUMAN92.0%1110.2%205226786.2(P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein) 
	TK120303_NMyc_cyto3_step09.2620.2620.2	2.3223	0.3832	2308.17	1	3000.0%	1	R.GAHGIIVVYDVTDQESFNNVK.Q
UMY9B_MOUSE92.0%6122.8%21142388328.6(Q9QY06) Myosin IXb (Unconventional myosin-9b) 
*	TK120303_NMyc_cyto3_step01.0743.0743.1	0.8282	0.0667	532.3	2	6000.0%	1	R.EAAGGK.L
*	TK120303_NMyc_cyto3_step11.2639.2639.2	1.6166	0.0167	2442.18	19	2000.0%	3	R.GEKDTNLVLNVFQSLLDEFTR.S
	TK120303_NMyc_cyto3_step02.1776.1776.1	1.0344	0.012	1025.11	38	4290.0%	1	K.VFLKETER.Q
*	TK120303_NMyc_cyto3_step06.3589.3589.2	2.3214	0.3799	2613.21	1	2290.0%	1	K.KPSLEGVEETESNGGQAAQETPARK.T
USCP1_MOUSE92.0%9396.4%9931159625.8(Q62209) Synaptonemal complex protein 1 (SCP-1 protein) 
*	TK120303_NMyc_cyto3_step02.3704.3704.3	1.4984	0.0283	3581.18	18	1480.0%	1	K.QKPFTLFVPPRLSSSQVSAVKPQTAGGDSNYFK.T
*	TK120303_NMyc_cyto3_step05.1755.1755.1	0.9322	0.1446	1090.17	1	3750.0%	1	K.EAQMEELNK.A
*	TK120303_NMyc_cyto3_step09.2032.2032.1	1.1341	0.0152	939.62	17	5000.0%	6	K.YIPTGGSNK.K
*	TK120303_NMyc_cyto3_step11.0121.0121.2	1.5579	0.1787	1527.17	2	4580.0%	1	K.NILAEDQKLLDEK.K
UATFB_MOUSE92.0%7376.6%699760076.7(O35451) Cyclic-AMP-dependent transcription factor ATF-6 beta (Activating transcription factor 6 beta) (ATF6-beta) (cAMP responsive element binding protein-like 1) (cAMP response element binding protein-related protein) (Creb-rp) 
*	TK120303_NMyc_cyto3_step03.3303.3303.3	2.1881	0.0402	3600.15	21	1290.0%	1	K.TESPSPPGCLLWDVPASSLGAVQISMGPSPDSSSGK.A
	TK120303_NMyc_cyto3_step02.2299.2299.1	1.6066	0.148	1209.83	2	6110.0%	6	K.KEYLQGLEAR.L
URSU1_MOUSE91.9%51112.6%277315508.9(Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1) 
	TK120303_NMyc_cyto3_step08.1330.1330.1	2.1645	0.1617	1276.54	1	7000.0%	1	R.HMQANPEPPKK.N
	TK120303_NMyc_cyto3_step08.2134.2134.2	1.6119	0.1908	2027.56	9	2940.0%	1	R.DNDLISLPKEIGELTQLK.E
	TK120303_NMyc_cyto3_step05.1027.1027.1	0.8277	0.0341	629.43	59	5000.0%	3	R.KPLAAK.N
UQ9CW1991.7%3326.6%184207269.4(Q9CW19) 1500041B16Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step02.3244.3244.3	1.9012	0.0035	2462.46	13	1930.0%	1	K.IKPTTLQVENISIGGVLVPLELK.G
*	TK120303_NMyc_cyto3_step03.2660.2660.3	1.664	0.0948	2978.53	3	2000.0%	1	R.QPIQITMPVSPSCGCGDMASEQRNCR.G
UQ9CZ8591.7%63623.7%114127155.0(Q9CZ85) 2810038F24Rik protein 
*	TK120303_NMyc_cyto3_step08.3332.3332.2	2.3513	0.1819	3009.69	19	1920.0%	6	R.AQYTLMAQAVDRDTNKPLGPPSEFIDK.D
UMY9B_HUMAN91.6%886.5%21582435558.7(Q13459) Myosin IXb (Unconventional myosin-9b) 
*	TK120303_NMyc_cyto3_step03.3783.3783.2	1.8185	0.0388	2148.72	1	3250.0%	1	R.AEKAAGMSSPGAQSHPEELPR.G
*	TK120303_NMyc_cyto3_step03.2436.2436.3	1.3373	0.0138	3505.91	9	1470.0%	1	K.LEQEEYQGEGITWHNIGYTDNVGCIHLISK.K
*	TK120303_NMyc_cyto3_step05.2333.2333.3	1.7065	0.0773	3145.87	84	1250.0%	1	K.QQHEDNKYFLGTPVMEPAFIIQHFAGK.V
*	TK120303_NMyc_cyto3_step09.3585.3585.2	1.512	0.0607	2327.37	2	2620.0%	1	K.LVAAASPSAMLSQSLDLSDRHR.A
*	TK120303_NMyc_cyto3_step01.2980.2980.1	1.4229	0.0518	1292.87	3	4500.0%	1	R.EVISTLLEKMK.I
*	TK120303_NMyc_cyto3_step04.1283.1283.1	0.87	0.0114	962.48	288	4170.0%	1	R.RHFLQMK.R
*	TK120303_NMyc_cyto3_step01.2190.2190.1	2.1681	0.1332	1156.76	4	6880.0%	1	K.YLDEFLLNK.I
*	TK120303_NMyc_cyto3_step02.0432.0432.1	0.8565	0.035	1383.32	1	2920.0%	1	K.QPTEQPQAMAVGK.V
ULMA5_MOUSE91.5%11115.4%37184040136.7(Q61001) Laminin alpha-5 chain precursor 
*	TK120303_NMyc_cyto3_step03.2455.2455.3	1.7692	0.0384	2822.04	2	2300.0%	1	R.LLLGGLPVSGTFHNFSGCISNVFVQR.L
*	TK120303_NMyc_cyto3_step12.4406.4406.2	1.4454	0.0165	2704.79	8	1880.0%	1	R.EQVLPAGQIVNCDCNAAGTQGNACR.K
*	TK120303_NMyc_cyto3_step02.0627.0627.2	0.7843	0.0791	1990.32	2	2500.0%	1	R.CDCSPCGTETCDPQSGR.C
*	TK120303_NMyc_cyto3_step03.3860.3860.3	1.7715	0.183	2791.44	2	2120.0%	1	K.IAHAKAVAAEALSTATHVQSQLQGMQK.N
*	TK120303_NMyc_cyto3_step12.2859.2859.2	2.1156	0.3901	2461.68	1	2950.0%	1	R.SPSLVLFLNHGHFVAQTEGPGPR.L
*	TK120303_NMyc_cyto3_step01.2752.2752.1	1.4906	0.1131	1456.05	1	3750.0%	1	R.LEVDTQSNHTTGR.L
*	TK120303_NMyc_cyto3_step09.2817.2817.3	2.3573	0.2262	3130.9	13	1790.0%	1	K.NQLAAQIQEAQAMLAMDTSETSEKIAHAK.A
*	TK120303_NMyc_cyto3_step09.1337.1337.3	1.5244	0.0666	2900.79	34	1900.0%	1	R.ITASATCGEEAPTRSVSRPTEDLYCK.L
*	TK120303_NMyc_cyto3_step03.0384.0384.2	0.859	0.0093	1507.98	6	3180.0%	1	K.ENVQGSRCDQCR.V
	TK120303_NMyc_cyto3_step08.1278.1278.1	0.8759	0.1014	557.38	22	6250.0%	1	R.VPEGR.W
*	TK120303_NMyc_cyto3_step09.2693.2693.3	2.013	0.0307	2831.07	2	2100.0%	1	R.EQVLPAGQIVNCDCNAAGTQGNACRK.D
UQ1484091.5%5512.4%720819937.5(Q14840) Mitogen inducible gene mig-2 (Fragment) 
*	TK120303_NMyc_cyto3_step02.2255.2255.1	2.0935	0.2081	1339.68	1	5830.0%	1	R.VTGEVHIGGVMLK.L
*	TK120303_NMyc_cyto3_step12.3367.3367.2	1.2571	0.0446	2175.16	8	2220.0%	1	K.TMADSSYNLEVQNILSFLK.M
*	TK120303_NMyc_cyto3_step07.2916.2916.3	1.5865	0.1135	3788.69	100	1250.0%	1	K.LSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGK.T
*	TK120303_NMyc_cyto3_step03.2139.2139.1	1.1623	0.0031	1391.61	8	3750.0%	1	R.LIRMDASTGDAIK.T
*	TK120303_NMyc_cyto3_step02.2204.2204.1	1.51	0.128	1066.68	2	6880.0%	1	R.HPEELSLLK.K
UHBE_MOUSE91.5%4616.4%146160058.2(P02104) Hemoglobin epsilon-Y2 chain 
	TK120303_NMyc_cyto3_step03.2279.2279.1	2.0259	0.2247	1193.64	1	5500.0%	1	K.KVLTAFGESIK.N
	TK120303_NMyc_cyto3_step01.1572.1572.1	0.9855	0.1445	1331.64	30	2920.0%	2	K.VNVEEVGGEALGR.L
	TK120303_NMyc_cyto3_step01.2066.2066.1	1.4712	0.0523	1066.66	2	5560.0%	1	K.VLTAFGESIK.N
UQ99KN991.5%112.6%531567585.9(Q99KN9) Similar to KIAA0171 gene product (Fragment) 
	TK120303_NMyc_cyto3_step09.1695.1695.2	2.4982	0.3682	1611.66	1	5380.0%	1	K.HIHITQATETTTTR.H
USEP2_MOUSE91.3%4615.8%361415266.5(P42208) Septin 2 (NEDD5 protein) 
	TK120303_NMyc_cyto3_step01.3450.3450.2	1.3046	0.1405	2702.38	37	1900.0%	1	K.TIISYIDEQFERYLHDESGLNR.R
	TK120303_NMyc_cyto3_step03.0431.0431.1	0.9156	0.1276	953.2	82	3120.0%	2	K.VNIVPVIAK.A
	TK120303_NMyc_cyto3_step05.2699.2699.2	2.089	0.395	2953.44	1	2800.0%	1	K.QQPTQFINPETPGYVGFANLPNQVHR.K
UTP2A_MOUSE91.3%446.2%15281728768.7(Q01320) DNA topoisomerase II, alpha isozyme (EC 5.99.1.3) 
*	TK120303_NMyc_cyto3_step05.3811.3811.3	1.4741	0.3014	4497.43	18	1090.0%	1	K.VPDEEENEESDTETSTSDSAAEAGPTFNYLLDMPLWYLTK.E
	TK120303_NMyc_cyto3_step07.1777.1777.1	1.4641	0.3359	1126.68	3	5000.0%	1	K.TLAVSGLGVVGR.D
	TK120303_NMyc_cyto3_step12.3028.3028.2	1.3174	0.0223	1733.31	213	2330.0%	1	K.AAIGCGIVESILNWVK.F
	TK120303_NMyc_cyto3_step02.3532.3532.2	1.5031	0.0185	2905.25	56	1600.0%	1	K.ELILFSNSDNERSIPSMVDGLKPGQR.K
UQ9D7I891.2%7926.2%585643246.8(Q9D7I8) 2310007D09Rik protein 
*	TK120303_NMyc_cyto3_step04.3060.3060.2	1.4139	0.0277	2644.74	4	2050.0%	1	R.AKPKRPDSEASTISDEDYFHSHK.D
*	TK120303_NMyc_cyto3_step03.1628.1628.2	1.5797	0.0438	1977.51	360	1760.0%	1	K.DQLEDSKVADAATQTEPR.E
*	TK120303_NMyc_cyto3_step08.3027.3027.3	2.8021	0.3585	3550.43	2	1940.0%	2	-.MAARFELLDDLPAACLSPCGPPNPTELFSEAR.R
*	TK120303_NMyc_cyto3_step01.2640.2640.3	1.5625	0.1557	3245.98	1	1580.0%	1	R.AASSQATVWSKSTTTQTEADESFLPQGAQSK.E
*	TK120303_NMyc_cyto3_step04.4345.4345.2	1.2586	0.0025	2860.43	78	1300.0%	1	R.EVIAVVMDVFSDIDIFRDLQESCR.K
*	TK120303_NMyc_cyto3_step04.3088.3088.2	1.3895	0.0755	2991.68	13	1460.0%	1	K.RGVAVYILLDQTLLPHFLDMCMDLR.V
UQ91YE491.2%4612.4%564666476.4(Q91YE4) 67 kDa polymerase-associated factor PAF67 
	TK120303_NMyc_cyto3_step08.3102.3102.3	1.607	0.0012	3122.89	8	1700.0%	2	K.FLSPVVPNYDNVHPNYHKEPFLQQLK.V
	TK120303_NMyc_cyto3_step12.1323.1323.3	2.7895	0.3447	3534.46	1	1670.0%	1	-.MSYPADDYESEAAYDPYAYPGDYDMHTGDPK.Q
	TK120303_NMyc_cyto3_step02.0445.0445.1	0.972	0.0779	1577.21	18	2920.0%	1	R.VFANILLYIQRTK.S
UADK_MOUSE91.2%113.9%279311037.4(P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment) 
	TK120303_NMyc_cyto3_step04.2031.2031.1	1.5536	0.2655	1157.61	1	6500.0%	1	R.AGHYAASVIIR.R
UZF25_HUMAN91.1%224.1%783906739.3(Q9UII5) Zinc finger protein ZFD25 
*	TK120303_NMyc_cyto3_step11.1649.1649.1	1.018	0.0356	1185.5	9	4440.0%	1	K.AFNRFSTLTK.H
*	TK120303_NMyc_cyto3_step02.3381.3381.2	2.0097	0.4606	2588.46	1	2380.0%	1	K.SFNQFSSLNIHKIIHTGEKPYK.C
UQ9D9R191.1%6364.8%440495666.6(Q9D9R1) Adult male testis cDNA, RIKEN full-length enriched library, clone:1700030N20, full insert sequence 
	TK120303_NMyc_cyto3_step06.3136.3136.2	1.511	0.2725	2386.51	1	2250.0%	6	K.VVGHRGSVDHENWVSSYNALR.A
UQ9NU1291.1%116.4%203237386.4(Q9NU12) DJ102H19.3 (Novel protein) 
*	TK120303_NMyc_cyto3_step01.2068.2068.1	2.1316	0.1552	1359.57	2	5000.0%	1	K.LANTQGELLSIAK.Q
URGL2_MOUSE91.0%356.8%778838276.7(Q61193) Ral guanine nucleotide dissociation stimulator-like 2 (RalGDS-like factor) 
	TK120303_NMyc_cyto3_step07.3060.3060.2	1.1695	0.0622	2405.68	231	1750.0%	1	R.DRPGHSHLCPSVRATVTQFNK.V
*	TK120303_NMyc_cyto3_step03.3692.3692.2	2.6163	0.2206	2995.61	4	1940.0%	2	R.RPSAATPGSHSGPSASGTPPSEGGGGSFPRIK.A
UCA1C_MOUSE90.9%16208.4%31193402455.6(Q60847) Collagen alpha 1(XII) chain precursor 
*	TK120303_NMyc_cyto3_step07.2573.2573.2	1.6538	0.2484	2810.4	5	1920.0%	1	K.YEISVIAEYPSGPGSPLTGNAATEEVR.G
*	TK120303_NMyc_cyto3_step04.3018.3018.2	1.7269	9.0E-4	2410.22	18	2860.0%	1	K.VKQYLVTYTPAAGGETQEVTVR.G
*	TK120303_NMyc_cyto3_step04.1724.1724.1	2.1762	0.2092	1417.6	6	4230.0%	2	R.AGFPKVGIIITDGK.S
	TK120303_NMyc_cyto3_step07.1111.1111.1	0.6987	0.0459	437.35	13	7500.0%	1	R.QYK.L
*	TK120303_NMyc_cyto3_step08.3658.3658.3	1.4874	0.1396	4718.5	3	1160.0%	1	K.GTEKALPVPVVSLNIYDVGPTTMHVQWQPVGGATGYTVSYQPTR.S
	TK120303_NMyc_cyto3_step08.3414.3414.2	1.2305	0.0568	2484.86	335	1360.0%	1	K.GAKADIVFLTDASWSIGDDNFNK.V
	TK120303_NMyc_cyto3_step04.4249.4249.2	0.8994	0.0791	1086.17	52	3570.0%	1	K.RQEFYVSR.L
	TK120303_NMyc_cyto3_step05.1775.1775.1	0.7515	0.0553	509.08	10	5000.0%	2	R.ANFR.T
*	TK120303_NMyc_cyto3_step12.3438.3438.2	1.208	0.0261	3112.98	101	1430.0%	1	R.NLQPDTPYTITVVPVYTEGDGGRTSDTGR.T
*	TK120303_NMyc_cyto3_step04.0381.0381.1	1.1234	0.3101	1199.56	17	3000.0%	1	R.ITWAPVGNPDK.M
	TK120303_NMyc_cyto3_step04.2347.2347.2	1.0475	0.1224	2187.8	1	3160.0%	1	K.DEGVELFAIGIKNADEVELK.M
	TK120303_NMyc_cyto3_step01.1432.1432.1	1.2694	0.0198	1144.51	22	5000.0%	1	K.WDPASGRVQK.Y
*	TK120303_NMyc_cyto3_step03.2360.2360.1	1.3274	0.0345	1311.57	38	4500.0%	1	R.EPFIVPVEPER.T
*	TK120303_NMyc_cyto3_step05.3273.3273.3	1.8922	0.2064	3809.12	11	1430.0%	1	R.GSETSHCFTGLSPEAEYGVTVFVQTPNLEGPGVPIK.E
UO4316390.9%7195.1%689787285.4(O43163) Hypothetical protein KIAA0436 (Fragment) 
*	TK120303_NMyc_cyto3_step09.3317.3317.3	2.2472	0.1202	3051.73	88	1480.0%	3	K.DTGEGYQTPNIILDIQPGGNHVIEDSHK.K
*	TK120303_NMyc_cyto3_step06.2195.2195.1	1.3137	0.0616	801.82	7	5830.0%	1	K.KITAQIK.F
UQ96QE390.9%161087.5%12041358379.3(Q96QE3) ATP/GTP-binding protein 
*	TK120303_NMyc_cyto3_step12.1986.1986.2	1.1789	0.0707	1910.89	26	2940.0%	1	K.AADPVPSFDESSQDTSEK.S
*	TK120303_NMyc_cyto3_step03.1426.1426.1	0.9332	0.0016	1132.59	254	5000.0%	1	R.SGRQILSQLK.E
*	TK120303_NMyc_cyto3_step06.1147.1147.1	1.1105	0.0148	694.05	1	7000.0%	1	K.SEELSK.R
*	TK120303_NMyc_cyto3_step09.2991.2991.2	2.1538	0.0894	2370.25	2	2890.0%	10	K.EDYSLNNDFVESSTSVLRYK.K
*	TK120303_NMyc_cyto3_step12.1704.1704.2	1.4408	0.0938	2663.98	14	1960.0%	2	K.TAAVYACAQELGFKIFEVNASSQR.S
*	TK120303_NMyc_cyto3_step01.1768.1768.1	1.595	0.1443	1348.59	2	5000.0%	1	R.DFLMSGLPDLLK.R
UPODX_HUMAN90.7%225.5%528555965.6(O00592) Podocalyxin-like protein 1 precursor 
*	TK120303_NMyc_cyto3_step04.2286.2286.1	1.6532	0.2454	1364.52	4	4580.0%	1	K.SSHSVTTDLTSTK.A
*	TK120303_NMyc_cyto3_step11.3266.3266.3	1.9892	0.0272	3086.64	12	1610.0%	1	K.SSHSVTTDLTSTKAEHLTTPHPTSPLSPR.Q
UO0879490.7%9915.1%9661094046.2(O08794) Alpha glucosidase II, alpha subunit 
*	TK120303_NMyc_cyto3_step02.2716.2716.1	0.7917	0.1136	725.55	109	5000.0%	1	R.SSDCMK.D
*	TK120303_NMyc_cyto3_step03.2678.2678.1	1.5642	0.2577	1350.77	1	5000.0%	1	K.GHLETPIWIER.V
*	TK120303_NMyc_cyto3_step04.3042.3042.3	1.7655	0.0211	2762.07	17	1500.0%	1	K.ISIPMCLSLALVGLSFCGADVGGFFK.N
*	TK120303_NMyc_cyto3_step04.1572.1572.1	1.2461	0.0248	831.6	32	6670.0%	1	R.NHGLYVK.T
*	TK120303_NMyc_cyto3_step04.1539.1539.1	1.4977	0.0522	945.56	1	6110.0%	1	-.MAAIAAVAAR.R
*	TK120303_NMyc_cyto3_step01.4326.4326.2	1.2013	0.0052	2500.64	98	1820.0%	1	R.ALLDTLQLGPDALTVHLIHEVTK.V
*	TK120303_NMyc_cyto3_step08.3340.3340.3	1.9516	0.0177	3014.33	336	1300.0%	1	K.GHLETPIWIERVVIMGAGKPAAVVLQTK.G
*	TK120303_NMyc_cyto3_step11.2577.2577.2	1.427	0.0692	2667.46	2	2050.0%	1	R.DGSDYEGWCWPGSASYPDFTNPR.M
*	TK120303_NMyc_cyto3_step11.3890.3890.3	1.5517	0.0578	2580.01	1	2160.0%	1	R.RSWLSLVLAYLGVCLGITLAVDR.S
UQ921J090.5%228.9%564643865.9(Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) 
*	TK120303_NMyc_cyto3_step04.3486.3486.3	2.0088	0.1737	4380.42	16	1220.0%	1	R.TNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFK.H
	TK120303_NMyc_cyto3_step02.1908.1908.1	1.9356	0.2317	1340.48	1	5450.0%	1	K.SAFPHLQDAQVK.L
UQ8TEL190.5%339.5%9381016745.0(Q8TEL1) FLJ00182 protein (Fragment) 
*	TK120303_NMyc_cyto3_step12.3536.3536.3	3.0939	0.1824	3446.57	4	1710.0%	1	R.IQIPNDSRPENPGPLGPISGVGGGGLGSGSDDNALK.Q
*	TK120303_NMyc_cyto3_step04.1006.1006.2	0.9939	0.0109	3163.37	2	1790.0%	1	K.EAGLLAAVTLTQKIIVYLSDTTLMDILPR.I
*	TK120303_NMyc_cyto3_step04.3837.3837.2	1.8016	0.3099	2850.77	4	1960.0%	1	K.VFTLEMAYTIYVPFSCLLGDIIRK.I
UQ9NQS590.5%2210.6%396437059.5(Q9NQS5) Inflammation-related G protein-coupled receptor EX33 (Orphan G protein-coupled receptor 84) (Putative G-protein coupled receptor) 
*	TK120303_NMyc_cyto3_step04.2318.2318.1	1.5576	0.2536	1220.44	2	5000.0%	1	R.QASIHSNHVAR.T
*	TK120303_NMyc_cyto3_step08.2624.2624.3	1.8188	0.1652	3496.19	1	1750.0%	1	R.VQAPRVVHMLAANLTWLNGCINPVLYAAMNR.Q
UO9584890.5%61824.5%290315206.3(O95848) Hypothetical protein 
*	TK120303_NMyc_cyto3_step09.2579.2579.3	2.1706	0.1745	2373.97	9	2500.0%	4	K.SWDFMKTHDSVTVLLFNSSR.R
*	TK120303_NMyc_cyto3_step06.2109.2109.2	0.9295	0.0061	2091.6	3	2810.0%	1	K.EAWEECGYHLAPSDLRR.V
*	TK120303_NMyc_cyto3_step06.3065.3065.3	1.9389	0.1604	3507.06	5	1360.0%	1	R.ELQPALPGSAGVTVELCAGLVDQPGLSLEEVACK.E
UQ9CY9190.5%3311.6%601657005.1(Q9CY91) G1 to phase transition 2 
	TK120303_NMyc_cyto3_step12.3899.3899.3	1.8538	0.0337	3768.67	100	1250.0%	1	K.GQQLVMMPNKHSVEVLGIVSDDAETDFVAPGENLK.I
	TK120303_NMyc_cyto3_step11.4102.4102.2	1.6403	0.0124	2445.12	10	2170.0%	1	K.SFVPNMIGGASQADLAVLVISARK.G
	TK120303_NMyc_cyto3_step08.2310.2310.1	2.0574	0.2171	1237.83	1	6000.0%	1	K.HFTILDAPGHK.S
UQ91VW590.5%557.2%12101389305.5(Q91VW5) Golgi autoantigen, golgin subfamily a, 4 (Fragment) 
	TK120303_NMyc_cyto3_step01.0978.0978.1	1.178	0.1121	748.4	1	8000.0%	1	K.QIKTMK.A
	TK120303_NMyc_cyto3_step04.1303.1303.1	2.0535	0.2086	1473.82	1	4550.0%	1	K.ELTCQALEQRVK.E
	TK120303_NMyc_cyto3_step03.2422.2422.1	1.6549	0.017	1209.62	5	5000.0%	1	K.KECDLETALK.T
	TK120303_NMyc_cyto3_step09.2455.2455.2	1.3799	0.0053	2286.26	16	2140.0%	1	R.LKEAVSGQDVALAGLQGQLEQK.S
	TK120303_NMyc_cyto3_step10.3894.3894.3	2.154	0.0784	4004.82	1	1390.0%	1	K.NLESSPHPEVPAVSRSMQSVAASPEQEAPDSQDCTHK.A
UC1QC_MOUSE90.4%399.3%246259668.4(Q02105) Complement C1q subcomponent, C chain precursor 
*	TK120303_NMyc_cyto3_step10.2405.2405.2	2.2441	0.2916	2147.0	2	2500.0%	3	R.GTSGLPGDPGPRGPPGEPGVEGR.Y
UQ9UPW890.3%335.8%9861121036.3(Q9UPW8) Hypothetical protein KIAA1032 (Fragment) 
*	TK120303_NMyc_cyto3_step02.3416.3416.3	2.3098	0.1408	3876.43	8	1560.0%	1	K.GEEKVAPYHVQYTCLHENLFHFVTDVQNNGVVK.I
*	TK120303_NMyc_cyto3_step10.2604.2604.2	1.575	0.0336	1787.24	79	2690.0%	1	K.WLYNEYVTELPSFK.D
*	TK120303_NMyc_cyto3_step02.1664.1664.1	2.1247	0.1251	1120.61	4	5560.0%	1	K.QMGDILSQVK.G
UDCT2_MOUSE90.2%2210.0%402441175.3(Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) 
	TK120303_NMyc_cyto3_step03.1762.1762.1	2.0566	0.2057	1286.68	1	6110.0%	1	K.VHQLYETIQR.W
*	TK120303_NMyc_cyto3_step04.3082.3082.3	2.0981	0.3344	3278.73	8	1550.0%	1	K.DNTALLTQVQTTMRENLATVEGNFASIDAR.M
UTVA1_HUMAN90.1%3531.3%131147715.5(P04436) T-cell receptor alpha chain V region HPB-MLT precursor (Fragment) 
*	TK120303_NMyc_cyto3_step08.2171.2171.1	1.3588	0.0084	1551.84	6	3330.0%	1	R.RNSFDEQNEISGR.Y
*	TK120303_NMyc_cyto3_step10.3029.3029.3	2.2936	0.0659	2979.77	2	2040.0%	2	R.AVIASICVVSSMAQKVTQAQTEISVVEK.E
UQ9Z2E190.1%2210.6%4144354310.0(Q9Z2E1) Methyl-CpG binding protein MBD2 
*	TK120303_NMyc_cyto3_step02.2021.2021.1	1.3912	0.1053	1088.73	5	5500.0%	1	K.QAARGGGVCGR.G
*	TK120303_NMyc_cyto3_step02.1304.1304.2	2.4005	0.3652	2772.47	1	2030.0%	1	R.GRPQSGGSGLGGDGGGGAGGCGVGSGGGVAPRR.D
UQ6124190.1%7378.5%364413838.0(Q61241) Serine/threonine kinase 
*	TK120303_NMyc_cyto3_step02.3396.3396.2	1.6304	0.0844	2326.68	1	3420.0%	6	K.VYIVMELGVQGDLLEFIKTR.G
*	TK120303_NMyc_cyto3_step01.2883.2883.1	1.8658	0.1111	1289.68	9	4500.0%	1	R.DLKSENLLLDK.D
UHH3R_HUMAN90.1%2216.0%445486719.3(Q9Y5N1) Histamine H3 receptor (HH3R) (G protein-coupled receptor 97) 
	TK120303_NMyc_cyto3_step06.2160.2160.3	1.804	0.017	2926.93	137	1440.0%	1	R.EAAGPEPPPEAQPSPPPPPGCWGCWQK.G
*	TK120303_NMyc_cyto3_step12.3902.3902.3	2.8832	0.3387	3937.53	1	1630.0%	1	R.YGVGEAAVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPR.S
UPSD4_MOUSE90.0%353.7%376407044.8(O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) 
	TK120303_NMyc_cyto3_step05.1627.1627.1	1.3221	0.1142	751.57	3	6670.0%	2	R.VAHLALK.H
	TK120303_NMyc_cyto3_step05.1217.1217.1	1.3438	0.1667	822.41	1	7500.0%	1	K.LHTVQPK.G
UQ9ESQ189.9%81011.3%16911641459.0(Q9ESQ1) Type IV collagen alpha 6 chain 
*	TK120303_NMyc_cyto3_step04.2064.2064.3	1.4748	0.0955	3652.79	9	1250.0%	1	R.GPPGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAK.G
*	TK120303_NMyc_cyto3_step07.2599.2599.3	1.6913	0.078	3244.84	47	1320.0%	1	R.GPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGR.T
*	TK120303_NMyc_cyto3_step09.1840.1840.2	1.1734	0.1984	1401.64	7	3570.0%	1	R.GLPGIPGKPGTHGSK.G
*	TK120303_NMyc_cyto3_step05.3580.3580.3	1.6452	0.0196	3782.22	1	1440.0%	2	K.GDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFPGER.G
*	TK120303_NMyc_cyto3_step08.4207.4207.2	1.6619	0.0030	2149.27	11	2390.0%	1	K.GSSGPVGFPGLPGLPGLPGADGLK.G
*	TK120303_NMyc_cyto3_step07.1417.1417.2	1.2087	0.1831	1171.78	38	4090.0%	1	R.GDIGQPGSTGKR.G
*	TK120303_NMyc_cyto3_step11.1270.1270.3	1.6983	0.1237	2413.06	9	2080.0%	1	K.GDQGQTLGISGSPGPKGQPGELGFK.G
UQ9EST089.9%6129.7%10881225086.4(Q9EST0) NCBE 
	TK120303_NMyc_cyto3_step01.3288.3288.3	1.7308	0.0413	4253.39	3	1420.0%	1	K.EYGLSYLSLRASIGLWTATLCIILVATDASSLVCYITR.F
	TK120303_NMyc_cyto3_step03.3048.3048.2	1.9589	0.2103	2689.38	105	1350.0%	1	K.IPAVPNGTAAHGEAEPHGGHSGPELQR.T
	TK120303_NMyc_cyto3_step02.2028.2028.2	1.1043	0.0315	2290.52	4	3160.0%	1	R.FLFILLGPLGKGQQYHEIGR.S
*	TK120303_NMyc_cyto3_step03.3346.3346.2	1.4726	0.0405	2272.06	8	2500.0%	3	K.KIPPGAEASNILVGELEFLDR.A
UQ99J3689.9%113.1%350388856.1(Q99J36) Similar to hypothetical protein FLJ20274 
	TK120303_NMyc_cyto3_step10.1998.1998.1	1.8713	0.2252	1396.79	1	5000.0%	1	K.LVHHILQDMYK.T
UQ9CVS489.8%3548.6%109119769.1(Q9CVS4) 1700049J03Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step04.3711.3711.1	1.8539	0.2247	1449.58	3	3460.0%	2	-.LATRLPPPGSDAPR.S
*	TK120303_NMyc_cyto3_step09.4234.4234.3	2.1943	0.2051	4334.68	18	1180.0%	1	R.VGCYPSPGLQDSRFGSFWPLIFFPSVAGCTEGVVLAQER.K
UPPCT_MOUSE89.6%2219.2%214247857.0(P53808) Phosphatidylcholine transfer protein (PC-TP) 
*	TK120303_NMyc_cyto3_step12.3478.3478.3	3.0174	0.2749	3207.74	3	1790.0%	1	R.EACAELQKPALTGADWQLLVEASGITIYR.L
*	TK120303_NMyc_cyto3_step01.3802.3802.3	1.8128	0.1266	4610.9	23	1000.0%	1	R.EACAELQKPALTGADWQLLVEASGITIYRLLDQPSGLYEYK.V
UCPTM_HUMAN89.4%7139.8%772878018.6(Q92523) Carnitine O-palmitoyltransferase I, mitochondrial muscle isoform (EC 2.3.1.21) (CPT I) (CPTI-M) (Carnitine palmitoyltransferase I like protein) 
*	TK120303_NMyc_cyto3_step02.0405.0405.2	1.1618	0.157	2483.5	17	1750.0%	1	R.EEIKPVMALGIVPMCSYQMER.M
*	TK120303_NMyc_cyto3_step05.1625.1625.1	1.0383	0.1287	1280.53	2	3890.0%	1	R.HLFCLYLVSK.Y
*	TK120303_NMyc_cyto3_step07.1324.1324.3	1.8279	0.1364	2114.49	1	2790.0%	1	R.HPMLYSFQTSLPKLPVPR.V
*	TK120303_NMyc_cyto3_step01.3534.3534.2	1.6684	0.0967	3150.6	10	1730.0%	1	R.LLKPQDLEMQFQRILDDPSPPQPGEEK.L
UQ1630189.4%339.4%435514877.0(Q16301) Cerebrin-50 
*	TK120303_NMyc_cyto3_step03.2074.2074.3	2.118	0.1666	2744.94	1	2270.0%	1	K.YVDHSHLTRADLANDIYNINLQR.Y
*	TK120303_NMyc_cyto3_step06.1271.1271.1	1.0546	0.1212	721.43	2	8000.0%	1	R.YAAKIR.K
*	TK120303_NMyc_cyto3_step07.2148.2148.1	1.6321	0.2375	1295.63	4	4550.0%	1	-.MTSQITSNSPVK.W
UFMN1_MOUSE89.4%10307.7%14681638098.6(Q05860) Formin 1 isoforms I/II/III (Limb deformity protein) 
*	TK120303_NMyc_cyto3_step05.3291.3291.2	1.3975	0.213	2510.51	1	2620.0%	1	K.FLLLDLPHTVGPDSPQPKCDEK.K
	TK120303_NMyc_cyto3_step06.4115.4115.2	0.8079	0.0603	1446.74	3	2080.0%	1	R.TPGRLQAVWPPPK.T
	TK120303_NMyc_cyto3_step11.2193.2193.2	1.4634	0.1986	1913.75	47	3120.0%	1	K.RSQTVGILISSLHLEMK.D
	TK120303_NMyc_cyto3_step10.2441.2441.3	1.7415	0.1167	4679.2	5	1160.0%	1	R.SQTVGILISSLHLEMKDIQQAIFTVDDSVVDLETLAALYENR.A
	TK120303_NMyc_cyto3_step02.1824.1824.1	1.4667	0.0506	1195.7	10	5000.0%	5	K.KKPLSEAYEK.K
*	TK120303_NMyc_cyto3_step04.2144.2144.3	1.8132	0.1204	2780.75	7	1980.0%	1	K.QEAGTDKSVFPLPEPQDFFLASQVK.F
UP2CB_MOUSE89.3%2211.0%390427955.2(P36993) Protein phosphatase 2C beta isoform (EC 3.1.3.16) (PP2C-beta) (IA) (Protein phosphatase 1B) 
	TK120303_NMyc_cyto3_step03.2696.2696.2	2.0204	0.3949	2420.46	1	3680.0%	1	R.VANYCSTHLLEHITTNEDFR.A
	TK120303_NMyc_cyto3_step12.3543.3543.2	1.0986	0.0458	2601.52	13	1820.0%	1	K.CVDGKGPTEQLVSPEPEVYEIVR.A
UPCB1_HUMAN89.2%81043.0%356375267.1(Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) 
*	TK120303_NMyc_cyto3_step11.1898.1898.3	1.7852	0.0226	3202.81	14	1610.0%	1	K.GYWASLDASTQTTHELTIPNNLIGCIIGR.Q
*	TK120303_NMyc_cyto3_step02.3141.3141.2	2.1567	0.3275	1961.99	2	3750.0%	1	K.QICLVMLETLSQSPQGR.V
*	TK120303_NMyc_cyto3_step01.2751.2751.1	1.487	0.1678	1389.77	4	4170.0%	1	R.IITLTGPTNAIFK.A
*	TK120303_NMyc_cyto3_step01.4723.4723.2	1.3449	0.0899	2492.81	46	2270.0%	1	K.LEEDINSSMTNSTAASRPPVTLR.L
*	TK120303_NMyc_cyto3_step08.2280.2280.3	1.2498	0.012	3977.98	60	970.0%	1	R.CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK.L
*	TK120303_NMyc_cyto3_step09.2460.2460.2	2.1164	0.384	2608.07	1	2920.0%	2	R.QQSHFAMMHGGTGFAGIDSSSPEVK.G
*	TK120303_NMyc_cyto3_step08.2904.2904.3	1.607	0.0039	4200.97	14	1220.0%	1	K.GYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIR.Q
UIF42_MOUSE89.2%113.2%407464025.5(P10630) Eukaryotic initiation factor 4A-II (eIF-4A-II) (eIF4A-II) 
	TK120303_NMyc_cyto3_step08.2070.2070.1	1.5467	0.2514	1449.7	2	5000.0%	1	R.KGVAINFVTEEDK.R
USEP6_MOUSE89.2%226.9%434496206.4(Q9R1T4) Septin 6 
	TK120303_NMyc_cyto3_step03.3788.3788.2	1.3701	0.1276	2110.82	4	2630.0%	1	R.TVPLAGHVGFDSLPDQLVNK.S
	TK120303_NMyc_cyto3_step02.2165.2165.1	2.122	0.1352	1233.71	9	6110.0%	1	K.RNEFLGELQK.K
UO3532889.2%3332.6%1811960311.8(O35328) Proline-rich protein 9-1 (Fragment) 
*	TK120303_NMyc_cyto3_step02.2727.2727.3	1.7583	0.0735	3252.98	123	1160.0%	1	R.SEPNSSSLSSFFRFLGLPGLFSFCFLGPR.F
*	TK120303_NMyc_cyto3_step04.3584.3584.2	1.0774	0.0831	1109.46	3	5000.0%	1	R.RPPPPPPPPR.R
*	TK120303_NMyc_cyto3_step02.2588.2588.1	2.0181	0.2132	1564.71	5	3160.0%	1	R.ISSLSGGGGGGSGGGGGGKR.W
UQ9H4A189.2%6610.4%15121649699.7(Q9H4A1) CDC2L5 protein kinase 
	TK120303_NMyc_cyto3_step07.4206.4206.3	1.1436	0.055	2250.35	13	1470.0%	1	K.MPPPDLPLWQDCHELWSK.K
	TK120303_NMyc_cyto3_step01.3036.3036.2	1.2447	0.0343	2896.56	16	1460.0%	1	R.ILPPDQRPPEPPEPPPVTEEDLDYR.T
*	TK120303_NMyc_cyto3_step12.4088.4088.3	1.6988	0.0023	4244.05	48	1060.0%	1	K.INLPAGILATGEKQTDPSTPQQESSKPLGGIQPSSQTIQPK.M
*	TK120303_NMyc_cyto3_step09.3525.3525.2	2.5723	0.2404	2951.07	1	2400.0%	1	K.TSVNMADFVQVLNIKVNSETQQQLNK.I
	TK120303_NMyc_cyto3_step04.3682.3682.3	1.3803	0.0238	4314.99	7	1180.0%	1	R.ILELTPEPDRPRILPPDQRPPEPPEPPPVTEEDLDYR.T
	TK120303_NMyc_cyto3_step09.2551.2551.3	1.5679	0.0403	3824.44	25	1320.0%	1	R.ENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMR.I
UQ96MB589.1%5512.3%690809204.8(Q96MB5) Hypothetical protein FLJ32682 
*	TK120303_NMyc_cyto3_step08.1803.1803.1	1.346	0.1209	1165.38	8	5000.0%	1	K.EENVLEFASK.E
*	TK120303_NMyc_cyto3_step07.1864.1864.2	1.3517	0.0591	1781.36	37	2670.0%	1	K.TVVHQGDGKLILYPNK.N
*	TK120303_NMyc_cyto3_step07.1871.1871.2	1.5185	0.0031	1580.48	2	4550.0%	1	K.EEHLEEEEYLEK.V
*	TK120303_NMyc_cyto3_step01.3058.3058.3	1.5328	0.125	3912.39	8	1290.0%	1	R.IRALINNSGNATFYDENSDIWLNLSSNLGYYFPK.D
*	TK120303_NMyc_cyto3_step04.1511.1511.1	1.5251	0.2734	1585.48	5	3330.0%	1	R.YKFVIPEVLSEMK.K
UTRXB_HUMAN88.7%6817.9%497544196.5(Q16881) Thioredoxin reductase, cytoplasmic precursor (EC 1.6.4.5) (TR) 
*	TK120303_NMyc_cyto3_step01.0696.0696.1	0.6266	0.0195	624.57	28	3750.0%	1	R.DACTR.K
*	TK120303_NMyc_cyto3_step12.3784.3784.2	1.4608	0.1103	2926.14	74	1430.0%	1	-.MNGPEDLPKSYDYDLIIIGGGSGGLAAAK.E
*	TK120303_NMyc_cyto3_step12.2360.2360.2	1.2274	0.03	2687.43	17	1920.0%	1	K.SYDYDLIIIGGGSGGLAAAKEAAQYGK.K
*	TK120303_NMyc_cyto3_step04.2903.2903.2	2.2753	0.3682	2401.16	2	2750.0%	1	K.LMHQAALLGQALQDSRNYGWK.V
*	TK120303_NMyc_cyto3_step07.3109.3109.3	2.2362	0.0869	3022.84	1	2310.0%	2	K.TGKIPVTDEEQTNVPYIYAIGDILEDK.V
UQ9JII688.7%7925.9%324364567.4(Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase) 
	TK120303_NMyc_cyto3_step01.2348.2348.1	1.6926	0.2224	1506.58	1	4580.0%	1	R.DAGHPLYPFNDPY.-
*	TK120303_NMyc_cyto3_step12.2163.2163.2	1.3235	0.0102	2341.77	2	2620.0%	1	-.TASSVLLHTGQKMPLIGLGTWK.S
*	TK120303_NMyc_cyto3_step04.1402.1402.1	1.2242	0.1275	874.48	1	6430.0%	1	K.HALSAGYR.H
	TK120303_NMyc_cyto3_step05.1540.1540.1	1.6702	0.2292	1301.56	1	5500.0%	2	K.HHPEDVEPALR.K
*	TK120303_NMyc_cyto3_step04.2430.2430.1	0.9561	0.0285	1389.72	13	3640.0%	1	R.YIVPMITVDGKR.V
*	TK120303_NMyc_cyto3_step03.1524.1524.3	1.3322	0.0044	2186.62	38	2350.0%	1	R.ILQNIQVFDFTFSPEEMK.Q
UTYB0_HUMAN88.7%1114.0%4348945.3(P13472) Thymosin beta-10 
*	TK120303_NMyc_cyto3_step01.0860.0860.1	1.69	0.2303	675.46	2	8000.0%	1	K.NTLPTK.E
USNX5_MOUSE88.7%242.2%404467976.6(Q9D8U8) Sorting nexin 5 
	TK120303_NMyc_cyto3_step03.1468.1468.1	1.1647	0.0137	968.54	19	5000.0%	2	R.LSSHPVLSK.D
UNME1_HUMAN88.7%111.0%14641652827.1(Q12879) Glutamate [NMDA] receptor subunit epsilon 1 precursor (N-methyl D-aspartate receptor subtype 2A) (NR2A) (NMDAR2A) (hNR2A) 
*	TK120303_NMyc_cyto3_step01.2642.2642.1	1.5688	0.2406	1551.76	1	3460.0%	1	K.FNQKGVEDALVSLK.T
UAPT_MOUSE88.6%393.9%180197366.8(P08030) Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT) 
*	TK120303_NMyc_cyto3_step05.1640.1640.1	1.5621	0.2399	783.53	3	7500.0%	3	R.LLASHLK.S
UO2B3_HUMAN88.6%5919.8%313355438.4(O76000) Olfactory receptor 2B3 (Olfactory receptor 6-4) (OR6-4) (Hs6M1-1) 
*	TK120303_NMyc_cyto3_step06.3252.3252.3	2.1509	0.285	4132.67	5	1400.0%	2	K.LHTPMYFFLTNLSILDLCYTTTTVPHMLVNIGCNK.K
*	TK120303_NMyc_cyto3_step12.3363.3363.2	2.3769	0.342	2666.72	2	2730.0%	2	K.MVSLFYGIITSMLNSLIYSLRNK.D
*	TK120303_NMyc_cyto3_step10.2216.2216.3	1.6652	0.157	2909.29	7	1880.0%	1	K.DWGKMVSLFYGIITSMLNSLIYSLR.N
UO7061988.6%2217.0%171193276.5(O70619) Hypothetical 19.3 kDa protein 
*	TK120303_NMyc_cyto3_step11.1457.1457.2	0.835	0.0287	1351.36	65	3180.0%	1	K.VSPGDVENYKDK.D
*	TK120303_NMyc_cyto3_step03.3520.3520.2	2.2581	0.3674	1892.54	2	3440.0%	1	R.EKGLDLVTCDGGDCPVR.D
UQ9Z1S388.5%4412.3%795903048.1(Q9Z1S3) Ras activator RasGRP 
*	TK120303_NMyc_cyto3_step01.2908.2908.3	1.4445	0.0664	3243.7	172	1380.0%	1	R.TVAHKSTQTESFPWVGGETTPGHFVLSSPR.K
*	TK120303_NMyc_cyto3_step06.1932.1932.3	1.2564	0.0434	3417.73	127	1290.0%	1	K.VNVQKLLALYNHINELVQLQEMAPPLDANK.D
	TK120303_NMyc_cyto3_step09.3112.3112.3	1.7263	0.0851	3095.3	17	1720.0%	1	R.APPLTPSKPPVVVDWASGVSPKPDPKTISK.H
*	TK120303_NMyc_cyto3_step01.0206.0206.1	1.6614	0.229	890.38	4	6430.0%	1	K.IESLQLGK.S
UQ9D0R888.5%3516.9%195217017.8(Q9D0R8) 2600001B17Rik protein 
	TK120303_NMyc_cyto3_step02.1465.1465.1	1.661	0.2243	955.73	1	6880.0%	1	K.EGSALSHVR.K
	TK120303_NMyc_cyto3_step01.3188.3188.2	1.2977	0.1436	2936.43	23	1520.0%	2	K.WQEKNIVVMEEVVITPPYQVENCK.G
UTBA1_MOUSE88.4%112.9%451501365.1(P02551) Tubulin alpha-1 chain 
	TK120303_NMyc_cyto3_step01.2959.2959.1	1.7207	0.2209	1599.55	1	3750.0%	1	R.TIQFVDWCPTGFK.V
UQ91WX688.4%6810.6%748819417.6(Q91WX6) SNF-1 related kinase 
	TK120303_NMyc_cyto3_step03.3683.3683.2	1.0034	0.0128	2097.45	3	2630.0%	1	K.MCISAPGPSPSADLDPVRTK.K
	TK120303_NMyc_cyto3_step09.3472.3472.3	2.8487	0.3398	4764.87	3	1110.0%	2	R.DSSEGPPGSEGDGGGQSKPSSGGGVDKASPGEQGTGGGSQGGSGGTPSGTAGSSR.R
	TK120303_NMyc_cyto3_step10.2286.2286.2	1.4225	0.0012	2350.63	7	2040.0%	1	K.ASPGEQGTGGGSQGGSGGTPSGTAGSSR.R
	TK120303_NMyc_cyto3_step02.2857.2857.2	1.9964	0.1188	1872.27	1	3820.0%	1	K.MCISAPGPSPSADLDPVR.T
	TK120303_NMyc_cyto3_step12.4456.4456.2	1.2663	0.0339	2371.14	2	2380.0%	1	K.STWKMCISAPGPSPSADLDPVR.T
UHO1_HUMAN88.4%2216.0%288328198.2(P09601) Heme oxygenase 1 (EC 1.14.99.3) (HO-1) 
*	TK120303_NMyc_cyto3_step10.4026.4026.2	1.1561	0.0504	2456.16	10	2390.0%	1	K.ALDLPSSGEGLAFFTFPNIASATK.F
*	TK120303_NMyc_cyto3_step01.3642.3642.2	2.3256	0.3534	2620.33	1	2860.0%	1	K.TAFLLNIQLFEELQELLTHDTK.D
UQ9BZE588.4%444.9%16641776666.6(Q9BZE5) PGC-1 related co-activator (Hypothetical protein KIAA0595) 
*	TK120303_NMyc_cyto3_step12.3799.3799.3	1.8784	0.1076	4284.44	3	1320.0%	1	K.LSFLPTPRTQGSEDVVQAFISEIGIEASDLSSLLEQFEK.S
*	TK120303_NMyc_cyto3_step11.2357.2357.3	3.0762	0.2383	3785.07	1	1760.0%	1	R.TQGSEDVVQAFISEIGIEASDLSSLLEQFEKSEAK.K
*	TK120303_NMyc_cyto3_step11.1210.1210.1	0.8252	0.0676	1534.52	336	2140.0%	1	K.EPQNPPANAAPGSQR.A
*	TK120303_NMyc_cyto3_step04.3216.3216.2	1.1711	0.1291	2562.68	40	1590.0%	1	R.LQEGVHGPSRVHVGSGDHDYCVR.S
UZEP2_HUMAN88.3%686.3%18332021286.7(P31629) Human immunodeficiency virus type I enhancer-binding protein 2 (HIV-EP2) 
	TK120303_NMyc_cyto3_step12.1563.1563.2	1.1868	0.0296	1917.17	10	2220.0%	1	K.RGPHALQSSGPPSTPSSPR.L
	TK120303_NMyc_cyto3_step04.0457.0457.1	0.9125	0.0397	872.28	6	4380.0%	1	K.GASGESFSK.D
	TK120303_NMyc_cyto3_step01.3554.3554.3	1.7152	0.0699	4685.64	20	1040.0%	1	R.HFSRPEPGQPCTSATHPDLHDGEKDNFGTSQTPLAHSTFYSK.S
	TK120303_NMyc_cyto3_step02.3651.3651.3	1.5072	0.0198	4097.76	109	1050.0%	2	K.ESSDELDIDETASDMSMSPQSSSLPAGDGQLEEEGKGHK.R
	TK120303_NMyc_cyto3_step10.2716.2716.2	2.2219	0.3641	2707.4	3	2170.0%	1	K.DNFGTSQTPLAHSTFYSKSCVDDK.Q
UQ9D1J188.1%2210.9%266285988.0(Q9D1J1) 1110005F07Rik protein 
*	TK120303_NMyc_cyto3_step12.2027.2027.2	2.3277	0.3431	1775.68	3	3610.0%	1	R.ARPTSAGGLSLLPPPPGGK.S
*	TK120303_NMyc_cyto3_step02.2373.2373.1	1.8364	0.1264	1085.78	1	5000.0%	1	K.QAQNPDEGPK.L
UHEPS_MOUSE88.1%241.7%416447397.4(O35453) Serine protease hepsin (EC 3.4.21.-) 
	TK120303_NMyc_cyto3_step05.1139.1139.1	1.6685	0.2199	794.51	1	8330.0%	2	R.KPGVYTK.V
UCYRB_HUMAN88.0%102215.2%897973365.5(P32927) Cytokine receptor common beta chain precursor (CDw131 antigen) 
*	TK120303_NMyc_cyto3_step06.1309.1309.3	1.5179	0.233	1992.09	42	2350.0%	1	K.SGFEGYVELPPIEGRSPR.S
*	TK120303_NMyc_cyto3_step09.3183.3183.3	1.6643	0.0127	4490.23	7	1280.0%	3	K.WSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRK.E
*	TK120303_NMyc_cyto3_step02.1180.1180.2	0.9771	0.1277	3085.7	21	1250.0%	1	R.RPSQGAAGSPSLESGGGPAPPALGPRVGGQDQK.D
*	TK120303_NMyc_cyto3_step05.2851.2851.2	1.854	0.1069	2373.66	1	2800.0%	3	R.RPSQGAAGSPSLESGGGPAPPALGPR.V
*	TK120303_NMyc_cyto3_step12.3115.3115.2	1.441	0.1099	2067.21	425	1670.0%	1	K.HIKSSVNIQMAPPSLNVTK.D
*	TK120303_NMyc_cyto3_step12.3495.3495.3	2.4109	0.0024	3059.1	56	1570.0%	1	K.EVASSVSFGLFYKPSPDAGEEECSPVLR.E
URASH_MOUSE88.0%5256.9%189213485.3(Q61411) Transforming protein P21/H-RAS-1 (C-H-RAS) 
	TK120303_NMyc_cyto3_step11.2253.2253.2	2.3213	0.2354	1390.89	2	5830.0%	5	K.DSDDVPMVLVGNK.C
UQ9305287.8%5714.2%612657467.4(Q93052) LIPOMA PREFERRED partner (LPP) 
*	TK120303_NMyc_cyto3_step03.3619.3619.3	1.8149	0.046	4490.2	13	1100.0%	1	R.GGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGYYAAGPGYGGR.N
*	TK120303_NMyc_cyto3_step03.1503.1503.1	1.632	0.0462	1220.54	9	4550.0%	1	K.STGEPLGHVPAR.M
*	TK120303_NMyc_cyto3_step12.3800.3800.2	1.7132	0.2687	3165.4	25	1670.0%	1	K.KAYCEPCYINTLEQCNVCSKPIMER.I
*	TK120303_NMyc_cyto3_step07.1696.1696.1	1.5968	0.1518	1133.65	1	7140.0%	2	R.DFHVHCYR.C
UQ9H28087.8%113.8%312365015.6(Q9H280) Serologically defined breast cancer antigen NY-BR-62 (Fragment) 
*	TK120303_NMyc_cyto3_step01.2490.2490.1	2.0893	0.1374	1468.53	1	5000.0%	1	-.LQETQTKNDFLK.S
UQ6069087.7%2218.2%435463329.4(Q60690) Myelin gene expression factor (Fragment) 
*	TK120303_NMyc_cyto3_step12.3586.3586.3	2.4876	0.1578	3110.56	284	1170.0%	1	R.NITGVMGNLGPSGVGFGGLEAMNSMAGFGGVGR.M
	TK120303_NMyc_cyto3_step11.3469.3469.3	2.711	0.3601	4729.22	1	1220.0%	1	R.ALQRTGTSFQGSHASDVGSGLVNLPPSILNNPNIPPEVISNLQAGR.L
UCA14_MOUSE87.7%112511.7%16691606808.2(P02463) Collagen alpha 1(IV) chain precursor 
*	TK120303_NMyc_cyto3_step03.2523.2523.2	1.4763	0.0678	2398.38	67	1800.0%	1	K.VVPLPGPPGAAGLPGSPGFPGPQGDR.G
*	TK120303_NMyc_cyto3_step09.3629.3629.3	2.0471	0.1706	4072.55	7	1200.0%	1	R.GDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGEGPPGSSGPPGIKGEK.G
	TK120303_NMyc_cyto3_step09.2403.2403.3	1.7061	0.0459	3576.59	3	1670.0%	4	R.NDYSYWLSTPEPMPMSMAPISGDNIRPFISR.C
*	TK120303_NMyc_cyto3_step08.1283.1283.3	1.4109	0.0593	1622.76	65	2210.0%	2	K.GVPGIPGSQGVPGSPGEK.G
*	TK120303_NMyc_cyto3_step11.3413.3413.2	1.5615	0.2028	2702.91	2	1850.0%	1	R.QGPQGEKGEAGLPGPPGTVIGTMPLGEK.G
*	TK120303_NMyc_cyto3_step06.3192.3192.3	1.3834	0.0877	2900.39	22	1640.0%	1	K.GDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEK.G
*	TK120303_NMyc_cyto3_step09.2039.2039.1	1.47	0.0022	1217.31	21	3640.0%	1	K.GDRGYPGAPGLR.G
UCPD9_MOUSE87.7%4421.2%504569496.3(P11714) Cytochrome P450 2D9 (EC 1.14.14.1) (CYPIID9) (P450-16-alpha) (CA) (Testosterone 16-alpha hydroxylase) 
*	TK120303_NMyc_cyto3_step01.4082.4082.3	3.0117	0.2857	4189.51	2	1490.0%	1	K.EANHLCDAFTAQAGQPINPNPMLNKSTCNVIASLIFAR.R
*	TK120303_NMyc_cyto3_step01.4187.4187.2	1.2115	0.0049	3130.22	9	1670.0%	1	R.YPPGPVPWPVLGNLLQVDLGNMPYSLYK.L
	TK120303_NMyc_cyto3_step08.4216.4216.3	1.9472	0.0438	4546.54	17	1190.0%	1	K.EMLLTCGEDTADRPPVPIFEYLGVKPGSQGVVLAPYGPEWR.E
UST31_HUMAN87.5%8286.8%10191157305.2(Q9BXU1) Serine/threonine protein kinase 31 (EC 2.7.1.37) (Serine/threonine-protein kinase NYD-SPK) 
	TK120303_NMyc_cyto3_step08.0176.0176.1	0.6525	0.0628	776.91	23	3000.0%	1	K.KEEEIK.T
*	TK120303_NMyc_cyto3_step06.2612.2612.2	2.2526	0.1592	1838.97	1	4670.0%	5	K.RPLVRSEVNGQIILLK.G
*	TK120303_NMyc_cyto3_step05.3873.3873.3	1.1295	0.0244	2387.73	98	1180.0%	1	K.LYMSVEDFILEVDESSLNKR.L
*	TK120303_NMyc_cyto3_step05.3289.3289.2	1.3229	0.0729	2881.58	32	1350.0%	1	K.TLQDLSVSLEAVYGQAKEGANSDEILK.K
UQ99LS387.5%2219.1%225250966.1(Q99LS3) Similar to phosphoserine phosphatase 
	TK120303_NMyc_cyto3_step11.3475.3475.2	1.3834	0.1767	3012.1	6	1610.0%	1	K.IIMIGDGATDMEACPPADAFIGFGGNVIR.Q
*	TK120303_NMyc_cyto3_step12.1842.1842.2	2.3102	0.3403	1551.77	1	6150.0%	1	R.LLAEHPPHLTPGIR.E
UQ99KD587.5%226.9%9441034506.3(Q99KD5) Hypothetical 103.4 kDa protein 
*	TK120303_NMyc_cyto3_step02.1193.1193.3	1.5445	0.168	3940.61	1	1640.0%	1	K.EGNELFKCGDYEGALTAYTQALSLGATPQDQAILHR.N
*	TK120303_NMyc_cyto3_step03.3042.3042.3	2.8183	0.3376	3280.56	1	1880.0%	1	R.SEERSVLFAVGSALVNCTNSYDYEEPDPK.M
UYC18_HUMAN87.2%356.2%864921399.8(Q9ULK2) Hypothetical protein KIAA1218 (Fragment) 
	TK120303_NMyc_cyto3_step04.1682.1682.2	1.4822	0.0821	1697.12	139	2670.0%	1	R.LSSDEGEMDGADESEK.L
*	TK120303_NMyc_cyto3_step11.3335.3335.3	1.9189	0.1205	4622.11	1	1220.0%	2	K.EDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCER.R
UVIME_MOUSE87.0%4415.5%465535575.1(P20152) Vimentin 
*	TK120303_NMyc_cyto3_step01.3698.3698.2	1.4145	0.0297	2924.14	3	1850.0%	1	R.TYSLGSALRPSTSRSLYSSSPGGAYVTR.S
*	TK120303_NMyc_cyto3_step06.2111.2111.3	1.4934	0.0123	2367.76	4	2250.0%	1	R.EEAESTLQSFRQDVDNASLAR.L
	TK120303_NMyc_cyto3_step01.4687.4687.1	1.205	0.0575	1218.49	13	4440.0%	1	R.RQVDQLTNDK.A
	TK120303_NMyc_cyto3_step02.2931.2931.1	2.114	0.252	1533.73	8	3750.0%	1	R.KVESLQEEIAFLK.K
UQ8VHQ087.0%118317.4%385437876.4(Q8VHQ0) SPI3L2 
*	TK120303_NMyc_cyto3_step12.4139.4139.2	2.1097	0.2732	1257.8	1	5500.0%	9	K.QGLFLSNVIHK.S
*	TK120303_NMyc_cyto3_step12.4408.4408.3	1.649	0.0217	4063.63	176	1030.0%	1	K.ILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEK.F
*	TK120303_NMyc_cyto3_step11.1299.1299.2	1.0432	0.0197	2145.8	134	2000.0%	1	K.SVVEVNEEGSEATAATTIVLK.G
UO1509687.0%353.4%828927256.3(O15096) Phosphatidylinositol 4-kinase 
*	TK120303_NMyc_cyto3_step04.1950.1950.2	1.0783	0.0059	2074.33	271	1760.0%	1	K.LPARVWLPTAGFDHHVVR.V
*	TK120303_NMyc_cyto3_step02.1253.1253.1	1.9112	0.2082	1131.57	1	6110.0%	2	R.LATLPTKEQK.T
UQ9CZT386.9%246.9%335379709.8(Q9CZT3) 2610529C04Rik protein 
*	TK120303_NMyc_cyto3_step01.4658.4658.2	2.5239	0.1185	2750.6	4	2500.0%	2	R.RMMCIAGNGLVVLFFSWMLSIFR.S
UQ9DBG386.9%5176.2%9371045835.4(Q9DBG3) 1300012O03Rik protein 
	TK120303_NMyc_cyto3_step06.3404.3404.2	2.5554	0.1643	2397.25	6	2860.0%	4	K.KLAPPLVTLLSGEPEVQYVALR.N
	TK120303_NMyc_cyto3_step01.4451.4451.3	2.2456	0.1636	4089.94	3	1570.0%	1	R.IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLK.K
URP30_MOUSE86.7%41018.3%268294739.0(O88796) Ribonuclease P protein subunit p30 (EC 3.1.26.5) (RNaseP protein p30) (RNase P subunit 2) 
	TK120303_NMyc_cyto3_step11.1327.1327.2	1.0958	0.1163	2471.56	2	2140.0%	3	K.REIEKPIAVSELFTTLPIVQGK.S
	TK120303_NMyc_cyto3_step03.3062.3062.3	2.2977	0.1326	3267.07	9	1920.0%	1	K.LFHVACTHLDVDLVCITVTEKLPFYFK.R
UGDIC_MOUSE86.6%229.2%445505376.2(Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) 
	TK120303_NMyc_cyto3_step09.2429.2429.3	1.897	0.0889	3174.49	17	1610.0%	1	-.MNEEYDVIVLGTGLTECILSGIMSVNGKK.V
	TK120303_NMyc_cyto3_step01.2644.2644.1	1.5726	0.2321	1327.71	1	4550.0%	1	K.YIAIVSTTVETK.E
USODM_MOUSE86.5%118.6%222246038.6(P09671) Superoxide dismutase [Mn], mitochondrial precursor (EC 1.15.1.1) 
*	TK120303_NMyc_cyto3_step06.2799.2799.2	2.3364	0.3298	2143.1	1	3060.0%	1	K.FNGGGHINHTIFWTNLSPK.G
UQ9CVB686.5%2212.4%170199138.4(Q9CVB6) 2210023N03Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step11.1639.1639.1	2.0611	0.1588	1450.66	1	4170.0%	1	R.ASHTAPQVLFSHR.E
	TK120303_NMyc_cyto3_step05.1896.1896.1	1.2746	0.1276	1088.43	1	6430.0%	1	R.DYLHYHIK.C
UO5497186.5%5512.8%854979756.5(O54971) Ubiquitin protein ligase 
	TK120303_NMyc_cyto3_step05.3464.3464.2	1.7628	0.2996	2274.29	3	2500.0%	1	K.DNYCLQINPASYINPDHLK.Y
	TK120303_NMyc_cyto3_step01.2523.2523.1	2.0347	0.1623	1590.73	1	5000.0%	1	K.FIDTGFSLPFYKR.I
	TK120303_NMyc_cyto3_step08.3106.3106.3	2.1452	0.0987	3341.09	21	1670.0%	1	R.GVEEQTQAFFEGFNEILPQQYLQYFDAK.E
	TK120303_NMyc_cyto3_step11.3330.3330.2	1.7499	0.0502	3004.75	5	1740.0%	1	K.ELEVLLCGMQEIDLNDWQRHAIYR.H
*	TK120303_NMyc_cyto3_step03.3934.3934.2	1.3501	0.0559	2787.75	7	2080.0%	1	R.VWSHQTLKSDVLLGTAGLDIYETLK.S
URNHL_HUMAN86.3%2212.7%299333955.3(O75792) Ribonuclease HI large subunit (EC 3.1.26.-) (RNase HI large subunit) (RNase H(35)) (Ribonuclease H2) (RNase H2) 
*	TK120303_NMyc_cyto3_step05.2181.2181.2	1.0659	0.2088	2188.07	2	2940.0%	1	K.AWLKEHVEPVFGFPQFVR.F
*	TK120303_NMyc_cyto3_step12.1444.1444.2	2.2061	0.3449	2306.12	1	3950.0%	1	K.EAEDVIWEDSASENQEGLRK.I
UQ8TE5886.3%111.5%9501032878.6(Q8TE58) Metalloprotease disintegrin 15 with thrombospondin domains 
*	TK120303_NMyc_cyto3_step03.2238.2238.1	1.5677	0.2249	1338.57	2	4620.0%	1	R.RGVPGGPSGDPTSR.C
UQ99KN586.2%6813.6%589676706.5(Q99KN5) Similar to thyroid hormone receptor interactor 12 
	TK120303_NMyc_cyto3_step05.1688.1688.1	1.0518	0.0171	908.52	105	4290.0%	1	R.FLGKLMAK.A
	TK120303_NMyc_cyto3_step09.3132.3132.2	1.343	0.0946	2467.65	19	1900.0%	1	R.QLQDPLVIMTGNIPTWLTELGK.T
	TK120303_NMyc_cyto3_step01.4503.4503.1	1.2866	0.0409	1240.88	31	4000.0%	2	R.SLNPPLTIVRK.T
*	TK120303_NMyc_cyto3_step05.3420.3420.3	2.659	0.4291	3395.67	4	1940.0%	1	R.DGFESVFPLCHLQYFYPEELDQLLCGSK.A
	TK120303_NMyc_cyto3_step08.3234.3234.3	2.261	0.126	3884.95	14	1480.0%	1	R.QLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTR.Q
UQ1567386.2%51111.0%645704108.0(Q15673) TYL protein 
	TK120303_NMyc_cyto3_step09.2219.2219.1	1.1824	0.0945	1297.53	101	3330.0%	3	R.HSSEPRPGAGSGR.R
	TK120303_NMyc_cyto3_step11.2081.2081.3	1.7029	0.0015	4454.72	135	810.0%	1	K.AGSEELDAVEAALAQAGSTEDGLPPSHSSPSLQPKPSSQPRAQR.H
	TK120303_NMyc_cyto3_step02.1625.1625.2	1.1317	0.1184	1740.63	8	3850.0%	1	R.ASDYSKRPHVFYLR.T
UQ96N2986.1%116.3%189213309.3(Q96N29) Hypothetical protein FLJ31482 
	TK120303_NMyc_cyto3_step02.2256.2256.1	1.8461	0.2109	1408.68	5	4550.0%	1	K.DLPNGDIDEYEK.K
UCYC_HUMAN86.1%62621.2%104116189.6(P00001) Cytochrome c 
*	TK120303_NMyc_cyto3_step12.1158.1158.1	0.852	0.014	1146.36	14	5000.0%	1	K.CSQCHTVEK.G
*	TK120303_NMyc_cyto3_step11.1658.1658.1	1.776	0.0985	1470.67	2	4170.0%	5	K.YIPGTKMIFVGIK.K
UQ9H0C086.1%226.7%505552248.1(Q9H0C0) Hypothetical protein 
*	TK120303_NMyc_cyto3_step12.1631.1631.3	1.7982	0.0575	2190.67	235	2240.0%	1	R.LHGGLKPLASLLNNTDNKER.L
*	TK120303_NMyc_cyto3_step09.2152.2152.1	1.8635	0.2124	1495.66	1	4230.0%	1	R.VAFGEHKAVAPLVR.Y
UITA3_MOUSE86.0%179115.9%10531167456.6(Q62470) Integrin alpha-3 precursor (Galactoprotein B3) (GAPB3) (VLA-3 alpha chain) (CD49c) 
*	TK120303_NMyc_cyto3_step03.2728.2728.3	1.8767	0.0184	3194.05	100	1210.0%	1	R.SAFGISIASIGDINQDGFQDIAVGAPFEGLGK.V
*	TK120303_NMyc_cyto3_step04.3035.3035.3	2.0202	0.1205	3796.16	2	1540.0%	1	K.GTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFER.K
*	TK120303_NMyc_cyto3_step05.3340.3340.3	2.2541	0.0877	4388.66	8	1250.0%	1	R.TLVARPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRR.N
*	TK120303_NMyc_cyto3_step12.1410.1410.3	1.5479	0.0082	3922.95	45	1140.0%	2	K.GTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERK.E
*	TK120303_NMyc_cyto3_step07.4226.4226.3	2.0559	0.0346	4631.5	59	970.0%	1	R.SAFGISIASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLR.Q
*	TK120303_NMyc_cyto3_step07.2776.2776.3	1.6659	0.0852	3896.97	63	1140.0%	1	K.MDVDENLYPDLLVGSLSDHIVLLRARPVINILHR.T
	TK120303_NMyc_cyto3_step04.3714.3714.1	1.6876	0.0242	1433.84	32	2920.0%	9	R.TGAVYLCPLTAHK.D
UTYY1_MOUSE85.9%357.2%414447176.3(Q00899) Transcriptional repressor protein YY1 (Yin and yang 1) (YY-1) (Delta transcription factor) (NF-E1) (UCR-motif DNA-binding protein) 
	TK120303_NMyc_cyto3_step09.1515.1515.1	1.8938	0.0606	908.61	1	7140.0%	2	K.SHILTHAK.A
	TK120303_NMyc_cyto3_step04.3765.3765.2	1.473	0.0619	2292.08	9	2380.0%	1	K.LPPGGIPGIDLSDPKQLAEFAR.M
UAPB_HUMAN85.7%16724.3%45635155697.1(P04114) Apolipoprotein B-100 precursor (Apo B-100) [Contains: Apolipoprotein B-48 (Apo B-48)] 
*	TK120303_NMyc_cyto3_step09.3505.3505.2	2.0684	0.221	2782.96	4	2170.0%	8	R.INDVLEHVKHFVINLIGDFEVAEK.I
*	TK120303_NMyc_cyto3_step04.4098.4098.3	1.5939	0.136	3417.51	34	1430.0%	1	K.IPSRFSTPEFTILNTFHIPSFTIDFVEMK.V
*	TK120303_NMyc_cyto3_step09.3471.3471.3	1.7149	0.0506	4444.04	28	1110.0%	1	R.MYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAK.N
*	TK120303_NMyc_cyto3_step03.0295.0295.3	1.07	0.1967	3728.57	45	780.0%	1	K.FITPGLKLNDLNSVLVMPTFHVPFTDLQVPSCK.L
*	TK120303_NMyc_cyto3_step03.3935.3935.2	1.0347	0.1281	2261.41	7	2500.0%	1	R.LPYTIITTPPLKDFSLWEK.T
*	TK120303_NMyc_cyto3_step04.1571.1571.2	2.089	0.0543	1927.71	27	3330.0%	1	K.VKHLIDSLIDFLNFPR.F
*	TK120303_NMyc_cyto3_step08.1683.1683.2	1.0679	0.0382	1667.42	70	2330.0%	1	R.GIISALLVPPETEEAK.Q
*	TK120303_NMyc_cyto3_step01.2830.2830.1	1.1057	0.0114	1567.7	65	3080.0%	1	K.EVYGFNPEGKALLK.K
*	TK120303_NMyc_cyto3_step08.1672.1672.1	1.3654	0.0258	1082.53	10	5000.0%	1	K.GSTSHHLVSR.K
UCFAB_MOUSE85.7%227.8%761850057.4(P04186) Complement factor B precursor (EC 3.4.21.47) (C3/C5 convertase) 
*	TK120303_NMyc_cyto3_step05.2517.2517.3	2.7492	0.3328	3059.49	3	1640.0%	1	K.IVLDPSGSMNIYLVLDGSDSIGSSNFTGAK.R
*	TK120303_NMyc_cyto3_step07.2511.2511.3	1.8417	0.3013	3165.59	13	1610.0%	1	K.NPREDYLDVYVFGVGPLVDSVNINALASK.K
UCRTC_MOUSE85.5%3311.5%416479954.5(P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) 
	TK120303_NMyc_cyto3_step04.2118.2118.3	1.8793	0.0171	2963.78	90	1410.0%	1	K.KPEDWDEEMDGEWEPPVIQNPEYK.G
*	TK120303_NMyc_cyto3_step12.2642.2642.3	1.6136	0.0708	2500.35	74	1740.0%	1	-.MLLSVPLLLGLLGLAAADPAIYFK.E
UQ9H9F785.3%2218.2%285314345.5(Q9H9F7) Hypothetical protein FLJ12788 
*	TK120303_NMyc_cyto3_step12.3251.3251.3	2.8871	0.3135	3996.86	5	1530.0%	1	K.SFLYPPQESEPCPQSPSASATFPSVSDSLPQVAMPQK.L
*	TK120303_NMyc_cyto3_step04.1690.1690.2	1.2919	0.0152	1607.82	6	3570.0%	1	K.GLNQEPQGRGLALQK.M
UQ9Y6X085.1%12684.5%15421696329.8(Q9Y6X0) SET-binding protein (SEB) (Hypothetical protein KIAA0437) 
*	TK120303_NMyc_cyto3_step01.1990.1990.1	1.6784	0.0026	1579.57	6	3210.0%	1	K.GSAGNTWSQLSNNNK.D
*	TK120303_NMyc_cyto3_step03.3940.3940.2	1.2778	0.02	2293.43	1	2860.0%	1	K.LSKMIENESPSVGLETGGNAEK.V
*	TK120303_NMyc_cyto3_step07.2761.2761.3	1.736	0.0734	2952.34	5	1880.0%	1	K.MIENESPSVGLETGGNAEKVIPGGVSKPR.K
*	TK120303_NMyc_cyto3_step04.3419.3419.2	1.5988	0.0545	2668.44	2	2270.0%	8	R.YSFDFCSLDNPEAIPSDTSTKNR.H
*	TK120303_NMyc_cyto3_step04.0400.0400.1	0.8643	0.0908	1011.14	281	2220.0%	1	K.VIPGGVSKPR.K
UQ9CXF484.8%338.5%671765275.3(Q9CXF4) 4432405K22Rik protein 
*	TK120303_NMyc_cyto3_step04.1631.1631.1	1.1992	0.0059	1285.58	7	4090.0%	1	K.KPHTNGDAPGHR.N
*	TK120303_NMyc_cyto3_step02.3535.3535.2	2.5059	0.1333	2016.54	4	3890.0%	1	K.DDSPTQTLASPNACRLTPA.-
	TK120303_NMyc_cyto3_step03.3387.3387.2	1.5789	0.2191	2752.97	1	2000.0%	1	R.GSDPSTHQRPPSEMADFLSDAIPGLK.I
UQ8VD7684.8%92714.6%309342446.8(Q8VD76) TFIIH basal transcription factor complex p34 subunit (Basic transcription factor 2 34 kDa subunit) (BTF2-p34) (General transcription factor IIH polypeptide 3) 
	TK120303_NMyc_cyto3_step09.2340.2340.1	1.1659	0.1037	1423.66	4	3850.0%	1	K.GQHTETLLAGSLAK.A
*	TK120303_NMyc_cyto3_step03.3560.3560.2	2.0923	0.325	2697.63	2	2500.0%	3	K.NGGLGDFFGDPGNALPDCNPSGSKDGK.Y
	TK120303_NMyc_cyto3_step07.1463.1463.3	1.4042	0.0289	1868.66	86	2350.0%	1	K.SDIKGQHTETLLAGSLAK.A
*	TK120303_NMyc_cyto3_step04.3448.3448.2	2.1146	0.0128	2396.92	1	2830.0%	4	K.NGGLGDFFGDPGNALPDCNPSGSK.D
UVGR2_MOUSE84.8%157311.3%13671525166.1(P35918) Vascular endothelial growth factor receptor 2 precursor (EC 2.7.1.112) (VEGFR-2) (Protein-tyrosine kinase receptor flk-1) (Fetal liver kinase 1) (Kinase NYK) 
	TK120303_NMyc_cyto3_step09.1944.1944.2	1.1462	0.0563	2117.52	1	3160.0%	1	R.RLDSITSSQSSASSGFVEEK.S
*	TK120303_NMyc_cyto3_step07.3505.3505.2	1.2099	0.0504	2642.56	6	1590.0%	8	R.DYRSPFIASVSDQHGIVYITENK.N
*	TK120303_NMyc_cyto3_step11.1351.1351.2	1.0946	0.0617	2216.76	4	2890.0%	1	K.TVVIPCRGSISNLNVSLCAR.Y
*	TK120303_NMyc_cyto3_step11.2203.2203.2	1.1406	0.1071	2188.92	49	2500.0%	1	K.DILTILANTTLQITCRGQR.D
*	TK120303_NMyc_cyto3_step11.3217.3217.3	2.2608	0.0961	3038.28	7	1830.0%	1	R.IYDVILSPPHEIELSAGEKLVLNCTAR.T
*	TK120303_NMyc_cyto3_step02.3357.3357.2	1.6756	0.0558	2510.12	1	3000.0%	2	K.TGYLSIVMDPDELPLDERCER.L
*	TK120303_NMyc_cyto3_step11.1767.1767.2	1.4731	0.0664	2751.55	1	2290.0%	1	K.VIPDDSQTDSGMVLASEELKTLEDR.N
UCLN3_HUMAN84.8%115.0%438476236.4(Q13286) CLN3 protein (Battenin) (Batten disease protein) 
	TK120303_NMyc_cyto3_step06.2769.2769.2	2.502	0.2495	2274.91	7	2380.0%	1	R.TSGNQSHVDPGPTPIPHNSSSR.F
UY893_HUMAN84.8%113.2%9191019495.9(O94967) Hypothetical protein KIAA0893 
*	TK120303_NMyc_cyto3_step07.2228.2228.3	2.6781	0.3561	3175.5	2	1960.0%	1	R.RPQSADAYMTRSLNPALDGLTCGLTSHDK.R
UQ9CQ0484.7%228.0%349392706.4(Q9CQ04) 5730405M13Rik protein 
	TK120303_NMyc_cyto3_step03.4306.4306.2	2.0291	0.3635	3052.35	1	2220.0%	1	K.ETLEVEHVVGSGILHRGGQLHGARPLCK.G
	TK120303_NMyc_cyto3_step03.1527.1527.1	1.423	0.0661	1295.55	6	4550.0%	1	R.GGQLHGARPLCK.G
UCENF_HUMAN84.7%10106.4%32103675955.1(P49454) CENP-F kinetochore protein (Centromere protein F) (Mitosin) (AH antigen) 
*	TK120303_NMyc_cyto3_step12.2840.2840.3	2.0262	0.1542	3863.59	2	1290.0%	1	K.ELNEAVAALCGDQEIMKATEQSLDPPIEEEHQLR.N
*	TK120303_NMyc_cyto3_step03.1863.1863.3	1.7084	0.0372	2388.29	15	2000.0%	1	K.ASIEHEALYLEADLEVVQTEK.L
*	TK120303_NMyc_cyto3_step07.1316.1316.1	0.9128	0.1357	671.45	21	6000.0%	1	K.EGLPTR.T
*	TK120303_NMyc_cyto3_step01.3140.3140.2	1.1158	0.1562	2486.93	24	1670.0%	1	K.LALSPLSLGKENLAESSKPTAGGSR.S
*	TK120303_NMyc_cyto3_step07.4339.4339.3	1.6946	0.0865	4547.42	73	940.0%	1	R.ALLEQTGDMSLLSNLEGVVSANQCSVDEVFCSSLQEENLTR.K
*	TK120303_NMyc_cyto3_step07.2488.2488.3	1.624	0.0259	3151.91	16	1730.0%	1	R.NQNLMLELETVQQALRSEMTDNQNNSK.S
*	TK120303_NMyc_cyto3_step07.2200.2200.2	1.9487	0.3875	2027.36	4	2500.0%	1	R.GSPLLGPVVPGPSPIPSVTEK.R
*	TK120303_NMyc_cyto3_step05.1591.1591.1	1.1403	0.0090	717.61	8	7000.0%	1	K.LQSLEK.D
*	TK120303_NMyc_cyto3_step02.4005.4005.2	1.3228	0.0601	2004.69	13	2810.0%	1	K.AKEQNLSSQVECLELEK.A
	TK120303_NMyc_cyto3_step04.1098.1098.1	1.0809	0.0071	727.41	67	6000.0%	1	R.LHEAEK.K
UQ924X884.7%2211.5%314357538.6(Q924X8) Olfactory receptor S85 (Olfactory receptor MOR13-6) 
*	TK120303_NMyc_cyto3_step02.4000.4000.2	0.9912	0.014	2687.22	37	1590.0%	1	K.FTSLVYLFVPPMLNPIIYSIKTK.E
	TK120303_NMyc_cyto3_step01.3067.3067.1	1.7415	0.2171	1598.9	1	4170.0%	1	R.SFCMVFPLPFLLK.R
UQ9DAH084.6%5723.3%279319247.6(Q9DAH0) Four and a half LIM domains 4 
*	TK120303_NMyc_cyto3_step02.2803.2803.3	1.6843	0.0091	4196.63	89	1030.0%	1	K.DGANYCVTCFDSHCANICQECHKPIGADSKEVCYK.E
*	TK120303_NMyc_cyto3_step04.3941.3941.3	1.0589	0.0135	2147.84	165	1910.0%	1	K.CSKCSQLLATETFVAWDK.N
	TK120303_NMyc_cyto3_step01.1591.1591.1	1.496	0.2731	833.66	1	6430.0%	2	K.NPITGFGK.G
*	TK120303_NMyc_cyto3_step07.3092.3092.3	1.8776	0.0529	4035.25	4	1360.0%	1	K.YVQKDGANYCVTCFDSHCANICQECHKPIGADSK.E
UQ91Y3884.4%223.9%10461169806.7(Q91Y38) UDP-N-acetylglucosaminyltransferase 
	TK120303_NMyc_cyto3_step07.2523.2523.2	2.4871	0.2562	2118.85	1	3420.0%	1	R.AIQINPAFADAHSNLASIHK.D
	TK120303_NMyc_cyto3_step09.4196.4196.2	1.2494	0.049	2368.95	2	2500.0%	1	K.AADRIHQDGIHILVNMNGYTK.G
UO0028584.1%1115.2%263281959.2(O00285) Putative alternative lens membrane intrinsic protein (Fragment) 
*	TK120303_NMyc_cyto3_step11.2567.2567.3	2.6587	0.3849	4443.77	1	1350.0%	1	R.GNLALNTLHAGVSVGQATTVEIFLTLQFVLCIFATYDERR.N
UQ96B9783.9%339.2%665731546.6(Q96B97) C-Cbl-interacting protein 
*	TK120303_NMyc_cyto3_step08.1960.1960.3	2.1243	0.2419	3441.34	1	1490.0%	1	K.ASLPPKPGTMAAGGGGPAPLSSAVPSPLSSSLGTAGHR.A
*	TK120303_NMyc_cyto3_step12.1103.1103.2	2.378	0.3083	1813.51	1	5000.0%	1	K.EGNRPKKPPPPSAPVIK.Q
*	TK120303_NMyc_cyto3_step01.1119.1119.1	0.8996	7.0E-4	689.49	109	5000.0%	1	K.DPLTNK.A
UO8847383.9%12145.3%48365273806.2(O88473) HERC2 protein 
*	TK120303_NMyc_cyto3_step08.3578.3578.3	1.6971	0.1827	4568.56	1	1160.0%	1	K.GSLQEVIGWGLIGWKYYANVIGPIQCEGLASLGVMQVACAEK.R
*	TK120303_NMyc_cyto3_step12.1462.1462.2	1.2476	0.0933	2092.13	15	3120.0%	1	K.SFLLPSVQYAMFCGWQR.L
*	TK120303_NMyc_cyto3_step01.3810.3810.3	1.6816	0.0090	3203.23	12	1430.0%	1	K.TSGPEPQSLDEFTSLLIPDDTRVVVELLK.L
*	TK120303_NMyc_cyto3_step02.4281.4281.2	1.5326	0.157	2874.27	1	2080.0%	1	K.WLKQNVQGLYPQSALLNTIVEFALK.E
	TK120303_NMyc_cyto3_step04.0313.0313.2	1.0649	0.1152	2536.12	24	1590.0%	1	R.YIHVELIGYPPPSSSSHIKIGDK.V
	TK120303_NMyc_cyto3_step02.3472.3472.1	1.163	0.0089	1191.68	7	5560.0%	1	R.TVFQENVKVK.W
	TK120303_NMyc_cyto3_step11.1861.1861.1	1.8336	0.0341	1533.65	18	3080.0%	2	R.GGSEGCNIPQNIER.L
	TK120303_NMyc_cyto3_step04.0562.0562.1	0.7165	0.0663	1100.27	81	2500.0%	1	K.IDSLTGLGVVK.V
	TK120303_NMyc_cyto3_step07.1753.1753.3	1.5917	0.0088	2399.46	9	2270.0%	1	K.ETAPVQLPVSGPELAAMMKIGTR.V
	TK120303_NMyc_cyto3_step05.2912.2912.3	1.7627	0.0714	3452.74	63	1410.0%	1	R.RPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAK.V
	TK120303_NMyc_cyto3_step03.0792.0792.2	1.0693	0.0471	2949.53	3	1480.0%	1	R.DIACGSSHSAALTSSGELYTWGLGEYGR.L
ULRP1_HUMAN83.9%442.8%45445045795.4(Q07954) Low-density lipoprotein receptor-related protein 1 precursor (LRP) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD91) 
*	TK120303_NMyc_cyto3_step08.3634.3634.3	1.7272	0.034	4296.45	22	1250.0%	1	R.ELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGK.T
*	TK120303_NMyc_cyto3_step02.3444.3444.3	2.0455	0.1281	4343.78	36	1080.0%	1	R.CEEHVFSQQQPGHIASILIPLLLLLLLVLVAGVVFWYK.R
*	TK120303_NMyc_cyto3_step04.2903.2903.3	2.9865	0.2763	3601.23	1	1830.0%	1	R.CVAEALLCNGQDDCGDSSDERGCHINECLSR.K
*	TK120303_NMyc_cyto3_step02.2989.2989.2	1.5334	0.117	2660.76	41	2140.0%	1	K.AQRCQPNEHNCLGTELCVPMSR.L
URYR3_HUMAN83.8%15176.2%48705519395.7(Q15413) Ryanodine receptor 3 (Brain-type ryanodine receptor) (RyR3) (RYR-3) (Brain ryanodine receptor-calcium release channel) 
*	TK120303_NMyc_cyto3_step06.2908.2908.2	1.344	0.0632	2544.44	2	2390.0%	1	R.QILLLIDPSVFGEHSAGTEEGAEK.E
*	TK120303_NMyc_cyto3_step04.2934.2934.2	1.457	0.0282	1880.16	20	2500.0%	1	K.LIGTLLVMGVFDDDDVR.Q
*	TK120303_NMyc_cyto3_step06.4263.4263.3	2.4262	0.2058	4007.2	264	1090.0%	1	R.EELYDFHEDLLLHCGVPLEEEEEEEEDTSWTGK.L
*	TK120303_NMyc_cyto3_step02.2984.2984.2	1.8026	0.0823	2970.4	66	1250.0%	1	K.QMVDTLVESSTNVEMILKFFDMFLK.L
*	TK120303_NMyc_cyto3_step01.3080.3080.1	1.6927	0.2171	1486.66	1	4330.0%	1	R.GEGGNGLLAAMQGAIK.I
*	TK120303_NMyc_cyto3_step06.2117.2117.2	1.2066	0.0374	1962.73	69	2650.0%	1	K.AEGLGMVTEEGTLIVRER.G
*	TK120303_NMyc_cyto3_step02.3340.3340.2	1.7343	0.0888	2138.62	10	2650.0%	1	K.LPETEKNYNLQMSTETLK.T
*	TK120303_NMyc_cyto3_step09.1868.1868.2	1.262	0.1794	1448.1	2	4170.0%	1	R.SQTDKLAFDVGLR.E
*	TK120303_NMyc_cyto3_step07.2936.2936.3	1.8632	0.0453	3639.84	14	1470.0%	1	K.QYTQSEIDFLLSCAEADENDMFNYVDFVDR.F
*	TK120303_NMyc_cyto3_step03.0819.0819.3	1.1736	0.0089	4744.23	1	1100.0%	1	R.WHQGSGYFGRTWQPGDVVGCMINLDDASMIFTLNGELLITNK.G
*	TK120303_NMyc_cyto3_step01.4168.4168.2	1.4941	0.136	3040.38	4	1920.0%	1	R.QNQKAMFEHLSYLLENSSVGLASPSMR.G
*	TK120303_NMyc_cyto3_step03.4380.4380.2	1.2884	0.1167	1739.74	1	4290.0%	1	R.QFIFDVVNEGGEQEK.M
*	TK120303_NMyc_cyto3_step07.2223.2223.3	1.3347	0.0703	2325.79	172	2070.0%	1	R.ALQEMLANTGENGGEGAAQGGGHR.T
UANR2_MOUSE83.8%71914.9%328367076.4(Q9WV06) Ankyrin repeat domain protein 2 (Skeletal muscle ankyrin repeat protein) (mArpp) 
*	TK120303_NMyc_cyto3_step09.2333.2333.3	1.8426	0.0882	3449.75	9	1480.0%	1	R.DALAAAQEPPPEPEEITGPVNEETFLKAAVEGK.M
*	TK120303_NMyc_cyto3_step11.2531.2531.2	2.0046	0.3619	1668.92	1	4640.0%	4	K.IIKLLLLHGADMMAK.N
*	TK120303_NMyc_cyto3_step03.2456.2456.3	1.5995	0.132	3049.23	155	1390.0%	1	K.RDALAAAQEPPPEPEEITGPVNEETFLK.A
UQ9CS9283.8%111.4%695795399.7(Q9CS92) 5730406M06Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step03.2039.2039.1	1.8308	0.201	1110.63	2	6110.0%	1	R.QRSPIALPVK.Q
UDNPE_MOUSE83.8%8833.8%473521677.1(Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21) 
	TK120303_NMyc_cyto3_step12.2087.2087.1	1.8188	0.203	1197.48	1	6670.0%	1	R.IPHLAIHLQR.N
*	TK120303_NMyc_cyto3_step11.4254.4254.2	0.9336	0.0216	2730.73	12	1960.0%	1	R.SQVGYHQVGVETYGGGIWSTWFDR.D
*	TK120303_NMyc_cyto3_step02.2845.2845.2	1.3944	0.1283	2892.17	28	1400.0%	1	R.LDNLHSCFCALQALIDSCASPASLAR.D
*	TK120303_NMyc_cyto3_step03.0499.0499.1	0.8841	0.1166	1119.53	2	3890.0%	1	R.LTAFEEAIPK.S
*	TK120303_NMyc_cyto3_step08.2251.2251.1	1.2204	0.147	1394.56	3	3850.0%	1	K.GTPEPGPLGATDER.H
*	TK120303_NMyc_cyto3_step10.2062.2062.3	1.7415	0.2217	3675.52	11	1560.0%	1	R.DPHVRMVTLYDNEEVGSESAQGAQSLLTELILR.R
*	TK120303_NMyc_cyto3_step12.1826.1826.2	1.9097	0.1122	1246.27	1	7220.0%	1	R.LVHIERPILR.I
*	TK120303_NMyc_cyto3_step05.2043.2043.3	1.7009	0.1071	3397.54	1	1880.0%	1	R.NSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLR.V
UQ9H6D783.5%5711.3%363424005.7(Q9H6D7) Hypothetical protein FLJ22363 
*	TK120303_NMyc_cyto3_step01.1462.1462.1	1.6499	0.214	1244.52	1	5560.0%	1	R.LQQEVEEQLK.K
*	TK120303_NMyc_cyto3_step04.0330.0330.3	1.236	0.0065	2434.01	144	1430.0%	1	-.MASGDFCSPGEGMEILQQVCSK.Q
*	TK120303_NMyc_cyto3_step01.1738.1738.1	1.4317	0.0741	1134.74	23	5000.0%	1	K.EQMLLLEKK.S
UQ9WU7883.4%577.2%869961516.7(Q9WU78) ALG-2 interacting protein AIP1 
	TK120303_NMyc_cyto3_step12.1884.1884.3	1.6901	0.0014	3411.78	29	1360.0%	2	R.EATTLANGVLASLNLPAAIEDVSGDTVPQSILTK.S
	TK120303_NMyc_cyto3_step01.2430.2430.1	1.1745	0.0040	1534.63	3	3080.0%	1	K.LANQAADYFGDAFK.Q
	TK120303_NMyc_cyto3_step11.0016.0016.3	1.4834	0.1405	4098.82	22	1220.0%	1	R.SIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK.S
	TK120303_NMyc_cyto3_step03.1768.1768.1	2.0816	0.1266	1024.5	1	6880.0%	1	R.LQHAAELIK.N
UW70T_MOUSE83.4%226.3%9221008615.7(Q9D2V7) 70 kDa WD-repeat tumor rejection antigen homolog 
*	TK120303_NMyc_cyto3_step08.3038.3038.3	2.1735	0.0955	3919.9	1	1540.0%	1	K.VSLNPARRPHPCFTSSLVPTMEPAPDMVQPAEMPR.A
*	TK120303_NMyc_cyto3_step02.3177.3177.2	1.9443	0.3735	2389.18	1	2950.0%	1	R.VPPGGLENVLTTPETVLTGHTEK.I
UQ9DCY983.1%1110.0%260290337.0(Q9DCY9) Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 
*	TK120303_NMyc_cyto3_step01.2792.2792.2	1.9152	0.4134	2837.05	1	2400.0%	1	R.QSPVDIDTATAQHDPALQPLLISYDK.A
UCA17_HUMAN83.1%141411.5%29442952166.3(Q02388) Collagen alpha 1(VII) chain precursor (Long-chain collagen) (LC collagen) 
*	TK120303_NMyc_cyto3_step06.1875.1875.1	0.9503	0.0589	1323.3	2	2920.0%	1	R.GREEGPAAVIVAR.T
*	TK120303_NMyc_cyto3_step04.0031.0031.3	1.2607	0.0748	3845.59	19	1100.0%	1	R.GPPGPVGGHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPPGR.G
*	TK120303_NMyc_cyto3_step03.3902.3902.3	1.7127	0.123	2723.76	20	1810.0%	1	R.GLLGPQGQPGAAGIPGDPGSPGKDGVPGIR.G
*	TK120303_NMyc_cyto3_step08.2486.2486.3	1.9529	0.1742	3402.44	16	1360.0%	1	R.DGLPGLRGEQGLPGPSGPPGLPGKPGEDGKPGLNGK.N
*	TK120303_NMyc_cyto3_step11.2265.2265.3	2.1207	0.1001	3875.85	6	1120.0%	1	R.GEQGLPGPSGPPGLPGKPGEDGKPGLNGKNGEPGDPGEDGR.K
*	TK120303_NMyc_cyto3_step01.2736.2736.2	1.4374	0.0822	1958.45	1	2620.0%	1	R.AGNPGTPGAPGLKGSPGLPGPR.G
*	TK120303_NMyc_cyto3_step05.2115.2115.2	1.432	0.0534	1854.67	8	2500.0%	1	R.GPPGPAGSRGLPGVAGRPGAK.G
*	TK120303_NMyc_cyto3_step06.3360.3360.3	1.5377	7.0E-4	4447.83	47	1040.0%	1	R.LVLALGPLGPQAVQVGLLSYSHRPSPLFPLNGSHDLGIILQR.I
*	TK120303_NMyc_cyto3_step03.3334.3334.2	2.3972	0.2993	3082.27	3	1960.0%	1	R.TLVLPGSQTAFDLDDVQAGLSYTVRVSAR.V
*	TK120303_NMyc_cyto3_step08.1134.1134.1	1.0624	0.2158	1028.6	95	3330.0%	1	K.DGVPGIRGEK.G
*	TK120303_NMyc_cyto3_step07.1468.1468.2	1.0299	0.0102	1300.03	1	4620.0%	1	R.GPPGLVLPGDPGPK.G
*	TK120303_NMyc_cyto3_step08.1516.1516.3	1.842	0.0259	3653.27	210	1090.0%	1	R.TDASVEQTLRPVILGPTSILLSWNLVPEARGYR.L
*	TK120303_NMyc_cyto3_step12.4135.4135.2	1.2518	0.0224	2063.85	15	2270.0%	1	R.GPPGPSGLAGEPGKPGIPGLPGR.A
*	TK120303_NMyc_cyto3_step09.2187.2187.2	1.386	0.0609	1964.13	46	2060.0%	1	R.TVHVTQASSSSVTITWTR.V
UQ9CZK383.1%1123.4%111127064.0(Q9CZK3) 2700069A07Rik protein 
	TK120303_NMyc_cyto3_step01.3912.3912.2	2.3865	0.2986	3087.95	1	2800.0%	1	K.YPDETPLYEIFSQENLEDNDVSDILK.L
UQ9JJN283.0%13138.6%35503923256.4(Q9JJN2) Zinc-finger homeodomain protein 4 
*	TK120303_NMyc_cyto3_step10.2738.2738.3	1.7698	0.0922	4358.97	1	1340.0%	1	R.GLWSAFHVENGDSLQAGFAFLKGSASPSSSAEQPLGITHMPK.A
*	TK120303_NMyc_cyto3_step04.3858.3858.3	2.9564	0.2872	4046.44	1	1620.0%	1	K.FLFSLTSPSIHFNDKDGDHDQSFYITDDPDDNADR.S
*	TK120303_NMyc_cyto3_step10.3468.3468.3	2.3574	0.201	3491.63	5	1720.0%	1	K.SLLQTPPPPPPPPPPPSSLSGQQTEPQNKESEK.K
*	TK120303_NMyc_cyto3_step05.2571.2571.2	1.2361	0.0235	2464.99	3	2380.0%	1	K.DFPLLNQSISPLSSSVLKFIEK.G
*	TK120303_NMyc_cyto3_step01.1159.1159.1	1.1985	0.1124	575.4	16	7000.0%	1	R.IASGAR.G
*	TK120303_NMyc_cyto3_step12.1243.1243.1	1.3262	0.2533	790.47	16	6000.0%	1	K.RTLPFR.K
*	TK120303_NMyc_cyto3_step04.3182.3182.3	2.2778	0.1125	2699.0	19	1930.0%	1	K.SFCYFGQPLIDPQETVLRIPVSK.Y
*	TK120303_NMyc_cyto3_step12.1679.1679.2	1.3716	0.0906	1907.64	7	2810.0%	1	K.QTPELISAQPTHHPPPR.S
*	TK120303_NMyc_cyto3_step03.2826.2826.2	1.1093	0.0466	3030.89	39	1670.0%	1	R.EAYDKLIQFLLPPLPPAPPQPSTLGPVK.I
*	TK120303_NMyc_cyto3_step07.2861.2861.3	1.7145	0.0899	2703.52	21	1930.0%	1	R.KLQLHQQGLPSEEDNLSEIFFVK.E
*	TK120303_NMyc_cyto3_step02.0328.0328.1	0.8463	0.0173	1428.92	31	2730.0%	1	R.QPLSVSDRHVYK.Y
*	TK120303_NMyc_cyto3_step03.0923.0923.3	1.2068	0.0821	4689.49	1	1040.0%	1	K.VLQEASSPVPQEANSSTDNKPYKCSTCSVAYSQSSTLEIHMR.S
*	TK120303_NMyc_cyto3_step02.2379.2379.2	1.1321	0.1034	1970.84	8	2350.0%	1	K.VAGIEPDRENSSSHDNLK.T
UQ99JT983.0%117.3%179215245.5(Q99JT9) Similar to hypothetical protein FLJ10913 
*	TK120303_NMyc_cyto3_step02.1767.1767.1	1.4885	0.2642	1508.61	1	4580.0%	1	R.AQPDRPVSLEQLR.T
UP7832483.0%112.0%503548136.8(P78324) Protein tyrosine phosphatase, NON-receptor type substrate 1 precursor (SHP substrate-1) (Inhibitory receptor SHPS-1) (SHPS-1) (Signal-regulatory protein ALPHA-1) (SIRP-ALPHA1) (MYD-1 antigen) 
	TK120303_NMyc_cyto3_step02.1637.1637.1	1.4928	0.2633	1110.69	2	5560.0%	1	R.VTTVSESTKR.E
UQ9D57782.7%3327.3%286323848.4(Q9D577) 4930505M11Rik protein 
	TK120303_NMyc_cyto3_step03.2108.2108.2	2.4789	0.1944	1566.75	1	5380.0%	1	K.VHGLYRTTGASFEK.A
*	TK120303_NMyc_cyto3_step10.3773.3773.3	1.7274	0.0063	4091.63	104	1020.0%	1	K.TVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSR.A
	TK120303_NMyc_cyto3_step12.3567.3567.3	1.6234	0.1189	3803.73	40	1330.0%	1	R.AVDFGLSILWFLLFTPCSFVCWYRPLYGAFR.S
UQ9D4W682.5%115.2%540600735.3(Q9D4W6) 4930571B16Rik protein 
*	TK120303_NMyc_cyto3_step10.3072.3072.3	2.9634	0.2751	3050.42	2	2040.0%	1	K.ARVPSLQEVKPVLIDPQGGEDTLLSCVK.L
UGSHR_MOUSE82.5%4616.0%500536758.1(P47791) Glutathione reductase, mitochondrial precursor (EC 1.6.4.2) (GR) (GRase) 
*	TK120303_NMyc_cyto3_step12.4026.4026.3	2.7215	0.1981	3165.64	8	1880.0%	2	K.LDYDNIPTVVFSHPPIGTVGLTEDEAVHK.Y
*	TK120303_NMyc_cyto3_step12.3518.3518.3	1.9453	0.0403	3110.63	169	1500.0%	1	K.VMWNTAVHSEFMHDHVDYGFQSCEGK.F
*	TK120303_NMyc_cyto3_step07.2669.2669.2	2.0292	0.3586	2712.76	1	3120.0%	1	K.SHIEIIHGYATFADGPRPTVEVNGK.K
USG2_MOUSE82.4%102018.3%617706444.8(Q03517) Secretogranin II precursor (SGII) (Chromogranin C) 
*	TK120303_NMyc_cyto3_step06.2683.2683.3	1.6159	0.1173	3722.98	3	1450.0%	1	K.LYTDDEDDVYKTNNIAYEDVVGGEDWSPIEEK.I
*	TK120303_NMyc_cyto3_step06.4197.4197.2	1.3392	0.0433	2630.66	17	1820.0%	2	K.RVPSPVSSEDDLQEEEQLEQAIK.E
*	TK120303_NMyc_cyto3_step10.3698.3698.2	1.2406	0.069	2124.86	2	2940.0%	1	R.QAPYENLNDQELGEYLAR.M
*	TK120303_NMyc_cyto3_step02.4103.4103.3	1.0422	0.2416	1769.65	20	1670.0%	1	K.EHLGPGSSQEMERLAK.V
*	TK120303_NMyc_cyto3_step12.3914.3914.3	2.0113	0.0651	3912.32	16	1320.0%	2	R.VPSPVSSEDDLQEEEQLEQAIKEHLGPGSSQEMER.L
*	TK120303_NMyc_cyto3_step10.2796.2796.2	1.8391	0.0529	2553.62	18	1740.0%	3	R.LGAVLLLIHLIFLISGAEAASFQR.N
UDF5L_HUMAN82.4%114.3%484528015.1(P57764) DFN5-like protein FLJ12150 
*	TK120303_NMyc_cyto3_step04.3787.3787.2	2.48	0.1744	2408.49	1	3250.0%	1	R.GDNVYVVTEVLQTQKEVEVTR.T
UG25B_HUMAN82.4%225.8%191213116.0(P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) 
	TK120303_NMyc_cyto3_step08.2104.2104.2	1.6687	0.2812	1404.14	10	4500.0%	1	K.WVPEITHHCPK.T
UMK14_MOUSE82.4%112.8%360412875.9(P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1) 
	TK120303_NMyc_cyto3_step06.1845.1845.1	2.0014	0.1584	1226.76	2	6110.0%	1	K.YIHSADIIHR.D
UQ9JLI282.3%131716.3%17391719686.8(Q9JLI2) Collagen type V alpha 3 chain 
*	TK120303_NMyc_cyto3_step01.3008.3008.2	1.3511	0.0422	3112.61	14	1410.0%	1	R.GELGFQGLTGPPGPAGVLGPQGKVGDVGPLGER.G
*	TK120303_NMyc_cyto3_step08.2714.2714.2	1.9195	0.3941	2352.36	1	2920.0%	1	K.EGPPGPRGFPGPQGAPGDPGPIGLK.G
*	TK120303_NMyc_cyto3_step05.1291.1291.2	1.2294	0.085	1087.83	22	5000.0%	1	R.MGPEGREGEK.G
*	TK120303_NMyc_cyto3_step01.2928.2928.3	1.5543	0.0469	4001.96	10	1250.0%	2	K.GEVGDVGSMGPHGAPGPRGPPGPSGSEGPPGLPGGVGQPGAVGEK.G
*	TK120303_NMyc_cyto3_step12.3523.3523.3	2.3073	0.1498	4731.45	49	950.0%	1	R.EESFEGDIQELLLIPDPQAAFQACESYLPGCETLDSTTTGAPK.D
*	TK120303_NMyc_cyto3_step07.3464.3464.2	1.3716	0.0405	2456.64	8	1730.0%	2	R.GLIGPRGLPGPLGRPGVTGSDGAPGAK.G
*	TK120303_NMyc_cyto3_step10.3604.3604.2	1.3998	0.0269	2212.19	295	1360.0%	1	K.GELGEVGPQGPRGLQGPPGPPGR.E
*	TK120303_NMyc_cyto3_step05.0019.0019.2	0.8551	0.2616	1052.86	10	2270.0%	1	K.GAQGPPGSAGPR.G
*	TK120303_NMyc_cyto3_step09.2245.2245.2	1.5582	0.2018	1613.41	11	2940.0%	1	R.GLPGPAGLPGIPGIDGAR.G
*	TK120303_NMyc_cyto3_step06.3272.3272.2	1.336	0.0287	1867.2	29	2370.0%	1	R.GPPGPPGPPGEQGLPGIEGR.E
	TK120303_NMyc_cyto3_step09.2760.2760.2	1.1939	0.0179	2576.74	20	1730.0%	1	K.GDDGVRGFVGVIGPPGLQGLPGPPGEK.G
USYI_HUMAN82.3%6613.1%12661449586.2(P41252) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) (IRS) 
*	TK120303_NMyc_cyto3_step09.2695.2695.3	2.1621	0.0354	3403.61	64	1410.0%	1	R.GSSLPGPACAYVNLNICANGSEQGGVLLLENPK.G
*	TK120303_NMyc_cyto3_step06.1923.1923.2	1.3928	0.0397	981.89	19	6250.0%	1	R.FPGAYLKGK.K
*	TK120303_NMyc_cyto3_step12.3711.3711.3	2.0086	0.1816	3780.79	48	1250.0%	1	R.GWFYTLLVLATALFGQPPFKNVIVNGLVLASDGQK.M
*	TK120303_NMyc_cyto3_step03.2934.2934.2	1.4899	0.0144	2477.68	23	1750.0%	1	-.MSNKMLQQVPENINFPAEEEK.I
*	TK120303_NMyc_cyto3_step10.2628.2628.3	2.7308	0.3236	4420.25	2	1380.0%	1	R.YWGTPIPLWVSDDFEEVVCIGSVAELEELSGAKISDLHR.E
*	TK120303_NMyc_cyto3_step04.2788.2788.3	1.8341	0.03	3366.66	13	1430.0%	1	R.LMAPYTPFLTELMYQNLKVLIDPVSVQDK.D
UQ9D14082.2%247.8%293319087.6(Q9D140) 1110030O19Rik protein 
*	TK120303_NMyc_cyto3_step06.3057.3057.2	2.1691	0.331	2602.59	2	2270.0%	2	K.SIPHPGYSHPGHSNDLMLIKMNR.K
UQ9D9D682.1%1120.2%168179659.3(Q9D9D6) 1700095D18Rik protein 
*	TK120303_NMyc_cyto3_step07.4304.4304.3	2.9591	0.2619	3662.35	2	1520.0%	1	R.QFIHSLPHAQSHSHTHSEEAAVSTAGRGTAAPWR.L
UQ9DBG782.0%339.0%636696239.0(Q9DBG7) 1300011P19Rik protein 
	TK120303_NMyc_cyto3_step09.3367.3367.3	2.5969	0.0402	3108.6	7	1700.0%	1	K.YRTEIQQQSALSLLNGTFDFQNDFLR.L
*	TK120303_NMyc_cyto3_step11.2990.2990.3	1.734	0.1121	3123.29	10	1580.0%	1	R.GTGPGGQLQDLDCSSSDDEGATQNTKPSATK.G
UQ8VGJ781.9%116.5%309345598.9(Q8VGJ7) Olfactory receptor MOR136-11 
*	TK120303_NMyc_cyto3_step04.2779.2779.2	2.2785	0.3253	2321.92	3	2370.0%	1	-.MRMDNESTVSEFILLGLPIR.A
UQ8R2Q781.8%225.2%869990467.5(Q8R2Q7) Similar to hypothetical protein FLJ20318 
*	TK120303_NMyc_cyto3_step07.2397.2397.3	2.3199	0.164	2768.22	2	2200.0%	1	R.SLQASMPGVQVLGNQIMPGLLNMEIK.F
*	TK120303_NMyc_cyto3_step12.2444.2444.2	2.3887	0.2805	2241.83	1	3890.0%	1	K.DHLIAPNDNDFGKYSFLFK.D
UDD24_HUMAN81.6%9519.7%859963329.1(Q9GZR7) ATP-dependent RNA helicase DDX24 (DEAD-box protein 24) 
*	TK120303_NMyc_cyto3_step12.3771.3771.2	1.296	0.0426	3181.51	326	860.0%	1	K.LDILGAAETGSGKTLAFAIPMIHAVLQWQK.R
*	TK120303_NMyc_cyto3_step07.3399.3399.2	1.4101	0.0044	2524.78	20	1880.0%	7	R.NAAPPPSNTEAPPGETRTEAGAETR.S
*	TK120303_NMyc_cyto3_step04.1718.1718.3	2.0823	0.036	2884.85	4	2130.0%	1	K.AEAESDALPDDTVIESEALPSDIAAEAR.A
UPHS1_MOUSE81.6%101611.1%850974317.1(Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) 
	TK120303_NMyc_cyto3_step02.1412.1412.1	1.4023	0.155	811.51	3	6670.0%	1	K.IHSDIVK.T
*	TK120303_NMyc_cyto3_step10.2800.2800.2	1.5986	0.0339	3137.72	33	1350.0%	1	R.LWSARAPNDFNLQDFNVGDYIQAVLDR.N
*	TK120303_NMyc_cyto3_step03.1536.1536.1	1.224	0.1133	867.57	1	6670.0%	1	R.HGNPWEK.A
	TK120303_NMyc_cyto3_step12.1755.1755.2	1.648	0.2321	1995.5	1	3440.0%	1	R.NVATPRDYYFALAHTVR.D
	TK120303_NMyc_cyto3_step02.1109.1109.1	1.2738	0.0822	696.54	1	8000.0%	1	R.DHLVGR.W
*	TK120303_NMyc_cyto3_step08.3410.3410.2	2.4509	0.2085	1994.62	1	4060.0%	1	R.LKQEYFVVAATLQDVIR.R
	TK120303_NMyc_cyto3_step11.2038.2038.1	1.2894	0.1328	996.66	1	5710.0%	3	R.HLHFTLVK.D
*	TK120303_NMyc_cyto3_step01.0255.0255.1	1.3576	0.0988	622.46	5	6250.0%	1	K.TQVFK.D
USCO2_HUMAN81.5%5927.8%266298108.9(O43819) SCO2 protein homolog, mitochondrial precursor 
*	TK120303_NMyc_cyto3_step07.1216.1216.2	1.2579	0.0422	1738.28	6	3240.0%	1	R.QGPAETGGQGQPQGPGLR.T
*	TK120303_NMyc_cyto3_step03.3734.3734.3	1.7977	0.0436	4317.11	36	1040.0%	2	R.VYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGR.S
*	TK120303_NMyc_cyto3_step07.3635.3635.2	1.9351	0.0053	1900.54	40	3330.0%	2	R.LLITGLFGAGLGGAWLALR.A
UO6032181.4%112.5%9471072267.2(O60321) Hypothetical protein KIAA0575 
*	TK120303_NMyc_cyto3_step03.3410.3410.2	2.0817	0.3376	2561.83	3	2170.0%	1	R.LLLSGPPQIGKTGAYLQFLSVLSR.M
UO5498881.4%465.3%12331414855.1(O54988) Serine/threonine protein kinase 
	TK120303_NMyc_cyto3_step12.4058.4058.2	1.8212	0.0010	3094.35	5	1790.0%	2	K.AVDEHASDVNLETGAELNDQTVGIHENGR.E
	TK120303_NMyc_cyto3_step08.2871.2871.2	2.1459	0.3331	2454.7	1	3250.0%	1	R.WTTSQLLQHPFVTVDSNKPVR.E
	TK120303_NMyc_cyto3_step03.4159.4159.2	1.0428	0.1958	1879.93	22	2500.0%	1	R.EAAIWELEERHLQEK.H
UQ9D00781.3%115.5%236274946.0(Q9D007) 2610209L14Rik protein 
	TK120303_NMyc_cyto3_step01.4532.4532.1	1.6572	0.2036	1525.89	1	4170.0%	1	K.QMNAIIDTVINYK.D
UP9729381.2%2212.7%347392967.4(P97293) MAP kinase kinase 3B (Mitogen activated protein kinase kinase 3) 
*	TK120303_NMyc_cyto3_step08.1482.1482.2	1.896	0.3976	1736.39	1	4000.0%	1	R.ISCVSKPPVSNPTPPR.N
*	TK120303_NMyc_cyto3_step04.2662.2662.3	1.9991	0.0486	3250.16	26	1480.0%	1	K.QVVEEPSPQLPADQFSPEFVDFTSQCLR.K
UQ6229381.2%3511.8%415471215.7(Q62293) T cell-specific protein 
*	TK120303_NMyc_cyto3_step03.2815.2815.3	0.9911	5.0E-4	3314.68	5	1610.0%	1	R.SYFGLDDASLENIAQDLNMSVDDFKVHLR.F
*	TK120303_NMyc_cyto3_step02.3540.3540.2	2.4111	0.2544	1987.4	1	5000.0%	2	R.GVGHEEKGAAPTGAIETTMK.R
UQ91WL081.1%51110.7%600682168.0(Q91WL0) Similar to hypothetical protein FLJ21522 (Epidermal growth factor receptor pathway substrate 8 related protein 3) 
*	TK120303_NMyc_cyto3_step05.2940.2940.2	1.5474	0.0235	2284.64	3	2630.0%	1	R.FPPEQPHNMTSERSISPSSR.S
*	TK120303_NMyc_cyto3_step06.3557.3557.3	2.5011	0.1447	3067.19	1	2040.0%	3	R.WWLVKNEAGLTGYIPSNILEPLPAGAPR.G
*	TK120303_NMyc_cyto3_step11.1490.1490.3	1.7085	0.0694	1903.19	17	2500.0%	1	K.SKNGITQAEYIDCFQK.I
UQ99KD081.1%1110.6%216244245.6(Q99KD0) Hypothetical 24.4 kDa protein (Fragment) 
	TK120303_NMyc_cyto3_step07.1531.1531.2	2.2698	0.316	2504.29	1	3410.0%	1	R.RPGAAEPSPDGTTGHTYNQYTQR.Y
UCOTE_HUMAN81.0%4414.5%669714838.5(P81408) COTE1 protein 
*	TK120303_NMyc_cyto3_step10.4141.4141.3	2.2028	0.1547	3782.75	13	1370.0%	1	R.DFQQCSLEGKVCVCCPSVPLLRPCPESGQELK.V
*	TK120303_NMyc_cyto3_step08.3000.3000.3	2.2025	0.2821	3785.99	4	1640.0%	1	K.VCVCCPSVPLLRPCPESGQELKVAPNSTCDEAR.G
	TK120303_NMyc_cyto3_step11.3595.3595.2	2.0047	0.351	2610.31	1	2710.0%	1	R.RPVPTFQKVPLPSGPAPAHSLGDLK.G
*	TK120303_NMyc_cyto3_step05.2488.2488.2	1.2168	0.1975	3075.44	5	1610.0%	1	R.RFSDSSGSLTPPGHRPPHPASPPPLLLPR.S
UACTZ_HUMAN80.9%115.6%376426146.6(P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) 
	TK120303_NMyc_cyto3_step12.3919.3919.2	1.9368	0.3691	2214.73	1	3000.0%	1	R.TLFSNIVLSGGSTLFKGFGDR.L
UENOG_MOUSE80.8%246.9%433471655.1(P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2) 
	TK120303_NMyc_cyto3_step04.3358.3358.2	1.6199	0.1711	3026.72	3	1720.0%	2	R.HIAQLAGNSDLILPVPAFNVINGGSHAGNK.L
UQ9DAM280.8%41022.7%216260678.8(Q9DAM2) 1700007I06Rik protein 
	TK120303_NMyc_cyto3_step01.3862.3862.3	1.7529	0.0932	3770.85	11	1370.0%	1	R.HSRPVFELLDLDGEMNIGAANFQNYRFLFNIK.K
	TK120303_NMyc_cyto3_step10.2765.2765.2	2.1341	0.1761	2082.46	1	4690.0%	3	R.DLFHDFDITGDRLLNYK.E
UGTO1_MOUSE80.5%2211.2%240274987.4(O09131) Glutathione transferase omega 1 (EC 2.5.1.18) (GSTO 1-1) (p28) 
	TK120303_NMyc_cyto3_step02.2116.2116.1	1.7306	0.1944	1079.62	1	7500.0%	1	R.HEVININLK.N
*	TK120303_NMyc_cyto3_step03.1050.1050.2	1.0599	0.064	2021.64	38	2650.0%	1	K.MTLESFSKVPPLIASFVR.S
UQ9NVI180.4%446.9%10841222466.5(Q9NVI1) Hypothetical protein FLJ10719 (Fragment) 
*	TK120303_NMyc_cyto3_step11.2458.2458.2	1.5974	0.0945	1736.57	30	2670.0%	1	R.KSVLEGIIAFFSALDK.Q
	TK120303_NMyc_cyto3_step10.3474.3474.2	1.4062	0.048	2065.4	1	3240.0%	1	R.VLLWRYTSIPTSVEESGK.K
*	TK120303_NMyc_cyto3_step02.2816.2816.2	1.2663	0.0289	2910.38	2	1920.0%	1	K.HLKVGQQGDSNNNLSPFSIALLLSVTR.I
	TK120303_NMyc_cyto3_step04.2039.2039.1	1.7261	0.1949	1487.63	4	3850.0%	1	K.EALLLVTVLTSLSK.L
UQ9CVN880.3%113.5%260298174.9(Q9CVN8) 1700027M21Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step05.1293.1293.1	1.453	0.2931	1091.84	1	6250.0%	1	K.QEEEEAVKK.E
UQ9DCL780.3%5718.0%461536316.6(Q9DCL7) 0610025O11Rik protein 
	TK120303_NMyc_cyto3_step10.3512.3512.3	2.7453	0.3165	4030.45	2	1760.0%	2	R.YQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVR.K
	TK120303_NMyc_cyto3_step06.2172.2172.3	2.1156	0.043	3175.22	54	1380.0%	1	K.LVETVACGGNLLMNIGPTGDGTIPVIFEER.L
	TK120303_NMyc_cyto3_step08.3630.3630.3	2.0537	0.1223	3301.11	4	1830.0%	1	K.KLVETVACGGNLLMNIGPTGDGTIPVIFEER.L
	TK120303_NMyc_cyto3_step10.2249.2249.3	1.3927	0.076	2019.82	39	2190.0%	1	K.KPQFVDFMNNNYAPGFK.Y
UPPCC_MOUSE80.2%9519.0%622693556.6(Q9Z2V4) Phosphoenolpyruvate carboxykinase, cytosolic [GTP] (EC 4.1.1.32) (Phosphoenolpyruvate carboxylase) (PEPCK-C) 
*	TK120303_NMyc_cyto3_step10.3974.3974.2	1.4079	0.0366	1997.76	11	2670.0%	7	R.YLEDQVNTDLPYEIER.E
	TK120303_NMyc_cyto3_step02.3296.3296.2	2.4298	0.0485	1827.67	1	5290.0%	1	R.EIISFGSGYGGNSLLGKK.C
*	TK120303_NMyc_cyto3_step11.2103.2103.2	1.2612	0.0255	2303.54	24	1670.0%	1	K.ENALNLKGLGGVNVEELFGISK.E
UPLIN_HUMAN80.1%112.7%522559506.4(O60240) Perilipin (PERI) (Lipid droplet-associated protein) 
*	TK120303_NMyc_cyto3_step03.2643.2643.2	1.9083	0.379	1422.76	1	5380.0%	1	R.VLHLTPAPAVSSTK.G
UQ9ULM380.0%91111.7%14871571649.1(Q9ULM3) Hypothetical protein KIAA1197 (Fragment) 
*	TK120303_NMyc_cyto3_step01.3938.3938.2	1.926	0.1629	2501.26	4	2500.0%	1	K.QSHEPVPDTSVEKGFPASTEAER.H
*	TK120303_NMyc_cyto3_step03.2054.2054.1	2.0472	0.0599	1106.69	1	7000.0%	2	-.AGRNAPGGLHR.A
*	TK120303_NMyc_cyto3_step04.1018.1018.2	1.3334	0.2397	2003.77	3	2500.0%	1	K.QAVAISGGQILVAKASSSVSK.A
*	TK120303_NMyc_cyto3_step09.2205.2205.1	1.3098	0.0224	1419.64	14	3570.0%	1	R.SLTSPCSLAAAGGAR.A
*	TK120303_NMyc_cyto3_step10.2705.2705.2	1.1375	0.0878	3025.25	71	1400.0%	1	R.IPKEITVSNIHQAICNIPFLDFLTNK.H
*	TK120303_NMyc_cyto3_step11.2207.2207.2	1.3175	0.0999	2739.89	86	1350.0%	1	K.IVSGSPISTPSPSPLPRTPTSTPVHVK.Q
*	TK120303_NMyc_cyto3_step11.3401.3401.2	1.209	0.083	2578.27	158	1200.0%	1	K.QLTTGSVVQGTLGVSTSSAQGQQTLK.V
*	TK120303_NMyc_cyto3_step06.2488.2488.3	1.5746	0.0249	2761.05	39	1880.0%	1	K.IVPQSQVPNPESPGKSFQPITMSCK.I
UIMA4_MOUSE80.0%7744.1%521579234.9(O35343) Importin alpha-4 subunit (Karyopherin alpha-4 subunit) (Importin alpha Q1) 
	TK120303_NMyc_cyto3_step10.3282.3282.2	2.0792	0.3352	3142.82	1	2410.0%	1	R.VQNTSLEAIVQNASSDNQGIQLSAVQAARK.L
	TK120303_NMyc_cyto3_step11.3735.3735.3	1.8914	0.1214	3889.95	48	1180.0%	1	K.EAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDK.G
*	TK120303_NMyc_cyto3_step02.3125.3125.2	1.7287	0.0446	2138.63	6	3530.0%	1	R.NVPQEDICEDSDIDGDYR.V
	TK120303_NMyc_cyto3_step07.3301.3301.3	1.7504	0.0515	4249.43	11	1250.0%	1	R.DYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCR.H
*	TK120303_NMyc_cyto3_step11.3533.3533.3	2.1024	0.0793	4117.46	8	1150.0%	1	K.DAQVVQVVLDGLSNILKMAEDQAETIANLIEECGGLEK.I
	TK120303_NMyc_cyto3_step05.3293.3293.3	1.9217	0.0257	3548.65	1	1640.0%	1	R.AVGNIVTGTDEQTQVVLNCDALSHFPALLTHPK.E
	TK120303_NMyc_cyto3_step04.4457.4457.3	1.0055	0.1851	4190.47	49	860.0%	1	R.DDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLR.L
UQ9BT0479.8%5255.7%418456796.3(Q9BT04) Similar to hypothetical protein FLJ22688 (Hypothetical protein) 
*	TK120303_NMyc_cyto3_step02.4296.4296.2	1.4848	0.1471	2670.74	1	2610.0%	5	R.ALPSGFPLHTDILGLLLLHLELKR.C
UO7057679.8%102214.3%12401411536.3(O70576) Stag3 protein 
*	TK120303_NMyc_cyto3_step06.4235.4235.2	2.4166	0.1435	2908.69	1	3120.0%	4	K.QLYTELIQEQGPQGLTELPAFIEMR.D
*	TK120303_NMyc_cyto3_step12.1228.1228.1	1.036	0.1582	1194.71	94	3890.0%	1	K.MSSAPCFQIR.C
*	TK120303_NMyc_cyto3_step10.2693.2693.3	1.8778	0.0013	4090.13	3	1390.0%	1	K.AVDTGEVPHQVILPALTLVYFSILWTVTHISESTSHK.Q
*	TK120303_NMyc_cyto3_step09.2783.2783.3	1.7583	0.0827	3725.5	137	1090.0%	1	K.TMSNSEIIQHLTEEFNEDSGDYPLTAPGPSWKK.F
*	TK120303_NMyc_cyto3_step11.1550.1550.3	1.8417	0.0589	3506.18	29	1380.0%	1	K.FSADAENVAPLLQLLSYFDLSIYCTQRLEK.H
*	TK120303_NMyc_cyto3_step03.2872.2872.2	1.3746	0.01	2006.24	11	2650.0%	1	R.AQMALSPCSSSILPCDDR.D
*	TK120303_NMyc_cyto3_step08.3707.3707.2	0.8157	0.1624	2659.32	30	1520.0%	1	R.LLAGFCKLLLYGVLELDAASDVFK.H
UQ925C179.7%244.9%430474748.1(Q925C1) GIG18 
	TK120303_NMyc_cyto3_step02.3487.3487.2	2.4216	0.2032	2412.41	7	2750.0%	2	K.VFEEMASRQPISAPLFSCPDK.N
UATPB_MOUSE79.7%117.0%529563015.3(P56480) ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) 
	TK120303_NMyc_cyto3_step04.3335.3335.3	2.9947	0.2481	3847.26	1	1810.0%	1	K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.A
UP11A_HUMAN79.5%336.1%10681244127.5(P42336) Phosphatidylinositol 3-kinase catalytic subunit, alpha isoform (EC 2.7.1.137) (PI3-kinase p110 subunit alpha) (PtdIns-3-kinase p110) (PI3K) 
*	TK120303_NMyc_cyto3_step09.2999.2999.2	1.3351	0.0691	2443.67	4	2250.0%	1	K.ILNREIGFAIGMPVCEFDMVK.D
*	TK120303_NMyc_cyto3_step06.2957.2957.2	1.8466	0.412	3016.03	1	2310.0%	1	R.RPDFMDALQGLLSPLNPAHQLGNLRLK.E
*	TK120303_NMyc_cyto3_step05.3365.3365.2	1.395	0.0309	2033.32	2	3440.0%	1	K.TLALDKTEQEALEYFMK.Q
UQ9BVL079.4%2218.6%290324475.1(Q9BVL0) Similar to hypothetical protein FLJ20643 
	TK120303_NMyc_cyto3_step11.1674.1674.2	1.8955	0.3717	2286.08	1	2630.0%	1	R.SEQRPRIQELGDLYTPAPGR.A
	TK120303_NMyc_cyto3_step11.3546.3546.3	1.704	0.0884	3884.33	304	910.0%	1	K.VFINICHSPSIPPPADVTEEELLQMLEEDQAGFR.I
UDHA5_HUMAN79.3%227.7%517572176.8(P30837) Aldehyde dehydrogenase X, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) 
*	TK120303_NMyc_cyto3_step11.1449.1449.2	1.0921	0.1451	2140.28	37	2190.0%	1	K.WHGKTIPMHGQHFCFTR.H
	TK120303_NMyc_cyto3_step02.3223.3223.2	2.3065	0.294	2344.21	1	2730.0%	1	K.VAFTGSTEVGHLIQKAAGDSNLK.R
UIRS1_HUMAN79.3%336.0%12421315918.5(P35568) Insulin receptor substrate-1 (IRS-1) 
*	TK120303_NMyc_cyto3_step08.2315.2315.3	1.6298	0.1407	3380.35	42	1330.0%	1	K.QCPQECTPEPQPPPPPPPHQPLGSGESSSTR.R
*	TK120303_NMyc_cyto3_step05.3560.3560.2	1.4557	0.0539	2894.44	23	1610.0%	1	R.CTPGTGLGTSPALAGDEAASAADLDNRFR.K
*	TK120303_NMyc_cyto3_step01.1216.1216.1	1.5503	0.2131	1497.54	1	4230.0%	1	-.MASPPESDGFSDVR.K
UQORL_HUMAN79.3%4422.1%349386635.8(O95825) Quinone oxidoreductase-like 1 (QOH-1) (4P11) 
*	TK120303_NMyc_cyto3_step12.4428.4428.3	2.017	0.1136	4312.95	5	1280.0%	1	R.EIAGIVLDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVR.V
*	TK120303_NMyc_cyto3_step11.3211.3211.2	1.5595	0.1416	3130.75	109	1300.0%	1	K.VSFFQPDDEVVGILPLDSEDPGLCEVVR.V
	TK120303_NMyc_cyto3_step09.2724.2724.2	1.4561	0.0969	2689.96	3	2500.0%	1	R.VHEHYLVHKPEKVTWTEAAGSIR.D
	TK120303_NMyc_cyto3_step10.1766.1766.1	1.516	0.2259	1481.42	5	3080.0%	1	R.GAKVISTACSLEDK.Q
UQ8R3D479.2%115.8%657720895.3(Q8R3D4) Hypothetical 72.1 kDa protein 
*	TK120303_NMyc_cyto3_step02.3521.3521.3	2.6294	0.393	4344.09	1	1280.0%	1	R.EEPCVWEQHHPEEREIPVTADTGTETLVPAQDISSQVK.R
UQ99MH679.2%2210.0%471523918.3(Q99MH6) Nkd 
*	TK120303_NMyc_cyto3_step09.1945.1945.2	1.9057	0.3652	1947.54	1	3240.0%	1	R.ELPAVVVYESQAGQAVQR.H
	TK120303_NMyc_cyto3_step02.2676.2676.3	1.7599	0.1261	3215.3	11	1790.0%	1	K.VTREDITSLLHTIYEVVDSSVNHSPTSSK.T
UQ921L779.2%92921.2%340382086.0(Q921L7) Similar to HEMK homolog 7kb (Expressed sequence AW049265) 
*	TK120303_NMyc_cyto3_step11.3435.3435.3	1.6068	0.0121	3681.72	83	1250.0%	1	K.MVPPVFIPRPETEELVEWVLEEVARRPHAVR.A
*	TK120303_NMyc_cyto3_step04.2346.2346.3	2.8974	0.2842	2815.64	1	2500.0%	5	K.TYSSLTGPLSATGMVNHWTQVFEER.G
*	TK120303_NMyc_cyto3_step11.1103.1103.1	0.8558	0.1177	735.55	5	6000.0%	1	R.RPHAVR.A
*	TK120303_NMyc_cyto3_step04.4251.4251.3	1.7731	0.2119	1681.14	3	3270.0%	1	K.LWGQILWTLLSVPR.G
*	TK120303_NMyc_cyto3_step04.4214.4214.2	1.1341	0.1422	1943.69	1	2670.0%	1	-.MKLWGQILWTLLSVPR.G
UABC9_HUMAN79.2%228.0%766844757.9(Q9NP78) ATP-binding cassette, sub-family B, member 9 precursor (ATP-binding cassette transporter 9) (ABC transporter 9 protein) (TAP-like protein) (TAPL) (hABCB9) 
*	TK120303_NMyc_cyto3_step01.4164.4164.2	1.1229	0.0061	2589.84	34	1670.0%	1	R.QMLGLQPAADFTAGHNEPVANGSHK.A
*	TK120303_NMyc_cyto3_step10.2677.2677.3	2.901	0.3027	3794.14	3	1430.0%	1	K.SMDQFSTAVVIVCLLAIGSSFAAGIRGGIFTLIFAR.L
UO8878379.2%794.7%21832472286.0(O88783) Murine coagulation factor V 
*	TK120303_NMyc_cyto3_step03.1996.1996.3	1.958	0.1559	1774.47	27	2860.0%	1	K.SPHVRQEEENSGFQK.R
*	TK120303_NMyc_cyto3_step11.1433.1433.2	1.6211	0.3217	1775.21	1	5000.0%	1	K.QHVLLFAVFDESKSR.S
*	TK120303_NMyc_cyto3_step12.3888.3888.3	2.9104	0.3061	3947.85	1	1690.0%	2	R.SSPPELSQGLDYDLSHDFYPDDIGLTSFFPDQSQK.S
*	TK120303_NMyc_cyto3_step06.2925.2925.2	1.4517	0.0579	2008.29	11	2940.0%	1	K.SVMYFTGNSDGSTIKENR.L
*	TK120303_NMyc_cyto3_step06.1416.1416.2	1.1014	0.014	970.69	2	6430.0%	1	R.KGTLHMER.N
*	TK120303_NMyc_cyto3_step07.1239.1239.3	1.2656	0.0605	1376.1	5	2750.0%	1	K.IINNNLKDFQR.T
UUNG_MOUSE79.1%114.4%2953305410.0(P97931) Uracil-DNA glycosylase, mitochondrial precursor (EC 3.2.2.-) (UDG) 
	TK120303_NMyc_cyto3_step01.3666.3666.1	1.5377	0.2101	1394.53	5	3750.0%	1	R.QGVLLLNAVLTVR.A
UQ9CR1679.1%4413.2%370407437.4(Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) 
*	TK120303_NMyc_cyto3_step04.1300.1300.1	0.9785	0.0817	1501.67	25	2920.0%	1	K.DVDKILLISEDLK.N
	TK120303_NMyc_cyto3_step04.2246.2246.1	1.4643	0.2505	1026.63	1	6880.0%	1	K.HVVFGQVIK.G
*	TK120303_NMyc_cyto3_step08.1354.1354.1	0.8123	0.043	900.31	252	2860.0%	1	K.AVIEKADR.S
*	TK120303_NMyc_cyto3_step12.3374.3374.2	1.5846	0.2336	2086.68	13	2500.0%	1	K.GTGSTTGKPLHFKGCPFHR.I
UQ91YD679.0%465.1%859965096.3(Q91YD6) Villin-like protein (Fragment) 
	TK120303_NMyc_cyto3_step07.1995.1995.2	2.3819	0.2057	1829.99	1	5000.0%	2	R.AQIAVVDAENEATNLLR.I
	TK120303_NMyc_cyto3_step03.2454.2454.3	2.1674	0.1736	2906.27	238	1250.0%	1	R.IMEAVLGCRSGSLCPSVPSNSVSQLQK.A
	TK120303_NMyc_cyto3_step09.1648.1648.1	0.9476	0.0097	1051.5	39	5620.0%	1	R.IMEAVLGCR.S
UMEC2_MOUSE79.0%4419.4%4845230810.0(Q9Z2D6) Methyl-CpG-binding protein 2 (MeCP-2 protein) (MeCP2) 
	TK120303_NMyc_cyto3_step04.1883.1883.1	1.2661	0.0542	1167.51	1	5500.0%	1	R.KAEADPQAIPK.K
*	TK120303_NMyc_cyto3_step05.2963.2963.1	1.6449	0.1945	1508.63	1	4000.0%	1	K.GEGGGATTSAQVMVIK.R
	TK120303_NMyc_cyto3_step03.0740.0740.2	0.9765	0.0757	3047.44	5	1540.0%	1	K.VELIAYFEKVGDTSLDPNDFDFTVTGR.G
*	TK120303_NMyc_cyto3_step12.1703.1703.3	1.6302	0.124	3934.41	25	1090.0%	1	K.HEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPK.Q
UEHD1_MOUSE78.9%577.9%534606036.8(Q9WVK4) EH-domain containing protein 1 (mPAST1) 
*	TK120303_NMyc_cyto3_step08.2568.2568.2	2.3817	0.19	2061.39	1	3330.0%	2	K.LEGHELPADLPPHLIPPSK.R
	TK120303_NMyc_cyto3_step10.1123.1123.1	1.1596	0.0298	575.57	1	8330.0%	1	R.RPFR.K
*	TK120303_NMyc_cyto3_step12.2395.2395.2	1.6071	0.1307	2290.41	7	2500.0%	1	K.VKLEGHELPADLPPHLIPPSK.R
	TK120303_NMyc_cyto3_step11.1469.1469.2	1.4425	0.1254	2016.8	6	3120.0%	1	R.VYIGSFWSHPLLIPDNR.K
UGAL1_MOUSE78.9%337.9%391421765.3(Q9R0N0) Galactokinase (EC 2.7.1.6) (Galactose kinase) 
	TK120303_NMyc_cyto3_step01.2255.2255.1	1.1247	0.0157	1385.64	1	4170.0%	1	R.SLETSLVPLSDPK.L
*	TK120303_NMyc_cyto3_step03.1446.1446.1	1.3358	0.1507	839.58	73	5000.0%	1	R.HVVSEIR.R
*	TK120303_NMyc_cyto3_step02.1496.1496.1	1.5733	0.2037	1231.59	1	5500.0%	1	R.HSLGSSEYPVR.R
UQ6128578.9%392.7%741834839.1(Q61285) ALDR protein (ATP-binding cassette, sub-family D (ALD), member 2) 
	TK120303_NMyc_cyto3_step04.3522.3522.2	1.8106	0.277	1901.86	1	3160.0%	3	R.GASPIGPTLLAGLVVYATAK.V
UQ6173078.8%112.1%570657417.8(Q61730) Interleukin 1 receptor accessory protein precursor 
	TK120303_NMyc_cyto3_step11.1778.1778.1	1.8713	0.1803	1531.63	5	4550.0%	1	R.QDRDLEEPINFR.L
UQ8TCY778.6%113.9%204229085.4(Q8TCY7) BNIP-Sbeta 
	TK120303_NMyc_cyto3_step11.1966.1966.1	1.4631	0.2457	942.63	2	6430.0%	1	K.RLSAPELR.L
UO1507478.5%448.5%14411594776.5(O15074) Hypothetical protein KIAA0368 (Fragment) 
*	TK120303_NMyc_cyto3_step04.1891.1891.3	1.8098	0.0819	2375.28	19	2120.0%	1	K.ERAIQTLGYFPVGDGDFPHQK.L
*	TK120303_NMyc_cyto3_step12.2480.2480.2	1.2677	0.0543	2534.36	9	1880.0%	1	K.QIELQFTIGEAITSAAIGTSSVAAR.D
*	TK120303_NMyc_cyto3_step10.2694.2694.3	1.8579	0.0889	4737.69	108	760.0%	1	K.SGETNPVQIYIGLLQQLLAGVGGLPVMYCLLEAVSVYPEKLATK.F
*	TK120303_NMyc_cyto3_step11.2111.2111.3	2.7085	0.3207	3443.41	1	1940.0%	1	K.AIACVVTACSAELEKSVPNQPSTNEILQAVLK.E
UQ99KZ578.4%226.6%774842148.0(Q99KZ5) Similar to hypothetical protein FLJ22087 
*	TK120303_NMyc_cyto3_step07.2461.2461.3	1.7798	0.0414	3428.28	62	1500.0%	1	K.KVLYGYWSAFVPDTPELGSPQSVSLMTLTLK.D
*	TK120303_NMyc_cyto3_step01.1778.1778.2	2.3901	0.0619	2190.35	5	3680.0%	1	R.CLLLALVAESSSQTLTQIIK.C
UQ8VD7378.4%5179.7%404437788.6(Q8VD73) Similar to potassium voltage gated channel, shaker related subfamily, beta member 3 
*	TK120303_NMyc_cyto3_step02.3679.3679.2	1.8561	0.181	2996.02	5	1820.0%	4	R.LCGPRPGPGGGNGGPVGGGHGNPPGGGGPSSKSR.A
*	TK120303_NMyc_cyto3_step01.2491.2491.3	1.5057	0.0598	3326.94	19	1390.0%	1	R.SSEDRLCGPRPGPGGGNGGPVGGGHGNPPGGGGPSSK.S
UP7033678.4%554.8%13881605856.0(P70336) Rho-associated, coiled-coil forming protein kinase p160 ROCK-2 
	TK120303_NMyc_cyto3_step04.2070.2070.2	1.2432	0.1166	1860.47	4	4000.0%	1	R.DVKPDNMLLDKHGHLK.L
	TK120303_NMyc_cyto3_step01.1310.1310.1	1.5113	0.0511	780.46	7	7000.0%	1	R.YEKIVK.K
	TK120303_NMyc_cyto3_step07.2611.2611.2	1.5641	0.0141	1615.44	1	4620.0%	1	K.HGHLKLADFGTCMK.M
	TK120303_NMyc_cyto3_step01.2076.2076.1	1.6182	0.1938	1275.58	5	5000.0%	1	K.QENNHLMEMK.M
*	TK120303_NMyc_cyto3_step10.2545.2545.2	1.1226	0.0563	2963.31	5	1800.0%	1	K.GDVETFPIPKAFVGNQLPFIGFTYFR.E
UQ8WWL278.3%8228.2%728809257.5(Q8WWL2) Spir-2 protein (Fragment) 
*	TK120303_NMyc_cyto3_step09.3413.3413.2	2.2858	0.2969	2997.3	1	2500.0%	1	K.HLWLEFSHPVESLALTVEEVMDVRR.V
*	TK120303_NMyc_cyto3_step03.1255.1255.1	0.7063	0.0074	1220.56	168	3330.0%	1	R.EDEPHLETPR.A
*	TK120303_NMyc_cyto3_step12.4335.4335.2	1.4318	0.0291	2074.11	5	2650.0%	2	K.DVCSECTSFVADVVRSSR.K
*	TK120303_NMyc_cyto3_step03.1194.1194.1	1.1642	0.0176	900.04	92	5830.0%	4	K.QRSLHEK.I
UQ96JB178.3%15733.2%44905148186.3(Q96JB1) Axonemal dynein heavy chain 8 
*	TK120303_NMyc_cyto3_step01.2503.2503.1	1.4986	0.2317	1534.95	5	3460.0%	1	R.EGEKIVLDNSVMAK.G
*	TK120303_NMyc_cyto3_step04.2703.2703.2	1.4578	0.092	2228.07	22	2500.0%	8	K.LTQVIENWTNQNLSFAAFK.G
*	TK120303_NMyc_cyto3_step10.2998.2998.2	1.2778	0.0407	2556.91	1	2500.0%	1	R.VIADRFITPEDEQWFNAHLTR.A
*	TK120303_NMyc_cyto3_step05.3024.3024.2	1.1611	0.0601	2710.66	109	1360.0%	1	K.GPVEIWLLDLLKMQMSSLHNIIR.S
*	TK120303_NMyc_cyto3_step02.4439.4439.3	1.5664	0.0516	3026.38	62	1400.0%	1	K.DAPEEEIIPDGYNDSLDTCHKLLLIR.S
*	TK120303_NMyc_cyto3_step01.4628.4628.3	1.82	0.2149	4519.85	13	1040.0%	1	K.IPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTK.A
UQ9H84178.3%116.0%368407858.9(Q9H841) Hypothetical protein FLJ13955 
*	TK120303_NMyc_cyto3_step11.3047.3047.2	1.8175	0.4419	2620.76	1	2140.0%	1	R.EKEHLQQSYIDFGNIPDTTPER.K
UA1AT_HUMAN78.2%226.0%418467375.6(P01009) Alpha-1-antitrypsin precursor (Alpha-1 protease inhibitor) (Alpha-1-antiproteinase) (PRO0684/PRO2209) 
	TK120303_NMyc_cyto3_step08.2402.2402.2	1.7368	0.0797	2060.72	1	3530.0%	1	K.LYHSEAFTVNFGDTEEAK.K
	TK120303_NMyc_cyto3_step01.1380.1380.1	1.9494	0.1409	922.42	5	8330.0%	1	K.FLENEDR.R
UQ9DBV378.2%5510.0%11451286257.9(Q9DBV3) 1200013B07Rik protein 
	TK120303_NMyc_cyto3_step07.2667.2667.2	1.4027	0.1549	2586.95	2	2500.0%	1	K.STQVPQYLLAAGFSHVACTQPRR.I
	TK120303_NMyc_cyto3_step11.1469.1469.3	1.9374	0.0699	3024.69	5	1900.0%	1	K.GGYAVSDYLTYNCLTSDTDLYSDCLR.S
	TK120303_NMyc_cyto3_step03.0531.0531.2	1.1014	0.0879	1964.42	6	2650.0%	1	K.CILSTNIAETSVTIDGIR.F
	TK120303_NMyc_cyto3_step12.3468.3468.2	2.0541	0.3265	2254.57	1	2750.0%	1	R.ILQTLKEHQVVVVAGDTGCGK.S
	TK120303_NMyc_cyto3_step01.4138.4138.2	2.0654	0.1978	2788.48	6	1920.0%	1	R.IAHENTCPEAPGDDPGSEEAAPAPPQK.T
UQ9DA7278.2%2227.5%218248597.3(Q9DA72) 1700019B03Rik protein 
*	TK120303_NMyc_cyto3_step11.4078.4078.3	2.6437	0.2434	3986.7	8	1400.0%	1	R.TLKFSLLESNLPEGTGELDFFTTNQMMMKPHGIVR.A
*	TK120303_NMyc_cyto3_step10.2338.2338.3	2.8618	0.2636	3002.74	1	2290.0%	1	K.YLGCWHEKADPQGPQIPMYPCLSQQ.-
UQ9QXZ278.2%2212.1%529576047.0(Q9QXZ2) TAGL-alpha 
	TK120303_NMyc_cyto3_step12.3004.3004.3	1.7651	0.0132	2594.73	9	2280.0%	1	K.TPTTVDRLLAITLAGDLGLTFLHR.S
*	TK120303_NMyc_cyto3_step12.3591.3591.3	2.8661	0.2651	4529.09	1	1790.0%	1	K.LEPEHLQLQNISQEQLAQVATLATKEFTEAFLGCPAIHPR.C
UASSY_MOUSE78.2%112.2%412465858.2(P16460) Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) 
	TK120303_NMyc_cyto3_step02.1100.1100.1	1.4965	0.2293	920.58	1	6880.0%	1	K.YVSHGATGK.G
UQ99LR178.1%4626.8%179208807.6(Q99LR1) Hypothetical 20.9 kDa protein 
	TK120303_NMyc_cyto3_step04.3130.3130.3	1.6755	0.1014	2568.08	35	1850.0%	1	R.SGDNPVYIWGHSLGTGVATNLVRR.L
	TK120303_NMyc_cyto3_step01.2699.2699.1	1.2115	0.0135	1106.88	314	5000.0%	1	K.SHPFSVIYR.Y
*	TK120303_NMyc_cyto3_step05.2907.2907.2	1.2767	0.1118	1846.3	1	4290.0%	2	K.VQFIPFHSDLGYRHK.Y
U5H2B_HUMAN78.1%2211.9%481542989.1(P41595) 5-hydroxytryptamine 2B receptor (5-HT-2B) (Serotonin receptor) 
*	TK120303_NMyc_cyto3_step02.0724.0724.3	1.0964	0.0509	4239.04	180	790.0%	1	K.QIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEK.K
*	TK120303_NMyc_cyto3_step12.1762.1762.2	2.126	0.3193	2173.73	1	3530.0%	1	K.NKPPQRLTWLTVSTVFQR.D
UQ9D0Q578.0%1117.2%1161195811.3(Q9D0Q5) 2600006K01Rik protein 
*	TK120303_NMyc_cyto3_step04.1051.1051.2	2.3007	0.271	2096.3	1	3160.0%	1	R.TTVGSVGSVTLAARSCCPNR.S
UQ9JJU678.0%4623.9%373411077.2(Q9JJU6) B-Raf protein (Fragment) 
	TK120303_NMyc_cyto3_step02.2460.2460.3	2.0186	0.037	3256.78	3	1670.0%	1	K.FGGEHNPPSIYLEAYEEYTSKLDALQQR.E
	TK120303_NMyc_cyto3_step12.3459.3459.2	2.3141	0.2674	3007.55	2	1920.0%	2	R.SSSAPNVHINTIEPVNIDDLIRDQGFR.G
	TK120303_NMyc_cyto3_step07.0190.0190.3	1.1901	0.0383	3947.54	13	830.0%	1	K.KPIGWDTDISWLTGEELHVEVLENVPLTTHNFVR.K
UTNF9_MOUSE78.0%115.8%309338535.8(P41274) Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL) 
*	TK120303_NMyc_cyto3_step06.1936.1936.2	2.1159	0.32	2113.18	1	3240.0%	1	K.KELVVDSPGLYYVFLELK.L
UQ9BTR078.0%86422.2%3639117.3(Q9BTR0) Hypothetical protein 
*	TK120303_NMyc_cyto3_step04.2646.2646.1	1.2367	0.1098	883.65	3	6430.0%	8	R.RGILPGLR.-
UQ6225877.9%3311.0%418467505.8(Q62258) Spi2 proteinase inhibitor 
	TK120303_NMyc_cyto3_step02.1129.1129.1	1.4586	0.2439	796.41	3	6670.0%	1	R.VSQVVHK.A
	TK120303_NMyc_cyto3_step12.2131.2131.2	1.6156	0.0603	2441.48	5	2630.0%	1	K.RRPVIVPMMSMEDLTTPYFR.D
	TK120303_NMyc_cyto3_step10.3234.3234.2	1.3299	0.0233	2555.42	2	2000.0%	1	R.VSQVVHKAVLDVAETGTEAAAATGVK.F
UMYBB_MOUSE77.7%113.7%704791037.0(P48972) Myb-related protein B (B-Myb) 
*	TK120303_NMyc_cyto3_step07.3657.3657.2	1.9577	0.3394	2600.68	1	2600.0%	1	R.GELIPISPSTEFGGSGIGTPPSVLKR.Q
UFLIH_HUMAN77.5%352.0%12691447516.1(Q13045) Flightless-I protein homolog 
*	TK120303_NMyc_cyto3_step10.3292.3292.2	2.2127	0.3063	3066.96	1	2200.0%	2	K.LTNLEEFMAANNNLELVPESLCRCPK.L
UMAON_HUMAN77.4%227.9%604670547.8(Q16798) NADP-dependent malic enzyme, mitochondrial precursor (EC 1.1.1.40) (NADP-ME) (Malic enzyme 3) 
*	TK120303_NMyc_cyto3_step12.1978.1978.3	2.0858	0.2041	3556.91	6	1580.0%	1	K.GMAFTLEERLQLGIHGLIPPCFLSQDVQLLR.I
*	TK120303_NMyc_cyto3_step04.3130.3130.2	2.3117	0.2582	1712.39	3	4380.0%	1	-.MGAALGTGTRLAPWPGR.A
UEXL1_MOUSE77.2%356.9%669740098.3(Q9JKV7) Exostosin-like 1 (EC 2.4.1.-) (Exostosin-L) (Multiple exostosis-like protein) 
*	TK120303_NMyc_cyto3_step04.1887.1887.1	1.536	0.0351	1286.65	2	6000.0%	2	R.EMLPSRVLALR.Q
*	TK120303_NMyc_cyto3_step12.2735.2735.3	1.6675	0.0507	4019.6	56	1180.0%	1	R.SATSCFLQALQAGCIPVLLSPRWELPFSEVIDWTK.A
USMOO_HUMAN77.2%448.7%915984508.6(P53814) Smoothelin 
*	TK120303_NMyc_cyto3_step12.2490.2490.2	1.5016	0.01	2124.29	8	2500.0%	1	K.MEPEPAEPLAAAVEAANGAER.A
	TK120303_NMyc_cyto3_step11.3955.3955.2	0.9177	0.0207	2258.19	11	2140.0%	1	R.SENGSGSTMMQTKTFSSSSSSK.K
	TK120303_NMyc_cyto3_step10.3270.3270.2	1.1469	0.0421	2405.2	19	2050.0%	1	R.AQEIEAATLAGRLYSGRPNSGSR.E
	TK120303_NMyc_cyto3_step06.1500.1500.1	1.8742	0.1532	1464.55	1	4620.0%	1	R.ESTPLASGPSSFQR.A
UQ8TAJ677.1%3315.4%469529095.2(Q8TAJ6) Similar to KIAA1076 protein (Fragment) 
	TK120303_NMyc_cyto3_step10.2196.2196.1	1.8335	0.1688	1459.7	1	4580.0%	1	R.RRPPPPPPPPPPR.A
	TK120303_NMyc_cyto3_step08.3170.3170.3	1.631	0.1264	3895.06	8	1330.0%	1	R.LTYERLLQQTSGADWLNDTHWVHHTITNLTTPK.R
	TK120303_NMyc_cyto3_step04.3818.3818.3	2.1066	0.1453	3145.92	8	1800.0%	1	R.SEFEQMTILYDIWNSGLDSEDMSYLR.L
UQ924V877.1%3513.1%565618106.8(Q924V8) Carboxylesterase MH1 (EC 3.1.1.1) 
	TK120303_NMyc_cyto3_step03.3792.3792.2	2.2978	0.2787	3147.89	1	2580.0%	2	R.AISESGVSLTAALITTDVKPIAGLVATLSGCK.T
	TK120303_NMyc_cyto3_step03.2806.2806.3	1.5481	0.1041	4440.61	12	1040.0%	1	K.NSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYR.L
UP2AA_MOUSE77.1%41010.7%309356085.5(P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) 
	TK120303_NMyc_cyto3_step08.1328.1328.1	1.275	0.2467	953.63	1	6430.0%	3	R.RGEPHVTR.R
	TK120303_NMyc_cyto3_step01.3147.3147.2	2.2897	0.2837	2658.7	1	3120.0%	1	R.GAGYTFGQDISETFNHANGLTLVSR.A
UQ9HBF976.7%71913.6%714814978.8(Q9HBF9) Gag-pro-pol protein (Fragment) 
*	TK120303_NMyc_cyto3_step10.3448.3448.2	1.2965	0.0799	2059.6	270	1670.0%	1	K.YVTGLFPGIETATLPPRTK.I
*	TK120303_NMyc_cyto3_step06.2069.2069.2	2.2528	0.2862	2118.37	1	3240.0%	4	K.YVHVTVDTYSHFTFATAR.T
*	TK120303_NMyc_cyto3_step06.2931.2931.2	1.3321	0.0897	2524.35	1	2750.0%	1	K.DPDYIVVPYTKVQFDLLLQEK.E
*	TK120303_NMyc_cyto3_step12.3246.3246.3	1.4388	0.1026	4686.01	31	990.0%	1	R.LDLSRPWSLCILKTEYTPTACLWQNGVLEWIHLPHIPPK.V
UQ96C8176.7%2421.2%137152089.6(Q96C81) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step12.4226.4226.3	2.6425	0.3585	3389.88	1	2050.0%	2	R.ASSHQGGPFKLQICLSSLYSNLLLHCHYR.E
UASSY_HUMAN76.7%2213.1%412465308.0(P00966) Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) 
*	TK120303_NMyc_cyto3_step08.1552.1552.3	2.6349	0.3531	3376.64	1	2040.0%	1	K.VFIEDVSREFVEEFIWPAIQSSALYEDR.Y
*	TK120303_NMyc_cyto3_step03.4423.4423.3	1.8014	0.0828	2897.42	25	1800.0%	1	K.VTNVKDGTTHQTSLELFMYLNEVAGK.H
UQ9Z11376.7%3317.1%5215530110.0(Q9Z113) Insulinoma-associated protein 
*	TK120303_NMyc_cyto3_step03.3278.3278.3	1.9515	0.1113	2962.5	28	1530.0%	1	K.MGTAFSAGAEAARGPGTGPPLSPAAALRPPGK.R
	TK120303_NMyc_cyto3_step04.3702.3702.1	1.0893	0.0567	807.33	18	6000.0%	1	R.EHEKHK.Y
*	TK120303_NMyc_cyto3_step05.3629.3629.3	2.6258	0.3515	4595.16	1	1400.0%	1	R.SFNLGSPVSAESFPTPAALLAGGGSGANGAGGGGGGTCGGDALLFAPAELK.M
UTENX_HUMAN76.7%884.6%42894644615.3(P22105) Tenascin-X precursor (TN-X) (Hexabrachion-like) 
*	TK120303_NMyc_cyto3_step02.2612.2612.2	1.5291	0.2648	2611.84	1	2290.0%	1	K.GLKEQCTGGCCPASAQAGTGQTDVR.T
*	TK120303_NMyc_cyto3_step08.2875.2875.2	1.3921	0.0562	2598.29	52	1460.0%	1	R.VGPISVIGVTEEETPSPTELSTEAR.E
	TK120303_NMyc_cyto3_step03.2174.2174.1	1.3131	0.059	1157.68	1	5000.0%	1	K.FVLYGFVGKK.R
*	TK120303_NMyc_cyto3_step01.0795.0795.1	1.0647	0.0012	1074.33	28	5000.0%	1	K.LRLGQMTVR.D
*	TK120303_NMyc_cyto3_step01.4627.4627.3	1.6421	0.0812	3586.22	2	1800.0%	1	R.LGELTVTDATPDSVGLSWTVPEGEFDSFVVQYK.D
*	TK120303_NMyc_cyto3_step03.4362.4362.3	2.6536	0.3567	3793.45	1	1480.0%	1	R.LGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFK.D
	TK120303_NMyc_cyto3_step08.2875.2875.3	1.7736	0.1092	3896.93	20	1180.0%	1	K.TITTMIDGPQDLRVVAVTPTTLELGWLRPQAEVDR.F
*	TK120303_NMyc_cyto3_step03.2144.2144.3	1.8349	0.0037	2975.68	154	1400.0%	1	R.GRCVCFPGYTGPSCGWPSCPGDCQGR.G
UABCR_HUMAN76.4%665.9%22732559416.3(P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein) 
*	TK120303_NMyc_cyto3_step03.2387.2387.3	1.8662	0.1642	3109.36	1	1880.0%	1	K.LSTAIALIGCPPLVLLDEPTTGMDPQARR.M
*	TK120303_NMyc_cyto3_step06.2856.2856.3	1.6153	0.1085	3972.61	95	1090.0%	1	R.DFQELLMNAPESQHLGRIWTELHILSQFMDTLR.T
*	TK120303_NMyc_cyto3_step07.1303.1303.3	0.871	0.0077	1984.47	20	2190.0%	1	R.FGEEHSANPFHWDLIGK.N
*	TK120303_NMyc_cyto3_step05.3617.3617.2	2.3707	0.1653	2053.98	1	3420.0%	1	K.LPVVPITGEALVGFLSDLGR.I
*	TK120303_NMyc_cyto3_step02.1092.1092.2	0.8412	0.0094	1896.2	55	2670.0%	1	K.GPRESQADDMANFDWR.D
*	TK120303_NMyc_cyto3_step11.3393.3393.2	1.4064	0.1946	2123.71	8	2500.0%	1	R.TTSFCNALIQSLESNPLTK.I
USCAB_MOUSE76.4%112.5%638721976.1(Q9WU38) Amiloride-sensitive sodium channel beta-subunit (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) 
*	TK120303_NMyc_cyto3_step05.2480.2480.2	2.3451	0.2561	1897.44	1	4000.0%	1	K.HLLKDLDELMEAVLEK.I
UQ96JH276.4%8813.9%12701373115.6(Q96JH2) Hypothetical protein KIAA1855 (Fragment) 
*	TK120303_NMyc_cyto3_step04.4149.4149.1	0.7993	0.1381	596.53	15	4000.0%	1	R.GVPPAR.A
*	TK120303_NMyc_cyto3_step10.2424.2424.2	1.1908	0.0419	2562.92	7	1540.0%	1	R.APLENGLALSGLNGAEIEGSALSGAPR.E
*	TK120303_NMyc_cyto3_step03.3256.3256.2	2.3518	0.2525	2678.37	2	2800.0%	1	R.ASMADGDLEPEEGSKTLVLVSPGDMK.K
*	TK120303_NMyc_cyto3_step08.1375.1375.1	0.8428	0.0184	1252.61	259	3000.0%	1	R.HAMPGSRPRSR.I
*	TK120303_NMyc_cyto3_step08.2768.2768.3	2.6067	0.1951	3990.89	4	1410.0%	1	K.THLNVMSSGGQALRSEEFSAGGELGLELASDGGAVEEGAR.A
*	TK120303_NMyc_cyto3_step09.2713.2713.2	1.4137	0.1879	2401.19	1	2730.0%	1	R.LQLQTPPGSATAADLRPKQPPGR.G
*	TK120303_NMyc_cyto3_step11.4247.4247.3	1.5671	0.0254	2850.16	100	1590.0%	1	R.HDDLWSLFYMLVEFAVGQLPWRK.I
*	TK120303_NMyc_cyto3_step12.1039.1039.3	2.0175	0.0789	2245.76	9	2630.0%	1	R.LGKQILESIEAIHSVGFLHR.D
UPGK2_MOUSE76.4%111.4%416447807.1(P09041) Phosphoglycerate kinase, testis specific (EC 2.7.2.3) 
	TK120303_NMyc_cyto3_step01.2218.2218.1	1.9008	0.1306	734.55	1	8000.0%	1	K.DVIFLK.D
UQ99K7076.4%246.0%398441215.1(Q99K70) Similar to Rag C protein 
	TK120303_NMyc_cyto3_step07.2615.2615.2	1.7522	0.0387	2492.44	3	2390.0%	2	-.MSLQYGAEETPLAGSYGAADSFPK.D
UQ8VI9476.3%5712.7%511590897.1(Q8VI94) 2',5'-oligoadenylate synthetase-like 9 
*	TK120303_NMyc_cyto3_step10.1083.1083.2	1.5013	0.1174	1376.34	42	3640.0%	1	K.IQLSQGYLGLQR.L
*	TK120303_NMyc_cyto3_step07.3055.3055.2	2.2528	0.2019	2397.5	17	2250.0%	2	K.NPDGRSHAYAIHPLDYVLNLK.Q
*	TK120303_NMyc_cyto3_step11.3778.3778.3	1.684	0.0186	3555.86	54	1210.0%	1	R.ETWETITVTVVPAYRALGPSCPSSEVYANLIK.A
UQ96IC476.2%114.8%310338348.8(Q96IC4) Similar to RIKEN cDNA 9430029K10 gene (Fragment) 
	TK120303_NMyc_cyto3_step04.3199.3199.2	2.0732	0.3249	1524.05	1	4640.0%	1	R.LKILADAAAEGVPVR.G
U143S_MOUSE76.1%3513.7%248277134.8(O70456) 14-3-3 protein sigma (Stratifin) 
	TK120303_NMyc_cyto3_step09.2624.2624.2	1.3474	0.0458	2835.98	3	2200.0%	1	R.LGLALNFSVFHYEIANSPEEAISLAK.T
	TK120303_NMyc_cyto3_step01.1166.1166.1	1.5464	0.201	903.55	1	6430.0%	2	R.VLSSIEQK.S
UCD48_MOUSE76.1%2217.5%240273837.7(P18181) MRC OX-45 surface antigen precursor (BCM1 surface antigen) (BLAST-1) (CD48) (HM48-1) 
*	TK120303_NMyc_cyto3_step06.2867.2867.3	1.2457	0.12	3963.9	39	1110.0%	1	K.QGWCLVLELLLLPLGTGFQGHSIPDINATTGSNVTLK.I
*	TK120303_NMyc_cyto3_step02.3500.3500.3	2.6006	0.3464	4646.55	1	1400.0%	1	-.MCFIKQGWCLVLELLLLPLGTGFQGHSIPDINATTGSNVTLK.I
UQ9DB3876.1%3322.7%1721883610.1(Q9DB38) 1500015O20Rik protein 
	TK120303_NMyc_cyto3_step09.1636.1636.2	1.8259	0.0135	1229.3	160	5560.0%	1	R.KGYSCPECAR.V
*	TK120303_NMyc_cyto3_step03.1828.1828.1	1.8607	0.1479	1140.58	1	6000.0%	1	R.EATPGEPGPRK.G
*	TK120303_NMyc_cyto3_step08.3344.3344.2	1.6588	0.0292	2035.28	20	2220.0%	1	R.SSSPEVMDPPPPKTPPFPK.A
UGTA4_HUMAN76.0%115.0%222257048.3(O15217) Glutathione S-transferase A4-4 (EC 2.5.1.18) (GST class-alpha) 
*	TK120303_NMyc_cyto3_step04.3372.3372.1	1.7633	0.1807	1345.57	2	5500.0%	1	K.KKPPPDEIYVR.T
UQ91W5076.0%81018.2%798887916.4(Q91W50) Hypothetical 88.8 kDa protein 
	TK120303_NMyc_cyto3_step10.2458.2458.3	1.2837	0.0131	1879.37	50	2190.0%	1	K.GDLETLQPGDDVEFTIK.D
*	TK120303_NMyc_cyto3_step11.3729.3729.3	1.5631	0.0054	4554.16	100	980.0%	1	K.SPAAPGQSPTGSVCYERNGEVFYLTYTSEDVEGNVQLETGDK.I
	TK120303_NMyc_cyto3_step03.4444.4444.3	1.4426	0.0987	4734.57	1	1190.0%	1	K.DNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSK.G
	TK120303_NMyc_cyto3_step02.0391.0391.1	0.935	0.0105	1456.76	10	3330.0%	1	K.VGDDVEFEVSSDR.R
	TK120303_NMyc_cyto3_step09.0017.0017.1	0.5948	0.0056	1010.85	14	1880.0%	1	K.NQNDPLPGR.I
	TK120303_NMyc_cyto3_step06.2460.2460.2	1.0051	0.0196	1761.88	97	2500.0%	1	K.SPAAPGQSPTGSVCYER.N
	TK120303_NMyc_cyto3_step07.3452.3452.2	1.6809	0.0917	2574.81	1	2270.0%	2	R.LLPQGTVIFEDISIEHFEGTVTK.V
UO9493275.9%5117.6%645703717.8(O94932) Hypothetical protein KIAA0847 (Fragment) 
*	TK120303_NMyc_cyto3_step06.2315.2315.2	2.2112	0.2951	2161.39	1	4440.0%	3	R.TDLGLQIDHIGHDMLPNIR.E
*	TK120303_NMyc_cyto3_step07.2199.2199.3	1.5125	0.019	2550.01	61	1740.0%	1	R.HSRIPVLAQEIDSTLESSSPVSAK.E
*	TK120303_NMyc_cyto3_step01.0971.0971.1	0.9959	0.0216	746.2	19	6000.0%	1	R.EKITPR.N
UCTRO_MOUSE75.8%552.9%15971834486.6(P49025) Citron protein (Rho-interacting, serine/threonine kinase 21) 
	TK120303_NMyc_cyto3_step11.1663.1663.1	1.1862	0.166	1081.52	22	4380.0%	1	K.ALQLLHDIR.E
	TK120303_NMyc_cyto3_step08.1515.1515.1	1.1916	0.2708	683.61	3	6670.0%	1	R.LPAGAVR.T
	TK120303_NMyc_cyto3_step04.1611.1611.1	1.2115	0.0445	865.61	6	6430.0%	1	R.EDSSEGIK.K
	TK120303_NMyc_cyto3_step02.0365.0365.1	1.2343	0.0708	1473.04	1	3750.0%	1	R.ITESRQVVELAVK.E
	TK120303_NMyc_cyto3_step01.1896.1896.1	1.9995	0.1258	1234.48	3	5560.0%	1	K.KVPLQYNELK.L
UPESC_MOUSE75.7%242.2%584677966.8(Q9EQ61) Pescadillo homolog 1 
*	TK120303_NMyc_cyto3_step01.1931.1931.1	1.9944	0.1231	1567.59	1	4170.0%	2	K.DIKFLLHEPIVNK.F
UQ91X4775.7%2230.5%177196445.1(Q91X47) Unknown (Protein for MGC:18784) 
*	TK120303_NMyc_cyto3_step11.3687.3687.3	2.0001	0.1158	4547.91	59	940.0%	1	K.AVSVENGMIINVLELGTQQVADLTLNLDDYIDAEDLSDFHR.T
*	TK120303_NMyc_cyto3_step02.2245.2245.1	1.818	0.1511	1537.61	1	5420.0%	1	R.SGIITPIHEQWEK.A
USACS_HUMAN75.6%441.6%38294369797.2(Q9NZJ4) Sacsin 
*	TK120303_NMyc_cyto3_step01.4523.4523.1	1.6054	0.1877	1177.79	1	6110.0%	1	R.FPLRNAEMAK.V
*	TK120303_NMyc_cyto3_step07.2591.2591.2	1.249	0.0713	2269.91	1	3000.0%	1	R.RLGLVPCGAVGVQLSEIQDQK.W
*	TK120303_NMyc_cyto3_step11.4110.4110.2	1.0189	0.0105	2258.49	453	1110.0%	1	K.EQLFEKLESLLIIHDANSR.L
*	TK120303_NMyc_cyto3_step03.3944.3944.2	1.1655	0.0881	1519.18	3	3750.0%	1	K.NSEGKQLDPNEMR.T
UFP48_HUMAN75.4%115.5%417481665.5(Q92990) FKBP-associated protein 48 kDa (FK506-binding protein-associated protein 48 kDa) 
	TK120303_NMyc_cyto3_step05.3111.3111.2	2.0796	0.315	2656.87	2	2270.0%	1	K.QISQSILLLLQPLQTVIQKLHNK.A
UENP5_MOUSE75.3%224.2%427471025.3(Q9WUZ9) Ectonucleoside triphosphate diphosphohydrolase 5 precursor (EC 3.6.1.6) (NTPDase5) (Nucleoside diphosphatase) (CD39 antigen-like 4) (ER-UDPase) 
	TK120303_NMyc_cyto3_step01.2359.2359.1	1.5557	0.1928	1436.72	3	4090.0%	1	R.WLEAEWIFGGVK.Y
	TK120303_NMyc_cyto3_step01.1007.1007.1	0.9001	0.0869	586.5	46	4000.0%	1	K.ATAGLR.L
UQ9P2G775.2%687.7%12651412917.8(Q9P2G7) Hypothetical protein KIAA1380 (Fragment) 
*	TK120303_NMyc_cyto3_step09.1716.1716.2	1.9576	0.3285	1523.69	1	4550.0%	1	K.KFEEEDLDDILR.K
*	TK120303_NMyc_cyto3_step03.4035.4035.2	0.9581	0.0943	1795.76	16	2500.0%	2	R.TYESGSESGDSDESESK.S
*	TK120303_NMyc_cyto3_step08.2298.2298.3	1.5356	0.2678	3704.24	18	1400.0%	1	K.NGGSSPESDVGTDNKLTPPESQSPLHWLADLAEQK.A
*	TK120303_NMyc_cyto3_step09.2608.2608.2	1.5482	0.0072	2329.92	1	2620.0%	1	K.ANSVGNGQASQTSQPNYHTKLK.K
*	TK120303_NMyc_cyto3_step11.1530.1530.1	1.4554	0.0292	1471.66	9	3640.0%	1	K.TMMPARYEDLLK.S
UCD5R_MOUSE75.2%246.8%307340319.3(Q62938) Cyclin-dependent kinase 5 activator 1 precursor (CDK5 activator 1) (Cyclin-dependent kinase 5 regulatory subunit 1) (Tau protein kinase II 23 kDa subunit) (TPKII regulatory subunit) (P23) (P25) (P35) 
*	TK120303_NMyc_cyto3_step12.3014.3014.2	1.4935	0.1254	2370.19	4	2250.0%	2	K.KAQPNSSYQSNIAHLNNENLK.K
UQ9D2E875.2%1114.2%169187618.9(Q9D2E8) Adult male testis cDNA, RIKEN full-length enriched library, clone:4930578M22, full insert sequence 
*	TK120303_NMyc_cyto3_step03.3588.3588.2	2.0362	0.3173	2575.39	2	2170.0%	1	R.QASAPVPTSFCSSPTPNKSSQHQK.R
UQ9H0P075.1%2211.0%336379487.1(Q9H0P0) Hypothetical protein 
*	TK120303_NMyc_cyto3_step01.1839.1839.1	2.0242	0.0267	1266.44	2	6670.0%	1	K.IIEMMPEFQK.S
*	TK120303_NMyc_cyto3_step05.2311.2311.3	2.2072	0.0252	2763.81	26	2120.0%	1	R.VGAVASASVCALVAGVVLAQYIFTLKR.K
UGLI1_MOUSE75.0%338.0%11111185567.4(P47806) Zinc finger protein GLI1 (Glioma-associated oncogene homolog) 
*	TK120303_NMyc_cyto3_step03.4368.4368.3	2.8209	0.2798	3438.01	2	1640.0%	1	R.RSSLASPFPPGTPPENGASSLPGLTPAQHYMLR.A
*	TK120303_NMyc_cyto3_step09.2785.2785.2	1.2105	0.0171	2450.14	11	2170.0%	1	R.GSGTPPTAAHSLDRMGGLSVPPWR.S
	TK120303_NMyc_cyto3_step12.2348.2348.3	2.2995	0.2677	3360.06	2	1850.0%	1	R.ALSISPLSDASLDLQTVIRTSPSSLVAFINSR.C
UQ9BYZ474.9%9397.0%12521455737.8(Q9BYZ4) PRTD-NY2 
*	TK120303_NMyc_cyto3_step04.2082.2082.1	1.2182	0.1042	839.75	4	6670.0%	6	R.KLQALHK.E
	TK120303_NMyc_cyto3_step03.2919.2919.2	1.542	0.1029	2200.33	4	2810.0%	1	R.QPTWCYSKYIEALEQER.I
	TK120303_NMyc_cyto3_step02.3153.3153.3	1.7044	0.0316	3772.64	25	1330.0%	1	K.ITTIINCFINSSIPPALQIDIPVEQAQKIIEHR.K
*	TK120303_NMyc_cyto3_step05.3244.3244.3	1.6808	0.0599	3802.34	17	1420.0%	1	K.EIYMKIQPPFEDLFDTAEEYILLLLLEPWTK.M
UO6062274.9%71111.6%9341009885.2(O60622) Protocadherin 43 
	TK120303_NMyc_cyto3_step03.2123.2123.3	1.9167	0.0138	3275.92	47	1640.0%	1	R.REFELTAHISDGGTPVLATNISVNIFVTDR.N
	TK120303_NMyc_cyto3_step08.3347.3347.3	2.0055	0.0156	3029.79	2	1880.0%	2	R.EREPSLQLVLTALDGGTPALSASLPIHIK.V
	TK120303_NMyc_cyto3_step09.1436.1436.3	1.4473	0.0442	2744.46	321	1540.0%	1	R.EPSLQLVLTALDGGTPALSASLPIHIK.V
	TK120303_NMyc_cyto3_step11.2827.2827.3	2.0583	0.0629	3858.04	8	1290.0%	2	R.VLEDAPSGTRVVQVLATDLDEGPNGEIIYSFGSHNR.A
	TK120303_NMyc_cyto3_step04.1898.1898.1	1.5081	0.1676	1582.65	8	3330.0%	1	R.ETGEMFVNDRLDR.E
UQ9D6M074.9%6627.2%448487785.4(Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene) 
*	TK120303_NMyc_cyto3_step02.3548.3548.3	1.7076	0.0793	3437.93	4	1560.0%	1	K.VAEVQRSVDALQATFADAHCLGDVAPTALAEGR.G
*	TK120303_NMyc_cyto3_step06.1423.1423.1	2.0158	0.1056	1155.43	2	6110.0%	1	R.HLAYEHSLGK.L
*	TK120303_NMyc_cyto3_step01.4616.4616.2	1.7623	0.1669	2780.23	1	2120.0%	1	R.SLTLELQNAVDALAGCVRGLPPSAQAK.V
*	TK120303_NMyc_cyto3_step12.3167.3167.3	2.1696	0.0791	3997.15	1	1710.0%	1	R.FLPMTEAELAVLAAEAEGPEVGTVEEQRQQQGYFVR.L
*	TK120303_NMyc_cyto3_step12.3343.3343.2	1.5151	0.0485	1919.64	6	2670.0%	1	K.TQELWGSWSPCLENGR.S
*	TK120303_NMyc_cyto3_step01.3392.3392.2	1.2742	0.0484	2988.03	19	1480.0%	1	R.FLPMTEAELAVLAAEAEGPEVGTVEEQR.Q
UQ9BRU074.8%116.7%312353019.0(Q9BRU0) Similar to RIKEN cDNA 4931428F02 gene 
*	TK120303_NMyc_cyto3_step06.3179.3179.2	1.78	0.4077	2790.58	1	2750.0%	1	R.MVCSFYICYATLHLICCFKFR.V
UQ922M374.7%4421.6%315357016.3(Q922M3) Similar to tumor necrosis factor, alpha-induced protein 1 (Endothelial) 
	TK120303_NMyc_cyto3_step10.1489.1489.3	1.3768	0.0728	1870.61	102	2500.0%	1	K.IAEVCCTSIVYATEKK.Q
*	TK120303_NMyc_cyto3_step08.3142.3142.2	1.4065	0.11	2563.25	3	2290.0%	1	-.MEEMSGDSVVSSAVPAAATRTTSFK.G
*	TK120303_NMyc_cyto3_step07.2777.2777.2	1.4231	0.0137	2243.89	6	2890.0%	1	K.HFGTILNYLRDGGVPLPESR.R
*	TK120303_NMyc_cyto3_step01.1363.1363.1	1.7076	0.1781	1198.58	1	5910.0%	1	R.TTSFKGASPSSK.Y
UUBL3_MOUSE74.7%2213.0%230261525.0(Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3) 
*	TK120303_NMyc_cyto3_step12.1182.1182.1	1.7906	0.1613	1037.76	1	6250.0%	1	R.KPFPINHGK.T
	TK120303_NMyc_cyto3_step09.3215.3215.2	1.1276	0.0553	2418.53	4	2500.0%	1	K.VDLHFIALVHVDGHLYELDGR.K
UQ1517074.7%4167.0%1571830711.2(Q15170) Transcription factor S-II-related protein (PP21) 
*	TK120303_NMyc_cyto3_step01.2878.2878.1	1.1364	7.0E-4	1254.96	6	4500.0%	4	R.WSTLPKSSPPR.S
UDPOL_HUMAN74.6%4410.3%575634827.9(Q9UGP5) DNA polymerase lambda (EC 2.7.7.7) (Pol Lambda) (DNA polymerase kappa) (DNA polymerase beta-2) (Pol beta2) 
*	TK120303_NMyc_cyto3_step06.1831.1831.1	0.8668	0.0058	1086.4	47	3750.0%	1	R.YLDHPQPSK.A
	TK120303_NMyc_cyto3_step04.0866.0866.3	1.1497	0.0673	3006.56	8	1000.0%	1	R.LDIIVVPYSEFACALLYFTGSAHFNR.S
	TK120303_NMyc_cyto3_step01.3862.3862.2	2.1663	0.3031	2514.24	2	2500.0%	1	K.LDHISESVPVLELFSNIWGAGTK.T
	TK120303_NMyc_cyto3_step09.2789.2789.3	1.9062	0.2117	3163.15	4	1830.0%	1	R.RLDIIVVPYSEFACALLYFTGSAHFNR.S
UQ99L4874.6%4413.7%503576117.2(Q99L48) Similar to CGI-07 protein 
	TK120303_NMyc_cyto3_step10.3180.3180.2	2.3615	0.1906	2394.93	4	3500.0%	1	K.STFSVEIVPICKDNVVCLSPK.L
*	TK120303_NMyc_cyto3_step12.1267.1267.2	1.1032	0.0243	2511.54	2	2370.0%	1	K.QCQRYFQPPASWVQCALESR.E
	TK120303_NMyc_cyto3_step02.2421.2421.2	1.2086	0.0932	2530.68	10	2110.0%	1	K.TFYYLEQLILKYGMHQNTLR.I
	TK120303_NMyc_cyto3_step02.0292.0292.1	0.7002	0.0287	880.93	1	3570.0%	1	R.VPDVVLIK.K
UO1468674.6%19237.4%52625641925.9(O14686) ALR 
	TK120303_NMyc_cyto3_step12.3144.3144.3	1.6936	0.0017	4034.54	4	1370.0%	1	R.IPKGEELTYDYQFDFEDDQHEIPCHCGAWNCR.K
	TK120303_NMyc_cyto3_step05.3177.3177.3	1.6175	0.1063	3422.94	58	1440.0%	1	R.CPSLDNLAVPESPGVGGGKASEPLLSPPPFGESR.K
	TK120303_NMyc_cyto3_step07.1988.1988.2	1.1868	0.0107	1935.32	23	2190.0%	1	R.EVAEFMEQLGTALRPDK.V
	TK120303_NMyc_cyto3_step01.1868.1868.1	1.5967	0.0691	1521.6	6	3850.0%	1	K.EDAAARKPLTPKPK.R
	TK120303_NMyc_cyto3_step09.2864.2864.2	1.7177	0.226	2748.9	2	2000.0%	1	R.SAGDPSQPRPNPPTFAQGVINEADQR.Q
	TK120303_NMyc_cyto3_step08.1118.1118.1	0.8306	0.1469	680.41	21	6000.0%	1	R.FAMSAR.F
	TK120303_NMyc_cyto3_step05.3057.3057.2	2.3558	0.1843	2372.33	1	3260.0%	2	K.VEPAPAANSLGLGLKPGQSMMGSR.D
	TK120303_NMyc_cyto3_step01.1571.1571.1	1.1049	0.0581	774.63	24	6000.0%	1	K.ILTHYK.R
	TK120303_NMyc_cyto3_step12.3576.3576.3	1.7358	0.0352	4576.18	37	980.0%	1	K.STASSIETLVVADIDSSPSKEEEEEDDDTMQNTVVLFSNTDK.F
	TK120303_NMyc_cyto3_step06.1297.1297.1	1.1376	0.0779	1021.4	177	3330.0%	1	R.RPRGGAHGGR.G
	TK120303_NMyc_cyto3_step02.2335.2335.1	1.3467	0.0989	1212.06	241	3750.0%	1	R.EKIYEEQNR.G
	TK120303_NMyc_cyto3_step07.1719.1719.3	1.5832	0.1333	1758.11	2	3210.0%	2	K.CSLCQRTGATSSCNR.M
	TK120303_NMyc_cyto3_step07.3472.3472.3	1.6448	0.0059	4361.0	1	1250.0%	1	R.GGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQR.S
	TK120303_NMyc_cyto3_step05.2019.2019.3	1.382	0.0104	2328.36	314	1820.0%	1	K.REANGEPIGAPGTSNHLLLAGPR.S
	TK120303_NMyc_cyto3_step10.2121.2121.3	1.6329	0.0202	3768.72	43	1250.0%	1	R.VGGLVFHAIGQLLPHQMADFHSATALYPVGYEATR.I
	TK120303_NMyc_cyto3_step02.4384.4384.3	2.3051	0.3057	4229.0	5	1320.0%	1	K.QLKQELSLLPLTEPAITANFSLFAPFGSGCPVNGQSQLR.G
	TK120303_NMyc_cyto3_step02.3836.3836.3	2.0799	0.1875	4475.51	88	1010.0%	1	K.EEEEEDDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGR.G
UQ96Q3674.6%355.0%423496439.7(Q96Q36) ALS2CR11 protein (Fragment) 
*	TK120303_NMyc_cyto3_step06.2716.2716.2	2.0979	0.1281	1456.97	14	4580.0%	2	R.RMVSSGLVHINDK.T
*	TK120303_NMyc_cyto3_step07.3151.3151.1	1.0548	0.0108	1032.75	5	5710.0%	1	R.KEHVNIYK.W
UEGR4_HUMAN74.5%358.2%486508566.8(Q05215) Early growth response protein 4 (EGR-4) (AT133) 
*	TK120303_NMyc_cyto3_step02.3352.3352.3	1.754	0.0557	3887.36	15	1350.0%	1	R.SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAKAR.R
*	TK120303_NMyc_cyto3_step07.3659.3659.3	2.1245	0.1937	3659.73	2	1420.0%	2	R.SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAK.A
UMDR1_HUMAN74.5%6611.1%12801414629.0(P08183) Multidrug resistance protein 1 (P-glycoprotein 1) (CD243 antigen) 
*	TK120303_NMyc_cyto3_step10.1794.1794.2	1.2398	0.0464	2190.35	7	2620.0%	1	K.GLNLKVQSGQTVALVGNSGCGK.S
*	TK120303_NMyc_cyto3_step03.3926.3926.3	1.5032	0.0619	3191.25	155	1250.0%	1	R.YAYYYSGIGAGVLVAAYIQVSFWCLAAGR.Q
*	TK120303_NMyc_cyto3_step02.3585.3585.3	2.7787	0.2914	4130.62	3	1530.0%	1	R.AHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVR.A
*	TK120303_NMyc_cyto3_step11.3554.3554.2	1.2415	0.1509	2646.5	11	1880.0%	1	K.ILLLDEATSALDTESEAVVQVALDK.A
*	TK120303_NMyc_cyto3_step06.3123.3123.2	0.9495	0.0494	2459.05	2	2380.0%	1	K.IIDNKPSIDSYSKSGHKPDNIK.G
*	TK120303_NMyc_cyto3_step05.1101.1101.1	1.2388	0.041	705.59	126	5830.0%	1	K.ELEGAGK.I
UQ9NVP574.5%4415.0%852959636.1(Q9NVP5) Hypothetical protein FLJ10599 (Fragment) 
	TK120303_NMyc_cyto3_step12.3195.3195.3	1.479	8.0E-4	4695.33	1	1190.0%	1	K.VIYSFHTLSFKEAHSDTLFTIGNSITGIISSVLGHISLPSMIR.K
	TK120303_NMyc_cyto3_step06.4239.4239.3	1.5709	0.0246	4574.28	21	990.0%	1	K.LEKLLGEIIACLQFSYTGTYDSELLEQLSPLLCIIFLHK.N
*	TK120303_NMyc_cyto3_step11.2085.2085.3	2.7827	0.3032	3597.84	1	1990.0%	1	K.TSTECASSTENSFVVSSSSVSNTTVAGTPPYPTSR.R
	TK120303_NMyc_cyto3_step08.2658.2658.2	1.0078	0.0050	1403.4	393	2500.0%	1	R.TWSELYRAFAR.C
UUBIQ_HUMAN74.5%2215.8%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin 
	TK120303_NMyc_cyto3_step01.1818.1818.1	1.8698	0.1321	765.73	4	8000.0%	1	-.MQIFVK.T
	TK120303_NMyc_cyto3_step01.1744.1744.1	1.6103	0.1057	648.57	3	8000.0%	1	R.LIFAGK.Q
UQ9Z2I574.5%3310.1%662730138.2(Q9Z2I5) Hypoxia inducible factor three alpha 
	TK120303_NMyc_cyto3_step04.3919.3919.2	1.2617	0.0858	1860.17	23	2810.0%	1	R.SIHTLLSKGQAVTGQYR.F
*	TK120303_NMyc_cyto3_step02.3969.3969.3	1.9562	0.0099	4499.98	3	1320.0%	1	K.HLGLSQLELIGHSIFDFIHPCDQEELQDALTPRPNLSKK.K
*	TK120303_NMyc_cyto3_step01.2739.2739.1	1.5309	0.2004	1236.91	4	5500.0%	1	K.GLELLEIKPPK.R
UO7049174.4%4109.3%670737758.6(O70491) Retinoic acid-responsive protein 
*	TK120303_NMyc_cyto3_step05.2992.2992.2	1.2681	0.1139	2559.95	1	2860.0%	1	R.SLLSRAWAFSHHSIYTPQPGFR.L
*	TK120303_NMyc_cyto3_step09.3479.3479.3	2.7836	0.253	4680.36	1	1540.0%	3	R.SLESTWPFWLTVALAVILQNIAANWIFLRTHHGYPELTNR.R
UQ9DAE474.4%4422.8%342389265.5(Q9DAE4) 1700012F10Rik protein 
	TK120303_NMyc_cyto3_step03.2623.2623.3	2.0689	0.1688	3350.64	7	1700.0%	1	R.LALGSFVEEYNNKVQLVGLDEESSEFICR.N
	TK120303_NMyc_cyto3_step03.1511.1511.1	1.6891	0.1782	1485.66	2	4170.0%	1	R.LALGSFVEEYNNK.V
	TK120303_NMyc_cyto3_step06.2331.2331.3	1.6345	0.0616	3361.03	144	1210.0%	1	K.QDPNYLATMAMDGMEVVILDVRVPCTPVAR.L
	TK120303_NMyc_cyto3_step06.3365.3365.2	1.1422	0.0977	2339.57	10	2220.0%	1	R.HLEHSTIIYEDPQHHPLLR.L
UQ6162774.2%579.7%10091122446.7(Q61627) Glutamate receptor delta-1 subunit precursor 
*	TK120303_NMyc_cyto3_step05.3179.3179.2	2.3272	0.1796	2624.11	1	3180.0%	2	K.DDRVFQLAVSDLSLNDDILQSEK.I
*	TK120303_NMyc_cyto3_step12.3419.3419.2	1.424	0.0494	3175.22	60	1210.0%	1	R.NPGGSPRTACHLNPSPDGEAYTLASRPPVR.L
*	TK120303_NMyc_cyto3_step02.2359.2359.1	1.4587	0.0087	1573.76	40	3330.0%	1	R.LNDVMLRLVTELR.W
	TK120303_NMyc_cyto3_step03.2354.2354.3	2.0789	0.1611	3627.87	48	1290.0%	1	K.LHSFAGVFCILAIGLLLACLVAALELWWNSNR.C
UQ96FR074.1%1166.7%30345010.0(Q96FR0) Hypothetical protein 
*	TK120303_NMyc_cyto3_step09.1995.1995.3	2.7706	0.2926	2179.19	2	2630.0%	1	R.LPLFISLLERADSVTAAYAK.Q
UPGCA_MOUSE74.1%555.4%21322220074.3(Q61282) Aggrecan core protein precursor (Cartilage-specific proteoglycan core protein) (CSPCP) 
*	TK120303_NMyc_cyto3_step10.1453.1453.3	1.485	0.0553	3056.12	3	1830.0%	1	R.SNDSGIYRCEVMHGIEDSEATLEVIVK.G
*	TK120303_NMyc_cyto3_step04.2290.2290.1	1.6889	0.1712	1465.64	1	4290.0%	1	K.EDLVGSASGALDFGK.L
*	TK120303_NMyc_cyto3_step02.2156.2156.3	1.8347	0.1777	3006.08	42	1740.0%	1	K.WRPNQPDNFFATGEDCVVMIWHER.G
*	TK120303_NMyc_cyto3_step07.2821.2821.3	2.3455	0.1041	3416.23	1	1710.0%	1	R.EGSAAPEVSGESSTTSDIDTGTSGVPSATPMASGDR.T
	TK120303_NMyc_cyto3_step10.1245.1245.1	1.3574	0.0437	1386.62	10	3750.0%	1	K.ARPNCGGNLLGVR.T
UAHNK_HUMAN74.0%884.5%29603124936.7(Q09666) Neuroblast differentiation associated protein AHNAK (Desmoyokin) (Fragments) 
	TK120303_NMyc_cyto3_step08.2399.2399.3	1.7465	0.0657	2383.74	37	2000.0%	1	K.VDIDAPDVDVHGPDWHLKMPK.M
*	TK120303_NMyc_cyto3_step03.4099.4099.1	0.6711	0.1506	718.13	1	4170.0%	1	K.GSGGEWK.G
*	TK120303_NMyc_cyto3_step01.3262.3262.1	1.6688	0.1764	1558.67	4	3850.0%	1	K.APKISMPDIDLNLK.G
*	TK120303_NMyc_cyto3_step04.0558.0558.1	1.1754	0.064	686.25	20	5830.0%	1	K.IGIPGVK.M
*	TK120303_NMyc_cyto3_step06.2241.2241.2	1.017	0.0102	2321.73	66	1820.0%	1	K.GDVPSVGLEGPDVDLQGPEAKIK.F
*	TK120303_NMyc_cyto3_step04.1038.1038.2	1.077	0.0385	1670.19	38	2330.0%	1	K.VDVEVPDVSLEGPEGK.L
*	TK120303_NMyc_cyto3_step11.3411.3411.2	1.5499	0.1243	2526.06	7	2290.0%	1	K.GHYEVTGSDDETGKLQGSGVSLASK.K
*	TK120303_NMyc_cyto3_step12.2482.2482.2	1.1653	0.0080	2121.11	35	2250.0%	1	K.GEGPEVDVNLPKADVDVSGPK.V
UO5490974.0%2215.8%317357449.1(O54909) Cis-retinol androgen dehydrogenase 1 
*	TK120303_NMyc_cyto3_step12.3060.3060.3	1.823	0.0628	4113.91	58	1180.0%	1	R.YSAGWDAKLFYLPLSYLPTFLVDALLYWTSLKPEK.A
	TK120303_NMyc_cyto3_step05.1963.1963.2	2.354	0.1434	1658.4	2	4290.0%	1	R.VLAACLTEKGAEELR.N
UQ0264674.0%332.7%25002748816.9(Q02646) MBP-2 (MHC binding protein-2) 
*	TK120303_NMyc_cyto3_step03.3552.3552.2	2.3192	0.1457	2750.39	4	2500.0%	1	K.MFEDPVSQLIPSKGDVDPSQTSMLK.S
*	TK120303_NMyc_cyto3_step12.2932.2932.2	1.2956	0.0897	3124.98	2	1790.0%	1	R.NEGKLYPANFQGSNPVLLEAPVDSSPLIR.S
*	TK120303_NMyc_cyto3_step12.2099.2099.2	1.38	0.1561	1453.55	9	3850.0%	1	K.MSPGPPIPLDIASR.G
UQ9NTJ774.0%1116.5%1151242311.4(Q9NTJ7) Hypothetical protein 
*	TK120303_NMyc_cyto3_step10.2598.2598.2	2.3194	0.1373	2090.81	1	4440.0%	1	R.MGHGPSFLGTQYVLSSRPR.H
UGBP1_HUMAN74.0%227.1%592679036.3(P32455) Interferon-induced guanylate-binding protein 1 (Guanine nucleotide-binding protein 1) 
*	TK120303_NMyc_cyto3_step05.2600.2600.2	2.3477	0.1668	1893.09	1	5000.0%	1	K.VQLPTESLQELLDLHR.D
*	TK120303_NMyc_cyto3_step04.3502.3502.2	1.713	0.0595	2965.2	29	1600.0%	1	K.QNQEASSDRCSGLLQVIFSPLEEEVK.A
UCA39_HUMAN74.0%5520.0%684636167.7(Q14050) Collagen alpha 3(IX) chain precursor 
*	TK120303_NMyc_cyto3_step04.4129.4129.2	1.1048	0.0142	1311.92	59	2140.0%	1	R.GDVGDRGPGGAAGPK.G
	TK120303_NMyc_cyto3_step07.2932.2932.3	1.9677	0.0372	4731.9	22	950.0%	1	K.DGQDGAPGEPGPPGDPGLPGAIGAQGTPGICDTSACQGAVLGGVGEKSGSR.S
*	TK120303_NMyc_cyto3_step07.2213.2213.3	2.1846	0.0564	3014.5	41	1400.0%	1	R.GSLGPPGPPGLGGKGLPGPPGEAGVSGPPGGIGLR.G
*	TK120303_NMyc_cyto3_step04.3399.3399.2	2.322	0.1611	2082.47	1	3040.0%	1	R.GPGGAAGPKGDQGIAGSDGLPGDK.G
*	TK120303_NMyc_cyto3_step10.4121.4121.2	1.707	0.1147	2082.91	8	2750.0%	1	R.GFQGQKGSMGDPGLPGPQGLR.G
UHXD9_HUMAN74.0%5177.6%342355808.8(P28356) Homeobox protein Hox-D9 (Hox-4C) (Hox-5.2) 
*	TK120303_NMyc_cyto3_step10.3413.3413.2	1.3444	0.1625	3085.11	2	1600.0%	1	K.QHSQPQQQQLDPNNPEANWIHARSTR.K
*	TK120303_NMyc_cyto3_step02.3652.3652.2	1.989	0.2172	2739.66	1	2270.0%	4	K.QHSQPQQQQLDPNNPEANWIHAR.S
UQ8VCR573.7%114.9%225248658.0(Q8VCR5) Similar to hypothetical protein FLJ11036 
*	TK120303_NMyc_cyto3_step07.1837.1837.1	1.656	0.1762	1165.36	1	5500.0%	1	R.GADHGELEVLK.D
UQ96M5473.7%245.0%541609366.6(Q96M54) Hypothetical protein FLJ32818 
*	TK120303_NMyc_cyto3_step03.3619.3619.2	2.3357	0.1141	2993.8	5	2120.0%	2	-.MSTIQSETDCYDIIEVLGKGTFGEVAK.G
UCA11_HUMAN73.7%798.9%14641388845.9(P02452) Collagen alpha 1(I) chain precursor 
	TK120303_NMyc_cyto3_step04.1976.1976.3	1.6405	0.0999	3339.06	1	1940.0%	1	K.VFCNMETGETCVYPTQPSVAQKNWYISK.N
	TK120303_NMyc_cyto3_step06.0566.0566.2	1.0385	0.0855	2870.74	22	1250.0%	1	R.GEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAK.G
*	TK120303_NMyc_cyto3_step03.2446.2446.2	1.4511	0.0716	1934.77	2	2860.0%	1	K.SGDRGETGPAGPAGPVGPAGAR.G
	TK120303_NMyc_cyto3_step01.2731.2731.2	1.411	0.0668	2224.57	5	2170.0%	1	R.GFPGLPGPSGEPGKQGPSGASGER.G
	TK120303_NMyc_cyto3_step08.3475.3475.2	2.3269	0.015	2075.88	5	2830.0%	2	K.GSPGADGPAGAPGTPGPQGIAGQR.G
UO3505373.7%4411.0%11361143548.4(O35053) Collagen a1 XIX chain 
*	TK120303_NMyc_cyto3_step05.3441.3441.2	2.3125	0.0103	2723.75	2	2500.0%	1	K.GDAGPPGISLPGKPGLDGNPGSPGPREPK.G
*	TK120303_NMyc_cyto3_step04.2460.2460.2	1.4092	0.1144	2576.05	4	2270.0%	1	K.SELSGFDLGESFALRHAFCEGDK.T
*	TK120303_NMyc_cyto3_step07.3505.3505.3	1.8777	0.148	3963.33	1	1430.0%	1	K.GAIGPVGPAGSKGSTGPPGHQGPPGNPGIPGTPADAVSFEEIK.H
*	TK120303_NMyc_cyto3_step07.4326.4326.3	1.8924	0.18	3637.85	93	1210.0%	1	K.LWTWVTTFLLPACTCLTVRDKPETTCPTLR.T
UCAD2_MOUSE73.7%81018.1%906997614.8(P15116) Neural-cadherin precursor (N-cadherin) (Cadherin-2) 
*	TK120303_NMyc_cyto3_step02.2563.2563.3	1.5763	3.0E-4	4024.84	4	1350.0%	1	R.YSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIAR.F
*	TK120303_NMyc_cyto3_step06.2240.2240.3	1.6388	0.0034	3220.5	14	1390.0%	1	R.QEEGLHAGTMLTTLTAQDPDRYMQQNIR.Y
*	TK120303_NMyc_cyto3_step08.0183.0183.1	0.6917	0.0174	1090.54	75	1670.0%	1	R.SFPLTAEQAK.F
	TK120303_NMyc_cyto3_step11.2583.2583.3	2.0406	0.1119	3542.25	94	1170.0%	1	R.IVGAGLGTGAIIAILLCIIILLILVLMFVVWMK.R
*	TK120303_NMyc_cyto3_step09.3359.3359.3	2.5782	0.1275	2993.84	4	2070.0%	1	R.IAGGRGTLLPLLAALLQASVEASGEIALCK.T
	TK120303_NMyc_cyto3_step11.3830.3830.3	1.731	0.0538	2749.83	1	2190.0%	1	K.LSDPANWLKIDPVNGQITTIAVLDR.E
UQ8VGP373.7%114720.1%304340018.8(Q8VGP3) Olfactory receptor MOR227-1 
*	TK120303_NMyc_cyto3_step11.4059.4059.3	1.961	0.0834	3811.39	1	1520.0%	1	K.ALSTCASHITVVVLFFGPAIFLYMRPSSTFTEDK.L
*	TK120303_NMyc_cyto3_step03.3382.3382.3	1.9018	0.1098	3936.82	33	1320.0%	1	R.KALSTCASHITVVVLFFGPAIFLYMRPSSTFTEDK.L
	TK120303_NMyc_cyto3_step10.3380.3380.2	1.9819	0.0712	2982.81	1	2200.0%	6	K.LVAVFYTVITPMLNPIIYTLRNAEVK.N
UQ9QY4373.7%5521.0%496573949.1(Q9QY43) GABA receptor epsilon subunit 
	TK120303_NMyc_cyto3_step11.2313.2313.3	1.6648	0.0505	3084.78	2	2000.0%	1	R.FGFIVFQNYVPSSVTTMLSWVSFWIK.I
	TK120303_NMyc_cyto3_step05.2707.2707.2	2.3631	0.0806	1399.46	5	5450.0%	1	K.LLEFDFTGVNNK.T
	TK120303_NMyc_cyto3_step06.1749.1749.3	1.4311	0.0512	2681.88	50	1880.0%	1	R.VLFPITFFFFNVLYWLICLNL.-
	TK120303_NMyc_cyto3_step03.4384.4384.3	2.423	0.2301	4471.58	2	1460.0%	1	R.VSYLTALDFYIAICFVLCFCTLLEFAVLNFLTYNNIK.R
	TK120303_NMyc_cyto3_step10.1113.1113.1	0.937	0.0052	897.66	89	3570.0%	1	R.ANAHTRAR.A
UCA1B_MOUSE73.7%998.4%18041809635.2(Q61245) Collagen alpha 1(XI) chain precursor 
*	TK120303_NMyc_cyto3_step11.1313.1313.2	0.9962	0.0074	2467.79	59	2500.0%	1	K.ALRFLGSNDEEMSYENNPHIK.A
	TK120303_NMyc_cyto3_step08.3647.3647.2	1.4311	0.088	2742.74	1	1900.0%	1	K.GTSGGDGPPGPPGERGPQGPQGPVGFPGPK.G
*	TK120303_NMyc_cyto3_step02.4253.4253.3	2.526	0.115	3323.96	4	1640.0%	1	R.GLPGSQGSPGAKGDGGIPGPAGPIGPPGPPGLPGPAGPK.G
*	TK120303_NMyc_cyto3_step07.2312.2312.2	1.198	0.052	1888.07	7	2250.0%	1	R.GTPGPPGQPGIGGIDGPQGPK.G
	TK120303_NMyc_cyto3_step07.0975.0975.1	0.4745	0.0041	725.82	8	3750.0%	1	K.EYEER.T
	TK120303_NMyc_cyto3_step06.1184.1184.1	0.6971	0.0413	676.43	46	6000.0%	1	K.KSEGVR.I
*	TK120303_NMyc_cyto3_step11.3298.3298.2	1.7884	0.1594	1563.72	1	3820.0%	1	R.GEKGEAGPPGAAGPAGIK.G
*	TK120303_NMyc_cyto3_step06.1155.1155.2	1.1827	0.1054	1140.05	72	3180.0%	1	K.GARGIAGKPGPR.G
UQ9CWP273.7%115.8%326356308.2(Q9CWP2) Expressed sequence tag mouse EST 55 
	TK120303_NMyc_cyto3_step09.2376.2376.2	2.0035	0.3179	2128.64	1	3330.0%	1	K.THELTNPGIAEVTIRPDHK.I
UDTNB_HUMAN73.6%3312.4%627713567.9(O60941) Dystrobrevin beta (Beta-dystrobrevin) (DTN-B) 
	TK120303_NMyc_cyto3_step06.3880.3880.3	1.4583	0.2991	2562.14	3	1360.0%	1	K.EVLKLPTAVFEGPSFGYTEHSVR.T
	TK120303_NMyc_cyto3_step11.3093.3093.3	2.766	0.2872	3221.25	4	1700.0%	1	R.LPSTHQISVEQSISLLLNFMIAAYDSEGR.G
*	TK120303_NMyc_cyto3_step08.3088.3088.2	1.0901	0.0066	2630.62	10	1800.0%	1	K.QAAQATGSPHTSPTHGGGRPMPMPVR.S
UO4324573.4%336.4%614686209.6(O43245) Protein 
*	TK120303_NMyc_cyto3_step07.2095.2095.1	1.2911	0.0408	1155.61	11	5000.0%	1	R.QDLKNHNSAK.E
*	TK120303_NMyc_cyto3_step05.1597.1597.2	1.1852	0.026	2680.71	25	2500.0%	1	R.TCYNMLALVDWIEQDFKSTWR.K
*	TK120303_NMyc_cyto3_step01.2335.2335.1	1.8472	0.1344	984.78	1	7140.0%	1	K.DKFEGLFK.L
UPEX6_HUMAN73.3%335.0%9801040616.3(Q13608) Peroxisome assembly factor-2 (PAF-2) (Peroxisomal-type ATPase 1) (Peroxin-6) 
	TK120303_NMyc_cyto3_step02.1536.1536.1	1.1728	0.0267	1222.33	28	4000.0%	1	R.YLEGSIAPEDK.G
	TK120303_NMyc_cyto3_step10.2508.2508.2	2.1642	0.3018	2090.39	3	3000.0%	1	R.RPPALGWALLGTSLGPGLGPR.V
	TK120303_NMyc_cyto3_step11.2838.2838.2	1.3378	0.1063	1789.24	9	2810.0%	1	K.TTVVAAACSHLGLHLLK.V
UQ9QXA373.2%11115.4%45875060525.0(Q9QXA3) Mouse fat 1 cadherin (Fragment) 
*	TK120303_NMyc_cyto3_step03.2508.2508.2	1.3708	0.1097	1633.63	13	3210.0%	1	R.ASYQIKVVASDHGEK.V
	TK120303_NMyc_cyto3_step03.2671.2671.1	1.7362	0.1611	1501.62	1	5830.0%	1	R.YKIVSGDSENLFK.A
*	TK120303_NMyc_cyto3_step11.1189.1189.2	1.4824	0.1105	1429.34	1	5000.0%	1	R.YSIRDGSGIGVFR.I
*	TK120303_NMyc_cyto3_step11.3942.3942.2	1.2159	0.1045	1891.88	13	3210.0%	1	R.ALDYEQSQQHRIFVR.A
*	TK120303_NMyc_cyto3_step12.3683.3683.2	1.2024	0.0316	2873.88	55	1480.0%	1	K.GTVSEDDPPGGVIAILSTTDADTEEINR.Q
*	TK120303_NMyc_cyto3_step10.3225.3225.2	1.2871	0.1403	1674.99	1	3930.0%	1	R.EEKYSCVCPGGGFGK.C
*	TK120303_NMyc_cyto3_step01.3852.3852.3	1.5188	0.018	3787.74	17	1320.0%	1	K.DPTYAIITVEDCDQGANGEIASLSIVAGDFLQQFK.T
*	TK120303_NMyc_cyto3_step12.2632.2632.3	1.643	0.0629	4432.68	5	1060.0%	1	R.IFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEAR.I
*	TK120303_NMyc_cyto3_step11.2658.2658.2	1.2212	0.0317	2630.68	287	1360.0%	1	R.HLTLLLLLLLFLQQFGDSDGSQR.L
*	TK120303_NMyc_cyto3_step06.1668.1668.2	0.9956	0.0015	2476.08	2	2170.0%	1	K.GDPPMSEMTSVRIAVTVADNASPK.F
*	TK120303_NMyc_cyto3_step07.3543.3543.2	1.2066	0.1	3038.84	5	1790.0%	1	K.EYLVTVVAKDGGSPAFSAEVLVPITVMNK.A
UQ9HAV473.2%669.6%12041363115.8(Q9HAV4) Exportin 5 
*	TK120303_NMyc_cyto3_step06.2739.2739.2	1.5605	0.137	1754.01	61	2860.0%	1	-.MAMDQVNALCEQLVK.A
	TK120303_NMyc_cyto3_step05.2508.2508.3	1.7251	0.0090	3410.78	23	1250.0%	1	K.RLCQVLCALGNQLCALLGADSDVETPSNFGK.Y
	TK120303_NMyc_cyto3_step07.4350.4350.3	1.3141	0.1984	2191.05	12	1810.0%	1	K.HEDVCTALLITAFNSLAWK.D
	TK120303_NMyc_cyto3_step06.4311.4311.3	1.69	0.0114	2815.3	7	2000.0%	1	K.AGGFVVGYTSSGNPIFRNPCTEQILK.L
	TK120303_NMyc_cyto3_step01.4124.4124.2	2.1361	0.301	2575.58	1	3260.0%	1	K.KTKPMLETEVLDNDGGGLATIFEP.-
UQ9NSE473.1%339.8%9931118016.9(Q9NSE4) Mitochondrial isoleucine tRNA synthetase (Fragment) 
*	TK120303_NMyc_cyto3_step09.2737.2737.3	2.6177	0.3292	3351.8	1	1960.0%	1	R.SYKPVFWSPSSRTALAEAELEYNPEHVSR.S
*	TK120303_NMyc_cyto3_step10.2726.2726.3	1.7972	0.2033	3164.17	5	1640.0%	1	K.SLGNVIHPDVVVNGGQDQSKEPPYGADVLR.W
*	TK120303_NMyc_cyto3_step06.3433.3433.3	2.0963	0.0627	4369.04	70	880.0%	1	R.FLLGNVADFNPETDSIPVNDMYVIDQYMLHLLQDLANK.I
UKPCB_MOUSE73.1%5117.6%671767517.0(P04410) Protein kinase C, beta type (EC 2.7.1.-) (PKC-beta) (PKC-B) 
	TK120303_NMyc_cyto3_step06.3445.3445.1	1.6617	0.171	1322.6	3	4550.0%	1	K.EAVAICKGLMTK.H
	TK120303_NMyc_cyto3_step12.2982.2982.2	1.4355	0.1987	2657.94	306	1360.0%	1	R.VLALPGKPPFLTQLHSCFQTMDR.L
	TK120303_NMyc_cyto3_step10.3933.3933.2	1.7462	0.083	1828.74	2	4330.0%	3	R.DLKLDNVMLDSEGHIK.I
UQ9DCZ073.0%3335.7%168175585.1(Q9DCZ0) 0610008F14Rik protein 
	TK120303_NMyc_cyto3_step07.1892.1892.2	1.1488	0.0428	1377.99	1	4620.0%	1	K.AQSELSGAADEAAR.A
	TK120303_NMyc_cyto3_step07.1443.1443.1	1.1631	0.1308	735.46	23	5000.0%	1	R.HPGLRR.L
*	TK120303_NMyc_cyto3_step07.3384.3384.3	2.7427	0.2927	4127.3	1	1600.0%	1	K.QVDVPTLTGAFGILASHVPTLQVLRPGLVGVHTEDGTTTK.Y
UKLKD_MOUSE73.0%3525.3%261286898.0(P36368) Glandular kallikrein K13 precursor (EC 3.4.21.35) (Tissue kallikrein) (MGK-13) (Epidermal growth factor-binding protein type B) (EGF-BP B) (Prorenin-converting enzyme) (PRECE) 
*	TK120303_NMyc_cyto3_step11.4197.4197.2	1.3625	0.0025	2630.88	11	1740.0%	1	-.MWFLILFLALSLGGIDAAPPLQSR.V
*	TK120303_NMyc_cyto3_step04.3412.3412.3	2.1828	0.1666	4467.91	24	1160.0%	2	K.DTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIK.F
UQ8WYP573.0%888.4%22662525566.6(Q8WYP5) Transcription factor ELYS 
	TK120303_NMyc_cyto3_step08.2238.2238.3	2.73	0.275	2733.19	3	2080.0%	1	K.AILLPDLSEPNNEPLFSPASEVPRK.A
*	TK120303_NMyc_cyto3_step12.3891.3891.3	1.4686	0.0182	4377.46	116	950.0%	1	K.HSITIYLLLDIMYSFPNKTDTPIESFPTVFAISWGQVK.L
	TK120303_NMyc_cyto3_step11.1513.1513.3	1.7218	0.0226	2947.95	179	1300.0%	1	K.EVNQDILENTSSVEQELQITTGRESK.R
*	TK120303_NMyc_cyto3_step02.4249.4249.2	1.1704	0.0802	2362.46	13	1900.0%	1	K.TAQETSTMTMNVSQVDDVVSSK.T
*	TK120303_NMyc_cyto3_step05.2656.2656.3	2.7731	0.1496	2960.5	2	2100.0%	1	R.YIQTMKPTVSSGNDVILHLTVLLFNR.C
	TK120303_NMyc_cyto3_step12.4504.4504.3	1.3523	0.1144	2975.27	3	1980.0%	1	R.EYYIQLESGQVPVYAVTFQEPENDR.R
*	TK120303_NMyc_cyto3_step01.3430.3430.3	1.8325	0.0115	4629.34	25	1000.0%	1	K.YPPASLHAVLDMYLLDGVTEAAKHSITIYLLLDIMYSFPNK.T
	TK120303_NMyc_cyto3_step03.1104.1104.1	0.9165	0.0133	673.54	40	6000.0%	1	K.EAPSIR.R
UPGDR_HUMAN73.0%4105.2%11061239685.0(P09619) Beta platelet-derived growth factor receptor precursor (EC 2.7.1.112) (PDGF-R-beta) (CD140b antigen) 
*	TK120303_NMyc_cyto3_step03.0419.0419.3	1.4822	0.1277	3492.64	25	1330.0%	3	R.SILHIPSAELEDSGTYTCNVTESVNDHQDEK.A
*	TK120303_NMyc_cyto3_step08.3527.3527.2	1.1942	0.039	3114.48	4	1800.0%	1	R.QGENITLMCIVIGNEVVNFEWTYPRK.E
UYYY2_HUMAN72.9%114.7%190209088.0(O00597) Very very hypothetical protein CYCL 
*	TK120303_NMyc_cyto3_step01.0674.0674.1	1.598	0.1793	895.54	1	5620.0%	1	R.KAAGPLPLK.V
UQ9C09572.8%223.1%12071296175.7(Q9C095) Hypothetical protein KIAA1768 (Fragment) 
*	TK120303_NMyc_cyto3_step10.2489.2489.3	1.5052	0.0534	2961.18	108	1390.0%	1	R.RPPGDPSTDPEVLPTPEGPESETSRGPR.A
*	TK120303_NMyc_cyto3_step01.2248.2248.1	1.8661	0.1358	1106.8	1	6670.0%	1	R.VCRSLSAVGR.R
UQ9ULG172.7%352.1%15611773409.5(Q9ULG1) Hypothetical protein KIAA1259 (Fragment) 
*	TK120303_NMyc_cyto3_step08.3608.3608.2	1.602	0.1417	2552.6	1	2620.0%	2	K.DFLLGVNFPLSFPNLCSCPLLK.S
*	TK120303_NMyc_cyto3_step01.2668.2668.1	1.5965	0.1803	1418.6	3	4500.0%	1	R.EELHNMLRLHK.Y
UMAP4_MOUSE72.7%7711.7%11251176755.0(P27546) Microtubule-associated protein 4 (MAP 4) 
*	TK120303_NMyc_cyto3_step04.1240.1240.1	1.4606	0.2234	1125.51	1	6000.0%	1	K.AKPLATTQPAK.T
*	TK120303_NMyc_cyto3_step10.0996.0996.2	1.0738	0.1419	1345.8	11	3330.0%	1	K.KPTSTKPSSSAPR.V
*	TK120303_NMyc_cyto3_step01.3480.3480.2	1.6729	0.2061	2384.32	1	2730.0%	1	R.DDGLADLLFVSSGPTNASAFTER.D
*	TK120303_NMyc_cyto3_step01.3179.3179.2	1.7497	0.3224	2499.93	1	2860.0%	1	K.RDFMAALEAEPYDDIVGETVEK.T
*	TK120303_NMyc_cyto3_step06.1237.1237.1	0.975	0.0796	701.5	99	5000.0%	1	K.RPTSIK.T
*	TK120303_NMyc_cyto3_step06.3061.3061.3	1.9876	0.2328	4532.46	17	1040.0%	1	K.DVTLPLEAERPLVTDMTPSLETEMTLGKETAPPTETNLGMAK.D
*	TK120303_NMyc_cyto3_step03.1231.1231.1	1.3636	0.1358	1353.8	1	4290.0%	1	K.AAGSIASAQKPPAGK.V
UQ9D71472.7%118.1%372405905.5(Q9D714) 2310042E16Rik protein 
*	TK120303_NMyc_cyto3_step11.2410.2410.3	2.9591	0.2405	3514.7	4	1810.0%	1	K.VESFSIDHYQSRPGEGWQSGHFEGVFLQCK.E
UQ9QYY072.5%5510.9%695767935.7(Q9QYY0) GRB2-associated binding protein 1 
*	TK120303_NMyc_cyto3_step11.3759.3759.2	1.1574	0.0208	2644.06	15	1820.0%	1	R.KVKPAPLDIKPLSEWEELQAPVR.S
*	TK120303_NMyc_cyto3_step09.2633.2633.3	1.7531	0.0657	3074.43	8	1790.0%	1	K.IKSVLTAGGVSGEELDENYVPMNPNSPPR.Q
	TK120303_NMyc_cyto3_step01.0675.0675.1	1.2026	0.0523	573.35	1	8750.0%	1	R.SPITR.S
*	TK120303_NMyc_cyto3_step09.1857.1857.3	1.5768	0.1056	2298.07	17	2360.0%	1	K.HGMNGFLQQQMMYDCPPSR.L
UHEPS_HUMAN72.4%228.4%417450117.6(P05981) Serine protease hepsin (EC 3.4.21.-) (Transmembrane protease, serine 1) 
*	TK120303_NMyc_cyto3_step01.0544.0544.1	1.4332	0.2661	1258.99	1	4090.0%	1	K.THSEASGMVTQL.-
*	TK120303_NMyc_cyto3_step03.2227.2227.2	1.1982	0.0072	2594.46	15	2050.0%	1	R.VAGLSCEEMGFLRALTHSELDVR.T
UO0899572.0%7715.5%10781187055.0(O08995) Myelin transcription factor 1 
	TK120303_NMyc_cyto3_step05.4368.4368.2	0.9979	0.0464	2904.85	4	1920.0%	1	K.CPTPGCDGSGHITGNYASHRSLSGCPR.A
*	TK120303_NMyc_cyto3_step08.2816.2816.2	1.6033	0.0798	1985.52	7	2650.0%	1	R.GPELSSPKPEYSVIVEVR.S
*	TK120303_NMyc_cyto3_step06.3152.3152.2	1.861	0.3324	2812.35	1	2220.0%	1	K.SPGVSQRQSSTSAPSSSMTSPQSSQASR.Q
*	TK120303_NMyc_cyto3_step03.0280.0280.3	0.8522	0.0828	3637.58	15	970.0%	1	K.QLNQEIRDLNESNSGMEAAMVQLQSQISSMER.N
*	TK120303_NMyc_cyto3_step03.3220.3220.3	2.55	0.072	3113.17	1	1760.0%	1	R.DLNESNSGMEAAMVQLQSQISSMERNLK.N
*	TK120303_NMyc_cyto3_step10.1273.1273.3	1.9221	0.0345	2857.5	12	1920.0%	1	K.SSYSSYQGIIATSLLNLGQIAEEALVK.E
*	TK120303_NMyc_cyto3_step09.2621.2621.3	1.6399	0.0414	3371.81	49	1290.0%	1	K.EDSVSVAKLSPTVVHQLQDEAAMGVNSDEGEK.D
UQ9JMJ972.0%6124.3%19572131785.0(Q9JMJ9) Vomeroglandin precursor 
	TK120303_NMyc_cyto3_step05.0019.0019.3	0.9008	0.0508	1578.79	231	1070.0%	1	K.VDVVLGPIQLQSPSK.E
	TK120303_NMyc_cyto3_step09.2596.2596.1	1.6472	0.0059	1516.9	5	4550.0%	1	R.CSWKIVLPNMNR.V
	TK120303_NMyc_cyto3_step09.2323.2323.3	1.882	0.0666	2864.7	53	1520.0%	1	R.CQGRVEILYQGSWGTVCDDSWDTK.D
	TK120303_NMyc_cyto3_step03.3156.3156.3	1.9455	0.1637	3846.18	66	1210.0%	3	R.VTVAFTDVQLEGGCNYDYILVYDGPEYNSSLIAR.V
UQ8TF5571.9%4412.5%679758538.2(Q8TF55) Hypothetical protein KIAA1946 (Fragment) 
*	TK120303_NMyc_cyto3_step04.2776.2776.1	2.0115	0.0218	1456.39	3	4580.0%	1	K.MPIHSHAQPPDAR.E
*	TK120303_NMyc_cyto3_step07.4272.4272.3	1.7482	0.0035	4035.64	30	1180.0%	1	K.VDNFLHTTGITLNKPGFENIELTPLAAICVKIYSGGK.E
*	TK120303_NMyc_cyto3_step10.1524.1524.1	1.485	0.0323	1527.78	37	3080.0%	1	K.STVEDFEANTSPTK.R
*	TK120303_NMyc_cyto3_step11.1539.1539.3	1.541	0.088	3828.71	2	1590.0%	1	K.MPIHSHAQPPDAREEDIILEGQQSLPSQASDWSR.Y
UQ9294671.5%3312.5%600638798.6(Q92946) FUSE binding protein 3 (Fragment) 
	TK120303_NMyc_cyto3_step02.1449.1449.1	1.957	0.1066	1189.44	2	5450.0%	1	R.MGGGSIEVSVPR.F
	TK120303_NMyc_cyto3_step02.2848.2848.3	1.9544	0.0593	3872.07	52	1210.0%	1	R.IQAESGCKIQIASESSGIPERPCVLTGTPESIEQAK.R
*	TK120303_NMyc_cyto3_step03.2874.2874.3	1.7204	0.1407	2984.37	2	1830.0%	1	K.KQSHAASAAPQASSPPDYTMAWAEYYR.Q
US109_MOUSE71.4%116.2%112129187.2(P31725) Calgranulin B (Migration inhibitory factor-related protein 14) (MRP-14) (P14) (Leukocyte L1 complex heavy chain) 
*	TK120303_NMyc_cyto3_step03.0543.0543.1	1.5587	0.1773	880.29	2	6670.0%	1	K.LHENNPR.G
UQ99PG971.3%113.7%641733516.3(Q99PG9) Zinc finger 202 m1 
*	TK120303_NMyc_cyto3_step01.3924.3924.2	1.9346	0.3238	2822.3	4	2170.0%	1	K.EFYGEYVLEEDCGIVVSLSFPIPR.L
UQ921M571.3%5511.9%10801201496.5(Q921M5) Unknown (Protein for IMAGE:3597757) (Fragment) 
*	TK120303_NMyc_cyto3_step08.2558.2558.3	1.7328	0.0126	3529.2	3	1800.0%	1	R.EESPMDVDQPSPSAQDTQSIVISDGTPQGEKEK.E
*	TK120303_NMyc_cyto3_step12.1295.1295.2	1.939	0.3209	2111.72	1	3680.0%	1	K.HASSGSTVHIHPQAAPVVCR.H
*	TK120303_NMyc_cyto3_step02.0900.0900.2	1.0959	0.0984	2623.43	5	1960.0%	1	R.QLEAEADAIIQMSESSNQSETSVR.R
	TK120303_NMyc_cyto3_step04.0999.0999.3	1.3747	0.2578	3044.06	2	1630.0%	1	R.TVLNQILRQSTTHLADGPFAVLVDYIR.V
*	TK120303_NMyc_cyto3_step03.2531.2531.3	2.1639	0.0449	2820.33	4	2080.0%	1	K.QACSPCSSQSSSSGICTDFWDLLVK.L
UCBF_HUMAN71.2%447.7%9981140725.3(Q03701) CCAAT-box-binding transcription factor (CCAAT-binding factor) (CBF) 
*	TK120303_NMyc_cyto3_step05.3185.3185.2	1.8485	0.2297	2794.06	1	2290.0%	1	K.GAIDDLQQGELEAFIQNLNLAKYTK.A
*	TK120303_NMyc_cyto3_step04.1347.1347.1	1.1932	0.1563	672.6	6	7500.0%	1	R.KHFIK.D
*	TK120303_NMyc_cyto3_step03.2386.2386.3	2.2622	0.0949	2711.75	16	1770.0%	1	R.LGGTKQDYLMLATLDENEEVIDGGK.K
*	TK120303_NMyc_cyto3_step06.2855.2855.2	2.12	0.2864	2482.75	1	2620.0%	1	K.HLVAEFVQVLETLSHDTLVTTK.T
UQ1357771.2%6207.7%11491268098.9(Q13577) 51C protein 
*	TK120303_NMyc_cyto3_step06.3537.3537.3	2.3571	0.2791	4340.7	3	1160.0%	2	R.ALAPPAFLPPTGPSSPLPAPETPTAPAAESAPNGLSTVSHDYLK.G
	TK120303_NMyc_cyto3_step03.4358.4358.3	1.8833	0.1826	4538.99	14	1080.0%	4	R.VGEGSSSDEESGGTLPPPDFPPPPLPDSAIFLPPSLDPLPGPVVR.G
UQ96IS371.2%2222.8%184200869.5(Q96IS3) Similar to retina and anterior neural fold homeobox (Hypothetical protein) 
*	TK120303_NMyc_cyto3_step11.2966.2966.3	2.7106	0.2605	3768.34	1	1740.0%	1	R.LLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAK.E
*	TK120303_NMyc_cyto3_step01.0364.0364.1	0.7868	0.0447	542.38	13	6250.0%	1	R.AWPPA.-
UQ8R37471.1%2218.7%283293889.1(Q8R374) Hypothetical 29.4 kDa protein (Fragment) 
*	TK120303_NMyc_cyto3_step12.3211.3211.2	1.4157	0.0522	2584.23	34	1610.0%	1	K.GDVGPLGPEGPPGSPGPSGPQGKPGISGK.T
*	TK120303_NMyc_cyto3_step04.1986.1986.2	1.7948	0.3374	2271.4	1	2610.0%	1	K.GEPGIQGPPGLPGPPGPPGNQSPY.-
UQ9Y36170.9%113.2%442482916.7(Q9Y361) CGI-46 protein 
	TK120303_NMyc_cyto3_step11.1959.1959.1	1.6867	0.1619	1519.73	1	5000.0%	1	-.MATVTATTKVPEIR.D
UQ9CUR870.8%5921.6%296337619.7(Q9CUR8) 4833427E09Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step01.2482.2482.1	1.1231	0.0531	1036.83	7	5000.0%	1	K.IISKQDGFK.T
*	TK120303_NMyc_cyto3_step10.3782.3782.2	2.2197	0.2575	2081.5	4	2950.0%	2	R.GPLAAAVAGVALAGAGAAWHHGR.V
*	TK120303_NMyc_cyto3_step05.3299.3299.3	2.0794	0.1496	3612.97	54	1290.0%	2	R.DLGDKGVISYTEYLFLLTILTKPHSGFHVAFK.M
UQ8TE7170.8%111.6%10771209746.6(Q8TE71) EEG1L 
	TK120303_NMyc_cyto3_step05.3115.3115.2	2.2991	0.1152	2089.06	1	4060.0%	1	R.FNCPVNGTYVFIFHMLK.L
UKDGG_MOUSE70.8%223.9%788885236.8(Q91WG7) Diacylglycerol kinase, gamma (EC 2.7.1.107) (Diglyceride kinase) (DGK-gamma) (DAG kinase gamma) (88 kDa diacylglycerol kinase) 
*	TK120303_NMyc_cyto3_step12.1166.1166.1	1.2401	0.2101	1291.08	3	4500.0%	1	R.RLAQCSSVTIR.T
*	TK120303_NMyc_cyto3_step08.2544.2544.2	2.3059	0.1738	2044.54	8	2890.0%	1	K.EGASSSEPNVSDYNSDNAAK.A
UQ921Q570.7%3310.9%558608155.6(Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1 
	TK120303_NMyc_cyto3_step04.2343.2343.3	2.2987	0.1112	2703.6	6	2190.0%	1	R.VLSWIPSNNHQLQLAGALAIANFAR.N
	TK120303_NMyc_cyto3_step07.3687.3687.2	1.7811	0.3466	2185.78	1	3330.0%	1	K.LQLVEAGLVECLLEIVQQK.V
*	TK120303_NMyc_cyto3_step03.0886.0886.3	1.6851	0.0298	4092.73	22	1290.0%	1	R.EMIFEVLAPLAEHDAIKLQLVEAGLVECLLEIVQQK.V
UO9513570.7%466.9%10511110488.8(O95135) Ataxin-2-like protein A2LP 
*	TK120303_NMyc_cyto3_step03.3836.3836.3	1.6845	0.0547	3808.82	11	1220.0%	1	R.GHSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLRR.G
*	TK120303_NMyc_cyto3_step10.2752.2752.3	2.0406	0.127	4218.63	45	920.0%	1	R.GPSAPRGHSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR.R
*	TK120303_NMyc_cyto3_step02.2884.2884.2	1.7798	0.3469	2572.03	1	2710.0%	2	R.CHHVEASAATTALPAPAAAPHATCR.G
UQ9H2Y770.3%463.0%18832088817.2(Q9H2Y7) Zinc finger protein 106 (ZFP106) 
*	TK120303_NMyc_cyto3_step02.1072.1072.1	1.1455	0.0563	685.46	104	6000.0%	1	R.NISGHR.K
*	TK120303_NMyc_cyto3_step02.3421.3421.3	2.2739	0.2997	4301.52	1	1150.0%	2	R.DEPDSDSSLEVLEIPNPQLEVVAIDSSESGEEKPDSPSKK.D
*	TK120303_NMyc_cyto3_step03.2474.2474.1	1.9028	0.1098	1136.65	3	6110.0%	1	K.EIHTGSLNHK.A
UQ9QWY870.2%334.4%11471273957.6(Q9QWY8) ADP-ribosylation factor-directed GTPase activating protein isoform a 
	TK120303_NMyc_cyto3_step01.3267.3267.1	1.7842	0.1446	1440.7	4	4230.0%	1	K.FEGLSQQASTSSAK.T
	TK120303_NMyc_cyto3_step07.2135.2135.3	1.3278	0.0216	2851.92	53	1770.0%	1	K.SVKAIYNSGQDHVQNEENYAQVLDK.F
	TK120303_NMyc_cyto3_step05.1652.1652.2	1.2661	0.1603	1273.91	11	4090.0%	1	R.SSASRLSSFSSR.D
UQ9UFA470.2%82014.4%791856336.1(Q9UFA4) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step05.3219.3219.2	2.1476	0.2784	1508.76	2	4620.0%	3	K.DGKSPLHMTAVHGR.F
*	TK120303_NMyc_cyto3_step05.3329.3329.3	1.8079	0.0461	4300.34	7	1120.0%	1	K.FIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDK.G
*	TK120303_NMyc_cyto3_step06.2769.2769.3	1.8705	0.038	3411.86	42	1330.0%	3	R.TPLHASVINGHTLCLRLLLEIADNPEAVDVK.D
*	TK120303_NMyc_cyto3_step12.3474.3474.3	2.3638	0.1919	3151.84	15	1640.0%	1	K.DGNTPLHVAARYGHELLINTLITSGADTAK.C
UQ99PC970.2%227.7%594691398.6(Q99PC9) Protein phosphatase 2 regulatory subunit B56 delta isoform 
	TK120303_NMyc_cyto3_step12.3642.3642.3	2.0267	0.0564	3805.81	73	1210.0%	1	K.CVSSPHFQVAERALYYWNNEYIMSLISDNAAR.I
	TK120303_NMyc_cyto3_step08.1340.1340.2	2.1063	0.289	1511.27	2	4230.0%	1	K.RPSNSTPPPTQLSK.I
UQ9H09170.2%114.1%703773136.9(Q9H091) Hypothetical protein 
*	TK120303_NMyc_cyto3_step09.3148.3148.3	2.6952	0.2566	3166.13	2	2140.0%	1	R.AGELATLPFTYTAEVTSETFNKEAFLASR.G
URPOM_HUMAN70.1%9297.9%12301386849.0(O00411) DNA-directed RNA polymerase, mitochondrial precursor (EC 2.7.7.6) (MTRPOL) 
*	TK120303_NMyc_cyto3_step03.3506.3506.3	1.9717	0.087	3040.91	237	1380.0%	1	K.GCPQLGVPAPPSEAPQPPEAHLPHSAAPAR.K
*	TK120303_NMyc_cyto3_step08.1507.1507.3	1.5293	0.0649	2438.45	2	2750.0%	1	K.LLAEMLVQATQMPCSLDKPHR.S
*	TK120303_NMyc_cyto3_step10.1330.1330.1	1.6208	0.0158	1214.58	1	5000.0%	5	R.ELAHCQKVAR.E
*	TK120303_NMyc_cyto3_step01.1151.1151.1	0.7963	5.0E-4	744.39	32	6000.0%	1	R.KPNTRK.Q
*	TK120303_NMyc_cyto3_step11.1370.1370.3	1.4364	0.0642	3306.11	1	1720.0%	1	R.ALLEFAQGRPLGPHGLDWLKIHLVNLTGLK.K
UQ9D2M470.1%117.9%2282366311.5(Q9D2M4) 4632412I06Rik protein 
*	TK120303_NMyc_cyto3_step02.1797.1797.1	1.4812	0.2116	1592.77	1	3530.0%	1	R.SGAGGPGAPPLLPSASPR.L
UQ9CYN670.0%225.9%711808527.2(Q9CYN6) 5730405E07Rik protein 
*	TK120303_NMyc_cyto3_step02.3476.3476.2	2.2363	0.2468	2338.77	1	3750.0%	1	K.EDGSYQLPVVVLMLNLPHASR.D
*	TK120303_NMyc_cyto3_step03.3746.3746.2	1.264	0.0012	2528.39	42	2000.0%	1	R.RVAELFMFDFEISGIHLDEEK.R
UQ8R4P969.9%669.0%15011637347.2(Q8R4P9) Multidrug resistance-associated protein 7B 
	TK120303_NMyc_cyto3_step05.2251.2251.1	1.2731	0.0382	1262.29	8	4500.0%	1	R.IALARAVYQEK.A
*	TK120303_NMyc_cyto3_step03.3292.3292.2	1.7558	0.2448	2211.95	9	3000.0%	1	K.LGPSRPPTGEVLNLLGTDSER.L
*	TK120303_NMyc_cyto3_step11.2779.2779.2	1.1102	0.022	2582.53	266	1090.0%	1	R.LGSLTWSPLYSHLADTLAGLPVLR.A
*	TK120303_NMyc_cyto3_step11.3793.3793.3	2.4713	0.204	3987.69	3	1390.0%	1	R.EDPASCSPGSTALFSPRLLLFSPGNLYTPLLSTPLHK.A
*	TK120303_NMyc_cyto3_step01.3347.3347.2	1.1742	0.0072	3090.31	2	2040.0%	1	R.SRGPLALALAAFLPTPALVLTLLWHCQR.G
	TK120303_NMyc_cyto3_step11.4018.4018.2	2.2865	0.1898	1374.49	3	5000.0%	1	K.GMLVGIVGKVGCGK.S
UQ9DC1469.8%4410.0%592648997.5(Q9DC14) 1200007H22Rik protein 
	TK120303_NMyc_cyto3_step03.3559.3559.1	1.8996	0.1096	1505.59	1	4230.0%	1	K.LDLQKPSVPAIPPK.K
	TK120303_NMyc_cyto3_step02.2923.2923.3	1.8541	0.1535	2892.0	63	1540.0%	1	R.RPPSQSLTSSSLSSPDIFDSPSPEEDK.E
	TK120303_NMyc_cyto3_step01.1096.1096.1	1.3061	0.0544	1092.5	109	4380.0%	1	K.EEHISLAHR.G
	TK120303_NMyc_cyto3_step04.1256.1256.1	0.9658	0.0761	939.49	10	4380.0%	1	K.GVGFGDIFK.D
UO5486569.8%5118.5%620705985.3(O54865) Soluble guanylate cyclase beta-1 subunit 
	TK120303_NMyc_cyto3_step01.2072.2072.1	1.7456	0.148	1423.51	2	5000.0%	3	K.EPMQVWFLSRK.N
	TK120303_NMyc_cyto3_step10.3757.3757.3	1.6448	0.0027	2852.55	3	1800.0%	1	R.EGLQDIVIGIIKTVAQQIHGTEIDMK.V
	TK120303_NMyc_cyto3_step11.1087.1087.3	1.5693	0.0115	1928.95	23	2830.0%	1	R.MPRYCLFGNTVNLTSR.T
UQ99KC869.8%4411.0%444482399.5(Q99KC8) Similar to loss of heterozygosity, 11, chromosomal region 2, gene A 
	TK120303_NMyc_cyto3_step11.1249.1249.2	1.3148	0.0187	1460.45	20	3750.0%	1	K.ELNKPVQGPLAHR.V
*	TK120303_NMyc_cyto3_step08.2267.2267.3	1.3927	0.0426	2762.15	85	1600.0%	1	R.KAVAWLHDHAGSSIPMLVQAANSLLK.L
*	TK120303_NMyc_cyto3_step11.2007.2007.3	2.0399	0.1909	3616.02	1	1540.0%	1	K.AVAWLHDHAGSSIPMLVQAANSLLKLSVNPAVFGV.-
UQ6241269.8%444.7%11901377748.7(Q62412) Nebulin (Fragment) 
*	TK120303_NMyc_cyto3_step02.2844.2844.2	1.7532	0.121	2330.68	99	2000.0%	1	K.ADLEWMKGIGWVPIGSLEVVK.A
*	TK120303_NMyc_cyto3_step12.1138.1138.1	1.0323	0.0787	881.61	4	5830.0%	1	K.QKGYDLR.A
*	TK120303_NMyc_cyto3_step03.2752.2752.2	1.1579	0.1272	2449.78	70	2250.0%	1	K.ADLEWLRGIGWMPEGSIEMTR.V
	TK120303_NMyc_cyto3_step01.1631.1631.1	1.6425	0.1665	933.36	1	7500.0%	1	K.YKEAYEK.Q
UQ9NVH069.7%4413.1%496563468.3(Q9NVH0) Hypothetical protein FLJ10738 
*	TK120303_NMyc_cyto3_step02.2932.2932.2	1.6267	0.0227	2243.76	13	2500.0%	1	R.CSNWDAETLTEDQVIYAAR.D
*	TK120303_NMyc_cyto3_step04.1243.1243.2	1.1178	0.0119	1665.68	2	3570.0%	1	K.MDGMVPGNHQGRDPR.K
*	TK120303_NMyc_cyto3_step09.1616.1616.1	1.5089	0.1985	1368.57	1	4090.0%	1	R.ISNENYVPHGLK.V
*	TK120303_NMyc_cyto3_step06.3437.3437.3	2.1195	0.0523	4373.97	5	1280.0%	1	R.CSNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSR.N
UQ96PK269.7%330.7%59386701605.3(Q96PK2) Macrophin 1 isoform 4 
*	TK120303_NMyc_cyto3_step05.2093.2093.3	2.1835	0.3072	2402.33	1	2500.0%	1	R.LISPELANMIQIDSSEFSDHR.A
*	TK120303_NMyc_cyto3_step05.2281.2281.1	1.5175	0.1952	1425.97	1	5000.0%	1	K.EFISIINPHNLK.G
*	TK120303_NMyc_cyto3_step03.1784.1784.2	1.3886	0.0807	1194.57	15	5000.0%	1	K.VVEIGHQRQK.T
UO9492869.6%223.8%10201128514.9(O94928) Hypothetical protein KIAA0842 (Fragment) 
*	TK120303_NMyc_cyto3_step10.1497.1497.2	1.8833	0.32	1935.95	1	3440.0%	1	R.SEPGLLIPEMKDTSMER.L
*	TK120303_NMyc_cyto3_step04.1247.1247.2	1.1372	0.0463	2488.57	65	1670.0%	1	K.EEAQALDPPDACTELEVIRVTK.K
UQ9CQ2669.6%113.3%424485146.6(Q9CQ26) 5330424L14Rik protein (5730422L11Rik protein) (RIKEN cDNA 5730422L11 gene) (AMSH) (Associated molecule with the SH3 domain of STAM) 
*	TK120303_NMyc_cyto3_step11.1853.1853.1	1.6346	0.1659	1554.68	1	4620.0%	1	-.MSDHGDVSLPPQDR.V
UQ9D4D469.6%3311.2%627684477.0(Q9D4D4) 4933401I19Rik protein 
*	TK120303_NMyc_cyto3_step03.2750.2750.2	1.132	0.0805	2184.12	21	2890.0%	1	R.VIDLFTIKPLDAVTIIQSAK.A
*	TK120303_NMyc_cyto3_step11.2063.2063.3	1.3957	0.1381	4656.24	81	1070.0%	1	R.AFDQIRMGAISQTNINFVGSHCGVSVGEDGPSQMALEDLAMFR.S
*	TK120303_NMyc_cyto3_step05.2119.2119.1	1.5184	0.1912	827.63	2	6670.0%	1	R.EPDIVVR.Q
UA1B1_MOUSE69.4%6612.2%9431039795.1(O35643) Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta large chain) 
	TK120303_NMyc_cyto3_step05.1521.1521.1	1.3765	0.1289	755.71	8	6000.0%	1	K.RPEILK.H
	TK120303_NMyc_cyto3_step07.0267.0267.1	0.9446	0.0955	1448.33	4	2730.0%	1	R.EAQSICERVTPR.L
*	TK120303_NMyc_cyto3_step11.1181.1181.2	1.4781	0.0405	1319.79	15	4550.0%	1	R.DCPLNTEAASNK.L
*	TK120303_NMyc_cyto3_step11.3406.3406.3	2.6858	0.3044	3809.27	1	1600.0%	1	R.NSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLK.M
	TK120303_NMyc_cyto3_step02.2203.2203.1	1.6235	0.0411	963.71	3	6430.0%	1	K.KGEIFELK.A
	TK120303_NMyc_cyto3_step04.0822.0822.3	1.9591	0.1159	4177.39	5	1350.0%	1	K.DLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINK.L
UQ9C0A369.4%334.4%13861447526.5(Q9C0A3) Hypothetical protein KIAA1760 (Fragment) 
*	TK120303_NMyc_cyto3_step07.3396.3396.2	1.4278	0.0354	3029.15	7	1720.0%	1	K.DPAQASVGLTADSTGLSGKAVQTQQPCSVR.A
*	TK120303_NMyc_cyto3_step03.1642.1642.1	1.149	0.0948	1027.64	7	5000.0%	1	R.ETFIEQMK.D
*	TK120303_NMyc_cyto3_step06.3593.3593.2	1.7959	0.332	2542.83	1	2730.0%	1	K.LVDEWTSKTVGAAQLKPTLNQLK.Q
UO0030169.2%223.9%711731617.3(O00301) KSRP 
*	TK120303_NMyc_cyto3_step07.1380.1380.2	1.5526	0.1027	2109.95	3	3060.0%	1	K.KIGQQPQQPGAPPQQDYTK.A
*	TK120303_NMyc_cyto3_step04.1760.1760.1	1.4602	0.2203	925.75	2	5620.0%	1	R.HSVGVVIGR.S
USYW_MOUSE69.2%225.8%481542836.7(P32921) Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tryptophan--tRNA ligase) (TrpRS) 
*	TK120303_NMyc_cyto3_step06.2473.2473.2	1.2812	0.1345	2316.29	5	2370.0%	1	R.NCDSDATKASEDFVDPWTVR.T
	TK120303_NMyc_cyto3_step04.1616.1616.1	1.5553	0.1709	972.59	1	5710.0%	1	K.HVTFNQVK.G
UQ9H69569.1%249.7%257289606.1(Q9H695) Hypothetical protein FLJ22474 
*	TK120303_NMyc_cyto3_step10.3294.3294.2	2.2947	0.1423	2836.88	1	2290.0%	2	R.VALTLIKQHQELILEATSVPDICDK.F
UQ9CZ9569.1%2213.3%211241885.0(Q9CZ95) 2810035F15Rik protein 
	TK120303_NMyc_cyto3_step06.2324.2324.2	2.2846	0.1587	2041.32	1	4710.0%	1	R.ESSNSLLNHQLSEIDQAR.L
*	TK120303_NMyc_cyto3_step03.2452.2452.1	1.4707	0.0039	1254.58	1	5560.0%	1	K.EKHDRPQSEK.E
UCOQ6_HUMAN69.1%244.5%468508597.1(Q9Y2Z9) Putative ubiquinone biosynthesis monooxgenase COQ6 (EC 1.14.13.-) (CGI-10) 
	TK120303_NMyc_cyto3_step08.1954.1954.2	2.2981	0.1704	2409.81	1	3000.0%	2	K.DNLDDMGYIVENDVIMHALTK.Q
UCGG2_HUMAN69.1%116.4%344388665.5(Q16589) Cyclin G2 
*	TK120303_NMyc_cyto3_step11.2113.2113.2	2.291	0.135	2426.91	1	3330.0%	1	R.EKGLSLIEATPENDNTLCPGLR.N
UQ9CR2568.9%4103.1%489523655.5(Q9CR25) 9130020C19Rik protein 
*	TK120303_NMyc_cyto3_step10.3704.3704.2	1.9884	0.2839	1521.44	1	4640.0%	3	R.VVGLLAGTLGVARHR.E
UCNK_HUMAN68.8%4614.1%646717909.2(Q9H4B4) Cytokine-inducible serine/threonine-protein kinase (EC 2.7.1.37) (FGF-inducible kinase) (Proliferation-related kinase) 
	TK120303_NMyc_cyto3_step01.4028.4028.3	1.7071	0.0056	4628.64	1	1330.0%	1	R.DEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPR.G
	TK120303_NMyc_cyto3_step09.2428.2428.2	1.4476	0.068	1212.53	3	6670.0%	1	R.DRPSIDQILR.H
	TK120303_NMyc_cyto3_step02.4296.4296.3	2.2864	0.0075	4005.6	14	1400.0%	2	R.YFASYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVK.T
UQ96PI768.8%243.4%756848586.1(Q96PI7) Apoptosis-inhibitor-like protein 
*	TK120303_NMyc_cyto3_step09.3527.3527.2	1.8003	0.0422	3009.81	28	1800.0%	2	R.LLSASMDKTMILWAPDEESGVWLEQR.E
UZEP1_HUMAN68.8%10225.2%27172972187.9(P15822) Zinc finger protein 40 (Human immunodeficiency virus type I enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex binding protein 1) (MBP-1) (Positive regulatory domain II binding factor 1) (PRDII-BF1) 
*	TK120303_NMyc_cyto3_step10.3965.3965.2	1.2391	0.0582	2085.96	100	1940.0%	1	K.AHSEVFTKPSGQQTLSPDR.Q
*	TK120303_NMyc_cyto3_step12.1338.1338.2	1.1205	0.0088	2034.15	147	2810.0%	1	K.FVVIEPISELQEFENIK.S
*	TK120303_NMyc_cyto3_step03.4192.4192.2	0.9248	0.1812	3187.89	16	1250.0%	1	K.AHSEVFTKPSGQQTLSPDRQVPRPTGLPR.R
*	TK120303_NMyc_cyto3_step05.4278.4278.2	1.8145	0.0024	2369.41	7	2630.0%	4	R.SDQQHKNIQLQNSHIHLVAR.G
*	TK120303_NMyc_cyto3_step12.2743.2743.2	1.2387	0.031	2942.2	47	1200.0%	1	K.IDFLNKAEFLMIPAGLNTLNVPGCHR.E
*	TK120303_NMyc_cyto3_step08.2558.2558.2	1.6426	0.0896	2353.14	9	2500.0%	1	K.HKQNTEESSFAVLHSASESHK.K
*	TK120303_NMyc_cyto3_step01.3144.3144.2	1.2042	0.0597	3075.9	50	1300.0%	1	K.SNQHNQQLPGCSGFTGSLTNLQNQENAK.L
UKINH_MOUSE68.7%576.0%9631095496.3(Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) 
*	TK120303_NMyc_cyto3_step11.4247.4247.2	1.3757	0.209	1900.45	28	3210.0%	1	K.TLRNTIQWLENELNR.W
*	TK120303_NMyc_cyto3_step05.1131.1131.1	0.9464	0.042	1007.42	20	5000.0%	1	R.KCEEELAK.L
	TK120303_NMyc_cyto3_step03.1714.1714.2	2.2757	0.1882	1361.71	1	6500.0%	1	R.FRPLNESEVNR.G
*	TK120303_NMyc_cyto3_step09.2477.2477.2	1.3721	0.179	2357.52	9	2390.0%	2	K.DIAITSDKGAAAVGMAGSFTDAER.R
UQ9Y2S568.7%114.7%337386096.4(Q9Y2S5) HSPC015 
	TK120303_NMyc_cyto3_step05.2952.2952.2	2.2797	0.1894	1816.82	1	4670.0%	1	K.RELDVEEAHAASTEEK.E
UHO1_MOUSE68.6%3513.1%289329296.5(P14901) Heme oxygenase 1 (EC 1.14.99.3) (HO-1) (P32 protein) 
	TK120303_NMyc_cyto3_step01.2334.2334.1	1.4534	0.0556	1252.66	3	5000.0%	2	R.YLGDLSGGQVLK.K
*	TK120303_NMyc_cyto3_step07.3244.3244.2	1.0571	0.0721	2777.03	11	1800.0%	1	K.AMALPSSGEGLAFFTFPNIDSPTKFK.Q
UO1479568.5%352.8%15911806836.0(O14795) Munc13 
*	TK120303_NMyc_cyto3_step02.4284.4284.2	1.2055	0.0811	3006.51	17	1480.0%	1	R.DGQAGFGEQEKPLEVTGQAEKEAACEPK.E
*	TK120303_NMyc_cyto3_step03.3336.3336.2	2.2436	0.2311	2096.9	1	4380.0%	2	R.DSCNDSMQSYDLDYPER.R
UITH1_MOUSE68.5%6612.3%9071010837.0(Q61702) Inter-alpha-trypsin inhibitor heavy chain H1 precursor (ITI heavy chain H1) 
*	TK120303_NMyc_cyto3_step09.2735.2735.3	2.9889	0.0098	2712.6	1	2810.0%	1	R.VLLCLLPLLTLQARPALGLATGRPR.G
*	TK120303_NMyc_cyto3_step11.2585.2585.2	1.532	0.101	2614.53	264	1300.0%	1	K.VQSWKGSLVPVSNANLQAAQDFVR.R
*	TK120303_NMyc_cyto3_step01.3559.3559.2	1.4125	0.1381	2994.31	31	1350.0%	1	R.TKGLLGQFFSPLDFEVFDLHPGSDPTK.T
*	TK120303_NMyc_cyto3_step04.4081.4081.3	1.1196	0.0245	2033.2	69	1910.0%	1	R.FAHYVITSQVVNNADKAR.E
	TK120303_NMyc_cyto3_step06.1895.1895.1	1.05	0.0080	930.78	208	3570.0%	1	R.QTKEALLK.I
*	TK120303_NMyc_cyto3_step06.1507.1507.1	1.3998	0.0415	1189.76	2	5000.0%	1	R.GHVLENHVER.L
UQ91VJ368.3%469.4%361401496.2(Q91VJ3) Similar to Adenosin kinase 
*	TK120303_NMyc_cyto3_step01.3422.3422.1	1.0658	0.0186	889.52	71	5000.0%	2	R.NWVLVEK.A
*	TK120303_NMyc_cyto3_step02.2225.2225.1	1.7656	0.1377	1350.84	1	5000.0%	1	K.VAQWLIQEPHK.A
	TK120303_NMyc_cyto3_step04.2308.2308.2	1.4358	0.1674	1900.41	46	3000.0%	1	K.YSLKPNDQILAEDKHK.E
UNBL4_HUMAN68.3%113.3%598693759.3(Q9HCS5) Band 4.1-like protein 4 (NBL4 protein) 
*	TK120303_NMyc_cyto3_step11.2270.2270.2	1.9324	0.3135	2277.35	1	3160.0%	1	K.ELVDPSGLSEEQLKEIPYTK.I
UG6PI_HUMAN68.2%227.3%558631478.3(P06744) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) (Sperm antigen-36) (SA-36) 
*	TK120303_NMyc_cyto3_step06.2825.2825.3	1.6719	0.017	3332.94	57	1330.0%	1	K.TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR.V
*	TK120303_NMyc_cyto3_step01.2395.2395.1	1.9449	0.0512	994.48	1	7860.0%	1	K.EWFLQAAK.D
UTAL1_MOUSE68.2%4411.0%337373877.0(Q93092) Transaldolase (EC 2.2.1.2) 
*	TK120303_NMyc_cyto3_step01.2416.2416.1	1.2887	0.1239	786.64	32	5830.0%	1	K.LLGELLK.D
	TK120303_NMyc_cyto3_step01.3274.3274.1	1.0884	0.0342	1252.87	42	3500.0%	1	K.LFVLFGAEILK.K
*	TK120303_NMyc_cyto3_step03.1416.1416.1	1.9622	0.048	1226.62	3	5000.0%	1	K.KLGGPQEEQIK.N
*	TK120303_NMyc_cyto3_step01.1574.1574.1	1.156	0.2861	798.61	1	6430.0%	1	K.LAPALSVK.A
UQ9BQT968.2%338.9%9561060985.4(Q9BQT9) Calsyntenin-3 protein precursor 
	TK120303_NMyc_cyto3_step04.3063.3063.3	2.1135	0.1194	3368.48	20	1550.0%	1	K.EPVDCEAQKEHTFTIQAYDCGEGPDGANTK.K
	TK120303_NMyc_cyto3_step02.2665.2665.2	1.1049	0.0171	2843.08	62	1520.0%	1	K.DPDLFWDDSALTIIVNPMESYQNR.Q
	TK120303_NMyc_cyto3_step07.2827.2827.3	2.5569	0.4337	3230.27	3	1750.0%	1	R.QSCVTGAVGGQQEDEDSSDSEVADSPSSDER.R
UPER3_MOUSE68.1%336.3%11131209396.5(O70361) Period circadian protein 3 (mPER3) 
*	TK120303_NMyc_cyto3_step10.2493.2493.2	2.1034	0.2851	2076.79	1	2940.0%	1	R.DEALPGAAEESIWRMIER.T
*	TK120303_NMyc_cyto3_step10.3522.3522.2	1.3282	0.0519	3019.77	43	1600.0%	1	R.ILPYLVHVHSSAQPEPEPCCLTLVEK.I
*	TK120303_NMyc_cyto3_step12.2215.2215.3	1.7944	0.0014	2896.72	8	1900.0%	1	R.KCISCTNTSSSSEEAKPIPEVDSSQR.D
UMAOX_MOUSE68.1%101819.4%572639997.4(P06801) NADP-dependent malic enzyme (EC 1.1.1.40) (NADP-ME) (Malic enzyme 1) 
	TK120303_NMyc_cyto3_step05.3005.3005.3	2.6618	0.2609	4392.0	15	1100.0%	1	K.IKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSSPTSK.A
*	TK120303_NMyc_cyto3_step08.1536.1536.2	1.6636	0.0112	857.36	70	6670.0%	1	-.MEPRAPR.R
	TK120303_NMyc_cyto3_step10.3141.3141.3	2.9595	0.1912	3107.82	2	2330.0%	2	K.NLEAIVQKIKPTALIGVAAIGGAFTEQILK.D
	TK120303_NMyc_cyto3_step11.3690.3690.2	1.9223	0.1523	1773.42	5	3530.0%	3	R.ILGLGDLGCNGMGIPVGK.L
*	TK120303_NMyc_cyto3_step03.3744.3744.3	1.7528	0.0061	3418.28	41	1330.0%	1	K.LALYTACGGVNPQQCLPITLDVGTENEELLK.D
	TK120303_NMyc_cyto3_step01.1300.1300.1	1.0999	0.0401	533.25	1	6250.0%	1	K.EGLSK.E
UQ9R1D268.1%118.6%326370286.6(Q9R1D2) Cyclin-dependent kinase 6 
	TK120303_NMyc_cyto3_step07.3628.3628.3	2.9631	0.1686	3191.28	5	1940.0%	1	R.APEVLLQSSYATPVDLWSVGCIFAEMFR.R
UQ96M0468.0%225.4%519603519.3(Q96M04) Hypothetical protein FLJ32933 
*	TK120303_NMyc_cyto3_step10.3248.3248.2	1.2415	0.057	2198.82	240	1760.0%	1	R.IHTGEKPYQCEECGKAYK.C
*	TK120303_NMyc_cyto3_step04.2074.2074.1	1.9037	0.0766	1254.49	3	6110.0%	1	K.KPYGSQECRK.A
UQ9CZA768.0%2427.0%3743348.7(Q9CZA7) 2810026P18Rik protein 
*	TK120303_NMyc_cyto3_step02.1773.1773.1	1.9329	0.0235	1261.49	2	5560.0%	2	R.ELINERNMLK.T
UO8828668.0%12269.7%15611712437.5(O88286) WizL 
	TK120303_NMyc_cyto3_step04.2968.2968.2	1.2215	0.0417	2767.22	340	1250.0%	1	R.AQCPQSEDEGPLNLTSGPEPTRDIR.C
	TK120303_NMyc_cyto3_step09.1620.1620.1	0.9325	0.1076	1286.43	124	2730.0%	1	R.RQARPSDASAAR.G
	TK120303_NMyc_cyto3_step10.2516.2516.3	2.1589	0.0704	2088.3	8	2920.0%	1	R.CDFCGAGFDTRAGLSSHAR.A
	TK120303_NMyc_cyto3_step01.0758.0758.1	0.7794	0.0971	586.36	12	4000.0%	1	R.SAGHGR.D
*	TK120303_NMyc_cyto3_step12.2355.2355.3	1.5802	0.0080	3946.32	4	1320.0%	2	R.STHPLDFLLLDAPLGGSLGLNTLLEGDPAMALKHEER.K
	TK120303_NMyc_cyto3_step02.3040.3040.3	1.937	0.0369	2575.15	26	1960.0%	1	R.QLGVAESESSGAPIDLLYELVKQK.G
	TK120303_NMyc_cyto3_step06.1951.1951.3	1.9116	0.0319	2865.58	5	1850.0%	1	K.EFLAGAARPGLLTLAKPMDAPAVNKAIK.S
UCA21_HUMAN67.9%131720.5%13661294568.9(P08123) Collagen alpha 2(I) chain precursor 
	TK120303_NMyc_cyto3_step12.2107.2107.3	2.0203	0.0494	2833.84	18	1480.0%	1	K.GPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSR.G
	TK120303_NMyc_cyto3_step11.3701.3701.2	1.6267	0.0252	2043.4	3	2860.0%	2	K.EGPVGLPGIDGRPGPIGPAGAR.G
	TK120303_NMyc_cyto3_step09.3685.3685.2	1.0385	0.0185	2632.61	6	2270.0%	1	R.TLLLLAVTLCLATCQSLQEETVR.K
	TK120303_NMyc_cyto3_step08.2208.2208.3	1.4331	0.0097	3757.0	56	1100.0%	1	R.GLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGR.D
	TK120303_NMyc_cyto3_step12.1198.1198.1	1.2185	0.1665	1238.54	65	3570.0%	1	R.GEAGAAGPAGPAGPR.G
	TK120303_NMyc_cyto3_step05.3020.3020.3	1.9862	0.1624	3362.32	2	1790.0%	1	R.LLANYASQNITYHCKNSIAYMDEETGNLK.K
	TK120303_NMyc_cyto3_step01.4650.4650.3	2.1184	0.2049	2380.36	1	2310.0%	1	R.GEVGPAGPNGFAGPAGAAGQPGAKGER.G
	TK120303_NMyc_cyto3_step01.3766.3766.2	1.1659	0.0728	2715.48	18	1550.0%	1	R.GYPGNIGPVGAAGAPGPHGPVGPAGKHGNR.G
	TK120303_NMyc_cyto3_step03.1072.1072.1	1.2743	0.0381	813.4	345	3750.0%	1	K.GQPGAPGVK.G
	TK120303_NMyc_cyto3_step07.3455.3455.2	1.4629	0.1176	2626.1	15	1900.0%	1	R.GPPGESGAAGPTGPIGSRGPSGPPGPDGNK.G
	TK120303_NMyc_cyto3_step10.3428.3428.2	2.1912	0.2504	2030.62	1	3570.0%	2	K.HGNRGETGPSGPVGPAGAVGPR.G
UQ9H2T867.9%111.1%9851062088.0(Q9H2T8) Ribeye 
*	TK120303_NMyc_cyto3_step06.1560.1560.1	1.9715	0.1416	1210.65	7	5000.0%	1	R.EAVYNSVAARK.G
UQ9UH4867.8%7495.4%332388659.2(Q9UH48) Gastric cancer-related protein GCYS-20 
*	TK120303_NMyc_cyto3_step10.2641.2641.2	2.0316	0.0101	2214.15	3	2940.0%	7	K.IVDWMDNFKLVGLLNNYR.Y
UKPT3_MOUSE67.8%229.8%451518488.5(Q04899) Serine/threonine-protein kinase PCTAIRE-3 (EC 2.7.1.-) 
*	TK120303_NMyc_cyto3_step08.2383.2383.2	1.7648	0.3421	2005.77	1	2940.0%	1	R.MSAEAALNHPYFQSLGDR.V
*	TK120303_NMyc_cyto3_step06.2664.2664.3	2.2228	0.1034	2957.87	1	2100.0%	1	R.LLGTPTEESWPGVTSISEFRAYNFPR.Y
UNDF6_MOUSE67.8%116.8%337386448.6(P48986) Neurogenic differentiation factor 6 (NeuroD6) (Atonal protein homolog 2) (Helix-loop-helix protein mATH-2) (MATH2) (NEX-1 protein) 
	TK120303_NMyc_cyto3_step07.2644.2644.2	1.764	0.3484	2807.3	1	2950.0%	1	K.QEETLDYGKNYNYGMHYCAVPPR.G
UQ8R0A467.8%466.5%866951776.6(Q8R0A4) Similar to zinc finger protein 295 
*	TK120303_NMyc_cyto3_step11.2289.2289.2	1.1357	0.0468	2318.86	49	2060.0%	1	R.HQELLCSVKPFICHVCYK.A
*	TK120303_NMyc_cyto3_step07.0203.0203.1	0.9995	0.1559	1506.56	15	2500.0%	1	K.RNTVLPPKPSQDR.E
	TK120303_NMyc_cyto3_step12.3958.3958.2	1.9493	0.3028	2634.34	2	2500.0%	2	K.ESEVCPVPTNSPSPPPLPPPPPLPK.I
UMKKS_MOUSE67.7%3313.3%570619527.4(Q9JI70) McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin 
	TK120303_NMyc_cyto3_step05.3276.3276.2	2.0694	0.2983	2851.17	1	2410.0%	1	K.VTGATPIGSLNPIVSTTYGSVKDVCSAR.F
	TK120303_NMyc_cyto3_step03.2298.2298.2	1.3055	0.0706	2696.37	5	2170.0%	1	K.ETDHIGALILKAFLLTIPESTEER.M
	TK120303_NMyc_cyto3_step08.2076.2076.3	1.5193	0.0281	2850.92	98	1740.0%	1	R.FGSKHFFHLLPNEATVCTLLLCSR.N
UACC8_HUMAN67.7%7712.7%15801768907.8(Q09428) Sulfonylurea receptor 1 
*	TK120303_NMyc_cyto3_step12.4375.4375.2	2.0664	0.2943	3094.58	1	2590.0%	1	K.LSEFLSSAEIREEQCAPHEPTPQGPASK.Y
*	TK120303_NMyc_cyto3_step09.4438.4438.2	0.8903	0.0537	2944.54	19	1400.0%	1	K.HMVLVAIDYWLAKWTDSALTLTPAAR.N
*	TK120303_NMyc_cyto3_step11.4023.4023.3	1.7718	0.1646	4256.77	17	1050.0%	1	R.ELSAGLVGLGLTYALMVSNYLNWMVRNLADMELQLGAVK.R
*	TK120303_NMyc_cyto3_step07.4452.4452.1	0.8276	0.0571	1522.44	131	1920.0%	1	R.VHTILSADLVIVLK.R
*	TK120303_NMyc_cyto3_step09.2172.2172.3	1.2601	0.0106	3419.77	10	1550.0%	1	K.RGPVAYASQKPWLLNATVEENIIFESPFNK.Q
*	TK120303_NMyc_cyto3_step10.2420.2420.2	1.5865	0.1234	2612.8	2	2170.0%	1	R.ACAKYLSSAGILLLSLLVFSQLLK.H
*	TK120303_NMyc_cyto3_step11.2551.2551.3	1.5106	0.0187	4309.97	9	1120.0%	1	K.EMTSLRAFAIYTSISIFMNTAIPIAAVLITFVGHVSFFK.E
UMYH2_HUMAN67.7%7490.4%19412230425.8(Q9UKX2) Myosin heavy chain, skeletal muscle, adult 2 (Myosin heavy chain IIa) (MyHC-IIa) 
	TK120303_NMyc_cyto3_step12.4287.4287.1	1.1241	0.0237	975.77	5	5710.0%	7	K.LYDQHLGK.S
UNUGL_HUMAN67.6%4416.0%368411278.3(Q9Y2C4) Endonuclease G like 1 (EC 3.1.30.-) (Endo G like) 
*	TK120303_NMyc_cyto3_step12.2738.2738.2	1.5898	0.0477	1830.09	63	2500.0%	1	R.SQGAEGALTGKQPDGSAEK.A
*	TK120303_NMyc_cyto3_step03.3727.3727.2	1.2084	0.022	2556.0	3	2200.0%	1	R.RFLSGFVAGAVVGAAGAGLAALQFFR.S
*	TK120303_NMyc_cyto3_step05.1748.1748.2	0.909	0.0796	1745.01	27	2690.0%	1	K.LLDFQEFTLYLSTR.K
*	TK120303_NMyc_cyto3_step10.3509.3509.2	1.8147	0.326	2398.82	1	2290.0%	1	R.FLSGFVAGAVVGAAGAGLAALQFFR.S
UQ99LI067.5%356.2%547626545.4(Q99LI0) Similar to thyroid hormone receptor interactor 10 
	TK120303_NMyc_cyto3_step11.1057.1057.2	1.8132	0.3202	2836.66	5	2040.0%	2	R.HARPPDPPTTAPPDSSSSSTNSGSQDNK.E
	TK120303_NMyc_cyto3_step07.1631.1631.3	1.8095	0.1311	3449.76	6	1520.0%	1	R.GDSLSRHARPPDPPTTAPPDSSSSSTNSGSQDNK.E
UO7543367.5%225.1%591682867.0(O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog) 
*	TK120303_NMyc_cyto3_step09.1148.1148.1	1.4743	0.2046	964.39	4	6430.0%	1	R.HAIEVNKR.D
*	TK120303_NMyc_cyto3_step09.2080.2080.3	2.0556	0.1399	2660.07	29	1790.0%	1	K.YIQDIYSCGEIVEHLEESTAFR.Y
UQ96SH767.4%118.1%209236169.4(Q96SH7) BA204P2.1.3 (Interleukin 20 receptor alpha, isoform 3) 
*	TK120303_NMyc_cyto3_step03.2563.2563.2	2.2778	0.0617	1947.4	2	3750.0%	1	R.TVSLKWNGAYIHVPLCS.-
UQ96CK467.4%467.7%640734559.2(Q96CK4) Hypothetical protein 
*	TK120303_NMyc_cyto3_step03.2392.2392.2	1.1251	0.0787	2582.78	14	1900.0%	1	K.VVNTIFHGQLLSQVTCISCNYK.S
*	TK120303_NMyc_cyto3_step07.3124.3124.2	2.2747	0.0946	2395.98	1	3160.0%	1	K.FTETEALEGRIYACDQCNSK.R
*	TK120303_NMyc_cyto3_step01.0622.0622.1	1.1229	0.1362	700.36	11	5830.0%	2	R.VPAATLK.L
UQ9D5J467.4%61019.4%541598949.3(Q9D5J4) 4930432J16Rik protein 
*	TK120303_NMyc_cyto3_step02.3981.3981.3	1.6323	0.0715	3912.33	13	1500.0%	1	K.QAMASNCNHISQPCHGLHLTLPAPGITVEVASCQGR.L
*	TK120303_NMyc_cyto3_step03.4215.4215.3	1.482	0.1439	3936.35	1	1500.0%	2	R.EQPLSWFSGLLGSSPATPETSELGLGEQEMIFLKQK.L
*	TK120303_NMyc_cyto3_step06.0379.0379.2	0.6545	0.1044	963.75	24	2860.0%	1	R.LRGPVQHR.L
*	TK120303_NMyc_cyto3_step02.4135.4135.2	2.278	0.0564	2625.97	2	2710.0%	2	R.LAAMKTEAGVPLVDIQDPVEVPSSR.H
UABF1_HUMAN67.4%573.1%37034044746.2(Q15911) Alpha-fetoprotein enhancer binding protein (AT motif-binding factor) (AT-binding transcription factor 1) 
*	TK120303_NMyc_cyto3_step10.3797.3797.3	2.8957	0.2309	4639.88	5	1190.0%	2	K.AQVQVPQQSHQQILPQQQQNQLSIAQSHSALLQPSQHPEKK.N
*	TK120303_NMyc_cyto3_step01.3795.3795.2	1.4125	0.1394	2736.67	13	1670.0%	1	K.LIMTVTTPEMVMPSSMFLPAAVPDR.D
*	TK120303_NMyc_cyto3_step11.1077.1077.3	1.0939	0.0679	3138.1	16	1760.0%	1	R.VLGSLPSPAEAELYQYYLAQNMNLPNLK.M
*	TK120303_NMyc_cyto3_step04.2220.2220.2	1.2594	0.0247	2287.18	5	2380.0%	1	K.VQQQQPKASQTPVPPGAPSPDK.D
UMY5C_HUMAN67.4%777.2%17422027937.7(Q9NQX4) Myosin Vc (Myosin 5C) 
*	TK120303_NMyc_cyto3_step10.3828.3828.2	1.2646	0.032	1901.95	27	2860.0%	1	R.VLESHFQSQKDCYEK.E
*	TK120303_NMyc_cyto3_step02.1409.1409.1	1.9433	0.0046	758.72	1	8000.0%	1	K.EQIQLK.L
*	TK120303_NMyc_cyto3_step06.3568.3568.2	1.3329	0.0731	2072.08	97	2330.0%	1	R.WTYIEFYSRYGILMTK.Q
*	TK120303_NMyc_cyto3_step04.0822.0822.2	1.0101	0.0131	2785.26	56	1400.0%	1	K.IVTSSETVVKPMTRPQAVNARDALAK.K
*	TK120303_NMyc_cyto3_step10.4326.4326.2	0.5714	0.0409	2480.02	49	1050.0%	1	K.HNSPQQNKNCLNNFDLSEYR.Q
*	TK120303_NMyc_cyto3_step08.3102.3102.2	1.9533	0.0069	2082.26	5	3240.0%	1	K.QLFFLIGAVTLNSLFLRK.D
*	TK120303_NMyc_cyto3_step08.3378.3378.2	1.3256	0.096	2628.55	6	2170.0%	1	K.LGSAEEFNYTRMGGNTVIEGVNDR.A
UQ8WXA667.4%221.2%23162625165.4(Q8WXA6) AF15q14 isoform 2 
*	TK120303_NMyc_cyto3_step02.1409.1409.1	1.9433	0.0046	758.72	1	8000.0%	1	R.EKLQIK.I
*	TK120303_NMyc_cyto3_step05.3319.3319.3	1.2305	0.0726	2580.69	89	1750.0%	1	K.FSDTTQDREIFDHHTEEDIDK.S
UQ9JHW967.4%112.3%512561576.6(Q9JHW9) Retinaldehyde dehydrogenase 3 (EC 1.2.1.3) 
*	TK120303_NMyc_cyto3_step05.2708.2708.1	1.9672	0.1595	1401.63	9	4090.0%	1	R.KFATYNPSTLEK.I
UQ91Z1667.4%6615.4%801867809.2(Q91Z16) Hypothetical 86.8 kDa protein (Fragment) 
*	TK120303_NMyc_cyto3_step12.3212.3212.3	2.1226	0.0568	3766.2	257	1060.0%	1	R.QNHPLPFPPPPALPFYPASVYPRHFGPVPPSQGR.G
*	TK120303_NMyc_cyto3_step06.0616.0616.3	1.3778	0.053	3824.67	15	1210.0%	1	R.QSILEGLSFSRQNHPLPFPPPPALPFYPASVYPR.H
	TK120303_NMyc_cyto3_step08.1739.1739.2	1.9502	0.1975	1947.45	3	3330.0%	1	R.GPFPLQVVSVGGPARGRPR.G
*	TK120303_NMyc_cyto3_step07.2073.2073.2	1.25	0.0673	1655.6	70	3210.0%	1	K.IGWEKTGSHAEPLAR.G
	TK120303_NMyc_cyto3_step01.2476.2476.1	1.9686	0.3451	1285.65	6	4550.0%	1	R.REAALEAAVLNK.E
*	TK120303_NMyc_cyto3_step11.2645.2645.3	2.0487	0.1248	3497.45	69	1290.0%	1	R.VPSHSESALNNDSKPCNTNPHLNALSTDSACR.R
UQ922Y367.4%111.1%535605757.6(Q922Y3) Unknown (Protein for IMAGE:3498575) (Fragment) 
	TK120303_NMyc_cyto3_step02.1409.1409.1	1.9433	0.0046	758.72	1	8000.0%	1	K.EQLQLK.I
UCTE1_MOUSE67.4%577.9%419461366.6(O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) 
	TK120303_NMyc_cyto3_step08.1124.1124.1	1.0851	0.1399	810.58	10	5830.0%	1	K.RLQAHGK.E
	TK120303_NMyc_cyto3_step07.1276.1276.1	0.9246	0.1116	626.46	4	5000.0%	1	R.RVPVR.E
	TK120303_NMyc_cyto3_step09.1331.1331.1	1.8588	0.1089	934.59	1	7140.0%	2	R.LAHAVHER.H
	TK120303_NMyc_cyto3_step04.0310.0310.1	0.8555	0.0666	1295.11	5	2500.0%	1	K.GGELGLAMASFLK.G
UQ9HAR267.3%6610.2%12401392796.9(Q9HAR2) Lectomedin-3 
	TK120303_NMyc_cyto3_step09.2260.2260.3	1.6157	0.0715	2537.07	3	2270.0%	1	K.YFYLVGYGMPALIVAVSAAVDYR.S
	TK120303_NMyc_cyto3_step01.2352.2352.1	1.4186	0.2443	1353.76	2	4090.0%	1	K.VYLADPVVFTVK.H
	TK120303_NMyc_cyto3_step03.2104.2104.2	1.3629	0.054	2801.4	1	1960.0%	1	R.NTIHKNLCISLFVAELLFLIGINR.T
*	TK120303_NMyc_cyto3_step08.3288.3288.2	1.4388	0.0984	1928.97	21	2500.0%	1	K.RSASNAFMICGILYVVK.S
*	TK120303_NMyc_cyto3_step11.2949.2949.2	1.2856	0.0294	2700.99	10	2050.0%	1	K.IVISQLNPYTLRIEGTWDTAYDK.R
*	TK120303_NMyc_cyto3_step10.2634.2634.3	1.6253	0.0677	3359.59	292	1200.0%	1	K.MFHHTAILKPESGCLDNINYEDNRPFIK.S
UARP2_HUMAN67.3%4417.3%394447616.7(O15142) Actin-like protein 2 (Actin-related protein 2) 
*	TK120303_NMyc_cyto3_step11.4001.4001.3	2.1192	0.0589	3938.89	51	1290.0%	1	R.FEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTR.S
*	TK120303_NMyc_cyto3_step03.0428.0428.2	1.0375	0.1632	2169.04	1	2890.0%	1	K.HIVLSGGSTMYPGLPSRLER.E
*	TK120303_NMyc_cyto3_step03.1570.1570.1	1.727	0.1285	801.56	2	6670.0%	1	R.RLDIAGR.D
*	TK120303_NMyc_cyto3_step03.4039.4039.3	1.2113	0.1559	2429.52	35	1550.0%	1	R.SEFYKHIVLSGGSTMYPGLPSR.L
UQ9WTP567.3%3310.3%813880224.8(Q9WTP5) PB-cadherin 
*	TK120303_NMyc_cyto3_step07.1724.1724.2	1.1082	0.0489	2207.82	20	2220.0%	1	K.HLDFESQQVHTVVLEALNK.F
	TK120303_NMyc_cyto3_step12.3792.3792.3	1.6223	0.0451	3722.65	11	1360.0%	1	R.YEVVIQATDMAGQLGGLSGSTTVTIVVTDVNDNPPR.F
*	TK120303_NMyc_cyto3_step11.2595.2595.2	1.8883	0.3088	3099.21	4	1790.0%	1	R.QEQDVFLLPILVVDSGPPTLSSTGTLTIR.I
UTR5H_HUMAN67.2%242.5%444510047.4(P17752) Tryptophan 5-monooxygenase (EC 1.14.16.4) (Tryptophan 5-hydroxylase) 
*	TK120303_NMyc_cyto3_step02.2631.2631.1	1.5286	0.1715	1372.65	1	5000.0%	2	R.EQLNDIFHLLK.S
UG3BP_MOUSE67.2%338.4%465518295.6(P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) 
	TK120303_NMyc_cyto3_step11.1991.1991.2	1.9565	0.3022	2083.48	1	3820.0%	1	R.HPDSHQLFIGNLPHEVDK.S
*	TK120303_NMyc_cyto3_step05.1417.1417.3	1.2689	0.1188	1835.46	141	2660.0%	1	R.GPRPIREAGEPGDVEPR.R
	TK120303_NMyc_cyto3_step05.0749.0749.1	0.6917	0.0072	554.49	16	5000.0%	1	K.EIHR.K
UQ969H167.1%117.3%1231389310.2(Q969H1) Hypothetical protein FLJ30820 (Hypothetical protein FLJ30672) 
*	TK120303_NMyc_cyto3_step11.1213.1213.1	1.5721	0.1703	1048.58	5	5620.0%	1	K.KWFSGPGLR.H
USCF_HUMAN67.0%3326.7%273308996.2(P21583) Kit ligand precursor (C-kit ligand) (Stem cell factor) (SCF) (Mast cell growth factor) (MGF) 
	TK120303_NMyc_cyto3_step09.2996.2996.3	1.6805	0.0789	3549.88	1	1830.0%	1	K.YVPGMDVLPSHCWISEMVVQLSDSLTDLLDK.F
	TK120303_NMyc_cyto3_step01.1286.1286.1	1.8238	0.1145	754.47	1	8330.0%	1	K.LVANLPK.D
	TK120303_NMyc_cyto3_step04.3191.3191.3	1.9033	0.1375	3761.32	14	1320.0%	1	K.AKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWK.K
UQ96GE267.0%2214.5%255277078.8(Q96GE2) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step03.4288.4288.1	1.9093	0.074	1531.72	2	4230.0%	1	R.QVGVTEMLRAALLK.V
*	TK120303_NMyc_cyto3_step09.2607.2607.2	1.6898	0.0875	2224.9	7	2500.0%	1	R.VGQAVLDTLEGALQASDAAAPAR.F
USYN1_HUMAN67.0%113.1%705739549.8(P17600) Synapsin I (Brain protein 4.1) 
*	TK120303_NMyc_cyto3_step06.3485.3485.2	1.9303	0.308	2077.56	4	3100.0%	1	R.QTSVSGPAPPKASGAPPGGQQR.Q
UTRHY_HUMAN67.0%222.2%18982472175.7(Q07283) Trichohyalin 
*	TK120303_NMyc_cyto3_step07.2065.2065.3	1.3632	0.0339	3458.92	45	1550.0%	1	-.MSPLLRSICDITEIFNQYVSHDCDGAALTK.K
*	TK120303_NMyc_cyto3_step01.2240.2240.1	1.5602	0.1574	1535.68	2	4090.0%	1	R.VDFNEFLLFIFK.V
UPER1_MOUSE66.9%71110.8%12911364036.1(O35973) Period circadian protein 1 (Circadian pacemaker protein Rigui) (mPER) (M-Rigui) 
	TK120303_NMyc_cyto3_step11.3794.3794.3	2.4083	0.2543	3972.85	29	1120.0%	1	K.EPVVGGTLSPLALANKAESVVSVTSQCSFSSTIVHVGDK.K
*	TK120303_NMyc_cyto3_step05.3204.3204.3	2.1093	0.0344	4618.91	8	1000.0%	2	R.CSSPLQLNLLQLEESPRTEGGAAAGGPGSSAGPLPPSEETAEPEAR.L
*	TK120303_NMyc_cyto3_step04.3555.3555.1	1.2376	0.0405	1080.7	41	4000.0%	2	K.QRAGPVPVGAK.K
*	TK120303_NMyc_cyto3_step01.3570.3570.2	1.5763	0.0705	3146.83	14	1610.0%	1	R.LVEVTESSNQDALSGSSDLLELLLQEDSR.S
	TK120303_NMyc_cyto3_step06.2193.2193.2	1.6125	0.0073	1694.41	15	3570.0%	1	K.ILQLAGQPFDHSPIR.F
UQ9H8C566.9%3910.2%197223058.3(Q9H8C5) Hypothetical protein FLJ13765 
*	TK120303_NMyc_cyto3_step07.3181.3181.2	2.2617	0.1736	2413.55	4	3160.0%	3	-.MRVHCAIIPSDMLHISTNCR.T
UQ8R1G666.8%247.7%349377038.7(Q8R1G6) Hypothetical 37.7 kDa protein 
*	TK120303_NMyc_cyto3_step10.3992.3992.2	1.8118	0.316	3032.27	1	2120.0%	2	R.VLLHSPGRPSSPRFSSLDLEEDSEVFK.M
UQ8WV1666.7%114.6%495556579.1(Q8WV16) Hypothetical protein 
*	TK120303_NMyc_cyto3_step08.3246.3246.2	1.7025	0.4197	2511.12	2	2730.0%	1	R.SMDPSALASDRFNLILADTNSDR.L
UQ9NUW966.6%245.0%240279585.7(Q9NUW9) Hypothetical protein FLJ11088 
*	TK120303_NMyc_cyto3_step10.3173.3173.1	1.9237	0.0518	1418.67	5	4090.0%	2	K.QYISAIEKQAHK.C
UQ8VFD666.5%61423.5%310346357.9(Q8VFD6) Olfactory receptor MOR275-2 
*	TK120303_NMyc_cyto3_step11.3306.3306.3	2.0407	0.1789	4501.38	5	1280.0%	2	K.ISAAACGMQMFLYLSIGGSEFLLLAAMSYDRYVAICHPLR.Y
*	TK120303_NMyc_cyto3_step11.3718.3718.3	1.9773	0.2625	3390.66	53	1330.0%	3	K.ISAAACGMQMFLYLSIGGSEFLLLAAMSYDR.Y
*	TK120303_NMyc_cyto3_step02.3391.3391.3	2.5537	0.3776	3772.89	4	1640.0%	1	R.ICLLLLSVCWLLGSLDGFMLTPVTMTFPICGSR.E
UB3A2_MOUSE66.4%6811.3%12371368146.1(P13808) Anion exchange protein 2 (Non-erythroid band 3-like protein) (B3RP) 
	TK120303_NMyc_cyto3_step11.3866.3866.3	2.0516	0.1443	3344.3	5	1530.0%	1	K.GSGFHLDLLLIVAMGGICALFGLPWLAAATVR.S
	TK120303_NMyc_cyto3_step07.2512.2512.3	1.767	0.0222	3270.32	2	1790.0%	1	R.RVIGDFGVPIAILIMVLVDYSIEDTYTQK.L
*	TK120303_NMyc_cyto3_step12.2176.2176.3	1.7062	0.1179	4384.53	26	1100.0%	2	R.NISAGSLGSLLGHHHAQGTESDPHVTEPLIGGVPETRLEVDR.E
	TK120303_NMyc_cyto3_step03.2228.2228.1	1.7252	0.1346	1353.72	1	4440.0%	1	R.RYPHYLSDFR.D
	TK120303_NMyc_cyto3_step05.2033.2033.3	1.8468	0.0069	3089.47	64	1630.0%	1	R.QIPLAVLFGIFLYMGVTSLNGIQFYER.L
UM2B2_HUMAN66.4%221.9%10091139877.4(Q9Y2E5) Epididymis-specific alpha-mannosidase precursor (EC 3.2.1.24) (Mannosidase alpha class 2B member 2) 
*	TK120303_NMyc_cyto3_step06.2300.2300.1	1.9313	0.2068	1432.73	6	4090.0%	1	R.LWWDGVASDQQK.Y
*	TK120303_NMyc_cyto3_step03.1158.1158.1	1.4475	0.1643	784.54	37	5000.0%	1	R.RTSHAGR.Y
UQ9H5R366.4%4169.1%232267037.3(Q9H5R3) Hypothetical protein FLJ23147 
*	TK120303_NMyc_cyto3_step04.3600.3600.2	2.2668	0.0539	2481.63	2	3250.0%	4	R.LANFCIISRDGVSPCWPGWSR.T
UQ8VE8466.4%5175.5%487549625.1(Q8VE84) Hypothetical 55.0 kDa protein (Fragment) 
*	TK120303_NMyc_cyto3_step05.3400.3400.2	2.1054	0.2048	2868.94	1	2500.0%	4	K.LPIPGSIDSQNPDDHSAGTGPKNDLYR.T
UQ8WXX066.3%22527.3%40244611476.0(Q8WXX0) Ciliary dynein heavy chain 7 
	TK120303_NMyc_cyto3_step02.0308.0308.1	0.7079	0.1555	1196.88	72	2220.0%	1	K.RPSYVAPLYK.T
*	TK120303_NMyc_cyto3_step03.2666.2666.2	1.2946	0.0318	2237.65	1	3330.0%	1	K.VNPDQVEADIGNYWRGLYK.L
*	TK120303_NMyc_cyto3_step07.2569.2569.3	1.9793	0.053	2958.19	15	1600.0%	1	R.MVVFVDDVNMPAREVYGAQPPIELLR.Q
*	TK120303_NMyc_cyto3_step05.2740.2740.2	1.5339	0.016	2110.72	1	3330.0%	1	R.SQLHVVLAMSPIGDAFRNR.L
	TK120303_NMyc_cyto3_step12.4408.4408.2	1.3418	0.1415	2709.42	43	1670.0%	1	R.LFFPRFFFLSNDELLEILSETK.D
*	TK120303_NMyc_cyto3_step09.3024.3024.3	1.5376	0.0399	3903.37	5	1450.0%	1	R.ILTWHLEICYKFPDEFLDLTTQIVNGTMTLYK.E
	TK120303_NMyc_cyto3_step09.1483.1483.2	1.4016	0.0523	1604.77	67	3330.0%	1	K.FFNPELVENSDYK.F
*	TK120303_NMyc_cyto3_step12.3099.3099.3	1.9818	0.0525	4582.05	3	1250.0%	4	K.MITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIK.T
*	TK120303_NMyc_cyto3_step10.2109.2109.2	1.1505	0.0648	1999.04	2	3000.0%	1	K.MITEWDAVEFVIHSYR.E
*	TK120303_NMyc_cyto3_step09.3151.3151.3	2.4456	0.2224	4251.86	37	950.0%	2	R.ALPQLSMVSTKPHWQQAAPSFHLSVKQDDESPEPFSVK.N
*	TK120303_NMyc_cyto3_step06.3351.3351.2	1.8996	0.1847	2909.93	3	2200.0%	4	K.EESFLEDVSNLLNAGEIPNLFALDEK.Q
*	TK120303_NMyc_cyto3_step04.2803.2803.2	1.8964	0.3056	2709.7	3	2270.0%	2	R.DHLNAMNPTMLAVLDLWHTNFKK.L
	TK120303_NMyc_cyto3_step11.4021.4021.3	2.2634	0.0887	2657.84	111	1670.0%	2	R.RGVLSTTGHSTNFVIAMTLPSDQPK.E
UPDL1_MOUSE66.3%3313.8%326357176.8(O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) 
	TK120303_NMyc_cyto3_step06.2547.2547.2	2.0301	0.2221	2104.26	1	3060.0%	1	K.MNLASEPQEVLHIGSAHNR.S
*	TK120303_NMyc_cyto3_step05.1655.1655.3	1.8512	0.1273	2678.48	1	2200.0%	1	K.TSASGEEANSRPVVQPHPSGSLIIDK.D
UQ9DBK866.3%8812.2%9021003246.6(Q9DBK8) Repeat family 3 gene 
	TK120303_NMyc_cyto3_step05.1156.1156.1	0.7743	0.1426	950.31	42	5000.0%	1	K.NVIFVIDK.S
	TK120303_NMyc_cyto3_step02.4392.4392.3	1.7957	0.0959	2880.02	9	2080.0%	1	K.FEVSVNVAPGSKITFELIYQELLQR.R
	TK120303_NMyc_cyto3_step09.3601.3601.2	2.1759	0.2541	2093.08	1	3160.0%	1	R.AHGGTNINNAVLLAVELLDR.S
	TK120303_NMyc_cyto3_step04.1498.1498.1	1.0788	0.0263	1017.51	2	5620.0%	1	R.FAHTVVTSR.V
	TK120303_NMyc_cyto3_step06.1637.1637.1	1.4147	0.0808	1452.7	5	3750.0%	1	R.TVKVQGVDYLATR.E
	TK120303_NMyc_cyto3_step11.1155.1155.1	1.2885	0.0205	843.51	1	7000.0%	1	K.FQHHFK.G
	TK120303_NMyc_cyto3_step07.1832.1832.2	1.5006	0.0843	1742.65	5	3850.0%	1	R.LWALLTIQQQLEQR.I
	TK120303_NMyc_cyto3_step12.1202.1202.2	1.422	0.1378	1798.41	4	3210.0%	1	R.DIVWEPPVEPDNTKR.T
UQ91X5566.2%114.8%208228954.4(Q91X55) Similar to salivary protein 2 
*	TK120303_NMyc_cyto3_step02.1615.1615.1	1.7798	0.1209	1168.7	2	6110.0%	1	K.EEDDTSNQTK.V
UNB2M_HUMAN66.1%1123.7%97112719.2(O43676) NADH-ubiquinone oxidoreductase B12 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B12) (CI-B12) 
*	TK120303_NMyc_cyto3_step08.2995.2995.2	1.8903	0.3076	2581.7	1	2270.0%	1	K.WGFAAFVVAVGAEYYLESLNKDK.K
UO8834966.0%132113.3%17131869076.1(O88349) Latent TGF beta binding protein 
	TK120303_NMyc_cyto3_step09.3099.3099.3	1.5892	0.0106	3485.76	8	1530.0%	1	K.GNCQNSCQKGNTTTLISENGHAADTLTATNFR.V
*	TK120303_NMyc_cyto3_step06.3320.3320.3	2.348	0.2768	4214.27	3	1250.0%	1	R.VNNTFCQDINECQLQGVCPNGECLNTMGSYRCSCK.M
*	TK120303_NMyc_cyto3_step02.2979.2979.3	1.9114	0.175	3486.58	15	1440.0%	1	K.GKACEITAAQDTMPPAFGGQNPGSSWAPLEQAAK.H
*	TK120303_NMyc_cyto3_step10.3457.3457.2	1.8671	0.0764	3031.33	15	1730.0%	1	R.CSCKMGFGPDPTFSSCVPDPPVISEEK.G
*	TK120303_NMyc_cyto3_step06.4216.4216.2	1.6297	0.137	2199.4	33	2650.0%	1	R.CINTAGAFRCEYCDSGYR.M
*	TK120303_NMyc_cyto3_step06.2124.2124.3	2.1768	0.2426	2852.83	6	1900.0%	1	K.STHPPPLPAKEEPVEALTSSWEHGPR.G
*	TK120303_NMyc_cyto3_step03.4312.4312.3	1.502	0.0516	2723.33	42	1880.0%	1	K.DQCEDIDECEHHHLCSHGQCR.N
*	TK120303_NMyc_cyto3_step06.0450.0450.1	0.683	0.023	1220.25	1	2730.0%	1	K.AGAQTAVTRFAK.H
*	TK120303_NMyc_cyto3_step03.3448.3448.3	2.1026	0.0188	2936.29	1	2210.0%	2	R.LEPGQPQLSPGVSTIHLHPQFPVVVEK.T
UQ9HBL266.0%2214.0%242278668.5(Q9HBL2) HT018 
*	TK120303_NMyc_cyto3_step09.2516.2516.2	1.1581	0.0603	2158.05	135	1940.0%	1	K.GTNVPIPLFCCVPLAQRSK.A
*	TK120303_NMyc_cyto3_step04.2728.2728.2	2.2382	0.1695	1994.46	1	3930.0%	1	K.QYIWWSLCLLLFPVR.S
UAD07_HUMAN66.0%393.4%754855836.6(Q9H2U9) ADAM 7 precursor (A disintegrin and metalloproteinase domain 7) (Sperm maturation-related glycoprotein GP-83) 
*	TK120303_NMyc_cyto3_step03.3688.3688.3	2.6501	0.3076	3025.02	3	1900.0%	3	K.WLYSHVQGISYPGGMCLPYYSTSIIK.D
UO7593266.0%337.6%669694929.7(O75932) SYT interacting protein SIP 
*	TK120303_NMyc_cyto3_step01.3250.3250.1	1.533	0.0577	1243.86	4	5000.0%	1	K.AAIAQLNGKEVK.G
*	TK120303_NMyc_cyto3_step11.3710.3710.3	1.9232	0.1187	3956.65	21	1120.0%	1	R.GQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTR.L
*	TK120303_NMyc_cyto3_step12.1754.1754.3	2.6112	0.3094	3694.27	2	1670.0%	1	R.GQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYER.T
UQ9UPV166.0%5724.6%342387706.6(Q9UPV1) Hypothetical protein KIAA1051 (MEF3 like 1) (Paternally expressed gene 10 ORF1) (Fragment) 
*	TK120303_NMyc_cyto3_step02.1996.1996.2	1.236	0.044	2416.42	140	1500.0%	1	R.KLNLCLYCGTGGHYADNCPAK.A
*	TK120303_NMyc_cyto3_step07.3329.3329.2	2.1883	0.1341	2030.24	2	3750.0%	2	R.EQVEPTPEDEDDDIELR.G
*	TK120303_NMyc_cyto3_step11.2559.2559.2	1.1724	0.0796	2427.62	2	2500.0%	1	K.LERSHYLMHNYPAFMMEMK.H
*	TK120303_NMyc_cyto3_step01.2984.2984.2	1.0964	0.0222	2838.17	41	1540.0%	1	R.SPPRALVLPHIASHHQVDPTEPVGGAR.M
UQ91XW265.9%776.7%25562921766.1(Q91XW2) Putative ubiquitin-specific protease 
*	TK120303_NMyc_cyto3_step12.3035.3035.3	1.8727	0.1138	3995.79	19	1400.0%	1	K.FHVYNGARPCESVSSSVQFPEDELFACSPDLHSPK.G
*	TK120303_NMyc_cyto3_step09.2763.2763.3	1.7596	0.0194	3276.5	4	1790.0%	1	R.HDLISQLQHNHALVTLVAENLAAYMNSIR.L
*	TK120303_NMyc_cyto3_step06.3577.3577.2	2.2488	0.1379	2481.8	4	2620.0%	1	R.NSILAIDSIWSDTDDDIFKGEK.Q
*	TK120303_NMyc_cyto3_step05.3675.3675.3	1.625	0.0054	3137.23	24	1540.0%	1	K.ACDLYPEEDPDDQDALDEHVSHAPQDR.T
*	TK120303_NMyc_cyto3_step07.2236.2236.3	1.846	0.0895	2454.34	346	1750.0%	1	R.EQHDALEFFNSLVDSLDEAFK.A
*	TK120303_NMyc_cyto3_step08.2008.2008.3	1.8709	0.1319	2757.83	1	2190.0%	1	R.MNVNVAHTKIELFIGGELVASEDDR.K
*	TK120303_NMyc_cyto3_step01.2204.2204.1	1.4516	0.0255	1306.88	1	5500.0%	1	K.ELLSFQSPEKK.Y
UQ9NVH965.9%8507.1%493572987.1(Q9NVH9) Hypothetical protein FLJ10724 
*	TK120303_NMyc_cyto3_step04.3594.3594.2	1.9714	0.0161	2740.65	4	2500.0%	7	R.EHEEELDQEFELETDTLFGGLKK.D
*	TK120303_NMyc_cyto3_step10.1542.1542.1	1.5579	0.1609	1232.36	14	4550.0%	1	K.ASLCVLALGLGR.L
UO0037065.9%4103.5%12751490119.7(O00370) Putative p150 
*	TK120303_NMyc_cyto3_step10.2762.2762.2	2.242	0.1395	2249.18	2	3060.0%	3	K.DTQELNSALHQTDLIDIYR.T
*	TK120303_NMyc_cyto3_step02.4228.4228.2	1.4874	0.0725	3111.0	2	2000.0%	1	R.MFIAALFTIAKTWNQPNCPTMIDWIK.K
UQ9UI9265.9%4415.6%629693989.3(Q9UI92) Putative WHSC1 protein 
	TK120303_NMyc_cyto3_step08.3002.3002.2	2.2476	0.1389	2371.49	1	3610.0%	1	R.QYHVQFFGDAPERAWIFEK.S
	TK120303_NMyc_cyto3_step11.2979.2979.2	1.237	0.0571	2352.52	6	2000.0%	1	R.AQWEMGIVQAEEAASMSVEER.K
	TK120303_NMyc_cyto3_step08.3270.3270.2	1.287	0.0493	2530.48	1	2380.0%	1	K.HRDEVVAEHPDASGEEIEELLR.S
	TK120303_NMyc_cyto3_step09.3685.3685.3	1.4362	0.0992	3948.41	10	1290.0%	1	K.TYMNGKPLFESSICGDSAADVSQSEENGQKPENKAR.R
UQ9ERN665.8%351137.8%49675649086.1(Q9ERN6) Cardiac Ca2+ release channel 
	TK120303_NMyc_cyto3_step10.3582.3582.2	1.1972	0.04	2813.54	1	2400.0%	1	K.LIPHNPNAGLSDLMTNPVPVPEVQEK.F
	TK120303_NMyc_cyto3_step08.2668.2668.2	1.5056	0.206	1371.31	56	3500.0%	1	R.MAPLYNLPRHR.A
	TK120303_NMyc_cyto3_step02.2741.2741.1	1.3597	0.0515	839.56	83	5830.0%	1	K.REGGQYK.L
	TK120303_NMyc_cyto3_step11.1205.1205.1	1.2412	0.0337	1421.73	2	4550.0%	1	R.QGWTYGIQQDVK.N
	TK120303_NMyc_cyto3_step01.1834.1834.1	1.2759	0.1028	980.02	3	6430.0%	7	K.RAVVACFR.M
	TK120303_NMyc_cyto3_step04.3934.3934.3	1.7903	0.0942	3107.53	9	1670.0%	1	R.MLALFVAFAINFILLFYKVSTSSVVEGK.E
	TK120303_NMyc_cyto3_step08.2303.2303.2	1.4306	0.0305	2146.28	1	2940.0%	1	R.LPQFLQVPSNHEHIEVTR.I
	TK120303_NMyc_cyto3_step04.1319.1319.1	0.7342	0.071	1394.3	141	3180.0%	1	R.DIIRSNIHLQGK.L
	TK120303_NMyc_cyto3_step05.2036.2036.3	1.6773	0.0137	3166.96	146	1570.0%	2	R.FHEPAKDIGFNVAVLLTNLSEHMPNDTR.L
	TK120303_NMyc_cyto3_step10.3473.3473.3	2.5744	0.0809	3008.24	2	2130.0%	5	R.ALGMHETVMEVMVNVLGGGESKEITFPK.M
	TK120303_NMyc_cyto3_step07.3116.3116.2	2.2402	0.1057	2339.02	14	2750.0%	1	R.TQTGNNTTVNIIISTVDYLLR.V
*	TK120303_NMyc_cyto3_step12.1643.1643.3	2.0501	0.1044	4055.25	1	1540.0%	1	R.AGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETK.S
*	TK120303_NMyc_cyto3_step02.3027.3027.2	1.7657	0.1409	2382.84	207	1750.0%	1	R.LFAGTEHHASLIDSLLHTVYR.L
	TK120303_NMyc_cyto3_step03.4380.4380.2	1.2884	0.1167	1739.74	1	4290.0%	1	R.QFIFDVVNEGGEKEK.M
	TK120303_NMyc_cyto3_step05.2929.2929.2	1.9394	0.1229	2186.29	1	3610.0%	2	K.DSSLSAVLNSIDVKYQMWK.L
*	TK120303_NMyc_cyto3_step02.3428.3428.2	1.5448	0.1067	2708.36	23	1740.0%	1	K.VVEPDMSAGFCPDHKAAMVLFLDR.V
	TK120303_NMyc_cyto3_step12.3292.3292.2	1.3976	0.0465	2670.4	77	1900.0%	1	K.NPVPQCPPRLHVQFLSHVLWSR.M
	TK120303_NMyc_cyto3_step04.2664.2664.3	2.0921	0.1464	3277.19	72	1380.0%	1	R.INGQPVQGMFENFNIDGLFFPVVSFSAGIK.V
	TK120303_NMyc_cyto3_step04.4347.4347.2	1.2517	0.0229	2634.12	8	1820.0%	1	R.FAVFCNGESVEENANVVVRLLIR.R
UZO2_MOUSE65.8%352.1%11671316166.8(Q9Z0U1) Tight junction protein ZO-2 (Zonula occludens 2 protein) (Zona occludens 2 protein) (Tight junction protein 2) 
	TK120303_NMyc_cyto3_step01.0328.0328.1	0.8961	0.0064	1012.21	304	3120.0%	1	R.VVDTLYDGK.L
*	TK120303_NMyc_cyto3_step07.2632.2632.2	2.2299	0.2044	1899.41	1	4290.0%	2	-.MEEVIWEQYTVTLQK.D
UO9534765.7%351.5%11971357808.6(O95347) Chromosome-associated protein-E 
*	TK120303_NMyc_cyto3_step01.2184.2184.1	1.8954	0.0482	1154.82	2	6880.0%	1	K.YEVLENKMK.N
*	TK120303_NMyc_cyto3_step06.1652.1652.1	1.4809	0.0799	1080.56	201	3750.0%	2	K.KNLACEESK.R
UQ8VBV065.7%465.3%12541416406.5(Q8VBV0) Protein tyrosine phosphatase, receptor type, delta A 
	TK120303_NMyc_cyto3_step02.3203.3203.3	1.7153	0.0148	3591.88	1	1880.0%	1	K.TCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLER.I
*	TK120303_NMyc_cyto3_step01.3148.3148.2	1.5061	0.0481	2163.54	15	2250.0%	1	-.MPGGSVNITCVAVGSPMPYVK.W
*	TK120303_NMyc_cyto3_step02.1635.1635.1	1.6704	0.1514	1418.71	4	4550.0%	2	R.SDTIASYELVYR.D
UQ6063865.6%559.2%10601148897.7(Q60638) Microtubule-associated protein 4 (Fragment) 
*	TK120303_NMyc_cyto3_step04.3634.3634.3	1.5834	0.033	2420.91	6	2390.0%	1	K.IHAPLFSHISGIATEEGADLKSK.K
*	TK120303_NMyc_cyto3_step01.2588.2588.1	1.5383	0.1669	1260.54	5	5000.0%	1	R.KEIASPPCVEK.L
*	TK120303_NMyc_cyto3_step10.1936.1936.3	1.9	0.2757	3412.08	23	1290.0%	1	K.DGVPGQERPKAPPAAMPSTSTEGVTGTSTEAQEK.F
*	TK120303_NMyc_cyto3_step06.2677.2677.3	1.8012	0.0362	3000.75	216	1250.0%	1	R.SPSGLMGKSISLEAVGSAGCEMLPCPIPR.S
*	TK120303_NMyc_cyto3_step04.3583.3583.2	1.4148	0.0471	2351.98	8	2390.0%	1	K.APPAAMPSTSTEGVTGTSTEAQEK.F
UFOH1_HUMAN65.5%5711.9%750843317.0(Q04609) Glutamate carboxypeptidase II (EC 3.4.17.21) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Pteroylpoly-gamma-glutamate carboxypeptidase) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Folate hydrolase 1) (Prostate-specific membrane antigen) (PSMA) (PSM) 
	TK120303_NMyc_cyto3_step04.3699.3699.2	1.0942	0.0314	2976.17	3	1850.0%	1	R.DSWVFGGIDPQSGAAVVHEIVRSFGTLK.K
	TK120303_NMyc_cyto3_step04.2095.2095.3	1.9999	0.1114	2807.71	7	1980.0%	1	R.WLCAGALVLAGGFFLLGFLFGWFIK.S
	TK120303_NMyc_cyto3_step10.2289.2289.2	1.1583	0.0244	2653.81	85	1880.0%	1	R.GNILNLNGAGDPLTPGYPANEYAYR.R
	TK120303_NMyc_cyto3_step01.3002.3002.1	1.413	0.2349	1252.87	5	5000.0%	2	R.HVIYAPSSHNK.Y
UOTOR_MOUSE65.5%41029.7%128143284.8(Q9JIE3) Otoraplin precursor (Melanoma inhibitory activity-like protein) 
*	TK120303_NMyc_cyto3_step04.3654.3654.2	2.2407	0.1189	2341.14	2	3330.0%	3	R.ILILLLGGLVVLCAGHGVFMDK.L
*	TK120303_NMyc_cyto3_step04.2231.2231.2	1.625	0.0541	1929.32	27	2670.0%	1	K.KLCADEECVYTISLAR.A
UQ920N765.5%229.5%421466805.6(Q920N7) Synaptotagmin XII 
*	TK120303_NMyc_cyto3_step07.2001.2001.2	2.2516	0.1281	1634.43	2	4170.0%	1	R.IQRNAYSIFFDEK.F
*	TK120303_NMyc_cyto3_step12.3103.3103.3	1.6482	0.0231	3056.99	32	1630.0%	1	K.RDDPNPVFNEAMIFSVPAIVLQDLSLR.V
UQ6387065.5%161613.1%29442951146.3(Q63870) Type VII collagen 
*	TK120303_NMyc_cyto3_step08.2555.2555.2	2.2315	0.0971	2414.29	5	2120.0%	1	R.SGLDGKPGAPGPPGLHGASGKAGDPGR.D
*	TK120303_NMyc_cyto3_step07.2177.2177.2	1.3344	0.0163	2682.38	2	1800.0%	1	R.AVPGGTACHPFVYGGCGGNANRFGTR.E
*	TK120303_NMyc_cyto3_step01.3870.3870.2	1.7322	0.0317	2501.27	2	2120.0%	1	K.GERGFPGPEGPPGSPGLPGVPGSPGIK.G
*	TK120303_NMyc_cyto3_step02.4088.4088.3	1.3488	0.0336	4310.71	45	1060.0%	1	R.LVSALGPLGPQAAQVGLLTYSHRPSPLFPLNSSHDLGIILR.K
*	TK120303_NMyc_cyto3_step06.2061.2061.2	1.3517	0.1155	1792.53	27	2940.0%	1	R.VRTHVAGVDGAPASVVVR.T
*	TK120303_NMyc_cyto3_step05.2232.2232.3	1.8805	0.0697	3236.26	23	1470.0%	1	K.GERGHPGPVGPQGLPGAAGHPGVEGPEGPPGPTGR.R
*	TK120303_NMyc_cyto3_step05.1369.1369.2	1.345	0.1099	1218.32	1	6500.0%	1	R.YLLASNAPGRR.Q
*	TK120303_NMyc_cyto3_step09.2249.2249.2	1.2292	0.0048	1790.5	48	2630.0%	1	R.GPPGESVVGAPGAPGTPGER.G
*	TK120303_NMyc_cyto3_step10.1866.1866.1	1.7244	0.0865	1557.67	8	4060.0%	1	K.GDMGEPGLPGQSGAPGK.E
*	TK120303_NMyc_cyto3_step05.3028.3028.2	1.4255	0.0381	2664.25	280	1250.0%	1	K.SLLVSGDATVAEIDGLEPDTEYIVR.V
*	TK120303_NMyc_cyto3_step11.1286.1286.1	1.4303	0.014	1569.7	17	3210.0%	1	R.VGAQEGDASILTIHR.D
*	TK120303_NMyc_cyto3_step03.1484.1484.3	1.7979	0.0191	3381.33	4	1770.0%	1	R.AVSDLAVALCQAAVTIEPQTGPCAVHCPKGQK.G
*	TK120303_NMyc_cyto3_step01.1186.1186.1	0.9942	0.1066	1028.64	9	4500.0%	1	K.GEKGDSGAPGR.E
*	TK120303_NMyc_cyto3_step04.3384.3384.2	1.0683	0.0106	1791.52	53	2330.0%	1	R.QQVPGVMVLLVDEPLR.G
*	TK120303_NMyc_cyto3_step03.0915.0915.2	0.8746	0.0063	3160.11	127	880.0%	1	R.GAPGNPGLQGPPGLPGQVGPPGQGFPGVPGITGPK.G
*	TK120303_NMyc_cyto3_step02.3257.3257.3	2.2576	0.0438	3275.42	14	1550.0%	1	R.TASSVEQTLHPIILSPTSILLSWNLVPEAR.G
UP2BA_HUMAN65.5%243.8%521586885.9(Q08209) Serine/threonine protein phosphatase 2B catalytic subunit, alpha isoform (EC 3.1.3.16) (Calmodulin-dependent calcineurin A subunit, alpha isoform) (CAM-PRP catalytic subunit) 
*	TK120303_NMyc_cyto3_step05.2813.2813.2	2.2323	0.1664	2000.31	7	3160.0%	2	K.ALTSETNGTDSNGSNSSNIQ.-
UARH6_HUMAN65.5%82013.9%776874996.0(Q15052) Rho guanine nucleotide exchange factor 6 (PAK-interacting exchange factor alpha) (Alpha-Pix) (COOL-2) 
*	TK120303_NMyc_cyto3_step01.2728.2728.3	1.3007	0.0539	3615.13	11	1480.0%	1	K.GCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNK.A
*	TK120303_NMyc_cyto3_step02.3653.3653.2	1.003	0.0173	2835.54	16	1740.0%	1	K.NLGNVIFMSQVMVQYGACEEKEER.Y
*	TK120303_NMyc_cyto3_step12.4435.4435.2	1.0968	0.0189	2471.04	4	2250.0%	1	R.KQLELQILSEPIQAWEGEDIK.N
*	TK120303_NMyc_cyto3_step05.3369.3369.2	1.9952	0.1432	2982.36	1	2590.0%	4	R.SSSLSAANTSQTNPQGAVSSTVSGLQRQSK.T
UQ9CVJ765.5%2411.3%177205559.6(Q9CVJ7) 1810048F22Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step07.3059.3059.2	2.2444	0.0167	2372.58	1	3680.0%	2	K.SLYKNVMLETFSNLFSVGYR.V
UQ9BU7965.5%2244.1%118133918.2(Q9BU79) Hypothetical protein 
*	TK120303_NMyc_cyto3_step05.4253.4253.2	2.2374	0.0762	2868.21	1	2400.0%	1	-.MEDFATRTYGTSGLDNRPLFGETSAK.D
*	TK120303_NMyc_cyto3_step06.4237.4237.3	1.9659	0.0216	3236.87	19	1700.0%	1	R.KLIYYIIFSIIMLCICANLYFHDVGR.-
UQ9CZU465.5%5525.6%437481878.8(Q9CZU4) 2610524P08Rik protein 
*	TK120303_NMyc_cyto3_step02.3697.3697.2	2.2584	9.0E-4	2519.39	2	2950.0%	1	R.SSTHCPGPETEGPNAHSVRNPQR.I
	TK120303_NMyc_cyto3_step03.2726.2726.3	1.5144	0.136	3424.72	9	1470.0%	1	R.HHLERSLLEDPWTSMESADLVVVLVDVSDK.W
	TK120303_NMyc_cyto3_step01.3264.3264.1	0.9702	0.0675	1404.79	38	2690.0%	1	R.VLRVVLLGAPNAGK.S
	TK120303_NMyc_cyto3_step04.0533.0533.1	0.7515	0.0141	892.82	23	3330.0%	1	K.VDCLKQK.S
	TK120303_NMyc_cyto3_step01.3050.3050.3	1.6548	0.0454	4338.86	7	1280.0%	1	K.LLEYLPEEVPYGVQQKTVIWEEGPSGELVIQQNLLVPK.E
UQ9BY9265.4%4611.8%791852087.2(Q9BY92) Hypothetical protein KIAA1668 (Fragment) 
*	TK120303_NMyc_cyto3_step01.2454.2454.3	1.584	0.0914	4040.61	7	1190.0%	1	R.GSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVK.S
*	TK120303_NMyc_cyto3_step12.3388.3388.2	1.5099	0.0292	2140.55	36	2250.0%	2	R.VPGKLQELASPPAGRPTPAPR.K
*	TK120303_NMyc_cyto3_step02.3123.3123.3	1.7458	0.0498	3369.45	22	1500.0%	1	R.SSLQQENLVEQAGSSSLVNGRLHELPVPKPR.G
UQ99KR665.4%244.8%376420304.8(Q99KR6) Hypothetical 42.0 kDa protein (Phafin 1) 
*	TK120303_NMyc_cyto3_step05.2553.2553.2	2.1999	0.2094	1911.81	2	3240.0%	2	R.ASLSDLSSLEEVEGMSVR.Q
URPA5_MOUSE65.3%7376.1%346390765.4(P52432) DNA-directed RNA polymerase I 40 kDa polypeptide (EC 2.7.7.6) (RPA40) 
	TK120303_NMyc_cyto3_step12.1116.1116.2	0.7442	0.027	934.18	11	5830.0%	1	R.LQVRCTR.N
	TK120303_NMyc_cyto3_step10.1744.1744.2	1.9181	0.1482	1553.18	2	3460.0%	6	K.DHAKFSPVATASYR.L
USHBG_MOUSE65.3%111019.4%403448166.6(P97497) Sex hormone-binding globulin precursor (SHBG) (Sex steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) 
*	TK120303_NMyc_cyto3_step10.2608.2608.2	2.1989	0.2243	2268.09	1	3420.0%	1	R.LLLLLLLLMPPPTHQGRALR.H
*	TK120303_NMyc_cyto3_step06.3348.3348.2	1.8327	0.2704	2119.28	6	2940.0%	10	K.EMLCLRQISASLADHSQR.S
UERR2_HUMAN65.2%114.6%500556198.2(O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor, beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2) 
*	TK120303_NMyc_cyto3_step02.3593.3593.2	1.9776	0.2952	2500.24	1	2500.0%	1	R.LDSESSPYLSLQISPPAKKPLTK.I
UQ8R1C065.2%3312.9%628686557.1(Q8R1C0) Similar to potassium voltage-gated channel, Shaw-related subfamily, member 4 
*	TK120303_NMyc_cyto3_step02.1872.1872.1	1.087	0.0876	1150.54	21	3890.0%	1	R.VGNITSVRFR.R
*	TK120303_NMyc_cyto3_step11.3121.3121.2	2.2058	0.203	2909.01	5	2070.0%	1	R.DAEEALDIFESPDGGGGGAGPGDEAGDDER.E
*	TK120303_NMyc_cyto3_step11.1902.1902.3	2.0585	0.4139	3817.85	1	1690.0%	1	R.LAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDR.H
UQ96C7465.2%2216.5%230261668.0(Q96C74) AKAP-associated sperm protein 
*	TK120303_NMyc_cyto3_step09.2755.2755.2	1.8401	0.3049	2669.35	1	3040.0%	1	R.LDSDVSPLETESYLASLKENIDAR.K
*	TK120303_NMyc_cyto3_step02.4056.4056.2	0.8505	0.0274	1604.61	13	2310.0%	1	R.KNGMIGLSDFFFPK.R
UP7026465.1%118.4%178190377.6(P70264) Proton-dependent peptide transporter (Fragment) 
*	TK120303_NMyc_cyto3_step12.2787.2787.2	1.8501	0.3015	1728.5	4	3930.0%	1	K.TAXPVXFHLLFGXQR.G
UTHYG_MOUSE65.1%10125.6%27663045155.5(O08710) Thyroglobulin precursor 
*	TK120303_NMyc_cyto3_step11.1065.1065.1	1.4449	0.1579	1141.73	4	5500.0%	1	K.KGYESTAAGQK.S
*	TK120303_NMyc_cyto3_step06.1471.1471.1	0.9028	0.0521	634.48	140	7000.0%	1	R.VTTLAK.L
*	TK120303_NMyc_cyto3_step08.2211.2211.3	2.4057	0.2912	2978.71	1	2190.0%	2	R.ACQRPQLWQTMQTQAHFQLLLPPGK.M
*	TK120303_NMyc_cyto3_step12.1106.1106.2	1.3662	0.0033	1699.71	16	3330.0%	1	R.LAPVSGVRSDTSCPPR.I
	TK120303_NMyc_cyto3_step05.1715.1715.1	0.9255	0.0425	446.34	2	8330.0%	1	R.QGLK.Q
*	TK120303_NMyc_cyto3_step01.4496.4496.1	1.184	0.0045	1146.94	16	5000.0%	1	R.EAIRAVFPSR.E
*	TK120303_NMyc_cyto3_step10.2193.2193.2	1.3495	0.0261	1983.9	6	2890.0%	1	R.KALLMGGSALSPAAIISPER.A
*	TK120303_NMyc_cyto3_step09.2369.2369.2	1.1211	0.0075	2219.84	46	1750.0%	1	R.IDSFGQLQGGSQVIKVGTAWK.Q
*	TK120303_NMyc_cyto3_step09.4296.4296.3	1.6101	0.1693	4691.03	8	1100.0%	1	K.TAFYQALQNSLGGEDSDARILAAAVWYYSLEHSTDDYASFSR.A
UQ9CTH165.1%61022.1%317368277.9(Q9CTH1) 1110008L16Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step03.3716.3716.2	2.2164	0.1982	2337.64	3	3060.0%	2	K.DINDDHYSDKLLDILLYLR.N
*	TK120303_NMyc_cyto3_step05.3648.3648.2	1.2067	0.2414	2970.46	3	1800.0%	2	R.FESFVNSCPPFDIVIDGLNVAKMFPK.G
*	TK120303_NMyc_cyto3_step03.4274.4274.2	1.3651	0.0469	1948.52	92	2330.0%	1	R.TIEPIHLSPEEYEFLK.E
*	TK120303_NMyc_cyto3_step10.2117.2117.3	1.7083	0.014	2898.76	5	1980.0%	1	K.SGQCSGCGRTIEPIHLSPEEYEFLK.E
UQ9BRC165.1%114.4%275312295.5(Q9BRC1) Hypothetical protein 
*	TK120303_NMyc_cyto3_step02.1345.1345.1	1.8853	0.0496	1451.58	1	5450.0%	1	R.EEEEQVRAHAPR.G
UEPA7_MOUSE65.0%6611.1%9981118745.8(Q61772) Ephrin type-A receptor 7 precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor EHK-3) (EPH homology kinase-3) (Embryonic brain kinase) (EBK) (Developmental kinase 1) (MDK-1) 
	TK120303_NMyc_cyto3_step04.1207.1207.1	0.9527	0.1141	743.65	28	5830.0%	1	R.EIGPLSK.K
*	TK120303_NMyc_cyto3_step10.2768.2768.3	2.2307	0.093	4310.94	32	1150.0%	1	K.TPLGTCSRPLSPLLDQSTPDFTAFCSVGEWLQAIKMER.Y
	TK120303_NMyc_cyto3_step02.3183.3183.2	1.7667	0.3306	2478.3	3	2620.0%	1	R.GKPVMIVIEFMENGALDAFLRK.H
*	TK120303_NMyc_cyto3_step07.3280.3280.2	1.0668	0.0353	2584.45	2	2380.0%	1	R.SVQLSWQEPEHPNGVITEYEIK.Y
	TK120303_NMyc_cyto3_step12.4470.4470.2	0.8883	0.0035	2353.33	20	2250.0%	1	R.GKPVMIVIEFMENGALDAFLR.K
	TK120303_NMyc_cyto3_step12.2424.2424.2	1.1959	0.0639	2455.72	72	1900.0%	1	K.IMSSIQTMRAQMLHLHGTGIQV.-
UQ8VI4165.0%227.5%549616727.0(Q8VI41) Zinc finger protein 352 
*	TK120303_NMyc_cyto3_step08.2826.2826.2	1.2216	0.1037	2556.44	3	2370.0%	1	K.YGCDEPGCTWSFFRLCDLNR.H
*	TK120303_NMyc_cyto3_step11.1994.1994.2	1.8221	0.3042	2308.47	2	2500.0%	1	K.GQENLLSGECSLSGYQTSGYR.C
UY711_HUMAN65.0%5119.1%623657206.1(O94819) Hypothetical protein KIAA0711 
*	TK120303_NMyc_cyto3_step09.1127.1127.1	1.0749	0.2045	808.57	21	5000.0%	1	R.LPEGAPAR.G
*	TK120303_NMyc_cyto3_step02.2327.2327.2	1.3594	0.0191	2228.58	15	2170.0%	1	R.EGEAGGDAGQGGGFEALGAPLDVR.G
*	TK120303_NMyc_cyto3_step06.1912.1912.3	2.8892	0.224	2658.25	2	2710.0%	3	R.VVERQWEAGSAGAASPEELASPEER.A
UO7506765.0%118.2%340383007.1(O75067) Hypothetical protein KIAA0479 (Fragment) 
*	TK120303_NMyc_cyto3_step12.3340.3340.2	2.218	0.1893	3122.27	3	2040.0%	1	R.EGPICTMTETTKTHVILLACGSFNPITK.G
UQ9Z1U165.0%2411.7%223249087.8(Q9Z1U1) Olfactory receptor G6 (Fragment) 
*	TK120303_NMyc_cyto3_step04.3414.3414.3	2.7905	0.0721	2922.71	4	2300.0%	2	-.YNLSLSDMGFSSTTIPKMLINLHAHK.R
UQ9D2K165.0%52514.4%270310307.8(Q9D2K1) 4921524P20Rik protein 
	TK120303_NMyc_cyto3_step09.3276.3276.3	2.623	0.1658	4510.0	1	1640.0%	5	K.MAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWER.A
UNCB2_MOUSE64.9%228.3%420503055.1(P81117) Nucleobindin 2 precursor (DNA-binding protein NEFA) 
*	TK120303_NMyc_cyto3_step11.2378.2378.2	1.4425	0.1853	2484.45	3	2370.0%	1	K.VYNPQNAEDDMIEMEEERLR.M
*	TK120303_NMyc_cyto3_step04.3231.3231.2	2.0746	0.2779	1466.33	4	4290.0%	1	K.LQQGIAPSGPAGELK.F
UTIE1_HUMAN64.9%111.1%11381250907.0(P35590) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112) 
*	TK120303_NMyc_cyto3_step09.1995.1995.2	2.0797	0.2765	1453.13	1	5450.0%	1	R.LVLADSGFWECR.V
UQ9ES3464.9%447.0%10511205088.2(Q9ES34) Ubiquitin-protein ligase UBE3B (Fragment) 
*	TK120303_NMyc_cyto3_step04.1914.1914.2	1.385	0.0742	1876.12	3	3670.0%	1	R.RAQLVLQHIPHVVPHK.N
*	TK120303_NMyc_cyto3_step07.2088.2088.2	2.0678	0.2754	1987.36	1	4380.0%	1	R.AQLVLQHIPHVVPHKNR.V
	TK120303_NMyc_cyto3_step02.4467.4467.2	1.2968	0.2282	2787.27	3	2080.0%	1	R.CVEVSDDQDTGDTLGSVLRGFFTIR.K
*	TK120303_NMyc_cyto3_step02.3088.3088.3	2.3656	0.1989	3705.11	11	1670.0%	1	K.HTVYYGGFHGSHRVIIWLWDILASDFTPEER.A
UQ1278964.9%9159.2%21092384177.4(Q12789) TFIIIC box B-binding subunit (Transcription factor (TFIIIC) alpha chain) (3' partial) 
*	TK120303_NMyc_cyto3_step03.3228.3228.3	1.7652	0.0112	3016.81	80	1540.0%	1	R.GYYSPGIVSTRNLNPNDSIVVNSCQMK.F
*	TK120303_NMyc_cyto3_step11.2330.2330.3	1.7863	0.056	3871.13	4	1430.0%	1	R.EDADIQREDPQARPLEGSSSEDSPPEGQAPPSHSPR.G
*	TK120303_NMyc_cyto3_step06.3543.3543.2	1.7598	0.0322	2524.47	1	2860.0%	3	K.FSSALRNSNLEIPDTLQELFAR.Y
*	TK120303_NMyc_cyto3_step08.3214.3214.2	1.4756	0.0346	2230.58	20	2220.0%	1	K.VCLAEVYQDKALVGDFMNR.R
*	TK120303_NMyc_cyto3_step09.3225.3225.2	1.0402	0.0494	1887.48	13	2350.0%	1	K.TSQPPVPQGEAEEDSQGK.E
*	TK120303_NMyc_cyto3_step09.4220.4220.2	1.3421	0.0541	3138.74	30	1480.0%	1	R.LLLLHPGTARPVQVQGELQRDLHTTAFK.V
*	TK120303_NMyc_cyto3_step12.3419.3419.3	2.0752	0.2329	4762.32	10	1100.0%	1	R.FSFKDQDNNEPTNDMVAFSLDGPGGNCVAVLTLFSLGLISVDVR.I
UYL1_HUMAN64.8%112.7%364405946.5(Q15906) YL-1 protein 
*	TK120303_NMyc_cyto3_step01.0986.0986.1	1.4651	0.2043	989.63	1	6670.0%	1	K.VNTPAGSSQK.A
UQ8TC0064.7%575.6%10611206779.4(Q8TC00) Similar to chromosome 17 open reading frame 1A 
	TK120303_NMyc_cyto3_step02.1521.1521.1	1.191	0.0592	971.76	3	6430.0%	1	R.YLPIHLSK.Y
	TK120303_NMyc_cyto3_step11.3311.3311.1	1.321	0.1336	1321.35	32	4000.0%	2	R.KIHLLDIIQVK.A
	TK120303_NMyc_cyto3_step10.3212.3212.2	1.4906	0.2189	3036.61	38	1400.0%	1	R.VLFLREENNISGLNQDITDVCFSPEK.D
	TK120303_NMyc_cyto3_step07.1509.1509.3	1.48	0.0143	1677.14	63	3080.0%	1	K.ANYTLLLLQMCNPK.L
UQ9BQ0664.6%555.6%14511641285.9(Q9BQ06) Fanconi anemia complementation group D2 protein, isoform 2 
	TK120303_NMyc_cyto3_step02.3228.3228.2	1.6106	0.1114	2549.1	227	1430.0%	1	R.NCLLSCERLQDEEASMGASYSK.S
	TK120303_NMyc_cyto3_step06.1955.1955.2	1.5442	0.138	1958.75	216	1760.0%	1	R.LQDEEASMGASYSKSLIK.L
	TK120303_NMyc_cyto3_step01.2468.2468.1	1.853	0.0979	1101.35	2	6670.0%	1	K.LLKISGIILK.T
	TK120303_NMyc_cyto3_step10.3161.3161.2	1.0339	0.0972	2076.27	50	2190.0%	1	K.HREDVLSLLETFQLDTR.L
	TK120303_NMyc_cyto3_step10.2165.2165.2	1.1028	0.0519	2892.24	47	1670.0%	1	K.LIGIIGAVTMAGIMAADRSESPSLTQER.A
UQ9CZI464.5%1115.2%264278839.5(Q9CZI4) 2700087H15Rik protein 
*	TK120303_NMyc_cyto3_step10.2673.2673.3	2.915	0.21	4077.41	4	1350.0%	1	R.ADGLLPSCPSPWGVLGHSSGSTTQPPTCPVGLVSLEAPSR.V
UTYB4_MOUSE64.4%41612.0%5056795.0(P20065) Thymosin beta-4 (T beta 4) 
	TK120303_NMyc_cyto3_step01.1024.1024.1	1.6002	0.1472	657.37	1	8000.0%	4	K.NPLPSK.E
USYT1_MOUSE64.3%51113.8%421474188.5(P46096) Synaptotagmin I (SytI) (p65) 
	TK120303_NMyc_cyto3_step05.2156.2156.1	1.5834	0.1231	1410.89	34	3330.0%	3	K.KMDVGGLSDPYVK.I
	TK120303_NMyc_cyto3_step06.3040.3040.3	1.57	0.2375	4503.76	13	1120.0%	1	K.LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVK.V
	TK120303_NMyc_cyto3_step03.1358.1358.1	0.9864	0.014	832.66	28	5000.0%	1	K.EEEKLGK.L
UIPSP_MOUSE64.3%227.9%405456229.5(P70458) Plasma serine protease inhibitor precursor (PCI) (Protein C inhibitor) (Plasminogen activator inhibitor-3) (PAI3) 
*	TK120303_NMyc_cyto3_step11.2609.2609.2	1.4567	0.0096	2173.19	16	2110.0%	1	K.TKTQILDGLGLSLQQGQEDK.L
*	TK120303_NMyc_cyto3_step05.2248.2248.1	1.5098	0.1732	1447.57	3	4090.0%	1	K.WQTAFSETNTHK.M
UQ9Y5Z764.3%4410.0%792867798.5(Q9Y5Z7) Host cell factor 2 
*	TK120303_NMyc_cyto3_step09.2547.2547.2	1.932	0.2892	2442.65	2	3100.0%	1	R.SLHTASVIGNKMYIFGGWVPHK.G
*	TK120303_NMyc_cyto3_step04.1684.1684.3	1.4241	0.0541	3113.33	23	1430.0%	1	K.ALTDSNAILYPSLASNASNHNSHVVDMLR.K
*	TK120303_NMyc_cyto3_step01.1483.1483.1	1.1312	0.0315	530.57	2	7500.0%	1	R.AVAIR.E
*	TK120303_NMyc_cyto3_step07.2227.2227.3	2.0051	0.2076	2393.64	39	1820.0%	1	K.TESSSTNGAVVKDETSLTTFSTK.S
UO1458464.2%5710.6%843979657.5(O14584) WUGSC:H_GS034D21.1 protein (Fragment) 
*	TK120303_NMyc_cyto3_step01.2195.2195.1	1.4663	0.0966	1235.71	1	5450.0%	2	R.ESGVSLIATVTR.L
	TK120303_NMyc_cyto3_step11.3557.3557.3	1.7479	0.0693	4012.0	262	940.0%	1	K.LYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLR.E
	TK120303_NMyc_cyto3_step02.1583.1583.1	1.3208	0.0695	1382.69	4	3890.0%	1	K.EEMYIRYIHK.L
	TK120303_NMyc_cyto3_step11.3477.3477.3	1.7205	0.046	3813.64	2	1590.0%	1	K.LVDQFFVMKSSLGIQEFSACMQASPVHFPNGSPR.V
UQ9Y5A164.2%2232.6%227233738.4(Q9Y5A1) NY-REN-36 antigen (Fragment) 
*	TK120303_NMyc_cyto3_step10.2897.2897.3	2.5153	0.4409	4380.3	1	1450.0%	1	K.LEFEPDSEDKISDCEEGLSNVALECSEPSTSVSAYDQLK.A
*	TK120303_NMyc_cyto3_step05.2641.2641.3	1.8642	0.0579	3590.79	27	1320.0%	1	K.GLNNELNNLPVISNMTAALDSCSAADGSLAAEMPK.L
UQ9Y6N364.2%83822.9%262299718.2(Q9Y6N3) CLCA homolog 
*	TK120303_NMyc_cyto3_step01.2487.2487.1	1.1261	0.0044	1136.69	4	4440.0%	1	K.GASCIARPFR.R
*	TK120303_NMyc_cyto3_step10.4166.4166.2	1.7614	0.126	1988.09	2	3750.0%	6	K.QETYDQADVIVADLYLK.Y
*	TK120303_NMyc_cyto3_step06.2652.2652.3	2.0598	0.1624	3572.92	2	1480.0%	1	K.SSLVTLNNNGYDGIVIAINPSVPEDEKLIQNIK.E
UQ9CTB964.1%118.2%195224399.6(Q9CTB9) 1110030K07Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step06.2123.2123.2	2.1794	0.2403	1864.37	1	5000.0%	1	R.TQIALSPNNHEVHIYK.K
UQ96MI164.1%112.6%740856907.7(Q96MI1) Hypothetical protein FLJ32343 
*	TK120303_NMyc_cyto3_step11.2541.2541.2	1.8039	0.3061	2311.24	2	3060.0%	1	K.MFEDKGLDCIFLETNMSMK.K
UQ9D3F564.1%115.1%431475596.7(Q9D3F5) 5830415F09Rik protein 
*	TK120303_NMyc_cyto3_step11.2275.2275.2	1.7477	0.3485	2214.6	2	2620.0%	1	R.IKLASESVQVADPEESLAALGS.-
UQ9D3V864.0%6623.4%625725819.0(Q9D3V8) 4933432B09Rik protein 
*	TK120303_NMyc_cyto3_step06.4288.4288.2	0.9844	0.0337	2716.76	4	1960.0%	1	R.IMEVELGSSLMISTLAIEDYELEK.K
*	TK120303_NMyc_cyto3_step01.2331.2331.1	1.8766	0.0763	1428.93	1	5450.0%	1	K.SSIQQIEQKHTK.F
*	TK120303_NMyc_cyto3_step09.2321.2321.2	1.6357	0.1487	2258.81	38	1670.0%	1	K.NLLAELHEHPPFDEMKPNK.L
*	TK120303_NMyc_cyto3_step01.3708.3708.3	2.3757	0.0637	4380.49	9	1250.0%	1	K.SEICNTMNLWVSGMYPCLQSYNNWDYSELDPERFR.Q
*	TK120303_NMyc_cyto3_step10.3590.3590.3	1.8264	0.0668	3670.05	84	1300.0%	1	K.LRQLDQMHENEWNCFNNYLTELQENFER.E
*	TK120303_NMyc_cyto3_step11.2425.2425.3	2.0201	0.0588	3477.03	3	1760.0%	1	R.LSSLLSKAMYTSFCCCFPQSWFNTHEFK.S
UKEMK_MOUSE64.0%224.7%774858749.7(Q05512) Putative serine/threonine-protein kinase EMK (EC 2.7.1.-) 
*	TK120303_NMyc_cyto3_step10.3417.3417.2	1.2771	0.0102	2437.46	211	1430.0%	1	R.DRVDGVNGLHTEEIQDSLVGQR.Y
*	TK120303_NMyc_cyto3_step10.2048.2048.1	1.7842	0.1055	1572.8	1	4620.0%	1	-.MSSARTPLPTLNER.D
UO1501764.0%445.1%19072189506.9(O15017) Hypothetical protein KIAA0299 (Fragment) 
*	TK120303_NMyc_cyto3_step10.1062.1062.3	1.7454	0.0196	3492.06	5	1550.0%	1	K.ELMQEQVHVLGVGLAVHEKFVHPEMRPLHK.K
*	TK120303_NMyc_cyto3_step11.2475.2475.3	2.659	0.3019	3835.28	3	1470.0%	1	K.QVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDK.D
*	TK120303_NMyc_cyto3_step11.1769.1769.2	1.445	0.042	2119.39	1	3330.0%	1	K.ELMQEQVHVLGVGLAVHEK.F
*	TK120303_NMyc_cyto3_step11.3407.3407.3	1.5917	0.0269	3578.43	13	1450.0%	1	K.AQPCRSHSAPGCVIPQDPMDPPALPPKPYHPR.L
UQ9H6D264.0%4411.6%456512029.1(Q9H6D2) Hypothetical protein FLJ22374 (Fragment) 
*	TK120303_NMyc_cyto3_step01.4492.4492.1	1.6256	0.1524	1431.05	1	5000.0%	1	K.LQSFSFSNTASLK.Y
*	TK120303_NMyc_cyto3_step12.2222.2222.2	1.3835	0.0778	2911.22	10	2200.0%	1	R.YFLDHFGNTANNFTQDTPIPALSVPK.K
*	TK120303_NMyc_cyto3_step08.1316.1316.1	0.7803	0.0185	941.25	269	3330.0%	1	K.RLPPWDR.A
*	TK120303_NMyc_cyto3_step06.1287.1287.1	1.0577	1.0E-4	822.44	208	5000.0%	1	K.YGIVQNK.K
UQ8VF7164.0%395.3%318353959.1(Q8VF71) Olfactory receptor MOR223-6 
	TK120303_NMyc_cyto3_step09.3176.3176.2	1.6219	0.0989	2037.28	27	2500.0%	3	R.YLAICQPLRYPVLMNGK.L
UGPDA_MOUSE63.9%6825.3%348374427.2(P13707) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic (EC 1.1.1.8) (GPD-C) (GPDH-C) 
*	TK120303_NMyc_cyto3_step11.3593.3593.2	2.0184	0.0465	2981.36	2	2400.0%	2	K.DLMQTPNFRITVVQEVDTVEICGALK.N
	TK120303_NMyc_cyto3_step03.0788.0788.1	0.3882	0.0054	454.33	16	3330.0%	1	K.GHLK.A
*	TK120303_NMyc_cyto3_step03.2983.2983.2	1.7513	0.2437	2014.0	1	3160.0%	1	K.NIVAVGAGFCDGLGFGDNTK.A
*	TK120303_NMyc_cyto3_step06.2841.2841.3	2.2154	0.282	3867.06	1	1740.0%	1	R.ITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTK.A
*	TK120303_NMyc_cyto3_step04.1923.1923.3	1.3659	0.0378	4021.11	144	1080.0%	1	K.YLPGHKLPPNVVAIPDVVQAATGADILVFVVPHQFIGK.I
UTRBP_MOUSE63.9%2215.1%365387905.8(P97473) TAR RNA-binding protein 2 (Protamine-1 RNA binding protein) (PRM-1 RNA binding protein) 
	TK120303_NMyc_cyto3_step02.2332.2332.1	1.8133	0.0909	1217.0	2	6000.0%	1	R.NSVGEKILSLR.S
*	TK120303_NMyc_cyto3_step02.2172.2172.3	1.638	0.0238	4339.2	127	870.0%	1	K.GGSMLEPALEDSSSLSLLDSSPPEDTPVVAAEAAAPVPSAVLTR.S
UQ9NY1563.7%13198.9%25702753466.5(Q9NY15) Stabilin-1 
	TK120303_NMyc_cyto3_step03.2571.2571.2	1.3941	0.1849	1648.55	101	3210.0%	1	K.RTIGQILASTEAFSR.F
	TK120303_NMyc_cyto3_step10.4025.4025.2	1.401	0.0723	2581.39	58	1520.0%	1	R.SGFAGTACELCAPGAFGPHCQACR.C
	TK120303_NMyc_cyto3_step07.0205.0205.3	0.7799	0.0234	3671.63	25	910.0%	1	R.EILTTAGPFTVLVPSVSSFSSRTMNASLAQQLCR.Q
*	TK120303_NMyc_cyto3_step07.2859.2859.3	2.2064	0.0346	3303.83	4	1670.0%	2	R.CPQNTQCSAEAPSCRCLPGYTQQGSECR.A
*	TK120303_NMyc_cyto3_step06.1804.1804.3	1.8774	0.1605	1557.51	3	3330.0%	1	R.CLPGYTQQGSECR.A
	TK120303_NMyc_cyto3_step02.3499.3499.3	1.7402	0.0411	4405.34	9	1150.0%	2	K.GCASYCNQTIMEQGCCKGFFGPDCTQCPGGFSNPCYGK.G
	TK120303_NMyc_cyto3_step09.3675.3675.2	1.0202	0.0512	2462.77	8	2500.0%	1	R.CTCKLGFAGDGYQCSPIDPCR.A
	TK120303_NMyc_cyto3_step05.1361.1361.3	1.316	0.016	1934.2	116	2340.0%	2	R.SVWVHPSLWGRPQGLGR.G
*	TK120303_NMyc_cyto3_step06.1739.1739.3	1.4364	0.0062	3130.64	223	1250.0%	1	R.GDGSCLCFAGYTGPHCDQELPVCQELR.C
	TK120303_NMyc_cyto3_step01.3814.3814.2	1.8613	0.2895	2733.08	5	2290.0%	1	K.GDGPFTIFVPHADLMSNLSQDELAR.I
UQ9H79963.7%114.1%493547936.2(Q9H799) Hypothetical protein FLJ21126 (Fragment) 
*	TK120303_NMyc_cyto3_step10.3241.3241.2	1.8749	0.2914	2216.78	1	2890.0%	1	R.LIPHAKTFSPGDGFPLLQFK.S
UNEBU_HUMAN63.6%17192.9%66697732309.1(P20929) Nebulin 
	TK120303_NMyc_cyto3_step08.1587.1587.3	1.7241	0.1868	2819.52	1	2300.0%	1	K.INIPADMVSVLAAKQGQTLVSDIDYR.N
*	TK120303_NMyc_cyto3_step02.2657.2657.2	1.9735	0.1407	1889.66	38	2670.0%	1	K.INYSETLYKLANEEAK.K
	TK120303_NMyc_cyto3_step01.1707.1707.1	1.3235	0.025	1001.67	2	6430.0%	1	K.LYSTILYK.G
	TK120303_NMyc_cyto3_step05.0456.0456.1	0.6297	0.0478	653.42	114	5000.0%	1	K.ETFQK.T
*	TK120303_NMyc_cyto3_step09.1603.1603.1	1.3023	0.0123	828.51	47	5000.0%	2	R.QPPDKLK.F
	TK120303_NMyc_cyto3_step01.1195.1195.1	0.9515	0.01	1531.36	19	3080.0%	1	K.ATPTPVTPEMERAK.R
	TK120303_NMyc_cyto3_step05.1471.1471.1	0.9655	0.0088	581.48	21	6250.0%	1	R.HLLAK.T
*	TK120303_NMyc_cyto3_step05.0383.0383.1	0.9986	0.0046	869.48	1	6430.0%	1	K.ALSDVAYK.K
	TK120303_NMyc_cyto3_step01.2671.2671.1	1.6796	0.1364	1286.62	1	5500.0%	1	K.AYDLQSDALYK.A
	TK120303_NMyc_cyto3_step08.1288.1288.3	1.5505	0.1854	1320.87	8	3500.0%	1	K.VNKQISDILYK.L
	TK120303_NMyc_cyto3_step06.3592.3592.2	1.2125	0.0682	2432.34	11	2140.0%	1	K.NALENYPNFTSVVDPPEIVLAK.I
*	TK120303_NMyc_cyto3_step01.2671.2671.1	1.6796	0.1364	1286.62	1	5500.0%	1	K.AYDLQSDAIYK.S
	TK120303_NMyc_cyto3_step05.1243.1243.1	1.2056	0.2194	920.46	86	5000.0%	1	R.KHYEDTK.A
	TK120303_NMyc_cyto3_step08.2326.2326.2	1.2949	0.1734	2167.32	2	2940.0%	1	K.VTDQISDIVYKDDLNWLK.G
	TK120303_NMyc_cyto3_step08.1811.1811.2	1.4429	0.208	1235.69	39	3500.0%	1	K.AQDVVSNVNYK.H
	TK120303_NMyc_cyto3_step11.2194.2194.2	1.6885	0.0833	1808.52	3	3670.0%	1	K.TSIHIMPDTPEINLAR.A
UQ99LX063.5%113.7%189200216.8(Q99LX0) Similar to DJ-1 protein 
	TK120303_NMyc_cyto3_step01.1910.1910.1	1.4612	0.1944	727.62	1	6670.0%	1	R.ALVILAK.G
UCADD_MOUSE63.5%82014.4%714782865.1(Q9WTR5) Cadherin-13 precursor (Truncated-cadherin) (T-cadherin) (T-cad) (Heart-cadherin) (H-cadherin) 
*	TK120303_NMyc_cyto3_step12.4006.4006.2	1.5015	0.0473	1772.19	3	2810.0%	4	R.VEEGAVGVIVNLTVEDK.D
*	TK120303_NMyc_cyto3_step04.2340.2340.2	1.2232	0.0153	1556.26	78	3460.0%	1	R.NITAVGRTLFVHAR.T
	TK120303_NMyc_cyto3_step10.1751.1751.3	1.6669	0.0542	2134.71	8	2940.0%	1	R.QQTPDKPSPNMFYIDPEK.G
*	TK120303_NMyc_cyto3_step12.3804.3804.3	2.232	0.1177	3249.05	24	1700.0%	1	R.TPLTLCVLLSQVLLVTSADDLECTPGFQR.K
*	TK120303_NMyc_cyto3_step10.4125.4125.2	1.4058	0.0348	2980.49	20	1670.0%	1	K.VLHIHQPAEFIEDQPVLNLTFNDCK.G
UBMR2_MOUSE63.5%5710.5%10381150206.2(O35607) Bone morphogenetic protein receptor type II precursor (EC 2.7.1.37) (BMP type II receptor) (BMPR-II) (BRK-3) 
*	TK120303_NMyc_cyto3_step01.3828.3828.3	1.5908	0.0824	3384.39	18	1500.0%	1	K.QGLHSMNMMEAAAAEPSLDLDNLKLLELIGR.G
	TK120303_NMyc_cyto3_step03.2526.2526.2	2.2181	0.1127	2188.66	3	3160.0%	1	K.NISSEHSMSSTPLTIGEKNR.N
*	TK120303_NMyc_cyto3_step12.4118.4118.3	1.9891	0.1309	3754.81	42	1320.0%	2	K.LAVEVTGQQDFTQAANGQACLIPDVPPAQIYPLPK.Q
	TK120303_NMyc_cyto3_step12.3951.3951.3	1.897	0.0134	2571.39	58	1930.0%	1	K.SVSPTVNPMSTAMQNERNLSHNR.R
ULAM5_MOUSE63.4%2410.3%261296028.6(Q61168) Lysosomal-associated multitransmembrane protein (Retinoic acid-inducible E3 protein) 
*	TK120303_NMyc_cyto3_step06.3433.3433.2	2.2184	0.302	2913.03	7	2120.0%	2	R.MADLLSSFLLIGVLFIISISLLFGVVK.N
UTEA2_MOUSE63.4%2210.1%445490416.4(P48301) Transcriptional enhancer factor TEF-4 (TEA domain family member 2) (TEAD-2) (Embryonic TEA domain-containing factor) (ETF) (ETEF-1) 
	TK120303_NMyc_cyto3_step02.2176.2176.2	2.2226	0.0163	1405.35	2	6360.0%	1	K.VETERAQLEDGR.F
*	TK120303_NMyc_cyto3_step06.2145.2145.3	1.7265	0.0878	3413.73	5	1480.0%	1	K.FWADLNWGPSAEEAGSSGGGGGFYGVSSQYESR.E
UPC16_HUMAN63.4%121210.6%32983461824.9(Q96JQ0) Protocadherin 16 precursor (Cadherin 19) (Cadherin fibroblast 1) 
*	TK120303_NMyc_cyto3_step05.4377.4377.3	1.4081	0.1492	4349.64	32	1150.0%	1	R.LVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWELR.V
*	TK120303_NMyc_cyto3_step10.2474.2474.3	1.8583	0.1838	2859.59	109	1430.0%	1	R.IDPPPLITAVAHPGAKSVPPKPANTAAAR.A
*	TK120303_NMyc_cyto3_step12.2652.2652.3	1.9981	0.1573	3539.82	18	1370.0%	1	R.LSYHILAGNSPPLFTLDEQSGLLTVAWPLARR.A
*	TK120303_NMyc_cyto3_step10.1969.1969.2	2.2166	0.0717	2130.07	1	3420.0%	1	R.LMRPLGPSGGPAHELELEAR.D
*	TK120303_NMyc_cyto3_step12.1944.1944.2	1.224	0.0257	2259.17	2	2380.0%	1	K.SVPPKPANTAAARAIFPPASHR.S
*	TK120303_NMyc_cyto3_step09.2569.2569.3	2.4525	0.1766	2964.83	8	2100.0%	1	R.AARATVHVQLQDQNDHAPSFTLSHYR.V
*	TK120303_NMyc_cyto3_step12.1702.1702.3	1.8834	0.1368	2823.03	50	1440.0%	1	K.GTFSIQPSTGAITVRSAEGLDFEVSPR.L
*	TK120303_NMyc_cyto3_step01.3639.3639.3	1.7144	0.0241	3776.85	23	1080.0%	1	R.STTGTVHVAVLDLNDNSPTFLQASGAAGGGLPIQVPDR.V
*	TK120303_NMyc_cyto3_step02.1516.1516.1	1.0291	0.0098	1332.59	47	3330.0%	1	R.ENAPPGTPIVSPR.A
*	TK120303_NMyc_cyto3_step12.2070.2070.3	2.0898	0.1361	3556.2	22	1290.0%	1	R.ASYRVTVPEDTPVGAELLHVEASDADPGPHGLVR.F
*	TK120303_NMyc_cyto3_step11.2349.2349.3	1.6639	0.0108	4537.54	60	1040.0%	1	R.ISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCVARR.L
*	TK120303_NMyc_cyto3_step01.3924.3924.3	2.2004	0.2289	4232.94	2	1440.0%	1	R.LGTQGYALSGDGAGETFRLETRPGPDGTPVPELVVTGELDR.E
UNAC1_MOUSE63.2%354.7%9701080355.0(P70414) Sodium/calcium exchanger 1 precursor (Na(+)/Ca(2+)-exchange protein 1) 
*	TK120303_NMyc_cyto3_step12.2631.2631.2	1.5604	0.0845	2765.28	1	2730.0%	2	K.HPEKEIEQLIELANYQVLSQQQK.S
*	TK120303_NMyc_cyto3_step03.0619.0619.3	1.0158	0.0829	2691.23	29	1480.0%	1	R.VGIIDDDIFEEDENFLVHLSNVR.V
UVINE_MOUSE63.2%227.2%733823499.2(Q9R1Z8) Vinexin (SH3-containing adapter molecule-1) (SCAM-1) (SH3 domain-containing protein SH3P3) 
*	TK120303_NMyc_cyto3_step01.3531.3531.3	2.8365	0.232	4548.64	1	1250.0%	1	R.LCDDGPQLPASPNPTTTAHLSSHSHPSSIPVDPTDWGGRTSPR.R
*	TK120303_NMyc_cyto3_step12.1168.1168.2	1.0754	0.0353	1259.54	1	6110.0%	1	R.NWNHSEETSR.N
UZO1_HUMAN63.2%576.9%17361947216.8(Q07157) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) 
*	TK120303_NMyc_cyto3_step10.1786.1786.2	1.5231	0.0080	1498.92	3	4170.0%	1	R.SPDQRSEPSDHSR.H
*	TK120303_NMyc_cyto3_step03.4398.4398.3	1.9817	0.0049	4138.95	29	1120.0%	1	K.KDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHDK.T
*	TK120303_NMyc_cyto3_step12.4259.4259.3	1.5798	0.1426	4280.91	34	1090.0%	2	R.GIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCR.D
*	TK120303_NMyc_cyto3_step12.3194.3194.2	1.4887	0.2578	3100.27	14	1540.0%	1	R.LRPEAQPHPSAGPKPAESKQYFEQYSR.S
UQ9NTG263.0%6121.1%13971578857.9(Q9NTG2) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step07.1937.1937.2	1.1418	0.0756	1039.12	24	5000.0%	1	R.EVARPAHKK.K
*	TK120303_NMyc_cyto3_step04.3578.3578.2	1.5746	0.0251	1589.87	1	3930.0%	1	K.LAGPGQREVARPAHK.K
*	TK120303_NMyc_cyto3_step03.2078.2078.1	1.7157	0.1207	910.67	2	7140.0%	3	R.EVARPAHK.K
UQ0761763.0%357.0%9261036006.8(Q07617) Infertility-related sperm protein 
*	TK120303_NMyc_cyto3_step11.3239.3239.3	1.556	0.0217	3703.69	1	1430.0%	1	R.SGQFAEAAGKYSAAIALLEPAGSEIADDLSILYSNR.A
*	TK120303_NMyc_cyto3_step05.2792.2792.2	1.7551	0.0558	2459.36	37	1790.0%	2	R.RASAAAAAGGGATGHPGGGQGAENPAGLK.S
UQ8WYN763.0%225.1%553620978.2(Q8WYN7) HUST3 
*	TK120303_NMyc_cyto3_step01.3500.3500.1	1.6468	0.1419	1555.72	5	4170.0%	1	R.WLIINNKPEEGLK.E
*	TK120303_NMyc_cyto3_step11.2018.2018.2	1.174	0.0271	1845.48	106	2140.0%	1	R.NKPLFDTIQDEKNER.K
UAOAH_HUMAN62.9%4611.1%575651058.2(P28039) Acyloxyacyl hydrolase precursor (EC 3.1.1.77) 
*	TK120303_NMyc_cyto3_step11.2501.2501.2	1.3671	0.158	2453.24	42	2140.0%	1	K.SDPVPAMTTPEKLYSNVMQTLK.H
*	TK120303_NMyc_cyto3_step03.1644.1644.1	1.6671	0.1319	1439.82	3	4090.0%	1	K.KVQLQWPQILGK.E
*	TK120303_NMyc_cyto3_step04.2160.2160.3	1.8709	0.0156	3437.06	32	1470.0%	2	K.HLNSHLPNGSHVILYGLPDGTFLWDNLHNR.Y
UO1463762.8%91510.8%14861624966.6(O14637) Laminin alpha 3b chain (Fragment) 
*	TK120303_NMyc_cyto3_step06.1331.1331.1	1.0659	0.0337	753.43	137	4170.0%	1	K.SSGSLFR.V
*	TK120303_NMyc_cyto3_step12.1312.1312.3	1.9084	0.0326	3137.27	100	1540.0%	1	R.FGFDPLAFPEFSWRGYAQMASVQNDVR.I
*	TK120303_NMyc_cyto3_step12.4267.4267.3	1.8206	0.1	4109.43	16	1320.0%	1	K.SNYFGCQGCQCDIGGALSSMCSGPSGVCQCREHVVGK.V
*	TK120303_NMyc_cyto3_step05.2499.2499.3	1.5469	0.1286	3264.42	40	1380.0%	1	R.IVPLENGEVVVSLINGRPGAKNFTFSHTLR.G
*	TK120303_NMyc_cyto3_step04.1236.1236.1	1.2558	0.0459	1521.41	39	3640.0%	1	K.CAIGYNFPFCLR.I
*	TK120303_NMyc_cyto3_step07.1945.1945.1	1.2748	0.1337	965.47	6	5710.0%	3	R.SLVAFYHK.G
*	TK120303_NMyc_cyto3_step08.4283.4283.3	1.5798	0.0426	4222.27	2	1320.0%	1	R.IPIFPVSTPSSEDPVAGDIKGCDCNLEGVLPEICDAHGR.C
UQ9P06362.8%247.9%165184669.6(Q9P063) HSPC319 (Fragment) 
*	TK120303_NMyc_cyto3_step08.2072.2072.1	1.8309	0.0764	1451.64	1	5000.0%	2	R.EPQTLAVQNPPKK.V
UGP15_HUMAN62.7%114.2%360407878.7(P49685) G protein-coupled receptor GPR15 (BOB) 
*	TK120303_NMyc_cyto3_step09.2623.2623.2	1.7081	0.3394	1824.04	5	3210.0%	1	R.ELTLIDDKPYCAEKK.A
UO6036362.6%5714.9%578651978.9(O60363) SA gene 
	TK120303_NMyc_cyto3_step03.1624.1624.2	1.4135	0.194	2069.85	2	2780.0%	1	K.SLKHCVSAGEPITPDVTEK.W
*	TK120303_NMyc_cyto3_step03.3246.3246.2	1.4989	0.0048	1964.63	2	3330.0%	2	K.SHDQEQLIKEIQEHVK.K
	TK120303_NMyc_cyto3_step01.1431.1431.1	1.6296	0.1468	1306.53	5	5000.0%	1	R.EGWGNLKELMK.H
*	TK120303_NMyc_cyto3_step12.2706.2706.3	2.0596	0.1194	4238.88	37	1150.0%	1	R.ADDVILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIR.G
UERG1_HUMAN62.6%4612.2%574639398.8(Q14534) Squalene monooxygenase (EC 1.14.99.7) (Squalene epoxidase) (SE) 
*	TK120303_NMyc_cyto3_step10.2200.2200.1	1.3274	0.0293	1480.61	25	2920.0%	2	K.RGVLLLGDAYNMR.H
*	TK120303_NMyc_cyto3_step01.2355.2355.1	1.1338	0.0138	1227.05	2	4440.0%	1	K.IYPQIPDHLK.E
*	TK120303_NMyc_cyto3_step12.2412.2412.3	2.9115	0.1949	4644.94	1	1250.0%	1	K.GTNISETSLIGTAACTSTSSQNDPEVIIVGAGVLGSALVAVLSRDGR.K
UQ96NW462.4%449.4%10601180816.8(Q96NW4) FLJ00040 protein (Fragment) 
	TK120303_NMyc_cyto3_step03.4275.4275.2	2.0935	0.062	2907.27	51	1610.0%	1	R.HTVEDAVVSQGPEAAGPLSTPQEVSASRS.-
	TK120303_NMyc_cyto3_step08.3031.3031.3	1.7167	0.0077	3900.39	2	1390.0%	1	K.KDLSGNTPLIYACSGGHHELVALLLQHGASINASNNK.G
	TK120303_NMyc_cyto3_step01.1923.1923.1	1.7573	0.1058	815.76	3	7500.0%	1	R.ELAQLNK.C
	TK120303_NMyc_cyto3_step05.2541.2541.2	1.4545	0.0681	2627.36	57	1730.0%	1	K.VPASGLGVNVTSQDGSSPLHVAALHGR.A
UXRC2_MOUSE62.4%112.9%278313916.5(Q9CX47) DNA-repair protein XRCC2 (X-ray repair cross-complementing protein 2) 
*	TK120303_NMyc_cyto3_step05.1373.1373.1	1.7688	0.1086	907.62	1	7860.0%	1	R.DDEAKSSR.F
UCGD3_MOUSE62.4%5253.1%292324116.5(P30282) G1/S-specific cyclin D3 
*	TK120303_NMyc_cyto3_step12.4336.4336.1	1.7669	0.1079	1074.62	3	5620.0%	5	R.EWEVLVLGK.L
UQ9ESL762.4%111.8%725795604.6(Q9ESL7) Niban 
*	TK120303_NMyc_cyto3_step07.2731.2731.1	1.7052	0.1257	1349.63	2	4580.0%	1	K.TAMGSNQASPARR.V
UERB3_HUMAN62.4%121819.1%13421480986.6(P21860) Receptor protein-tyrosine kinase erbB-3 precursor (EC 2.7.1.112) (c-erbB3) (Tyrosine kinase-type cell surface receptor HER3) 
*	TK120303_NMyc_cyto3_step11.2291.2291.3	1.4277	0.0634	3855.23	7	1400.0%	1	K.GTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNR.R
*	TK120303_NMyc_cyto3_step08.3168.3168.2	1.9952	0.2832	2466.53	1	2620.0%	1	R.EVTGYVLVAMNEFSTLPLPNLR.V
*	TK120303_NMyc_cyto3_step11.3287.3287.2	1.2417	0.061	2669.66	10	2000.0%	1	K.CWMIDENIRPTFKELANEFTR.M
*	TK120303_NMyc_cyto3_step06.2480.2480.3	1.7838	0.1401	3372.95	1	1900.0%	1	K.THLTMALTVIAGLVVIFMMLGGTFLYWRGR.R
*	TK120303_NMyc_cyto3_step11.2949.2949.3	2.0471	0.105	4050.98	20	1250.0%	1	R.EITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNR.G
*	TK120303_NMyc_cyto3_step06.4301.4301.3	1.782	0.0957	4392.19	3	1280.0%	3	R.DGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYAR.L
*	TK120303_NMyc_cyto3_step10.2694.2694.2	1.3417	0.0527	3158.79	34	1300.0%	1	K.THLTMALTVIAGLVVIFMMLGGTFLYWR.G
*	TK120303_NMyc_cyto3_step10.3366.3366.3	2.0794	0.1529	4673.61	32	1150.0%	1	K.TICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACR.H
*	TK120303_NMyc_cyto3_step04.2360.2360.2	1.457	0.1451	1719.63	73	3080.0%	1	K.DNGRSCPPCHEVCK.G
*	TK120303_NMyc_cyto3_step07.4482.4482.3	0.9117	0.1558	3701.0	122	520.0%	1	R.LAQPQICTIDVYMVMVKCWMIDENIRPTFK.E
UQ9Y68362.2%2212.4%339369797.3(Q9Y683) HSPC035 protein 
	TK120303_NMyc_cyto3_step06.1233.1233.3	1.5847	0.1578	2342.12	313	1620.0%	1	K.CVGGTAGCDSYTPKVIQCQNK.G
	TK120303_NMyc_cyto3_step04.3427.3427.2	1.8082	0.299	2175.81	1	3250.0%	1	R.AYSPLHGGSGSYSVCSNSDTK.T
UQ9BU9762.2%225.3%754822504.5(Q9BU97) Hypothetical protein KIAA1115 
*	TK120303_NMyc_cyto3_step12.3378.3378.3	2.8111	0.2258	3112.49	3	1920.0%	1	K.TANITFSLNADDENPNANLLEICYKDR.I
*	TK120303_NMyc_cyto3_step06.1879.1879.2	1.1006	0.0462	1584.33	46	2920.0%	1	R.LSCFHQLLLEPPK.L
UOPT_HUMAN62.2%114.2%332372615.6(Q9UBM4) Opticin precursor (Oculoglycan) 
*	TK120303_NMyc_cyto3_step04.2908.2908.2	2.0389	0.2731	1685.82	1	5770.0%	1	R.SVHLQNNLIETMQR.D
UQ91XA662.2%119.1%308340136.4(Q91XA6) Unknown (Protein for MGC:18668) 
*	TK120303_NMyc_cyto3_step12.3722.3722.2	1.7933	0.2979	3173.28	3	1850.0%	1	K.ELLPQECSINSVDKLPQPLAIHTLLDPK.V
UCSE1_MOUSE62.1%557.9%9711104555.8(Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) 
	TK120303_NMyc_cyto3_step11.3039.3039.2	1.3175	0.0849	2964.57	2	1960.0%	1	K.NPSKPHFNHYMFEAICLSIRITCK.A
	TK120303_NMyc_cyto3_step11.1358.1358.1	1.4772	0.0235	1047.55	2	6250.0%	1	K.IHLAQSLHK.L
	TK120303_NMyc_cyto3_step10.2510.2510.2	1.235	0.0628	3090.35	24	1540.0%	1	K.AIMRSFSLLQEAIIPYIPTLITQLTQK.L
*	TK120303_NMyc_cyto3_step01.0300.0300.1	1.6363	0.1338	1092.45	1	5910.0%	1	R.GSSTIATAAADK.I
	TK120303_NMyc_cyto3_step01.0387.0387.1	0.8544	0.0654	531.33	12	6250.0%	1	K.LIASK.A
UMM16_MOUSE62.0%103023.7%607696838.6(Q9WTR0) Matrix metalloproteinase-16 precursor (EC 3.4.24.-) (MMP-16) (Membrane-type matrix metalloproteinase 3) (MT-MMP 3) (MTMMP3) (Membrane-type-3 matrix metalloproteinase) (MT3-MMP) (MT3MMP) 
	TK120303_NMyc_cyto3_step01.4428.4428.2	1.3391	0.1992	3071.91	3	2000.0%	1	R.AFDVWQNVTPLTFEEVPYSELENGKR.D
*	TK120303_NMyc_cyto3_step01.3263.3263.1	1.4729	0.129	1499.57	10	3460.0%	1	K.EGLSPPDDVDIVIK.L
*	TK120303_NMyc_cyto3_step12.3848.3848.3	1.4009	0.0618	4503.59	7	1030.0%	1	K.DTTLQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFK.G
	TK120303_NMyc_cyto3_step03.3483.3483.2	1.4307	0.0219	2852.49	45	1600.0%	5	R.SAETMQSALAAMQQFYGINMTGKVDR.N
	TK120303_NMyc_cyto3_step06.1556.1556.1	1.4611	0.1898	800.43	3	7000.0%	1	R.EMFVFK.D
*	TK120303_NMyc_cyto3_step12.3894.3894.3	2.078	0.1007	3892.15	1	1530.0%	1	R.SVVFFLQTLLWILCATVCGTEQYFNVEVWLQK.Y
UQ9D0D662.0%337.7%723816017.8(Q9D0D6) 2610024N01Rik protein 
	TK120303_NMyc_cyto3_step10.3868.3868.3	2.7425	0.2403	3121.28	3	2120.0%	1	R.EASAPTPPHWLAERFGLFEELWTAHVK.K
	TK120303_NMyc_cyto3_step08.1980.1980.3	1.7709	0.1751	2460.76	25	2000.0%	1	R.CELHTVREASAPTPPHWLAER.F
	TK120303_NMyc_cyto3_step02.2808.2808.2	1.1342	0.0621	2526.85	6	2140.0%	1	R.SAELPILERICQELIAAAQPFR.R
UQ8R0E561.9%113.4%292345369.9(Q8R0E5) RIKEN cDNA 1700022C21 gene 
*	TK120303_NMyc_cyto3_step11.1963.1963.1	1.7997	0.0972	1216.76	1	6110.0%	1	R.RFLAVPPFLR.T
UQ8TCN561.9%244.9%849943255.7(Q8TCN5) Hypothetical protein 
*	TK120303_NMyc_cyto3_step03.3411.3411.3	2.6483	0.2946	4384.39	1	1650.0%	2	K.TQLKSSEESADPVTGSSENAVSSSELMSQTPSEVLGTNENEK.L
UVEGB_HUMAN61.9%1113.0%207216028.1(P49765) Vascular endothelial growth factor B precursor (VEGF-B) (VEGF related factor) (VRF) 
*	TK120303_NMyc_cyto3_step05.2675.2675.3	2.6246	0.2833	2955.8	2	1830.0%	1	R.EVVVPLTVELMGTVAKQLVPSCVTVQR.C
UO9483661.9%7914.1%10961229409.1(O94836) Hypothetical protein KIAA0731 (Fragment) 
*	TK120303_NMyc_cyto3_step05.0451.0451.1	0.6125	0.0266	787.31	68	2860.0%	1	R.ARGGGVLR.G
*	TK120303_NMyc_cyto3_step03.0922.0922.2	0.9913	0.1743	2759.72	5	1740.0%	1	K.SEESRFSHLTSLPQQLPSQQLMSK.D
*	TK120303_NMyc_cyto3_step10.1299.1299.3	2.0988	0.256	3154.61	1	1740.0%	1	R.ASPPSVHIAAAPEPGSPGRPGGGGEGGTGLEACR.A
*	TK120303_NMyc_cyto3_step09.3176.3176.3	2.6092	0.254	3055.41	1	2050.0%	2	K.VNPWTKNALPPVLTTVNGQSPPEHSAPAK.V
*	TK120303_NMyc_cyto3_step06.2637.2637.2	1.5701	0.1582	2649.46	29	1670.0%	1	K.NTFTAWSDEESDYEIDDRDVNK.I
*	TK120303_NMyc_cyto3_step02.3627.3627.3	1.7519	0.0305	4036.71	17	1180.0%	1	K.GSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVK.S
UTRAL_HUMAN61.7%4412.2%704800118.0(Q12931) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) 
*	TK120303_NMyc_cyto3_step09.3223.3223.3	1.5855	0.1186	1950.13	447	1670.0%	1	R.SGSKAFLDALQNQAEASSK.I
*	TK120303_NMyc_cyto3_step05.1611.1611.1	1.4571	0.186	1185.61	4	5560.0%	1	R.YVAQAHDKPR.Y
*	TK120303_NMyc_cyto3_step07.2267.2267.3	1.8637	0.0335	3696.39	8	1440.0%	1	K.LNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPR.A
*	TK120303_NMyc_cyto3_step12.2699.2699.2	1.702	0.0104	2590.04	1	2950.0%	1	R.HKLVSDGQALPEMEIHLQTNAEK.G
UQ9H91061.7%117.9%190200639.3(Q9H910) Hypothetical protein FLJ13092 (HN1 like) 
*	TK120303_NMyc_cyto3_step01.1731.1731.1	1.6059	0.1458	1429.68	1	3930.0%	1	R.SIPAGAEPGEKGSAR.K
UDLL1_HUMAN61.7%3310.1%723779566.2(O00548) Delta-like protein 1 precursor (Drosophila Delta homolog 1) (Delta1) (H-Delta-1) 
	TK120303_NMyc_cyto3_step10.1730.1730.3	1.241	0.1072	4508.74	62	930.0%	1	K.HYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR.F
	TK120303_NMyc_cyto3_step11.1403.1403.3	2.011	0.1538	3231.27	92	1520.0%	1	R.CQAGFSGRHCDDNVDDCASSPCANGGTCR.D
	TK120303_NMyc_cyto3_step02.4208.4208.2	1.7014	0.327	2370.76	1	3750.0%	1	R.HCDDNVDDCASSPCANGGTCR.D
UQ9H96061.7%1112.0%1251344511.6(Q9H960) Hypothetical protein FLJ12988 
*	TK120303_NMyc_cyto3_step06.1437.1437.2	1.7028	0.3282	1427.96	4	3930.0%	1	R.VLGLQAGGTAPGQKK.L
UALD1_MOUSE61.6%3511.4%315358577.3(P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7) 
*	TK120303_NMyc_cyto3_step01.2288.2288.3	1.4423	0.0096	3414.64	49	1570.0%	1	R.IQENLQVFDFQLSEEDMAAILSFNRNWR.A
	TK120303_NMyc_cyto3_step07.1635.1635.1	1.4973	0.077	884.68	10	5710.0%	2	R.LLNKPGLK.H
UCYC_MOUSE61.6%2226.0%104114749.6(P00009) Cytochrome c, somatic 
*	TK120303_NMyc_cyto3_step06.1897.1897.2	1.1506	0.1782	1671.65	5	3000.0%	1	K.TGQAAGFSYTDANKNK.G
	TK120303_NMyc_cyto3_step07.2548.2548.1	1.6283	0.1312	1170.75	1	5000.0%	1	K.TGPNLHGLFGR.K
UALDR_MOUSE61.6%3514.6%315356017.2(P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) 
	TK120303_NMyc_cyto3_step02.3823.3823.3	2.4214	0.2796	4296.75	1	1420.0%	1	K.LIEYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPR.I
	TK120303_NMyc_cyto3_step07.1635.1635.1	1.4973	0.077	884.68	10	5710.0%	2	R.ILNKPGLK.Y
UQ9EQQ961.6%5710.9%9161031624.9(Q9EQQ9) Cytosolic beta-N-acetylglucosaminidase 
	TK120303_NMyc_cyto3_step12.2260.2260.3	1.6383	0.0681	3673.63	103	1050.0%	2	K.GVLTNPNCEFEANYVAIHTLATWYKSNMNGVR.K
	TK120303_NMyc_cyto3_step11.1726.1726.2	1.375	0.0327	1549.88	234	2500.0%	1	K.QPDEEPMDMVVEK.Q
	TK120303_NMyc_cyto3_step01.3444.3444.3	1.8768	0.1173	4704.16	10	1120.0%	1	R.EMYSVEEAEQLMTLISAAREYEIEFIYAISPGLDITFSNPK.E
*	TK120303_NMyc_cyto3_step10.4136.4136.2	1.7609	0.3127	1720.69	2	3850.0%	1	K.FEEMCALVMGMFTR.L
UQ8R3T661.6%1115.0%234270088.5(Q8R3T6) Similar to hypothetical protein MGC2376 
*	TK120303_NMyc_cyto3_step01.3608.3608.3	2.8503	0.2032	4126.91	2	1620.0%	1	R.FFIDRPGTYFGLLLDYLRTGQVPTEYVPEVYQEAK.F
UO9556861.5%3321.8%372421486.8(O95568) Hypothetical protein 
*	TK120303_NMyc_cyto3_step08.3147.3147.3	1.8543	0.0269	4792.33	19	950.0%	1	K.GGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVK.R
*	TK120303_NMyc_cyto3_step09.2208.2208.1	1.5784	0.1527	1106.59	3	5620.0%	1	R.KPKVTQLYK.C
*	TK120303_NMyc_cyto3_step04.4281.4281.3	2.26	0.1401	2986.76	14	1700.0%	1	K.SMENAAPSQDTDSPLSAASSSRNLEPHGK.Q
UQ99MP061.5%4614.5%488525168.8(Q99MP0) T-box 1 
*	TK120303_NMyc_cyto3_step03.2791.2791.2	1.5487	0.0249	2777.36	11	1960.0%	1	R.DCDPEDWPRNHRPGALPLVSAFAR.S
*	TK120303_NMyc_cyto3_step05.3155.3155.2	2.199	0.1222	1957.15	2	3100.0%	2	R.VLSPALPGPGGLVPLPGGSGGR.H
*	TK120303_NMyc_cyto3_step09.2637.2637.2	1.5259	0.091	2275.98	48	1670.0%	1	R.AYPFAPAPGAAGSSAAESEGPGASR.A
UQ9CSF261.5%4168.8%159182849.2(Q9CSF2) 2810405K07Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step01.4643.4643.1	1.606	0.0672	1588.88	1	4230.0%	4	R.DCGKAFYGVTSLNR.H
UPRKD_MOUSE61.5%552.3%41284713917.1(P97313) DNA-dependent protein kinase catalytic subunit (EC 2.7.1.37) (DNA-PKcs) (P460) 
*	TK120303_NMyc_cyto3_step05.1219.1219.1	1.5402	0.155	1229.23	4	5000.0%	1	R.KPTTGHFQRR.E
*	TK120303_NMyc_cyto3_step09.3429.3429.3	2.282	0.183	3748.44	6	1450.0%	1	K.EFREEGSLVEQFVFEALVTYMESLALAHEDEK.S
*	TK120303_NMyc_cyto3_step12.4048.4048.3	2.1004	0.0639	1974.29	4	2650.0%	1	K.NLDIAVSRLMESSSDNPK.M
*	TK120303_NMyc_cyto3_step07.2196.2196.3	1.833	0.0499	2371.55	65	1750.0%	1	K.GLSSLLCNFTKSMEEDPQTSK.E
*	TK120303_NMyc_cyto3_step02.4457.4457.2	1.003	0.113	1439.22	20	3640.0%	1	K.VCLDIVYKMVAK.L
UFDFT_MOUSE61.4%5716.6%416481266.2(P53798) Farnesyl-diphosphate farnesyltransferase (EC 2.5.1.21) (Squalene synthetase) (SQS) (SS) (FPP:FPP farnesyltransferase) 
*	TK120303_NMyc_cyto3_step03.2411.2411.1	1.6695	0.0682	1476.85	7	3460.0%	2	R.SFAAVIQALDGDIR.H
*	TK120303_NMyc_cyto3_step03.2202.2202.3	1.4636	0.1027	1651.32	19	2920.0%	1	K.CLGHPEEFYNLLR.F
	TK120303_NMyc_cyto3_step04.0003.0003.2	0.9255	0.0431	1967.28	70	2330.0%	1	K.DRQVLEDFPTISLEFR.N
*	TK120303_NMyc_cyto3_step06.0569.0569.2	1.1548	0.0175	3026.54	2	1800.0%	1	R.HAICVFYLVLRALDTVEDDMSISVEK.K
UGC3_HUMAN61.4%115.5%290323317.6(P01860) Ig gamma-3 chain C region (Heavy chain disease protein) (HDC) 
*	TK120303_NMyc_cyto3_step03.2386.2386.2	2.1995	0.0866	1808.17	1	4670.0%	1	R.VVSVLTVLHQNWLDGK.E
U9KD_HUMAN61.4%51730.5%8285946.2(P13994) 9 kDa protein 
*	TK120303_NMyc_cyto3_step06.4245.4245.2	2.058	0.0739	2368.17	1	3120.0%	4	K.SHPGGGGERPGLAGQGEPDHPAGAR.D
UCHD1_MOUSE61.4%664.9%17111964107.4(P40201) Chromodomain-helicase-DNA-binding protein 1 (CHD-1) 
	TK120303_NMyc_cyto3_step10.1311.1311.1	0.9202	0.0416	1174.6	87	2780.0%	1	K.ENTNHDDSSR.D
	TK120303_NMyc_cyto3_step08.2615.2615.2	1.9204	0.275	2068.0	1	3750.0%	1	R.EYGYASLHKELEPFLLR.R
	TK120303_NMyc_cyto3_step03.1835.1835.1	1.4643	0.018	922.75	3	6670.0%	1	K.KQVNIYR.L
*	TK120303_NMyc_cyto3_step11.3135.3135.3	1.7695	0.0068	3598.54	35	1250.0%	1	K.QPQQAQQQRPASSNSGSEEDSSSSEDSDDSSSGAK.R
*	TK120303_NMyc_cyto3_step06.3228.3228.3	1.5078	0.076	3757.68	126	1070.0%	1	K.QPQQAQQQRPASSNSGSEEDSSSSEDSDDSSSGAKR.K
	TK120303_NMyc_cyto3_step09.2212.2212.1	1.2406	0.0289	1551.58	14	3750.0%	1	K.RPYSSFSNGKDHR.E
UO8844361.4%225.5%585689966.0(O88443) SWAP-70 
	TK120303_NMyc_cyto3_step09.1796.1796.1	1.687	0.1227	1033.71	1	6250.0%	1	K.VAHHEGLIR.L
*	TK120303_NMyc_cyto3_step05.3112.3112.2	1.2064	0.1072	2676.49	10	2050.0%	1	R.DDDEGPVSNQGYMPYLNKFILEK.V
UQ9UPZ661.3%8209.9%12901437786.9(Q9UPZ6) Hypothetical protein KIAA0960 (Fragment) 
*	TK120303_NMyc_cyto3_step07.3444.3444.2	1.5106	0.0758	2581.43	2	2390.0%	4	R.SILAYAGEEGGIRCPNSSALQEVR.S
*	TK120303_NMyc_cyto3_step08.2240.2240.2	1.9662	0.1252	1860.56	1	4290.0%	1	K.WLREKPYNGGRPCPK.L
*	TK120303_NMyc_cyto3_step08.2960.2960.3	1.979	0.1455	3491.8	68	1120.0%	1	K.VRCMQNTADGPSEHVEDYLCDPEEMPLGSR.V
*	TK120303_NMyc_cyto3_step08.3455.3455.2	1.5299	0.0084	2921.29	10	1800.0%	1	R.TVWCQRSDGINVTGGCLVMSQPDADR.S
*	TK120303_NMyc_cyto3_step10.2818.2818.3	1.9259	0.0687	4076.32	16	1330.0%	1	K.LDHVNQAQVYEVVPCHSDCNQYLWVTEPWSICK.V
UCA24_MOUSE61.3%7712.7%17071673918.6(P08122) Collagen alpha 2(IV) chain precursor 
*	TK120303_NMyc_cyto3_step03.4199.4199.2	0.9574	0.0141	1495.93	37	2140.0%	1	R.GSPGMDGFQGMLGLK.G
	TK120303_NMyc_cyto3_step08.2086.2086.2	1.8986	0.277	1511.78	1	3670.0%	1	K.AGPQGRGGVSAVPGFR.G
*	TK120303_NMyc_cyto3_step12.2183.2183.3	1.6316	0.0113	4501.55	24	960.0%	1	K.GQPGFPGPSGQPGQSGPPGQHAFPGTPGREGPLGQPGSPGLGGLPGDR.G
*	TK120303_NMyc_cyto3_step12.1358.1358.3	1.5297	0.0082	4564.95	3	1060.0%	1	R.GEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNR.G
*	TK120303_NMyc_cyto3_step02.1945.1945.2	1.1356	0.0479	2708.58	2	1850.0%	1	K.GIQGMPGVPGVSGFPGLPGRPGFIKGVK.G
*	TK120303_NMyc_cyto3_step07.4316.4316.3	2.1958	0.1171	3737.17	2	1310.0%	1	K.GTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTR.G
*	TK120303_NMyc_cyto3_step04.4314.4314.2	1.2248	0.1133	1982.0	1	3000.0%	1	R.GEPGDPGVPGPVGMKGLSGDR.G
UDLG2_HUMAN61.2%7274.8%870975006.4(Q15700) Channel associated protein of synapse-110 (Chapsyn-110) (Discs, large homolog 2) 
*	TK120303_NMyc_cyto3_step11.3749.3749.2	1.8441	0.2772	3039.49	1	2400.0%	1	K.EQSEQETSDPERGQEDLILSYEPVTR.Q
*	TK120303_NMyc_cyto3_step10.1049.1049.2	1.0143	0.0658	1723.84	4	3000.0%	1	R.VMLEGDSEEMGVIPSK.R
UQ9CXL161.2%1116.6%157174955.9(Q9CXL1) 3200001F09Rik protein 
*	TK120303_NMyc_cyto3_step05.2595.2595.3	2.884	0.12	2955.63	4	2000.0%	1	K.EKDVVYPGIAVFFQNAFIFFGGLVFK.F
UQ8VFA061.2%117.2%321370528.7(Q8VFA0) Olfactory receptor MOR225-5 
*	TK120303_NMyc_cyto3_step02.3791.3791.2	2.1218	0.2372	2698.19	1	2500.0%	1	K.DKEISVFYTVIAPMLNPLIYTLR.N
UO0884761.1%4161.5%19662167607.5(O08847) RNA polymerase II largest subunit 
*	TK120303_NMyc_cyto3_step12.3976.3976.2	1.4617	0.0453	3096.08	14	1550.0%	4	K.GSTYSPTSPGYSPTSPTYSLTSPAISDEEN.-
UKDGT_HUMAN61.0%225.6%9421014037.8(P52824) Diacylglycerol kinase, theta (EC 2.7.1.107) (Diglyceride kinase) (DGK-theta) (DAG kinase theta) 
*	TK120303_NMyc_cyto3_step01.3386.3386.2	1.7844	0.2932	2554.44	3	2390.0%	1	R.WTILLDAHEAGSAENDTADAEPPK.I
*	TK120303_NMyc_cyto3_step06.2093.2093.3	1.2387	0.0305	2760.07	56	1610.0%	1	K.TQSFRIVEAAEPGEGGDGADGSAAVGPGR.E
UY056_HUMAN61.0%222.6%15071697177.6(P42695) Hypothetical protein KIAA0056 (Fragment) 
*	TK120303_NMyc_cyto3_step07.2584.2584.3	1.7619	0.1083	3520.59	4	1500.0%	1	R.HHSHFHSGDDSQVLAWALLTLLTTESQELSR.Y
*	TK120303_NMyc_cyto3_step03.2195.2195.1	1.6431	0.1351	974.6	2	6430.0%	1	K.EIKLLAMR.S
UQ96NL760.8%3320.2%450472366.6(Q96NL7) Hypothetical protein FLJ30651 
*	TK120303_NMyc_cyto3_step04.3499.3499.2	1.7972	0.1473	1977.19	11	2630.0%	1	-.MAEGAQPQQPPQLGPGAAAR.G
*	TK120303_NMyc_cyto3_step07.2069.2069.2	2.1849	0.0147	2508.33	1	2920.0%	1	R.ESELELPVPGAGGDGADPGLSKRPR.T
*	TK120303_NMyc_cyto3_step07.3733.3733.3	1.1461	0.0564	4788.69	8	1110.0%	1	K.MVTPYANGWKLSPVVGAVYGPELYAAFSFQADVSLGNDAAVPLSGR.G
UCD11_MOUSE60.8%5179.8%336385547.2(P11609) T-cell surface glycoprotein CD1d1 precursor (CD1.1 antigen) 
*	TK120303_NMyc_cyto3_step10.3162.3162.2	1.7814	0.0937	2766.72	12	1880.0%	4	K.VLNADQGTSATVQMLLNDTCPLFVR.G
	TK120303_NMyc_cyto3_step02.1328.1328.1	1.5452	0.0073	1009.66	1	7140.0%	1	R.RSAYQDIR.-
UQ1513460.8%4412.6%8871009886.7(Q15134) Phosphatidylinositol 3-kinase 
*	TK120303_NMyc_cyto3_step08.2050.2050.3	1.7571	0.1952	3406.9	22	1580.0%	1	K.DGDESSPILTSFELVKVPDPQMSLENLVESK.H
*	TK120303_NMyc_cyto3_step10.3001.3001.3	2.8679	0.1663	3050.25	1	1900.0%	1	R.NAQVALTIWDVYGPGKAVPVGGTTVSLFGK.Y
*	TK120303_NMyc_cyto3_step09.1988.1988.3	1.2987	0.0256	3250.93	1	1980.0%	1	K.VWPNVEADGSEPTNTPGRTSSTLSEDQMSR.L
*	TK120303_NMyc_cyto3_step03.3007.3007.2	1.3289	0.0414	2465.8	44	1750.0%	1	K.TKEVPDGENLEQDLCTFLISR.A
UTRFR_HUMAN60.7%3910.1%398450858.3(P34981) Thyrotropin-releasing hormone receptor (TRH-R) (Thyroliberin receptor) 
*	TK120303_NMyc_cyto3_step02.3544.3544.3	1.9498	0.1645	4448.98	7	1220.0%	3	K.ESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS.-
UQ9CY5960.6%113.0%302336329.1(Q9CY59) 2500002N19Rik protein 
	TK120303_NMyc_cyto3_step07.1925.1925.1	1.4954	0.1684	1136.48	3	6250.0%	1	K.VYFKDTHPK.F
UG45B_HUMAN60.6%1115.0%160178184.4(O75293) Growth arrest and DNA-damage-inducible protein GADD45 beta (Negative growth-regulatory protein MyD118) (Myeloid differentiation primary response protein MyD118) 
*	TK120303_NMyc_cyto3_step10.2492.2492.2	1.8333	0.2865	2545.64	2	2610.0%	1	R.VSGMQRLAQLLGEPAETQGTTEAR.D
UQ96L7660.5%113.9%785866248.0(Q96L76) ATP-binding cassette transporter G1 
*	TK120303_NMyc_cyto3_step08.3622.3622.3	2.7115	0.2411	3317.75	1	1750.0%	1	R.DSVLTHLRITSHIGIGLLIGLLYLGIGNETK.K
UQ1466760.5%778.1%22302531547.2(Q14667) Hypothetical protein KIAA0100 (Fragment) 
*	TK120303_NMyc_cyto3_step07.2533.2533.3	1.4642	0.1031	3093.68	1	1960.0%	1	R.DLLRATVFPETVPSLALETSGTTSELEGR.A
*	TK120303_NMyc_cyto3_step06.2175.2175.2	1.4056	0.0070	2127.71	7	2940.0%	1	K.LLSHDLPHYVALCFGEVR.I
*	TK120303_NMyc_cyto3_step12.1940.1940.3	1.7432	0.0084	2796.65	3	2160.0%	1	R.NRVWLLSFGSVSVEFPYQYDFSR.T
*	TK120303_NMyc_cyto3_step03.2580.2580.3	2.4173	0.1334	3602.94	3	1690.0%	1	R.IVCLNSLKASVQVTTIDLSASLVLNTCIIHYR.H
*	TK120303_NMyc_cyto3_step01.2974.2974.2	1.8522	0.2775	3158.54	1	2330.0%	1	R.LDTLTILGSAETSTVGIQGLVLALVKSVTEK.M
*	TK120303_NMyc_cyto3_step05.1429.1429.1	1.1229	0.0301	1297.37	11	4380.0%	1	R.YLFEIRDWR.L
*	TK120303_NMyc_cyto3_step11.2542.2542.3	1.9259	0.0714	4077.04	6	1280.0%	1	K.FITLAAESVSLSRHGGSLQAYCPELAAGFDGNSIFNFK.E
UAOC3_HUMAN60.5%10289.4%763846226.5(Q16853) Membrane copper amine oxidase (EC 1.4.3.6) (Vascular adhesion protein-1) (VAP-1) (HPAO) 
*	TK120303_NMyc_cyto3_step12.2424.2424.3	1.6876	0.0818	3683.08	130	1180.0%	1	R.LVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGK.Y
*	TK120303_NMyc_cyto3_step11.2605.2605.3	1.6755	0.0163	3901.23	78	1110.0%	4	R.LGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDR.G
*	TK120303_NMyc_cyto3_step11.3302.3302.2	1.7627	0.0011	2983.31	25	1480.0%	3	R.LGPGLVDAAQARPSDNCVFSVELQLPPK.A
*	TK120303_NMyc_cyto3_step04.1632.1632.1	1.0459	0.0446	1031.62	67	4440.0%	1	R.YVDGGFGMGK.Y
UZN29_HUMAN60.5%86425.0%5663689.4(P17037) Zinc finger protein 29 (Zinc finger protein KOX26) (Fragment) 
*	TK120303_NMyc_cyto3_step01.2508.2508.1	1.4501	0.0541	1547.89	4	3460.0%	8	K.ECGEAFSQSSTLTK.H
UPTPZ_HUMAN60.5%111510.0%23142545284.9(P23471) Protein-tyrosine phosphatase zeta precursor (EC 3.1.3.48) (R-PTP-zeta) 
*	TK120303_NMyc_cyto3_step05.3728.3728.3	1.2846	0.0758	3837.29	13	1330.0%	1	K.GRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVR.K
*	TK120303_NMyc_cyto3_step08.3184.3184.3	1.7372	0.0671	3661.16	19	1360.0%	1	K.VFAGIPTVASDTFVSTDHSVPIGNGHVAITAVSPHR.D
*	TK120303_NMyc_cyto3_step07.3484.3484.3	1.9567	0.0343	3928.36	24	1150.0%	1	K.VILSLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV.-
*	TK120303_NMyc_cyto3_step05.3455.3455.3	1.6812	0.0455	4282.96	26	1250.0%	1	K.SEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK.L
*	TK120303_NMyc_cyto3_step05.2572.2572.3	1.9727	0.0256	3171.56	4	1850.0%	1	K.KAVIPLVIVSALTFICLVVLVGILIYWR.K
*	TK120303_NMyc_cyto3_step12.3924.3924.3	2.0622	0.0965	3788.16	6	1450.0%	2	K.CDQYWPADGSEEYGNFLVTQKSVQVLAYYTVR.N
*	TK120303_NMyc_cyto3_step12.1054.1054.1	1.4509	0.1941	1356.66	5	4090.0%	2	K.LIHSDEILTSTK.S
	TK120303_NMyc_cyto3_step07.2752.2752.2	1.8101	0.1309	1629.24	7	3670.0%	1	R.NASEDSTSSGSEESLK.D
UQ925U460.3%5514.7%652737016.1(Q925U4) EDEM protein 
	TK120303_NMyc_cyto3_step05.0573.0573.1	0.8976	0.0047	518.85	12	6250.0%	1	R.GTEGR.L
*	TK120303_NMyc_cyto3_step05.4289.4289.3	2.489	0.0391	3974.93	8	1440.0%	1	K.QPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTK.T
*	TK120303_NMyc_cyto3_step03.3724.3724.3	2.8862	0.0284	2957.17	3	2190.0%	1	K.QPFGDMTIEDYDNELLYMAHDLAVR.L
*	TK120303_NMyc_cyto3_step08.1920.1920.2	1.0221	0.0031	2338.49	11	1940.0%	1	K.EDLEMFNAAYQSIQSYLRR.G
*	TK120303_NMyc_cyto3_step12.4098.4098.3	1.7725	0.0234	3951.92	66	1080.0%	1	R.LETPPEPGPTPGPGVCGPAHWGYALGGGGCGPDEYERR.Y
UQ9BPX360.3%5710.0%10151143345.6(Q9BPX3) Chromosome-associated protein-G (Condensin subunit CAP-G) 
	TK120303_NMyc_cyto3_step04.2560.2560.2	1.5071	0.1781	1556.74	9	3210.0%	1	R.AVLSCIAPSAKTLPK.I
	TK120303_NMyc_cyto3_step10.2320.2320.2	1.2234	0.2394	2572.05	5	2500.0%	1	R.ILSRLILLWYNPVTEEDVQLR.H
	TK120303_NMyc_cyto3_step07.3607.3607.3	2.2203	0.069	4510.5	10	1050.0%	2	K.SKGDEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHR.G
*	TK120303_NMyc_cyto3_step10.4168.4168.3	2.8884	0.0641	3051.43	1	2120.0%	1	K.TLHCEGTEINSDDEQESKEVEETATAK.N
UQ91XY360.3%468.3%9321014065.0(Q91XY3) Protocadherin gamma A5 
*	TK120303_NMyc_cyto3_step05.1652.1652.3	1.9367	0.1388	1910.36	1	3240.0%	1	R.DGDVGVNSLQGYKLSSNR.H
*	TK120303_NMyc_cyto3_step12.3964.3964.2	1.484	0.0080	2938.71	26	1400.0%	2	K.VADINDNPPTFSRPFYSTSISENNPR.G
*	TK120303_NMyc_cyto3_step06.3204.3204.3	2.8889	0.0965	3617.64	2	1560.0%	1	R.LADMPASHFVGMDGVQAYLQTYSHEISLTTDSK.K
UPPOV_HUMAN60.3%668.1%17241925875.7(Q9UKK3) Vault poly(ADP-ribose) polymerase (EC 2.4.2.30) (VPARP) (193-kDa vault protein) (PARP-related/IalphaI-related H5/proline-rich) (PH5P) 
*	TK120303_NMyc_cyto3_step11.1245.1245.2	1.5484	0.046	1947.76	1	3530.0%	1	K.VGMEGGQEAVVVELQCSR.D
*	TK120303_NMyc_cyto3_step08.2387.2387.2	1.7213	0.1961	1638.85	18	3210.0%	1	K.QIALHALSLVGEKQK.V
*	TK120303_NMyc_cyto3_step03.1472.1472.1	1.1965	0.1845	1188.61	1	5000.0%	1	R.QVASFGSAAPPR.Q
*	TK120303_NMyc_cyto3_step10.1821.1821.3	1.492	0.1337	2805.55	8	1770.0%	1	R.GGVEKLLDLSWTESCKPTATEPLFK.K
*	TK120303_NMyc_cyto3_step03.3211.3211.3	2.8944	0.196	2968.43	6	1790.0%	1	K.AVISTMEGSSLDSSGFSLHIGLSAAYLPR.M
*	TK120303_NMyc_cyto3_step12.3744.3744.3	1.3917	0.0059	4522.92	70	810.0%	1	K.DFSLTEAPPGYDSVHGVSQTASVTTDFEDDEFVVYKTNQVK.M
UQ9NXB360.2%355.9%579650857.5(Q9NXB3) Hypothetical protein FLJ20342 
*	TK120303_NMyc_cyto3_step01.1562.1562.1	1.8012	0.0841	1144.64	2	6110.0%	1	R.VVEVVEETIK.G
*	TK120303_NMyc_cyto3_step11.3087.3087.2	1.143	0.0146	2736.01	36	1960.0%	2	R.AKQSFQEGVCEIWLTSEDTGAYGR.D
UQ8QZU660.2%5255.3%264291856.7(Q8QZU6) Similar to unknown (Protein for IMAGE:3534875) (Fragment) 
*	TK120303_NMyc_cyto3_step02.1672.1672.1	1.8095	0.0512	1588.69	2	4230.0%	5	R.VVAPHQLHSEANER.L
UQ9P15360.1%3325.0%144155878.6(Q9P153) PRO2729 (Similar to serine/threonine kinase 10) 
*	TK120303_NMyc_cyto3_step04.3346.3346.2	1.7531	0.3141	2645.46	1	2080.0%	1	R.LLPEPVPLSMLGGAVGVARAGCWHR.R
*	TK120303_NMyc_cyto3_step03.0523.0523.1	1.0721	0.1338	1152.19	53	3000.0%	1	R.QSLVYVGGGDR.G
UQ91YD360.0%337.5%602652197.0(Q91YD3) Transcription factor 
*	TK120303_NMyc_cyto3_step09.1465.1465.2	1.1172	0.0732	1675.59	26	2860.0%	1	R.LTPQHDQIQAQPLGK.G
	TK120303_NMyc_cyto3_step01.4463.4463.1	0.8708	0.057	855.66	11	5000.0%	1	K.NKDNHNL.-
*	TK120303_NMyc_cyto3_step12.3372.3372.2	2.1439	0.2214	2601.8	1	2730.0%	1	K.QSPSQANGCSDQRPIDILEMLSR.A
UO9486859.9%5510.8%684777525.6(O94868) Hypothetical protein KIAA0769 
*	TK120303_NMyc_cyto3_step03.3655.3655.1	1.7881	0.0973	1212.8	1	6670.0%	1	-.MQKLASQYLK.R
*	TK120303_NMyc_cyto3_step04.0456.0456.1	1.1556	0.0889	898.23	1	7500.0%	1	R.NYPLTCK.V
*	TK120303_NMyc_cyto3_step01.2888.2888.1	1.3182	0.0729	1473.86	95	2690.0%	1	K.SLHAESPGFSQASR.H
*	TK120303_NMyc_cyto3_step10.1810.1810.3	1.6098	0.041	2321.77	1	2620.0%	1	K.ATHARNDYLLTLAAANAHQDR.Y
*	TK120303_NMyc_cyto3_step08.3038.3038.2	1.358	0.0117	2613.6	5	2140.0%	1	R.YYQTDLVNIMKALDGNVYDHLK.D
UO4360659.9%4612.9%604697525.5(O43606) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step02.2981.2981.2	1.7398	0.1714	1904.84	34	2670.0%	1	K.GDFDLQIAKQDYYTAR.Q
*	TK120303_NMyc_cyto3_step03.0906.0906.3	1.2733	0.1262	4681.69	5	1050.0%	1	K.QFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERR.L
*	TK120303_NMyc_cyto3_step05.3096.3096.2	2.0788	0.263	2590.15	1	2500.0%	2	K.QNISLVQDQLAVSAQEHSFFLSK.R
UQ91ZE659.8%162810.1%25552881336.0(Q91ZE6) Beta4-spectrin 
*	TK120303_NMyc_cyto3_step10.2129.2129.3	1.7492	0.0602	3649.24	3	1370.0%	1	K.LQSMESQVEEWCREVGELQAQTAALPLEQASK.E
*	TK120303_NMyc_cyto3_step01.0454.0454.3	1.5063	0.2849	3605.69	7	1610.0%	1	R.VLDVNQTVQELVEGGHPSSDEVRSCQDHLNSR.W
	TK120303_NMyc_cyto3_step06.1111.1111.1	0.7381	0.0055	593.42	2	5000.0%	1	R.VGYVR.Q
	TK120303_NMyc_cyto3_step07.1903.1903.2	1.2603	0.0313	1846.29	20	2500.0%	1	R.WLRHQAFMAELAQNK.E
*	TK120303_NMyc_cyto3_step06.2587.2587.2	1.8876	0.1428	1970.78	6	2860.0%	3	R.RVSLEQQYWLYQLSR.Q
	TK120303_NMyc_cyto3_step01.4378.4378.2	1.3705	0.1573	2863.77	316	1200.0%	1	R.LAAVNQMVDELIECGHTAAATMAEWK.D
	TK120303_NMyc_cyto3_step08.3334.3334.2	1.5091	0.0895	2753.41	6	1740.0%	3	R.AFEHDLQLLVSQVRQLQEGAAQLR.T
	TK120303_NMyc_cyto3_step02.0991.0991.2	1.1959	0.1073	1095.82	4	4440.0%	1	R.TAEQHLGLAR.L
*	TK120303_NMyc_cyto3_step12.1751.1751.3	1.8522	0.1123	4446.67	5	1380.0%	1	R.EEDYARIVAASEALLASEGAELGPGLALDEWLPHLEVGWHK.L
	TK120303_NMyc_cyto3_step03.1912.1912.3	1.9879	0.0909	1746.26	2	3570.0%	1	K.KHEAIEADIAAYEER.V
	TK120303_NMyc_cyto3_step04.2191.2191.1	1.0664	0.0813	1324.63	106	3180.0%	1	R.KFFGDPTELAAK.A
*	TK120303_NMyc_cyto3_step10.2038.2038.3	1.832	0.0718	3831.34	5	1420.0%	1	R.LEQNLALQKVFQEMVYMVDWMEEMQTQLLSR.E
UQ9UFD859.8%556.6%19082083396.2(Q9UFD8) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step11.1610.1610.2	1.0018	0.112	2546.63	90	1670.0%	1	R.TSCLPVHFVVLTQLYNAIMNIL.-
*	TK120303_NMyc_cyto3_step05.2743.2743.3	1.9604	0.0397	3465.53	13	1560.0%	1	R.TQGNIGCGGDTDPGQSSSQPSQDGQESVTERER.I
*	TK120303_NMyc_cyto3_step12.2220.2220.3	1.5706	0.0847	4360.67	7	1340.0%	1	R.AGSSSLTQVTDLAPSLHDLDNIFDNSDDDELGAVSPALRSSK.M
*	TK120303_NMyc_cyto3_step03.1875.1875.2	1.81	0.2792	1810.15	1	4230.0%	1	R.CYTEMLDNLPEHMR.N
*	TK120303_NMyc_cyto3_step08.3228.3228.2	1.6388	0.0399	1796.31	6	3460.0%	1	K.TFFRDLSAVYEMCR.L
UQ8R58559.8%5517.2%522580735.0(Q8R585) Similar to hypothetical protein FLJ22635 
*	TK120303_NMyc_cyto3_step02.4095.4095.3	1.2123	0.0876	3128.7	16	1520.0%	1	R.GVLYTIHADSWGRLWAGCGLDVAGPLALR.Q
*	TK120303_NMyc_cyto3_step01.1288.1288.1	1.2468	0.067	1140.43	1	5000.0%	1	R.SFANVTEPFK.V
*	TK120303_NMyc_cyto3_step06.3252.3252.2	1.2855	0.0993	2755.45	80	1250.0%	1	R.GEEVKQADVVLLGYPVPFPLTPDIR.R
*	TK120303_NMyc_cyto3_step01.1355.1355.1	1.1568	0.0948	660.5	35	5000.0%	1	R.TLGGALK.N
*	TK120303_NMyc_cyto3_step06.3575.3575.2	1.8162	0.2779	2033.36	1	3610.0%	1	R.VSVSGISYLGNKINFAFSK.D
UQ9BQA959.8%2227.3%187207746.8(Q9BQA9) Hypothetical protein 
*	TK120303_NMyc_cyto3_step12.2980.2980.2	1.3535	0.0347	2724.69	55	1400.0%	1	R.LATGFSHPLTQSAVMGHRSDVEAIAK.L
*	TK120303_NMyc_cyto3_step01.3060.3060.2	1.8141	0.2824	3006.4	1	2290.0%	1	K.LFYVTGCLFVAVQNLEDWEEAIFDK.S
UQ9ERL759.8%119.2%142167485.7(Q9ERL7) Glia maturation factor-gamma (0610039G16Rik protein) (2310057N07Rik protein) (Glia maturation factor, gamma) 
*	TK120303_NMyc_cyto3_step01.1527.1527.1	1.7086	0.1101	1446.6	5	4580.0%	1	K.ETNNAAIIMKVDK.D
UQ9ESF959.7%41616.3%129145107.7(Q9ESF9) Odorant receptor B3 (Fragment) 
*	TK120303_NMyc_cyto3_step12.3816.3816.2	1.7987	0.2766	2600.85	1	2750.0%	4	-.AYDRYVAMCRPLHYPIIMNSK.V
UQ9CYH759.7%41610.9%1011180510.3(Q9CYH7) 5730460C07Rik protein 
*	TK120303_NMyc_cyto3_step11.2095.2095.2	1.4439	0.1641	1314.64	14	4500.0%	4	K.NPEIYISVYNT.-
UQ9UPF659.6%469.4%512551728.4(Q9UPF6) CD3e-associated protein 
	TK120303_NMyc_cyto3_step06.2372.2372.2	1.5496	0.0178	1991.99	8	3240.0%	2	R.FSCPPNFTAKPPASESPR.F
	TK120303_NMyc_cyto3_step11.3706.3706.2	1.5904	0.0179	3094.13	29	1380.0%	1	K.EPEAAGPVGTEPTVETLEPLGVLFPSTTKK.R
UQ9CT5859.5%222.9%380444245.5(Q9CT58) 2600001J17Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step03.4230.4230.1	0.6168	0.0193	644.44	8	5000.0%	1	K.QLKQK.L
	TK120303_NMyc_cyto3_step01.0191.0191.1	1.8257	0.0569	769.22	6	8000.0%	1	K.YQSLKK.Q
UQ9Z2X059.5%225.5%578654697.1(Q9Z2X0) SA 
	TK120303_NMyc_cyto3_step06.2099.2099.1	1.8215	0.0285	1232.67	10	5560.0%	1	R.KVEFIEELPK.T
*	TK120303_NMyc_cyto3_step02.4477.4477.2	1.1957	0.0205	2720.12	3	2140.0%	1	K.IEIPEYFNFAKDVLDQWDQYGK.G
UDPOA_HUMAN59.5%334.7%14621658605.9(P09884) DNA polymerase alpha catalytic subunit (EC 2.7.7.7) 
*	TK120303_NMyc_cyto3_step02.3045.3045.3	1.715	0.0314	3615.17	5	1580.0%	1	R.ICEPIDGIDAVLIATWLGLDPTQFRVHHYHK.D
*	TK120303_NMyc_cyto3_step12.1400.1400.3	1.9864	0.1986	1865.8	5	2660.0%	1	K.VEVAATERTLLGFFLAK.V
*	TK120303_NMyc_cyto3_step07.3131.3131.2	1.6964	0.3475	2269.98	4	2110.0%	1	R.TGPLCPACMKATLQPEYSDK.S
URFX5_HUMAN59.5%10824.7%616653239.3(P48382) DNA-binding protein RFX5 (Regulatory factor X subunit 5) 
*	TK120303_NMyc_cyto3_step03.2788.2788.2	1.3965	0.2301	1991.41	6	2780.0%	1	R.APRSLIPPIPVSPPILAPR.L
*	TK120303_NMyc_cyto3_step02.2112.2112.1	1.7236	0.0893	1165.79	21	4440.0%	9	K.KPERLAQPPK.D
UDBP_MOUSE59.4%149811.4%325344289.4(Q60925) D-site-binding protein (Albumin D box-binding protein) 
	TK120303_NMyc_cyto3_step01.0787.0787.1	1.1297	0.012	547.43	2	7500.0%	1	R.AVLSR.Y
*	TK120303_NMyc_cyto3_step11.3662.3662.2	1.623	0.0098	3040.25	1	1940.0%	9	-.MARPLSDRTPGPLLLGGPAGAPPGGGALLGLR.S
UQ96LD459.4%4417.2%638695326.4(Q96LD4) Gene overexpressed in astrocytoma 
*	TK120303_NMyc_cyto3_step11.3483.3483.2	1.2176	0.2022	2892.88	2	2170.0%	1	R.VCLCEACAAQEHRGHELVPLEQER.A
*	TK120303_NMyc_cyto3_step05.2687.2687.3	1.652	0.1476	4311.24	25	1220.0%	1	R.SFSVWFHGLEAPLPHPFSPTVGVCLEYADRALAFYAVR.D
*	TK120303_NMyc_cyto3_step11.3045.3045.2	1.5901	0.0446	2795.5	25	1670.0%	1	R.GASGAGGPGGAARCPLCQEPFPDGLQLR.K
*	TK120303_NMyc_cyto3_step11.3259.3259.2	2.0784	0.2614	2119.71	2	3420.0%	1	K.VLSAVEDRMDELGAGIAQSR.R
UQ96IA759.4%71316.6%554623007.1(Q96IA7) Hypothetical protein FLJ31409 (Fragment) 
*	TK120303_NMyc_cyto3_step12.1287.1287.2	1.4818	1.0E-4	1865.42	12	3570.0%	1	-.WEWSGGSVVMWLDRR.G
*	TK120303_NMyc_cyto3_step03.1552.1552.2	1.5735	0.081	1815.84	17	3570.0%	1	R.WVGHSLLHVFSTEFR.A
*	TK120303_NMyc_cyto3_step07.3935.3935.1	0.5565	0.0143	766.75	17	3000.0%	1	R.RPSFTR.T
*	TK120303_NMyc_cyto3_step10.2244.2244.3	2.1833	0.1451	2627.77	1	2620.0%	3	R.LQLNEKPVQDLNIVLKDNDFLR.N
*	TK120303_NMyc_cyto3_step03.1656.1656.3	2.6431	0.2499	3238.92	1	1970.0%	1	K.VELSPGPPKPAGREVEPAPVGGEHPSAAAPGPGK.H
UQ9H4U359.3%224.4%798847737.9(Q9H4U3) DJ14N1.1.2 (Profilaggrin 3' end) (Fragment) 
	TK120303_NMyc_cyto3_step10.4192.4192.2	1.2381	0.0691	2327.58	416	1250.0%	1	R.RQGSSVSQDSDSEAYPEDSER.R
*	TK120303_NMyc_cyto3_step02.2756.2756.1	1.6964	0.1131	1545.44	1	4620.0%	1	R.HGSHHQLQSADSSR.H
UQ9CUR159.3%112.1%611721326.0(Q9CUR1) 4921528I01Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step02.2137.2137.1	1.694	0.1158	1587.72	3	4170.0%	1	K.EHENFSKINAELR.S
UO3505659.2%3511.3%150171136.3(O35056) KIF16B (Fragment) 
*	TK120303_NMyc_cyto3_step08.1748.1748.1	1.0947	0.0174	1185.46	29	3890.0%	2	K.FTQAKFDAEK.L
*	TK120303_NMyc_cyto3_step01.0291.0291.1	1.1211	0.0743	790.43	2	6670.0%	1	K.LIDTVDL.-
UPAX7_MOUSE59.2%112.8%290329119.5(P47239) Paired box protein Pax-7 (Fragment) 
	TK120303_NMyc_cyto3_step02.1467.1467.1	1.4865	0.1683	936.81	3	5710.0%	1	K.EDDEEGDK.K
UQ9273859.2%4105.3%828941049.1(Q92738) Hypothetical protein KIAA0019 
*	TK120303_NMyc_cyto3_step02.3648.3648.2	2.1769	0.1694	2937.02	2	2220.0%	3	K.RGSTASQYDNVPGPELDSGASVEEALER.A
*	TK120303_NMyc_cyto3_step10.1415.1415.2	1.129	0.0171	1824.25	1	4330.0%	1	K.NGKLIIPPVDYLPDNR.T
URHG6_HUMAN59.1%337.9%9741059747.4(O43182) Rho-GTPase-activating protein 6 (Rho-type GTPase-activating protein RhoGAPX-1) 
*	TK120303_NMyc_cyto3_step06.3315.3315.3	1.8896	0.0535	4276.84	6	1220.0%	1	R.DDKRPPPPYPGPGKPAAAAAWIQGPPEGVETPTDQGGQAAER.E
*	TK120303_NMyc_cyto3_step06.2787.2787.3	2.511	0.3571	3919.87	1	1450.0%	1	K.RPPPPYPGPGKPAAAAAWIQGPPEGVETPTDQGGQAAER.E
*	TK120303_NMyc_cyto3_step11.4102.4102.3	1.9418	0.0264	3667.17	78	1100.0%	1	K.DPGMTGSSGDIFESSSLRAGPCSLSQGNLSPNWPR.W
UQ9P2C959.1%559.7%8891003058.8(Q9P2C9) Hypothetical protein KIAA1418 (Fragment) 
	TK120303_NMyc_cyto3_step11.2342.2342.2	1.4823	0.0354	2357.59	2	2500.0%	1	R.VNPVEYSIVMEFLDPGGPMMK.L
	TK120303_NMyc_cyto3_step03.2132.2132.3	1.4792	0.0578	3432.13	2	1470.0%	1	K.FDFPVSYLPGPVKASIQECILPDSPLYHNK.V
	TK120303_NMyc_cyto3_step11.1597.1597.3	1.6237	0.0781	2852.12	35	1630.0%	1	R.FEIEYQGDPELQPIRSYEIASLVR.T
	TK120303_NMyc_cyto3_step05.1555.1555.1	1.6315	0.123	1080.61	4	5560.0%	1	R.QVAGHTRGPR.L
	TK120303_NMyc_cyto3_step11.1437.1437.2	1.5662	0.0754	1990.96	18	3000.0%	1	R.RFEIEYQGDPELQPIR.S
UQ9CY2659.1%112.3%298333665.5(Q9CY26) 2700085E05Rik protein 
	TK120303_NMyc_cyto3_step06.2556.2556.1	1.4461	0.188	863.47	1	6670.0%	1	R.ALHFVFK.V
UQ8R42059.1%448.0%17041919847.2(Q8R420) ATP-binding cassette transporter ABCA3 
*	TK120303_NMyc_cyto3_step08.2922.2922.3	2.8209	0.21	4092.6	3	1380.0%	1	R.DLTLNLYEGQITVLLGHNGAGKTTTMSLLTGLFPPTSGR.A
*	TK120303_NMyc_cyto3_step12.3790.3790.3	2.4964	0.0133	3380.17	1	1850.0%	1	K.GFDIALNLLIAMAFLASTFSILAVSERAVQAK.H
*	TK120303_NMyc_cyto3_step12.3272.3272.3	2.2994	0.1454	4620.25	17	1000.0%	1	K.MVAAQVLVPLTCLTQALLAIHYTSEIFDDPLLKLSLNEYGR.T
*	TK120303_NMyc_cyto3_step10.2830.2830.3	2.3098	0.1647	2659.01	53	1740.0%	1	R.TVLLTTHFMDEADLLGDRIAILAK.G
UQ8VHV958.9%334.6%13321494276.0(Q8VHV9) Ikap 
	TK120303_NMyc_cyto3_step01.1078.1078.1	1.6258	0.1209	586.51	1	9000.0%	1	K.VAGLAR.T
	TK120303_NMyc_cyto3_step03.2071.2071.3	2.0427	0.0034	3738.91	31	1320.0%	1	R.QAPQVHVDHEVAHGPESDLFSETSSIMSGSEMSGR.Y
	TK120303_NMyc_cyto3_step09.1680.1680.2	0.7997	0.0242	2037.49	218	1320.0%	1	K.LGAVGGNGFKVPLTTPHLEK.R
UCA16_HUMAN58.8%81411.6%10281085475.5(P12109) Collagen alpha 1(VI) chain precursor 
*	TK120303_NMyc_cyto3_step12.3318.3318.2	1.3942	0.0989	1730.62	3	3060.0%	1	R.EGPVGVPGDPGEAGPIGPK.G
*	TK120303_NMyc_cyto3_step06.2851.2851.2	1.8513	0.1711	2201.29	3	2620.0%	3	K.GDEGEAGDPGDDNNDIAPRGVK.G
	TK120303_NMyc_cyto3_step01.0828.0828.1	0.7292	0.0588	586.28	72	4000.0%	1	R.GTPGPR.G
*	TK120303_NMyc_cyto3_step10.4262.4262.2	1.1218	0.0566	2118.67	2	2500.0%	1	K.HLGVKVFSVAITPDHLEPR.L
*	TK120303_NMyc_cyto3_step09.2908.2908.2	1.7328	0.1362	2742.52	34	1550.0%	1	R.GDEGPPGSEGARGAPGPAGPPGDPGLMGER.G
*	TK120303_NMyc_cyto3_step10.2786.2786.3	1.9768	0.0393	3867.13	13	1310.0%	1	R.GAPGPAGPPGDPGLMGERGEDGPAGNGTEGFPGFPGYPGNR.G
UQ9UPP258.7%469.7%740801115.9(Q9UPP2) Hypothetical protein KIAA1110 (Fragment) 
*	TK120303_NMyc_cyto3_step10.2857.2857.3	2.2455	0.0031	3051.1	13	1530.0%	2	R.APESAGPGPGGDAAETPGLPPAHSGTLMMAFR.D
*	TK120303_NMyc_cyto3_step05.3225.3225.3	1.7707	0.0111	4224.11	63	960.0%	1	R.GAPVPPPDLQPSPPRQQTPPLPPPPPTPPGTLVQCQQIVK.V
UQ9Y6X658.7%110.7%10451141668.3(Q9Y6X6) Hypothetical protein KIAA0865 (Fragment) 
	TK120303_NMyc_cyto3_step08.1176.1176.1	1.5818	0.1392	792.42	2	6670.0%	1	K.QPPPKPK.R
UKF3B_MOUSE58.7%559.6%747852887.7(Q61771) Kinesin-like protein KIF3B (Microtubule plus end-directed kinesin motor 3B) 
	TK120303_NMyc_cyto3_step03.2711.2711.2	2.0879	0.2493	1938.21	1	4000.0%	1	K.NIVDHTNEQQKILEQK.R
*	TK120303_NMyc_cyto3_step07.4430.4430.1	1.0298	0.1292	1554.2	25	2500.0%	1	K.ETYTSLQQEVDIK.T
	TK120303_NMyc_cyto3_step02.0552.0552.1	1.2051	0.0229	1592.7	116	2920.0%	1	K.DALLREFQEEIAR.L
	TK120303_NMyc_cyto3_step04.1390.1390.3	1.9574	0.1028	2955.38	56	1560.0%	1	R.GVIPNSFDHIFTHISRSQNQQYLVR.A
	TK120303_NMyc_cyto3_step01.1271.1271.1	0.8825	0.0021	631.62	3	7500.0%	1	R.ELKLK.H
UQ9JJG358.6%4410.8%10321099177.9(Q9JJG3) Brain cDNA, clone MNCb-1826 
*	TK120303_NMyc_cyto3_step03.3152.3152.3	1.6427	0.1566	4056.19	45	1140.0%	1	K.GYLPGNSPLQGLENCLREFPIPRPQAAWPCSSAVNR.G
*	TK120303_NMyc_cyto3_step01.3228.3228.3	1.6454	0.0294	3514.64	71	1290.0%	1	R.GSMGTGTLPENSPLQGLINCLKEILVPRPQHR.G
*	TK120303_NMyc_cyto3_step04.1851.1851.2	1.7764	0.2829	2009.43	3	2890.0%	1	K.GAAAGHPSPAPQLEEKPEPK.G
*	TK120303_NMyc_cyto3_step11.2469.2469.2	1.4425	0.1236	2407.71	10	2050.0%	1	R.VAAISIPNQPKEPDSLLGEALSR.D
UQ9D13558.6%2224.7%150163624.9(Q9D135) 2300003P22Rik protein 
*	TK120303_NMyc_cyto3_step08.2800.2800.3	2.0694	0.1138	3215.03	2	1810.0%	1	R.LLPVGSSLEDEFDLELIEEEEGSSAPEGSH.-
*	TK120303_NMyc_cyto3_step06.1345.1345.1	1.4477	0.185	763.54	4	5830.0%	1	K.VGHVPVR.F
UQ9DC8658.5%3325.1%263278215.2(Q9DC86) 2200008D09Rik protein 
	TK120303_NMyc_cyto3_step05.3293.3293.2	1.2602	0.0734	2366.1	21	2000.0%	1	R.IVNGEDAIPGSWPWQVSLQDR.T
	TK120303_NMyc_cyto3_step10.3024.3024.3	2.7115	0.2256	4584.98	5	1130.0%	1	R.NDITLLKLATPAQFSETVSAVCLPTVDDDFPAGTLCATTGWGK.T
	TK120303_NMyc_cyto3_step01.3670.3670.3	1.7284	0.0355	4013.67	31	1150.0%	1	K.LATPAQFSETVSAVCLPTVDDDFPAGTLCATTGWGKTK.Y
UCGB1_HUMAN58.5%2211.3%433483377.5(P14635) G2/mitotic-specific cyclin B1 
*	TK120303_NMyc_cyto3_step09.3289.3289.3	2.2802	0.2181	3622.85	1	1720.0%	1	K.LPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVK.E
*	TK120303_NMyc_cyto3_step10.3352.3352.2	1.8422	0.2712	1620.4	1	4000.0%	1	R.VPTAPAATSKPGLRPR.T
UQ9Z12558.5%3317.6%507554295.1(Q9Z125) OASIS protein 
	TK120303_NMyc_cyto3_step02.2263.2263.3	1.8355	0.0508	3690.75	45	1180.0%	1	K.QEQSPELPVDPLAASSAMAAAAAMATPPLLGLSPMPR.L
	TK120303_NMyc_cyto3_step09.3472.3472.2	1.8327	0.273	3176.91	1	1960.0%	1	R.GALLPVEPPEGWELKPGGPAEQRPQDHLR.H
	TK120303_NMyc_cyto3_step09.4275.4275.2	1.2516	0.0246	2705.12	65	1590.0%	1	K.YLRETWPEDTDDNGTSPNFSHPK.G
UABC9_MOUSE58.5%6813.1%762839637.6(Q9JJ59) ATP-binding cassette, sub-family B, member 9 precursor (ATP-binding cassette transporter 9) (ABC transporter 9 protein) (TAP-like protein) (TAPL) (mABCB9) 
*	TK120303_NMyc_cyto3_step11.0120.0120.3	2.1533	0.2058	3960.9	4	1570.0%	2	R.ALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQR.H
	TK120303_NMyc_cyto3_step08.2774.2774.2	1.5354	0.0384	2404.6	6	2250.0%	1	R.SLVSQETSFFDENRTGDLISR.L
*	TK120303_NMyc_cyto3_step07.2293.2293.2	1.4848	0.0193	2257.06	8	2630.0%	1	R.ASWLVITLVCLFVGIYAMAK.L
	TK120303_NMyc_cyto3_step10.4137.4137.2	1.8223	0.2714	2042.99	4	2780.0%	1	R.VVQQGTHQQLLAQGGLYAK.L
	TK120303_NMyc_cyto3_step08.1146.1146.1	1.4139	0.011	541.35	5	10000.0%	1	R.RPIR.D
UP9749958.5%10109.2%26292914587.2(P97499) Telomerase protein-1 
*	TK120303_NMyc_cyto3_step08.2856.2856.2	1.1963	0.0514	1838.33	8	3210.0%	1	R.QFPFRFLNAHDSIDK.L
*	TK120303_NMyc_cyto3_step08.2539.2539.2	1.4793	0.0021	2614.34	1	1900.0%	1	K.KLVEYLHIHKPAQHVQALLGYR.Y
*	TK120303_NMyc_cyto3_step10.3074.3074.3	2.1251	0.055	3491.55	4	1720.0%	1	K.IHGHRSVHSDILSLENQCLTMLSDLQPTER.I
*	TK120303_NMyc_cyto3_step10.1533.1533.3	1.1482	0.0531	2370.06	7	2240.0%	1	R.QLLTQPHVHAVELPCCAELR.G
*	TK120303_NMyc_cyto3_step01.0738.0738.1	1.2083	0.109	614.39	1	8000.0%	1	K.IVAVGR.I
*	TK120303_NMyc_cyto3_step07.2493.2493.3	1.422	7.0E-4	3504.99	26	1330.0%	1	R.DPDFLSSVPDAWKPDFISESEEAAHRVSELK.R
*	TK120303_NMyc_cyto3_step03.3392.3392.3	2.1642	0.1137	4000.29	8	1320.0%	1	R.CEGPVSCLEPWMEPSSPLQLAVGDTQGNLYFLSWE.-
*	TK120303_NMyc_cyto3_step07.2224.2224.2	0.8175	0.022	833.89	163	4170.0%	1	R.VILFGQR.M
*	TK120303_NMyc_cyto3_step02.3276.3276.3	1.7878	0.0169	4702.3	32	910.0%	1	R.TLQGHSGPVTAAAASEASGLLLTSDDSSVQLWQIPKEADDSYKPR.S
*	TK120303_NMyc_cyto3_step10.2912.2912.3	2.5746	0.3152	3534.28	2	1920.0%	1	K.ETKSWEEVLAASHSGNPFPLCPFAYLVQSLR.S
UQ8VI3758.5%113.2%557608126.3(Q8VI37) Paxillin alpha 
*	TK120303_NMyc_cyto3_step07.2019.2019.2	2.1752	0.1318	1957.76	2	4410.0%	1	R.YAHQQPPSPLPVYSSSAK.N
UQ9H1B658.3%226.3%827944908.9(Q9H1B6) Xylosyltransferase I (EC 2.4.2.26) (Fragment) 
*	TK120303_NMyc_cyto3_step12.3390.3390.2	1.7493	0.3009	3144.86	1	2040.0%	1	R.NAYMEQSFQSLNPVLSLPINPAQVEQAR.R
*	TK120303_NMyc_cyto3_step07.2792.2792.2	1.3314	0.0774	2709.89	10	1960.0%	1	R.TDSNNENSVPKDFENVDNSNFAPR.T
UVEGD_MOUSE58.3%245.6%358409096.7(P97946) Vascular endothelial growth factor D precursor (VEGF-D) (c-fos induced growth factor) (FIGF) 
*	TK120303_NMyc_cyto3_step02.3448.3448.2	2.1776	0.1298	2466.57	1	3420.0%	2	R.FAATFYDTETLKVIDEEWQR.T
UC343_HUMAN58.2%228.5%503576708.1(Q9HB55) Cytochrome P450 3A43 (EC 1.14.14.1) 
*	TK120303_NMyc_cyto3_step09.2965.2965.3	1.9026	0.1173	4392.23	31	1080.0%	1	K.LDFLDPFLLLISLFPFLTPVFEALNIGLFPKDVTHFLK.N
*	TK120303_NMyc_cyto3_step02.2316.2316.1	1.8005	0.0482	1461.17	2	4090.0%	1	K.DVTHFLKNSIER.M
UCA21_MOUSE58.2%171930.4%13721295579.2(Q01149) Collagen alpha 2(I) chain precursor 
*	TK120303_NMyc_cyto3_step04.2094.2094.2	2.1415	0.2153	2089.06	1	3330.0%	2	R.LPFLDIAPLDIGGADQEFR.V
*	TK120303_NMyc_cyto3_step12.2863.2863.2	1.2305	0.0547	2868.46	14	1410.0%	1	K.GPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSR.G
*	TK120303_NMyc_cyto3_step12.3148.3148.2	1.4259	0.0187	2560.44	1	1960.0%	1	K.GERGYPGSIGPTGAAGAPGPHGSVGPAGK.H
*	TK120303_NMyc_cyto3_step04.3495.3495.2	1.2081	0.3316	2929.29	6	1560.0%	1	R.GHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGK.G
*	TK120303_NMyc_cyto3_step01.3448.3448.2	1.0811	0.0892	2274.05	28	1920.0%	1	R.GIPGPAGAAGATGARGLVGEPGPAGSK.G
*	TK120303_NMyc_cyto3_step12.4315.4315.3	1.8422	0.1312	4085.43	3	1250.0%	1	K.GENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGR.T
*	TK120303_NMyc_cyto3_step03.4267.4267.3	2.029	0.0090	2822.71	57	1720.0%	1	K.GEQGPAGPPGFQGLPGPSGTTGEVGKPGER.G
*	TK120303_NMyc_cyto3_step08.2258.2258.3	1.343	0.0108	3317.94	84	1210.0%	1	R.GLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPR.G
*	TK120303_NMyc_cyto3_step10.1837.1837.3	1.7945	0.221	3798.6	1	1690.0%	1	R.GLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGR.D
	TK120303_NMyc_cyto3_step12.2856.2856.3	1.7796	0.12	2616.93	1	2240.0%	1	R.GSPGERGEVGPAGPNGFAGPAGAAGQPGAK.G
*	TK120303_NMyc_cyto3_step09.2359.2359.3	2.2932	0.0282	2942.78	2	1850.0%	1	R.GPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGK.E
*	TK120303_NMyc_cyto3_step11.2098.2098.2	1.2584	0.0426	2114.02	2	2390.0%	1	R.GLPGIAGALGEPGPLGISGPPGAR.G
*	TK120303_NMyc_cyto3_step10.1026.1026.3	1.1097	0.0015	3018.12	73	1140.0%	1	R.GPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGER.G
*	TK120303_NMyc_cyto3_step08.1164.1164.1	0.7497	0.0857	904.47	42	3120.0%	1	K.GHSGMDGLK.G
	TK120303_NMyc_cyto3_step03.0311.0311.1	0.888	0.1945	1068.48	42	1820.0%	1	R.GRVGAPGPAGAR.G
UPCNT_MOUSE58.2%7195.3%19202183364.9(P48725) Pericentrin 
*	TK120303_NMyc_cyto3_step08.1404.1404.2	1.2787	3.0E-4	1903.69	328	2000.0%	1	R.QLQQELDHRVHSVASR.D
*	TK120303_NMyc_cyto3_step05.2581.2581.3	1.4007	0.1132	4296.24	59	1180.0%	1	R.TLPEGAETSSVCEISSHVCESFFIRPENTLDCEQPIR.R
*	TK120303_NMyc_cyto3_step05.3092.3092.2	2.1299	0.2158	2774.99	1	2390.0%	4	R.EELNGSWDPVLAQASHLEELEHLR.S
*	TK120303_NMyc_cyto3_step11.2939.2939.2	1.0749	0.0202	2680.68	15	1520.0%	1	R.ENQEGTTLICMLRADLELAQGEGK.A
UQ9UKV358.0%6810.1%13411518876.4(Q9UKV3) AcinusL 
*	TK120303_NMyc_cyto3_step12.2968.2968.2	1.4035	0.0187	2504.95	9	2140.0%	1	K.LSEGSQPAEEEEDQETPSRNLR.V
	TK120303_NMyc_cyto3_step10.2597.2597.2	1.2112	0.0179	2332.85	142	1580.0%	1	K.TKAAPCIYWLPLTDSQIVQK.E
*	TK120303_NMyc_cyto3_step08.2300.2300.3	1.5529	0.0312	3214.19	271	980.0%	1	K.CEAEEAEPPAATQPQTSETQTSHLPESER.I
	TK120303_NMyc_cyto3_step09.3481.3481.3	2.5768	0.2709	4727.16	1	1340.0%	1	K.EEVTMDTSENRPENDVPEPPMPIADQVSNDDRPEGSVEDEEK.K
	TK120303_NMyc_cyto3_step04.3730.3730.2	1.7549	0.0555	2338.49	9	2380.0%	2	R.WGASTATTQKKPSISITTESLK.S
UQ99MI658.0%115.8%295333967.1(Q99MI6) Immunity-associated nucleotide 4 
*	TK120303_NMyc_cyto3_step11.3809.3809.2	2.179	0.0932	1771.66	9	3120.0%	1	K.GGCTSGSRPLRILLVGK.S
USM3C_HUMAN58.0%357.2%751852078.7(Q99985) Semaphorin 3C precursor (Semaphorin E) (Sema E) 
*	TK120303_NMyc_cyto3_step05.2851.2851.3	2.8354	0.1732	3559.98	1	1750.0%	2	K.DHILSLNINNISQEALSVFWPASTIKVEECK.M
*	TK120303_NMyc_cyto3_step01.4278.4278.2	1.4816	0.03	2532.84	4	2270.0%	1	K.VVVLPTNNSVSGELILEELEVFK.N
UQ8VDM958.0%6811.5%723813324.9(Q8VDM9) Hypothetical 81.3 kDa protein 
*	TK120303_NMyc_cyto3_step03.3674.3674.3	2.0061	0.0142	2910.28	5	1980.0%	2	K.ATTLPTDFHYETDNLIQLHLKPGKR.S
*	TK120303_NMyc_cyto3_step02.0940.0940.2	0.732	0.0433	2486.87	26	1580.0%	1	K.DFEINFDDDIDFDAYFQKTK.A
	TK120303_NMyc_cyto3_step07.2089.2089.1	0.934	0.0558	1142.49	67	5000.0%	1	R.VDAVHADVYR.V
*	TK120303_NMyc_cyto3_step08.3563.3563.3	2.4147	0.167	3107.46	5	1940.0%	1	R.VFDLQFSTDSIHLASPNRNIDVSTTISK.F
UNRTN_MOUSE57.9%2220.5%1952221910.9(P97463) Neurturin precursor 
*	TK120303_NMyc_cyto3_step02.3213.3213.2	1.3435	0.1267	2646.58	1	2380.0%	1	R.AHPCCRPTAYEDEVSFLDVHSR.Y
*	TK120303_NMyc_cyto3_step08.1364.1364.2	1.6933	0.3296	1985.84	1	3820.0%	1	R.LAQYRALLQGAPDAVELR.E
UTP2B_HUMAN57.9%111.4%16261832668.0(Q02880) DNA topoisomerase II, beta isozyme (EC 5.99.1.3) 
*	TK120303_NMyc_cyto3_step12.3202.3202.2	2.0849	0.2522	2538.33	2	2730.0%	1	K.FDSNEEDSASVFSPSFGLKQTDK.V
UQ8VFJ757.8%247.4%311350668.0(Q8VFJ7) Olfactory receptor MOR213-6 
*	TK120303_NMyc_cyto3_step02.3353.3353.2	1.8422	0.0942	2767.25	5	2270.0%	2	K.MVSTFYTVLFPMLNPMIYSLRNK.D
UTISR_HUMAN57.7%3936.4%4453219.8(Q9Y5M6) Oculomedin (Trabecular meshwork inducible stretch response protein) (TISR) 
*	TK120303_NMyc_cyto3_step09.2616.2616.2	2.053	0.0174	1914.22	2	3330.0%	3	K.SGIIWLSWYSFILLVL.-
UQ96R7757.6%117.9%214234487.9(Q96R77) Olfactory receptor (Fragment) 
*	TK120303_NMyc_cyto3_step12.3300.3300.2	2.1749	0.1215	2038.89	10	2810.0%	1	R.YLAICQPLRYPVLMTAK.L
UGAL7_HUMAN57.6%228.4%379433637.0(P07902) Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10) 
*	TK120303_NMyc_cyto3_step04.1348.1348.2	2.1742	0.1534	1183.3	10	6110.0%	1	R.RLPELTPAER.D
*	TK120303_NMyc_cyto3_step11.2007.2007.2	1.2436	0.016	2411.02	175	1430.0%	1	R.QQASEADAAAATFRANDHQHIR.Y
UQ99MM957.6%4165.7%453513014.3(Q99MM9) Radial spokehead-L protein 
	TK120303_NMyc_cyto3_step04.4367.4367.2	2.174	0.0179	2939.49	3	2400.0%	4	R.SQEYSQPLLTIPEDGLNRPPPQRGSR.S
UIRF6_MOUSE57.6%116.0%467531075.3(P97431) Interferon regulatory factor 6 (IRF-6) 
*	TK120303_NMyc_cyto3_step11.3030.3030.2	2.1748	0.0476	3044.16	1	2410.0%	1	K.IYQVCDIPQPQGSVINPGSTGSAPWDEK.D
UQ96KT157.6%114.8%249275949.2(Q96KT1) Hypothetical protein 
*	TK120303_NMyc_cyto3_step01.3174.3174.1	1.5341	0.1438	1348.66	2	4550.0%	1	R.FGKDSVILSDIR.K
UP7033557.6%666.1%13541581705.9(P70335) Rho-associated, coiled-coil forming protein kinase p160 ROCK-1 
	TK120303_NMyc_cyto3_step06.3591.3591.3	2.4825	0.068	3149.98	3	1850.0%	1	R.DPKSEVNSDCLLDGLDALVYDLDFPALR.K
	TK120303_NMyc_cyto3_step11.3655.3655.3	1.65	0.029	3487.24	49	1340.0%	1	R.YLYMVMEYMPGGDLVNLMSNYDVPEKWAR.F
	TK120303_NMyc_cyto3_step03.0426.0426.2	1.0498	0.2029	2813.57	12	1880.0%	1	K.SEVNSDCLLDGLDALVYDLDFPALR.K
	TK120303_NMyc_cyto3_step06.3444.3444.1	1.4922	0.0754	1416.57	1	5000.0%	1	K.LADFGTCMKMNK.E
	TK120303_NMyc_cyto3_step05.0445.0445.1	0.839	0.031	541.27	2	6250.0%	1	K.SGHLK.L
	TK120303_NMyc_cyto3_step02.1155.1155.1	1.5333	0.1458	1147.45	4	6250.0%	1	K.ELKEEIEEK.N
UQ9NZR257.4%14147.9%45995155165.3(Q9NZR2) Low density lipoprotein receptor related protein-deleted in tumor 
*	TK120303_NMyc_cyto3_step09.2924.2924.2	1.3879	0.0748	2806.49	24	1740.0%	1	K.SGPGTFLSLAVYDNYIFWSDWGRR.A
	TK120303_NMyc_cyto3_step08.2674.2674.1	1.7342	0.099	1349.79	4	5000.0%	1	R.CIPRAWLCDR.E
	TK120303_NMyc_cyto3_step07.2351.2351.3	1.8953	0.2052	3380.58	4	1570.0%	1	K.WHCDSDDDCGDGSDEVGCVHSCFDNQFR.C
	TK120303_NMyc_cyto3_step12.3844.3844.3	1.7944	0.0267	4568.47	34	1050.0%	1	R.ELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITSEVTLLR.H
	TK120303_NMyc_cyto3_step08.2320.2320.2	1.9288	0.2	2061.74	3	3060.0%	1	-.MSEFLLALLTLSGLLPIAR.V
*	TK120303_NMyc_cyto3_step02.2284.2284.3	1.2809	0.0262	2879.95	59	1440.0%	1	R.STLTGKNAQVVVSTDILTPNGLTIDYR.A
	TK120303_NMyc_cyto3_step06.3603.3603.3	1.9341	0.0315	3979.17	10	1210.0%	1	R.IYWADFELSIIGSVLYDGSNSVVSVSSKQGLLHPHR.I
*	TK120303_NMyc_cyto3_step02.4007.4007.3	1.4412	0.1525	3902.7	1	1540.0%	1	R.IDLETGGNREMVLSGSNVDMFSVAVFGAYIYWSDR.A
	TK120303_NMyc_cyto3_step11.3074.3074.3	2.1843	0.0629	3885.95	14	1480.0%	1	K.EEIHSPAGCNGNEFQCHPDGNCVPDLWRCDGEK.D
	TK120303_NMyc_cyto3_step10.2092.2092.2	1.4225	0.1309	2327.17	9	2500.0%	1	R.SCKDQDECAVYGTCSQTCR.N
	TK120303_NMyc_cyto3_step12.3326.3326.3	2.0953	0.2543	4772.38	1	1310.0%	1	R.GVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTDIK.T
	TK120303_NMyc_cyto3_step02.3641.3641.2	1.6637	0.0977	1750.54	6	3080.0%	1	R.CYCEDGFEITEDGR.S
	TK120303_NMyc_cyto3_step09.2440.2440.3	1.8307	0.085	3521.76	3	1850.0%	1	K.MLWPNGLTLDFHTNTLYWCDAYYDHIEK.V
	TK120303_NMyc_cyto3_step04.1287.1287.1	1.3613	0.1384	1231.56	11	3890.0%	1	K.TKFSCWSTGR.C
ULMA2_MOUSE57.3%775.4%31063426796.1(Q60675) Laminin alpha-2 chain precursor (Laminin M chain) (Merosin heavy chain) 
*	TK120303_NMyc_cyto3_step04.3530.3530.3	1.5862	0.0305	3721.27	45	1330.0%	1	K.CDRCAHGYFNFQEGGCIACDCSHLGNNCDPK.T
*	TK120303_NMyc_cyto3_step04.3415.3415.2	1.5242	0.1224	2924.33	36	1600.0%	1	R.APERLIQLAEGNVNTLVMETNELLTR.A
*	TK120303_NMyc_cyto3_step06.2697.2697.3	1.3661	0.0516	4055.36	22	1280.0%	1	K.GCSLENVNTVSFPKPGFVELAAVSIDVGTEINLSFSTR.N
	TK120303_NMyc_cyto3_step06.2732.2732.3	1.8539	0.0627	3861.52	1	1470.0%	1	K.EGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRPIR.W
	TK120303_NMyc_cyto3_step09.2528.2528.1	1.7307	0.0897	1584.68	2	3930.0%	1	K.TAVADNLLFYLGSAK.F
*	TK120303_NMyc_cyto3_step02.0949.0949.2	1.3613	0.202	2770.47	1	2290.0%	1	R.LIQLAEGNVNTLVMETNELLTRATK.V
*	TK120303_NMyc_cyto3_step03.3282.3282.2	1.1727	0.0228	2208.5	3	2630.0%	1	R.GLKPGSCHCKTGFGGVNCDR.C
UITB2_MOUSE57.3%4411.5%771850267.1(P11835) Integrin beta-2 precursor (Cell surface adhesion glycoproteins LFA-1/CR3/P150,95 beta-subunit) (CD18) (Complement receptor C3 beta-subunit) 
*	TK120303_NMyc_cyto3_step04.1187.1187.1	1.5032	0.1557	1082.5	1	5620.0%	1	K.GVMECGICR.C
*	TK120303_NMyc_cyto3_step08.2451.2451.2	1.3927	0.083	2316.78	1	2890.0%	1	K.LGAILTPNDGRCHLEDNMYK.R
*	TK120303_NMyc_cyto3_step11.1239.1239.3	1.5628	0.022	2739.03	35	1600.0%	1	K.LGGDLLQALNEITESGRIGFGSFVDK.T
*	TK120303_NMyc_cyto3_step04.1931.1931.3	1.5836	0.022	3680.54	67	1360.0%	1	K.QLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTR.L
UQ9UFU857.3%7916.1%917994396.9(Q9UFU8) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step10.3320.3320.1	1.6697	0.1859	1334.99	71	4000.0%	2	R.EFSEIQLARLK.K
*	TK120303_NMyc_cyto3_step01.1000.1000.1	1.0144	8.0E-4	1587.46	42	2690.0%	1	K.DIELSPEAQAKIDR.Y
*	TK120303_NMyc_cyto3_step04.3446.3446.3	1.7721	0.0331	4300.65	4	1320.0%	1	K.LHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGK.V
*	TK120303_NMyc_cyto3_step04.4215.4215.3	1.7991	0.152	2878.32	20	1730.0%	1	K.VGCGSPRIHFGGLIEEDDVILLAAALR.I
*	TK120303_NMyc_cyto3_step06.2097.2097.3	1.6389	0.0448	3863.56	3	1320.0%	1	K.DAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADK.I
*	TK120303_NMyc_cyto3_step05.2835.2835.3	1.8331	0.0126	2410.84	92	1970.0%	1	K.KEYTEENIQLVADGCCNLQK.Q
UCP3P_MOUSE57.3%229.3%503581228.8(O09158) Cytochrome P450 3A25 (EC 1.14.14.1) (CYPIIIA25) 
*	TK120303_NMyc_cyto3_step07.3119.3119.3	2.5079	0.0896	3778.91	2	1470.0%	1	K.DIFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAK.K
*	TK120303_NMyc_cyto3_step01.2224.2224.1	1.4391	0.1803	1451.53	1	4090.0%	1	K.KAITISEDEEWK.R
UQ8WYZ157.3%1118.7%107119509.1(Q8WYZ1) Hypothetical protein 
*	TK120303_NMyc_cyto3_step04.2918.2918.2	2.011	0.2686	2339.94	1	2370.0%	1	-.MPLHDLSIFQDRVLLWGATK.W
UO9581157.2%557.2%15801796706.8(O95811) Retinoblastoma binding protein 2 homolog 1 
	TK120303_NMyc_cyto3_step01.1058.1058.3	1.8357	0.1316	2060.07	275	2210.0%	1	K.TWYGVPGYAAEQLENVMK.K
*	TK120303_NMyc_cyto3_step11.3894.3894.3	2.8609	0.0843	2980.48	1	2590.0%	1	R.LLDSSNSSASASQAMNIKIEPEETTEAR.T
	TK120303_NMyc_cyto3_step05.3387.3387.3	1.9637	0.1211	4467.9	33	1050.0%	1	K.IKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMK.L
	TK120303_NMyc_cyto3_step04.1694.1694.1	1.4368	0.0091	1451.51	73	3180.0%	1	R.MGCPTPKCENEK.E
	TK120303_NMyc_cyto3_step09.2383.2383.2	1.2453	0.0452	2112.19	67	2670.0%	1	R.LLHRYCVFSHDEMICK.M
US142_HUMAN57.2%4422.8%403461457.8(O76054) SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (hTAP) (Supernatant protein factor) (SPF) (Squalene transfer protein) 
*	TK120303_NMyc_cyto3_step08.4387.4387.3	1.037	0.139	3990.07	7	740.0%	1	R.GSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLK.T
*	TK120303_NMyc_cyto3_step01.0290.0290.1	1.278	0.01	1032.57	10	5560.0%	1	K.MKQLGAGTPK.-
*	TK120303_NMyc_cyto3_step12.2204.2204.3	1.6718	0.0402	3357.42	15	1830.0%	1	K.HLWKPAVEAYGEFLCMFEENYPETLKR.L
	TK120303_NMyc_cyto3_step01.3699.3699.2	1.7169	0.2898	2330.83	1	2890.0%	1	R.ENVQDVLPALPNPDDYFLLR.W
UQ9WUC257.2%448.9%11301271997.7(Q9WUC2) SH2-containing inositol phosphatase 
	TK120303_NMyc_cyto3_step07.1924.1924.2	1.5854	0.0974	2451.85	21	2250.0%	1	K.LKPIISDPEYLLDQHILISIK.S
	TK120303_NMyc_cyto3_step06.2883.2883.2	1.7369	0.2923	1738.42	1	4000.0%	1	R.GPCPRVQEARPGDLGK.V
	TK120303_NMyc_cyto3_step09.2401.2401.2	1.005	0.0383	2709.88	2	2500.0%	1	K.TVAIHTLWNIRIVVLAKPEHENR.I
	TK120303_NMyc_cyto3_step03.3862.3862.3	1.5794	0.0223	4630.67	6	1190.0%	1	K.SSDSDESYGEGCIALRLETTEAQHPIYTPLTHHGEMTGHFR.G
UQ9CQM257.2%1110.4%212244548.7(Q9CQM2) 1110007A14Rik protein (Putative KDEL receptor) (RIKEN cDNA 1110007A14 gene) 
	TK120303_NMyc_cyto3_step07.2273.2273.2	1.7117	0.2978	2450.25	1	2620.0%	1	-.MNIFRLTGDLSHLAAIVILLLK.I
UQ6091257.2%1116.1%118138297.4(Q60912) Zfp70p (Fragment) 
*	TK120303_NMyc_cyto3_step11.2426.2426.2	1.7169	0.2898	2295.07	4	3060.0%	1	K.VELTVIEQGILQEWEMHLK.T
UCA44_HUMAN57.2%777.9%16901640958.6(P53420) Collagen alpha 4(IV) chain precursor 
*	TK120303_NMyc_cyto3_step03.0498.0498.1	1.1849	0.1055	1343.06	3	3210.0%	1	R.GALGPGGPLGHPGEK.G
*	TK120303_NMyc_cyto3_step05.0309.0309.1	0.678	0.0683	716.93	47	4000.0%	1	K.ESQAQR.Q
*	TK120303_NMyc_cyto3_step01.4696.4696.2	1.722	0.29	2693.24	2	1790.0%	1	K.GDLGLPGWLGTKGDPGPPGAEGPPGLPGK.H
*	TK120303_NMyc_cyto3_step06.4425.4425.2	0.7094	0.1693	1504.74	98	1000.0%	1	R.GAPGPPGLPGSVDLLR.G
*	TK120303_NMyc_cyto3_step07.1703.1703.2	1.6151	0.0701	1403.34	5	3930.0%	1	R.GLQGDPGIPGPPGIK.G
*	TK120303_NMyc_cyto3_step11.1249.1249.3	1.6475	0.0133	2190.17	27	2170.0%	1	K.GDTGEDGYPGGPGPPGPIGDPGPK.G
*	TK120303_NMyc_cyto3_step12.1472.1472.2	1.1218	0.061	2713.96	12	1850.0%	1	R.GHPGPPGVLVTPPLPLKGPPGDPGFPGR.Y
UQ9Y43157.2%2232.1%112124849.9(Q9Y431) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step05.1569.1569.2	1.736	0.2897	1954.06	2	3750.0%	1	R.LLELLPPLLRDNIDYPG.-
*	TK120303_NMyc_cyto3_step07.1961.1961.3	1.7902	0.2033	2200.66	108	2360.0%	1	-.TDEIFYTLIYLSGITLPLK.A
UQ1504257.1%122019.3%9811105245.6(Q15042) Hypothetical protein KIAA0066 (Fragment) 
*	TK120303_NMyc_cyto3_step08.2964.2964.2	0.9711	0.0092	3107.89	27	1670.0%	1	K.CNLLLSSVSIALGNTGCQVPLFVQIHHK.W
*	TK120303_NMyc_cyto3_step06.1597.1597.1	0.9894	0.2471	1067.46	1	5000.0%	1	K.SAPSDSLTYK.L
*	TK120303_NMyc_cyto3_step01.3919.3919.2	1.1468	0.0675	2508.58	88	1590.0%	1	K.LIGNSLGKPLEKGIFTSGTWEEK.S
*	TK120303_NMyc_cyto3_step06.1524.1524.2	1.8175	0.137	1528.39	83	3850.0%	1	R.RQNSVSDFPPPAGR.E
*	TK120303_NMyc_cyto3_step08.1442.1442.2	1.0708	0.0647	1241.64	34	4090.0%	1	K.GNVVLKGELSAR.M
*	TK120303_NMyc_cyto3_step10.4038.4038.2	1.2316	0.0725	2483.43	281	1500.0%	1	R.MYVGECQGPGVRTDFEMVHLR.K
*	TK120303_NMyc_cyto3_step07.3308.3308.3	2.5053	0.3375	3920.39	1	1690.0%	2	K.LTLLHNGEPLYIPVTQEPAPMTEDLLEEQSEVLAK.L
*	TK120303_NMyc_cyto3_step02.4043.4043.2	1.3662	0.0125	2193.03	24	2220.0%	1	K.LEEIIHQITNVEALIARAR.S
*	TK120303_NMyc_cyto3_step11.3903.3903.3	2.0885	0.1737	2750.61	1	2400.0%	3	K.TSASDVTNIYPGDAGKAGDQLVPDNLK.E
UQ9H4G657.1%557.5%10421129168.5(Q9H4G6) DJ885L7.9.1 (Death associated transcription factor 1 (Contains KIAA0333), isoform 1) (Fragment) 
	TK120303_NMyc_cyto3_step04.0314.0314.3	1.3714	0.0403	1790.73	5	2140.0%	1	R.LKPEELVSKELSTWK.E
	TK120303_NMyc_cyto3_step04.1651.1651.3	1.5423	0.0432	1618.29	43	3000.0%	1	K.RPWLSATPSSGASAAR.Q
	TK120303_NMyc_cyto3_step09.4147.4147.2	1.2312	0.0233	3085.99	1	1850.0%	1	K.TAPRQEAIPDLEDSPPVSDSEEQQESAR.A
	TK120303_NMyc_cyto3_step01.1536.1536.1	1.4022	0.229	729.58	1	6670.0%	1	K.HAAATMK.F
	TK120303_NMyc_cyto3_step02.0436.0436.1	0.9384	0.029	1256.87	4	3640.0%	1	K.KPPSGFKGTIPK.R
UGC5L_MOUSE57.1%1123.2%125143119.0(O55102) GCN5-like protein 1 
*	TK120303_NMyc_cyto3_step06.3560.3560.2	1.7694	0.277	3164.54	3	1610.0%	1	R.YAIAAATCLIEALVVHLNVGVAQAYMNQR.K
UINVO_HUMAN57.1%449.4%585684684.6(P07476) Involucrin 
*	TK120303_NMyc_cyto3_step11.2390.2390.2	1.3724	0.0567	2115.16	5	2810.0%	1	K.YLEQQEGQLKHLDQQEK.Q
*	TK120303_NMyc_cyto3_step04.1919.1919.1	0.6954	0.0333	1291.24	115	3640.0%	1	K.VPVELPVEVPSK.Q
*	TK120303_NMyc_cyto3_step04.2127.2127.2	2.1533	0.1912	1506.79	2	4580.0%	1	K.GEVLLPVEHQQQK.Q
*	TK120303_NMyc_cyto3_step04.4546.4546.1	0.7233	0.0539	1529.24	2	2500.0%	1	K.QLELPEQQEGQVK.H
UZ197_HUMAN57.0%574.9%10291188478.6(O14709) Zinc finger protein 197 (ZnF20) 
*	TK120303_NMyc_cyto3_step02.3307.3307.3	2.1852	0.0879	2822.84	21	1850.0%	2	K.WGTSFQGSSSSVWETSHLHFRQLR.Y
*	TK120303_NMyc_cyto3_step01.1843.1843.1	1.3818	0.2676	1026.9	4	5000.0%	1	R.ENVAHNALR.Q
*	TK120303_NMyc_cyto3_step08.1336.1336.2	0.9118	0.0719	1200.61	6	3890.0%	1	R.HSGLIIHLRR.H
*	TK120303_NMyc_cyto3_step01.1252.1252.1	0.926	0.0539	841.33	1	7500.0%	1	K.NLTVHQK.I
UQ96BQ157.0%112.7%224249639.3(Q96BQ1) Similar to RIKEN cDNA 1810037C20 gene 
*	TK120303_NMyc_cyto3_step03.1386.1386.1	1.8006	0.0367	744.57	2	8000.0%	1	K.EIQVKK.Y
UCUT1_MOUSE57.0%443.7%13951518026.1(P53564) CCAAT displacement protein (CDP) (Cut-like 1) (Homeobox protein Cux) (Fragment) 
	TK120303_NMyc_cyto3_step07.1671.1671.2	1.0406	0.011	1462.14	470	3640.0%	1	K.RAYQQKPYPSPK.T
*	TK120303_NMyc_cyto3_step04.1259.1259.1	0.9387	0.1053	728.59	10	7000.0%	1	R.DNPVRK.K
	TK120303_NMyc_cyto3_step03.1386.1386.1	1.8006	0.0367	744.57	2	8000.0%	1	R.ELQVQK.T
*	TK120303_NMyc_cyto3_step04.4282.4282.3	2.1545	0.0544	2908.69	7	2040.0%	1	K.TAEPVQTSSTSSSGNSDDAIRSILQQAR.R
UQ9D46857.0%3510.4%479540259.5(Q9D468) 4933411B03Rik protein 
*	TK120303_NMyc_cyto3_step11.3701.3701.3	2.8879	0.1589	3064.59	14	1830.0%	2	K.EKGVVFGSPLTEEGIAQIYQLIEYLHK.N
*	TK120303_NMyc_cyto3_step02.2147.2147.2	1.4474	0.0646	2582.3	93	1590.0%	1	K.NVTANDLQENIIKLNTGMAFMIK.H
UIRK8_MOUSE57.0%4616.5%424479809.2(P97794) ATP-sensitive inward rectifier potassium channel 8 (Potassium channel, inwardly rectifying, subfamily J, member 8) (Inwardly rectifier K+ channel Kir6.1) (uKATP-1) 
*	TK120303_NMyc_cyto3_step10.2684.2684.3	2.0999	0.1053	4732.91	79	910.0%	1	K.TTTPEGEVVPIHQQDIPVDNPIESNNIFLVAPLIICHVIDKR.S
	TK120303_NMyc_cyto3_step10.3330.3330.2	0.8528	0.0584	1894.31	4	3570.0%	1	R.FLQDIFTTLVDLKWR.H
	TK120303_NMyc_cyto3_step07.3039.3039.1	1.5501	0.1302	1418.7	3	3750.0%	2	R.FIAKSGACNLAHK.N
UQ9Z1L557.0%337.5%10911227785.7(Q9Z1L5) Calcium channel alpha-2-delta-C subunit 
*	TK120303_NMyc_cyto3_step10.4164.4164.3	2.7325	0.2212	4493.24	1	1560.0%	1	R.RPESCHGFHPEENARECGGASSLQAQAALLLLPLVSSLFSR.-
*	TK120303_NMyc_cyto3_step10.3613.3613.2	1.0602	0.0392	3196.56	174	810.0%	1	-.MAGPGSLCCASRGASALLATALLYAALGDVVR.S
	TK120303_NMyc_cyto3_step04.1660.1660.1	1.0122	0.1458	1100.51	3	3750.0%	1	R.EHLDKLFAK.G
UQ9UQR057.0%4411.0%700772578.5(Q9UQR0) SCML2 protein (DJ1129A6.1) (Sex comb on midleg (Drosophila)-like 2) 
*	TK120303_NMyc_cyto3_step04.3067.3067.2	1.579	0.1729	2378.38	2	3160.0%	1	R.NDFWRLVDSPDIQPVGTCEK.E
*	TK120303_NMyc_cyto3_step07.2116.2116.3	1.5226	0.023	3002.27	4	1700.0%	1	R.GGEVITASFDGETHSIQLPPVNSASFALR.F
*	TK120303_NMyc_cyto3_step02.3104.3104.3	2.7439	0.2117	2616.47	1	2730.0%	1	K.IVMSTVCVYVNKHGNFGPHLDPK.R
	TK120303_NMyc_cyto3_step01.0856.0856.1	1.1647	0.0353	508.38	5	8750.0%	1	R.SSSVK.N
UQ9D0I857.0%114.2%239275468.5(Q9D0I8) 2610012O22Rik protein 
	TK120303_NMyc_cyto3_step03.2606.2606.1	1.6621	0.1006	1235.52	4	5000.0%	1	K.LFGYEMAEFK.V
UQ9JLD357.0%224.1%560640658.3(Q9JLD3) KRAB-zinc finger protein KID3 
	TK120303_NMyc_cyto3_step06.0546.0546.1	1.0291	0.1564	812.73	23	4170.0%	1	R.KIHTGEK.L
*	TK120303_NMyc_cyto3_step05.2201.2201.2	1.6897	0.3173	1803.02	2	3670.0%	1	K.CSECEKAFGSSSTLIK.H
ULV6D_HUMAN56.9%3926.1%111119664.8(P06318) Ig lambda chain V-VI region WLT 
*	TK120303_NMyc_cyto3_step07.3143.3143.3	2.8225	0.1975	3341.08	2	1790.0%	3	K.TEDEADYYCQSYDNNNHVVFGGTRLTVLG.-
UO1494856.9%1110.4%347387885.5(O14948) TFEC isoform (or TFECL) 
*	TK120303_NMyc_cyto3_step01.4150.4150.3	2.8246	0.1744	3755.83	1	1640.0%	1	R.TLSGSILDVYSGEQGISPINMGLTSASCPSSLPMKR.E
UG6PT_MOUSE56.9%2410.6%357404819.0(P35576) Glucose-6-phosphatase (EC 3.1.3.9) (G6Pase) (G-6-Pase) 
*	TK120303_NMyc_cyto3_step10.4005.4005.3	2.8327	0.1746	3945.66	2	1550.0%	2	K.QFPVTCETGPGSPSGHAMGAAGVYYVMVTSTLAIFRGK.K
UMSRE_HUMAN56.9%4415.5%451497625.9(P21757) Macrophage scavenger receptor types I and II (Macrophage acetylated LDL receptor I and II) 
	TK120303_NMyc_cyto3_step02.1316.1316.1	1.2995	0.0615	1251.71	13	3890.0%	1	R.ESSIEECKIR.Q
*	TK120303_NMyc_cyto3_step01.3927.3927.3	1.0524	0.0299	3605.95	57	1250.0%	1	R.SLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGR.E
*	TK120303_NMyc_cyto3_step03.3534.3534.3	2.8257	0.1846	2936.72	4	1920.0%	1	R.LVGGSGPHEGRVEILHSGQWGTICDDR.W
UO3588456.9%7710.5%11751331289.2(O35884) N-RAP 
*	TK120303_NMyc_cyto3_step08.2252.2252.2	1.1845	0.0617	2137.96	1	2650.0%	1	K.ENYQTQLRGHYDGVGMDR.R
*	TK120303_NMyc_cyto3_step11.1559.1559.2	1.5016	0.1186	2920.79	1	2000.0%	1	R.QAQHLATDVGYRTASHCFTALPTDMK.A
	TK120303_NMyc_cyto3_step05.2528.2528.3	1.5344	0.1031	2725.58	28	2140.0%	1	K.ACFHCEVCKMMLSVNNFVSHQK.M
*	TK120303_NMyc_cyto3_step01.3176.3176.1	1.6594	0.1209	1420.92	58	4440.0%	1	R.YHQQYHREMK.G
*	TK120303_NMyc_cyto3_step08.2636.2636.2	1.3651	0.2307	1806.22	1	3530.0%	1	K.SVAAMGGIDGKEDGEPFK.S
*	TK120303_NMyc_cyto3_step02.1884.1884.1	1.478	0.0643	1590.37	3	4170.0%	1	K.THFNLPMDMVNLR.H
*	TK120303_NMyc_cyto3_step01.3298.3298.3	2.8264	0.1865	3245.94	4	1940.0%	1	R.SQCHISLDMVHLVHARQAQHLATDVGYR.T
UCAH3_MOUSE56.9%2211.6%259293977.9(P16015) Carbonic anhydrase III (EC 4.2.1.1) (Carbonate dehydratase III) (CA-III) 
	TK120303_NMyc_cyto3_step11.1521.1521.2	1.308	0.0887	1945.27	201	1760.0%	1	K.HDPSLQPWSASYDPGSAK.T
	TK120303_NMyc_cyto3_step01.1511.1511.1	1.4629	0.1686	1325.6	2	4550.0%	1	K.EPMTVSSDQMAK.L
UPOL2_MOUSE56.9%332.8%13001518299.7(P11369) Retrovirus-related POL polyprotein [Contains: Reverse transcriptase (EC 2.7.7.49); Endonuclease] 
	TK120303_NMyc_cyto3_step02.3599.3599.2	1.3741	0.0165	2420.26	25	2140.0%	1	K.GSNNYFSLISLNINGLNSPIKR.H
	TK120303_NMyc_cyto3_step01.4067.4067.1	1.4643	0.1581	1108.72	4	5620.0%	1	K.LENLDEMDK.F
	TK120303_NMyc_cyto3_step05.1119.1119.1	0.886	0.0029	713.53	106	4000.0%	1	K.KPRIAK.S
UO5488756.9%112.1%526575356.7(O54887) Testis specific serine kinase substrate 
*	TK120303_NMyc_cyto3_step07.1460.1460.1	1.4556	0.1657	1267.46	3	4500.0%	1	R.RGADHVLNLDR.S
UQ9998756.8%114.5%508581278.8(Q99987) VRK2 
*	TK120303_NMyc_cyto3_step01.3815.3815.2	2.0677	0.2475	2586.23	1	2950.0%	1	K.LPIPFPEGKVLDDMEGNQWVLGK.K
UCTD1_MOUSE56.7%224.7%9111017316.9(P30999) Catenin delta-1 (p120 catenin) (p120(ctn)) (Cadherin-associated Src substrate) (CAS) (p120(cas)) 
	TK120303_NMyc_cyto3_step01.3242.3242.1	1.6341	0.1134	1387.83	1	5000.0%	1	K.AASGALRNLAVDAR.N
*	TK120303_NMyc_cyto3_step06.3516.3516.3	1.6774	0.0154	3073.48	75	1430.0%	1	R.IYISLLKESNTPAILEASAGAIQNLCAGR.W
UQ9D7U556.7%228.6%209237298.7(Q9D7U5) 4933404O11Rik protein 
*	TK120303_NMyc_cyto3_step05.2443.2443.1	1.4552	0.1694	1575.44	1	4550.0%	1	K.YDIFQDFDPEKR.K
	TK120303_NMyc_cyto3_step05.1041.1041.1	0.7804	0.1009	707.5	134	5000.0%	1	K.QIELDS.-
UFATH_HUMAN56.7%13176.6%45905062835.0(Q14517) Cadherin-related tumor suppressor homolog precursor (Fat protein homolog) 
*	TK120303_NMyc_cyto3_step04.2192.2192.3	1.8152	0.0824	3555.22	1	1720.0%	2	K.EGRCPPVHHGCEDDPCPEGSECVSDPWEEK.H
*	TK120303_NMyc_cyto3_step11.4245.4245.3	1.4695	0.1297	3741.22	5	1470.0%	1	R.FTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINR.Q
*	TK120303_NMyc_cyto3_step10.3758.3758.2	1.4564	0.0673	2572.9	5	1960.0%	1	R.EYGATVSEDILVGTEVLQVYAASR.D
*	TK120303_NMyc_cyto3_step04.1308.1308.1	1.112	0.0399	709.6	14	6000.0%	1	K.LIAHKK.L
	TK120303_NMyc_cyto3_step04.3825.3825.3	1.9152	0.1671	4179.2	10	1080.0%	1	K.GKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVK.E
*	TK120303_NMyc_cyto3_step03.2848.2848.3	2.0147	0.1984	3523.57	10	1530.0%	1	K.IHATDQDVYDTLTYSLDPQMDNLFSVSSTGGK.L
*	TK120303_NMyc_cyto3_step06.1959.1959.2	1.787	0.0849	2096.49	1	3680.0%	2	R.ETISGYTLTVQASDNGSPPR.V
*	TK120303_NMyc_cyto3_step12.4110.4110.3	1.8147	0.0821	4578.71	27	1000.0%	1	R.LFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVK.V
*	TK120303_NMyc_cyto3_step03.3003.3003.2	1.6761	0.3512	2644.16	1	2950.0%	1	R.REVEVLATITLNNLNDNTPLFEK.I
*	TK120303_NMyc_cyto3_step10.1229.1229.3	1.6376	0.0197	2751.8	1	2170.0%	1	K.LSGVITTKESLIGLENEFFTFFVR.A
*	TK120303_NMyc_cyto3_step10.4046.4046.2	1.625	0.0049	3062.59	17	1960.0%	1	K.EYLVTVVAKDGGNPAFSAEVIVPITVMNK.A
UQ9NVJ056.7%226.7%718813445.8(Q9NVJ0) Hypothetical protein FLJ10706 
	TK120303_NMyc_cyto3_step12.1874.1874.3	2.1903	0.0642	3321.44	55	1520.0%	1	K.QVADQPYVQQTFSLLLPLLGFFIQTLDPK.L
	TK120303_NMyc_cyto3_step04.2899.2899.2	2.1389	0.1921	1954.3	1	3890.0%	1	R.SALHTIAGALEATESLLQK.G
UQ6077956.6%3310.4%489579237.6(Q60779) Growth arrest specific 
*	TK120303_NMyc_cyto3_step09.1245.1245.1	0.7722	0.0614	958.82	14	5830.0%	1	K.KEEHMER.E
*	TK120303_NMyc_cyto3_step09.3087.3087.3	2.2808	0.1448	3522.5	16	1450.0%	1	R.TCGVPYIAIFSAFNLYSLPLCPSNTSMPNTGK.G
*	TK120303_NMyc_cyto3_step01.3312.3312.1	1.5829	0.1244	1585.53	2	4550.0%	1	K.DLKWEHEVLEQR.F
URRM1_HUMAN56.6%51120.7%329360795.7(Q9UET6) Putative ribosomal RNA methyltransferase 1 (EC 2.1.1.-) (rRNA (uridine-2'-O-)-methyltransferase) (JM23 protein) 
*	TK120303_NMyc_cyto3_step06.2941.2941.3	1.6512	0.0371	3656.06	32	1320.0%	1	K.IGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAK.E
*	TK120303_NMyc_cyto3_step06.2297.2297.3	1.6047	8.0E-4	2784.71	3	2070.0%	1	R.GRDVTLLYSQLQVFFSSVLCAKPR.S
*	TK120303_NMyc_cyto3_step11.3283.3283.3	2.834	0.1197	4556.28	1	1450.0%	3	K.IGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFK.G
UO9599556.6%339.0%478563567.9(O95995) Growth arrest specific 11 
*	TK120303_NMyc_cyto3_step05.1031.1031.1	0.7122	0.1475	787.29	16	4170.0%	1	R.LADPLQK.A
*	TK120303_NMyc_cyto3_step12.2838.2838.2	1.3948	0.0462	2584.54	46	1740.0%	1	K.EVQFNEVLAASNLDPAALTLVSRK.L
*	TK120303_NMyc_cyto3_step01.3312.3312.1	1.5829	0.1244	1585.53	2	4550.0%	1	K.DLQWEHEVLEQR.F
UQ9DBW156.6%227.2%488517695.6(Q9DBW1) 1200012D01Rik protein (RIKEN cDNA 1200012D01 gene) 
*	TK120303_NMyc_cyto3_step01.3227.3227.1	1.4302	0.1966	1575.48	1	3850.0%	1	R.AVVSWRAVGPQLHR.N
*	TK120303_NMyc_cyto3_step07.2944.2944.2	1.2362	0.1027	2245.15	5	2750.0%	1	R.FPSKLAGTSSPWASSDSLCSR.R
UQ8VG9556.5%246.1%312347748.2(Q8VG95) Olfactory receptor MOR256-5 
*	TK120303_NMyc_cyto3_step04.3463.3463.2	2.1183	0.2044	2211.21	3	3330.0%	2	K.LDHLVCEIPILIKTACGEK.E
UQ8TF3256.5%3311.6%595690748.8(Q8TF32) Hypothetical protein KIAA1969 (Fragment) 
*	TK120303_NMyc_cyto3_step07.2501.2501.2	1.4294	0.0060	1814.9	2	3850.0%	1	K.QNNSYWRETLQMSR.M
*	TK120303_NMyc_cyto3_step10.4002.4002.2	2.1157	0.2009	2080.62	1	3820.0%	1	R.SSHLTTHKIIHTGEKPYK.C
*	TK120303_NMyc_cyto3_step01.4211.4211.3	2.0835	0.155	4540.55	1	1460.0%	1	K.ETLTFRDVAIEFSLEEWECLNPAQQNLYMNVMLENYK.N
UATX1_HUMAN56.5%338.8%816870518.4(P54253) Ataxin-1 (Spinocerebellar ataxia type 1 protein) 
*	TK120303_NMyc_cyto3_step11.2249.2249.2	1.9948	0.2592	2551.21	1	2390.0%	1	R.ASVMVLPNSNTPAADLEVQQATHR.E
*	TK120303_NMyc_cyto3_step04.2716.2716.2	1.1377	0.0070	2618.93	2	1820.0%	1	K.SVPHPYESRHVVVHPSPSDYSSR.D
*	TK120303_NMyc_cyto3_step10.2904.2904.2	1.3963	0.0366	2803.96	10	2080.0%	1	R.HRYAEQENGINQGSAQMLSENGELK.F
ULAT1_MOUSE56.4%227.6%512559027.9(Q9Z127) Large neutral amino acids transporter small subunit 1 (L-type amino acid transporter 1) (4F2 light chain) (4F2 LC) (4F2LC) 
	TK120303_NMyc_cyto3_step03.1970.1970.1	1.7995	0.0803	1110.58	6	5620.0%	1	K.KPELERPIK.V
*	TK120303_NMyc_cyto3_step10.4106.4106.3	1.6928	0.0024	3701.05	16	1550.0%	1	R.DIFSIINFFSFFNWLCVALAIIGMMWLRFK.K
UQ96BT756.4%3325.2%238274407.9(Q96BT7) Hypothetical protein 
*	TK120303_NMyc_cyto3_step12.1700.1700.3	1.7909	0.1519	3754.79	8	1430.0%	1	R.HEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEK.C
*	TK120303_NMyc_cyto3_step01.2768.2768.1	1.808	0.1548	1055.75	8	6250.0%	1	R.NQLLPVLEK.C
*	TK120303_NMyc_cyto3_step12.1514.1514.2	1.4953	0.2504	2694.8	1	3040.0%	1	K.ELRPQALPPGLMVVEEIISSEEEK.M
UQ9H9G656.4%112.4%579634738.2(Q9H9G6) Hypothetical protein FLJ12768 
*	TK120303_NMyc_cyto3_step02.4301.4301.1	1.4363	0.177	1569.89	3	4620.0%	1	K.MAVRVLWGGLSLLR.V
UHA2K_MOUSE56.4%115.5%256283514.9(P01910) H-2 class II histocompatibility antigen, A-K alpha chain precursor 
*	TK120303_NMyc_cyto3_step01.2834.2834.1	1.8065	0.0228	1462.44	8	4620.0%	1	R.FEPQGGLQNIATGK.H
UQ9H3T856.2%447.8%13921541567.9(Q9H3T8) MOP-3 
*	TK120303_NMyc_cyto3_step10.1964.1964.3	2.8079	0.1935	3278.53	1	2050.0%	1	R.ILGMEVHQQNALFQYFADTLTAVVQNAKK.N
	TK120303_NMyc_cyto3_step10.2222.2222.2	1.3805	0.1143	1919.13	103	2350.0%	1	K.FIQTTASTRPSVSAPTVR.N
	TK120303_NMyc_cyto3_step05.1955.1955.3	2.0271	0.0071	3002.79	7	1720.0%	1	K.VGGLTGSSSDDSGSESDASDNEESDYESSK.N
	TK120303_NMyc_cyto3_step10.3822.3822.3	2.3345	0.2326	3703.18	2	1670.0%	1	K.VVSDDALMHWLDQYNSSADTCTHAYWRGNCK.K
UO1504556.2%333.8%15831846575.1(O15045) Hypothetical protein KIAA0336 
*	TK120303_NMyc_cyto3_step10.3325.3325.3	2.7891	0.1766	3093.04	2	2210.0%	1	K.VEQTIQYNSELEQKVNELTGGLEETLK.E
*	TK120303_NMyc_cyto3_step02.4341.4341.2	1.2266	0.0038	2589.14	7	2380.0%	1	R.QLRNSTLQCETINSDNEDLLAR.I
*	TK120303_NMyc_cyto3_step08.0012.0012.1	0.7286	0.2295	1390.7	3	2000.0%	1	K.NSHEEMDNFHK.K
UC263_MOUSE56.2%71915.0%440493036.9(P58659) Protein C21orf63 homolog precursor 
	TK120303_NMyc_cyto3_step12.3435.3435.2	1.553	0.0070	2922.89	3	2080.0%	4	R.EQVIQEIWMNSGLDSSLPRNVGHFY.-
	TK120303_NMyc_cyto3_step01.4662.4662.2	2.1563	0.1862	2722.92	4	2500.0%	1	R.EDNLTCVASTTLQKVLDECQNQR.A
	TK120303_NMyc_cyto3_step03.3452.3452.2	1.8158	0.1328	2031.49	6	2650.0%	1	K.VLVDNYHFGSPCLPGVKK.Y
UQ96CR956.2%2218.8%2132262111.6(Q96CR9) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step08.3087.3087.2	1.486	0.0029	2224.65	78	1820.0%	1	R.GGGLLVRPSPPNSGPLAAPGDHR.V
*	TK120303_NMyc_cyto3_step05.1820.1820.2	1.6599	0.4412	1860.78	1	3750.0%	1	R.SHWHPRGNNASGMGGHR.M
UQ1482856.2%5532.7%394424297.2(Q14828) MG44 protein (Fragment) 
*	TK120303_NMyc_cyto3_step08.2644.2644.2	1.3479	0.0178	1927.79	30	2350.0%	1	-.MPILLLAKLSCPALGISK.R
*	TK120303_NMyc_cyto3_step07.2135.2135.2	1.4853	0.3323	1901.61	209	2500.0%	1	R.SGSVLNASVGLSPAANTSSSP.-
*	TK120303_NMyc_cyto3_step04.3359.3359.3	2.2997	0.1035	3422.36	3	1500.0%	1	R.VGEGITLNQVAVGCECQDCLWAPTGGCCPGR.H
*	TK120303_NMyc_cyto3_step06.3439.3439.2	2.0424	0.2545	2614.19	1	2610.0%	1	R.EHLGATAESQVCAYPQAVPQGLRK.G
*	TK120303_NMyc_cyto3_step08.2698.2698.3	1.9032	0.1458	3443.6	2	1690.0%	1	R.TGPKLGQLPGAEGQAEAAPPSLGAGAQCQAQHQGR.I
UQ9D16856.1%3320.0%461485689.7(Q9D168) 1110020M19Rik protein 
	TK120303_NMyc_cyto3_step08.4420.4420.1	0.7865	0.0364	1390.85	53	2500.0%	1	K.GPTSQESQLNAMK.R
*	TK120303_NMyc_cyto3_step10.2749.2749.3	2.5148	0.3367	4151.51	1	1450.0%	1	R.SVSCDNVSKVGLPSPSSLVPGGSSQLSGNGNSATTGPSGSTTSK.A
*	TK120303_NMyc_cyto3_step03.3427.3427.3	1.6316	0.0391	3444.58	2	1620.0%	1	R.TEVKPSTVISGNSSSNNVSSSVTSGLTGWAAFAAK.T
UYC94_HUMAN56.1%448.2%10511168918.8(Q9P2Q2) Hypothetical protein KIAA1294 (Fragment) 
*	TK120303_NMyc_cyto3_step04.1656.1656.1	1.5755	0.1211	1082.5	1	5560.0%	1	R.SSHSHSSSHK.R
*	TK120303_NMyc_cyto3_step03.3452.3452.3	2.2051	0.0621	3046.73	1	2120.0%	1	R.GQAIVNYMSIVESLPTYGVHYYAVKDK.Q
*	TK120303_NMyc_cyto3_step12.1474.1474.3	1.8184	0.1837	3256.54	4	1850.0%	1	K.GLPPRPPSHNRPPPPQSLEGLRQMHYHR.N
*	TK120303_NMyc_cyto3_step10.2489.2489.2	1.2573	0.1469	1974.46	4	2750.0%	1	R.QRAAGALGSASSGSMPNLAAR.G
UE2BD_MOUSE56.1%334.8%524575969.2(Q61749) Translation initiation factor eIF-2B delta subunit (eIF-2B GDP-GTP exchange factor) 
	TK120303_NMyc_cyto3_step09.1121.1121.1	0.9299	0.0269	700.43	42	6000.0%	1	R.KDYGSK.V
*	TK120303_NMyc_cyto3_step04.3119.3119.1	1.4091	0.2217	1561.71	4	4230.0%	1	R.VPEHTPADDPTLLR.R
*	TK120303_NMyc_cyto3_step01.0927.0927.1	1.1809	6.0E-4	630.53	7	7500.0%	1	R.QDPIR.E
UQ9UKT956.0%116.7%509579436.3(Q9UKT9) Zinc finger DNA binding protein Aiolos 
	TK120303_NMyc_cyto3_step11.2967.2967.3	2.5556	0.3095	3873.2	1	1670.0%	1	R.HVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHK.R
UQ91V4555.9%229.6%396430619.5(Q91V45) G-protein-coupled receptor GPR54 (G protein-coupled receptor 54) 
	TK120303_NMyc_cyto3_step01.3388.3388.2	1.6585	0.3876	2858.47	1	2590.0%	1	R.TPRLALAVSLSIWVGSAAVSAPVLALHR.L
*	TK120303_NMyc_cyto3_step08.1643.1643.1	1.1425	0.1616	1077.46	12	4440.0%	1	R.AATHTVPHSR.A
UQ9NT7255.9%72713.8%398422696.4(Q9NT72) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step11.3122.3122.3	2.24	0.3016	4309.24	1	1620.0%	5	K.DAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFK.D
*	TK120303_NMyc_cyto3_step05.1695.1695.1	0.7593	4.0E-4	1069.87	319	2780.0%	1	R.YKPGTGSFSK.D
*	TK120303_NMyc_cyto3_step02.0901.0901.3	1.182	0.0134	4708.13	78	910.0%	1	K.DAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFKDGVK.L
UHO2_MOUSE55.8%3513.7%315357395.9(O70252) Heme oxygenase 2 (EC 1.14.99.3) (HO-2) 
*	TK120303_NMyc_cyto3_step07.3143.3143.2	1.8936	0.1755	2227.72	10	2780.0%	2	K.LATTALYFTYSALEEEMDR.N
*	TK120303_NMyc_cyto3_step12.2923.2923.3	2.0939	0.0043	2591.43	15	2070.0%	1	R.KPSLQLILAASVALVAGLLAWYYM.-
UQ9CYX955.7%118.6%267302945.0(Q9CYX9) 2810431D22Rik protein 
	TK120303_NMyc_cyto3_step05.3143.3143.2	1.9249	0.2659	2634.72	1	2730.0%	1	K.AIGNEVTVDKWEPLLNNLGHVCR.K
UY053_HUMAN55.7%111.9%638724316.1(P42331) Hypothetical protein KIAA0053 
*	TK120303_NMyc_cyto3_step10.1556.1556.1	1.5999	0.1079	1301.05	3	4550.0%	1	R.DTDVHTVASLLK.L
UCONT_MOUSE55.6%71910.0%10201133886.2(P12960) Contactin precursor (Neural cell surface protein F3) 
*	TK120303_NMyc_cyto3_step12.3392.3392.3	2.4443	0.0133	3891.48	1	1620.0%	1	R.LENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRK.A
*	TK120303_NMyc_cyto3_step02.3379.3379.2	1.617	0.0221	2609.42	71	1820.0%	1	R.STEATLSFGYLDPFPPEERPEVK.V
*	TK120303_NMyc_cyto3_step06.2316.2316.3	2.1865	0.1677	3156.23	1	2020.0%	1	K.TDPPIIEGNMESAKAVDLIPWMEYEFR.V
*	TK120303_NMyc_cyto3_step10.3992.3992.3	1.7825	0.0029	4547.9	37	960.0%	4	K.DAGVYYCLASNNYGMVRSTEATLSFGYLDPFPPEERPEVK.V
UQ9WU8955.6%2217.4%321357509.0(Q9WU89) Odorant receptor S18 
*	TK120303_NMyc_cyto3_step07.1592.1592.3	1.6171	0.1312	3373.49	2	1880.0%	1	R.HKALNTCGSHIGVILLFFIPSFFTFLTHR.F
*	TK120303_NMyc_cyto3_step11.3605.3605.3	2.8339	0.1363	2981.66	10	2120.0%	1	R.TLHEPMYVFLSMLAGTDILLSTTTVPK.T
UQ99JR955.5%119.3%343395904.9(Q99JR9) RIKEN cDNA 4931428D14 gene 
*	TK120303_NMyc_cyto3_step06.3159.3159.3	2.7221	0.2055	3511.03	1	1850.0%	1	K.MSNSQGDGEHFVQPPSEVKVHFANQSVQSLAR.K
UQ8TEQ255.5%71110.0%13261455398.6(Q8TEQ2) FLJ00141 protein (Fragment) 
	TK120303_NMyc_cyto3_step06.1923.1923.3	1.6004	0.0016	1472.33	48	3330.0%	1	R.NLAATLQDIETKR.Q
	TK120303_NMyc_cyto3_step07.3581.3581.3	2.3487	0.2659	4703.95	3	1170.0%	2	R.GEEGEHAYDTLSLESSDSMETSISTGGNSACSPDNMSSASGLDMGK.I
	TK120303_NMyc_cyto3_step05.3683.3683.2	1.3809	0.0196	2671.49	5	2140.0%	1	K.EAEALETETKLFEDLEFQQLER.E
	TK120303_NMyc_cyto3_step12.4178.4178.3	2.1865	0.1768	4575.66	11	1140.0%	1	R.APGPPYSPVPAESESLVNGNHTPQTATRGPSACASHSSLVSSIEK.D
	TK120303_NMyc_cyto3_step09.2125.2125.1	1.1667	0.2896	833.56	2	5000.0%	2	R.RGLDSMR.E
UGCFC_HUMAN55.5%5513.0%9171048045.7(Q9Y5B6) GC-rich sequence DNA-binding factor homolog 
	TK120303_NMyc_cyto3_step04.4233.4233.2	1.3893	0.3087	2000.45	2	2650.0%	1	R.ALDHAMSVASDHNVKEFK.S
*	TK120303_NMyc_cyto3_step11.2969.2969.3	2.1673	0.1037	3978.23	1	1340.0%	1	R.APGGESLLGPGPSPPSALTPGLGAEAGGGFPGGAEPGNGLKPRK.R
*	TK120303_NMyc_cyto3_step03.1596.1596.3	1.863	0.0376	3258.65	40	1520.0%	1	K.TGHVKDTNQEDGVIISEHGEDEMDMESEK.E
*	TK120303_NMyc_cyto3_step04.3514.3514.2	1.5496	0.0578	1959.11	3	3330.0%	1	K.YYTSYKDAYIGLCLPK.L
*	TK120303_NMyc_cyto3_step07.1405.1405.2	1.6612	0.3667	1351.72	1	5000.0%	1	K.DESSEFSSHSNK.A
UAGAL_HUMAN55.5%4419.3%429487675.6(P06280) Alpha-galactosidase A precursor (EC 3.2.1.22) (Melibiase) (Alpha-D-galactoside galactohydrolase) (Alpha-D-galactosidase A) (Agalsidase alfa) 
*	TK120303_NMyc_cyto3_step04.1472.1472.1	0.9909	0.0024	728.47	12	6000.0%	1	R.FPHGIR.Q
*	TK120303_NMyc_cyto3_step04.3810.3810.3	2.0366	0.0147	2456.29	3	2380.0%	1	R.SHINPTGTVLLQLENTMQMSLK.D
*	TK120303_NMyc_cyto3_step10.2149.2149.3	2.0115	0.1272	3506.87	22	1550.0%	1	K.QGYQLRQGDNFEVWERPLSGLAWAVAMINR.Q
*	TK120303_NMyc_cyto3_step04.2651.2651.3	2.824	0.1417	2948.53	2	2190.0%	1	K.FDGCYCDSLENLADGYKHMSLALNR.T
UQ8VHI755.5%2210.3%493581707.0(Q8VHI7) NYD-SP28 protein 
*	TK120303_NMyc_cyto3_step01.3364.3364.2	1.8926	0.2632	2800.86	1	2500.0%	1	R.LGLLEENYNMELEVLTKEFETER.K
*	TK120303_NMyc_cyto3_step07.1861.1861.3	1.4964	0.0048	2976.1	4	1760.0%	1	R.SNLPQLPPPSAQPVYNVIEAAHIASHIL.-
UQ99KS455.4%5716.1%514594297.9(Q99KS4) Hypothetical 59.4 kDa protein (Fragment) 
	TK120303_NMyc_cyto3_step06.2001.2001.3	1.8616	0.0476	3651.79	1	1670.0%	1	K.QYNDNPSLITLLCKNCSMLVCSGENIHVIEK.M
	TK120303_NMyc_cyto3_step12.1075.1075.1	1.3224	0.0349	1307.67	5	4500.0%	1	K.ENLGQLKHQIK.E
	TK120303_NMyc_cyto3_step03.4228.4228.2	1.3261	0.1039	1961.08	13	2500.0%	1	R.ADESTYVLVTSSGSGVTER.E
	TK120303_NMyc_cyto3_step10.3278.3278.2	1.4536	0.0085	2503.25	58	1670.0%	2	R.QSTYALSQWIMENAKFAEVGVK.A
UDPOL_MOUSE55.4%227.9%573629438.0(Q9QXE2) DNA polymerase lambda (EC 2.7.7.7) (Pol Lambda) (DNA polymerase kappa) 
*	TK120303_NMyc_cyto3_step05.2791.2791.3	1.8872	0.1653	3509.31	2	1670.0%	1	K.TAQMWYHQGFRNLEDLQSLGSLTAQQAIGLK.H
*	TK120303_NMyc_cyto3_step10.1295.1295.2	2.1634	0.1771	1663.94	1	5000.0%	1	R.SHRGIFSCLLDSLR.Q
UPESC_HUMAN55.4%226.8%588680037.3(O00541) Pescadillo homolog 1 
*	TK120303_NMyc_cyto3_step12.2684.2684.3	2.5908	0.2807	2781.48	5	2290.0%	1	R.LLLPVAEYFSGVQLPPHLSPFVTEK.E
*	TK120303_NMyc_cyto3_step08.2296.2296.2	1.3923	0.0312	1869.74	169	2500.0%	1	R.CYVQPQWVFDSVNAR.L
UQ96JN255.4%5510.8%12701469154.8(Q96JN2) Hypothetical protein KIAA1793 (Fragment) 
	TK120303_NMyc_cyto3_step02.2645.2645.3	1.9948	0.0366	2948.88	10	1830.0%	1	K.SYDSSTSASEAYGKSYCTTSNSSITYK.K
	TK120303_NMyc_cyto3_step08.3254.3254.3	1.4837	0.0204	3608.06	17	1530.0%	1	K.SYGSTSSSDTCQKSFVSSCTDEEPAEPEDMER.F
*	TK120303_NMyc_cyto3_step09.3609.3609.3	2.5899	0.2917	3674.64	1	1720.0%	1	R.ELAGQHEDDSLELQGLLEDERLASAQQAEVFTK.Q
*	TK120303_NMyc_cyto3_step06.1517.1517.2	0.9075	0.0967	1712.06	10	3080.0%	1	K.KYDTSQDEQNELLK.M
	TK120303_NMyc_cyto3_step04.4550.4550.3	0.6271	0.0312	3581.63	27	500.0%	1	R.LQADLQLCLEEMQLLQVQSPSIKMSLESYGK.S
UQ8R06555.4%4432.6%239263427.9(Q8R065) Hypothetical 26.3 kDa protein 
*	TK120303_NMyc_cyto3_step03.2800.2800.3	2.7132	0.203	2839.24	1	2290.0%	1	K.ITYPTAPSRPYTPLKGGLSNVWFDR.F
*	TK120303_NMyc_cyto3_step10.3233.3233.3	2.143	0.1006	2533.38	54	2160.0%	1	R.HSASLIFLHGSGHSGQGQREWIK.H
*	TK120303_NMyc_cyto3_step07.2027.2027.2	1.4529	0.2253	1790.48	1	3440.0%	1	R.SHPDVAGVFVLSGFLNK.A
*	TK120303_NMyc_cyto3_step12.3347.3347.2	1.3265	0.0377	3187.7	219	860.0%	1	R.SHPDVAGVFVLSGFLNKASVVYQDLQQGGR.M
UQ9DAS855.3%111.6%637693016.0(Q9DAS8) 1600029N02Rik protein 
	TK120303_NMyc_cyto3_step04.1544.1544.1	1.4291	0.1853	1211.54	1	5560.0%	1	R.HYLGHNDDIK.C
UDBDR_HUMAN55.3%245.5%477529515.4(P21918) D(1B) dopamine receptor (D(5) dopamine receptor) (D1beta dopamine receptor) 
*	TK120303_NMyc_cyto3_step05.4262.4262.3	2.4663	0.1681	2879.3	10	2000.0%	2	R.ANMTNVFIVSLAVSDLFVALLVMPWK.A
UQ96MA655.2%225.0%479549266.1(Q96MA6) Hypothetical protein FLJ32704 
*	TK120303_NMyc_cyto3_step05.2460.2460.2	1.7583	0.2725	2012.39	1	3750.0%	1	R.DLDQAHLLNRLGYNPNR.V
*	TK120303_NMyc_cyto3_step05.0346.0346.1	0.6013	0.0056	805.23	313	2500.0%	1	R.VIPSYPK.I
UQ9CZ2455.2%3317.6%3303758110.4(Q9CZ24) 1190004A01Rik protein 
*	TK120303_NMyc_cyto3_step09.2968.2968.3	2.1446	0.0182	3944.49	1	1430.0%	1	R.TGHTVPTWGITLVLFLHDTGEPDTAPPRAHPITQLR.Q
*	TK120303_NMyc_cyto3_step03.1851.1851.1	1.2407	0.1139	849.53	1	5830.0%	1	R.QNPPCHP.-
	TK120303_NMyc_cyto3_step04.2695.2695.2	2.1218	0.1826	1695.96	4	3930.0%	1	K.EEQAAMVPQAVPLRR.C
UQ9Y36455.1%61021.5%438482507.4(Q9Y364) CGI-50 protein 
	TK120303_NMyc_cyto3_step07.2085.2085.1	1.0864	0.0020	1364.25	77	3750.0%	1	R.LFSSSLVAIVSLK.A
	TK120303_NMyc_cyto3_step09.3360.3360.2	1.7683	0.1439	2992.18	43	1350.0%	2	R.LLVGAADGYLYMYNLDPQEGGECALMK.Q
*	TK120303_NMyc_cyto3_step06.2993.2993.3	2.0664	0.0658	3777.05	48	1250.0%	1	R.FCLWHSHVEMFTHVLPFVISADTEDVCIVER.L
	TK120303_NMyc_cyto3_step10.2354.2354.2	1.3261	0.0375	2272.36	8	2500.0%	2	R.AANMIPAHDSPLAALAFDASGTK.L
UQ96D8855.0%227.2%558609179.9(Q96D88) Similar to hypothetical protein MGC3121 (Fragment) 
	TK120303_NMyc_cyto3_step09.2201.2201.3	2.5832	0.3058	2154.5	1	3030.0%	1	R.HTVGGGEMARAPPPPRPCLR.K
	TK120303_NMyc_cyto3_step09.1565.1565.3	1.0907	0.0458	2318.23	436	1450.0%	1	R.QWRTQDHNTPALLPKPSLGR.S
UQ9CQC155.0%223.0%690834166.9(Q9CQC1) 1200013P10Rik protein (Crooked neck protein) 
	TK120303_NMyc_cyto3_step04.1924.1924.1	1.0101	0.0054	1096.57	9	5000.0%	1	R.NCEEKEER.L
	TK120303_NMyc_cyto3_step11.2041.2041.1	1.4901	0.1484	1525.71	3	3750.0%	1	R.QVYQASLELIPHK.K
UO0037255.0%112.3%12751491119.7(O00372) Putative p150 
*	TK120303_NMyc_cyto3_step10.2877.2877.2	1.702	0.2769	3178.32	1	1960.0%	1	R.VNQEEVESLNRPITGSEIVAIINSLPTKK.S
UQ9D9Q255.0%1120.5%127143839.7(Q9D9Q2) 1700034J04Rik protein 
*	TK120303_NMyc_cyto3_step06.3555.3555.2	1.7149	0.2761	2796.41	1	2000.0%	1	K.IELISCPIPSSSAETLWGLPSPAKDK.D
UTDR1_HUMAN54.9%5713.9%777867635.2(Q9BXT4) Tudor domain containing protein 1 
*	TK120303_NMyc_cyto3_step11.1238.1238.3	1.6018	0.2039	4019.39	39	1290.0%	1	R.ASVLAYASEESVLVGYVDYGNFEILSLMRLCPIIPK.L
*	TK120303_NMyc_cyto3_step02.2845.2845.3	1.4892	0.0331	4337.75	19	1050.0%	1	R.VQPITSSHLALPFQIIRCSLEGLMELNGSSSQLIIMLLK.N
*	TK120303_NMyc_cyto3_step12.3427.3427.2	1.8397	0.2674	3094.16	1	1920.0%	1	K.EILPNGHVKVHFVDYGNIEEVTADELR.M
*	TK120303_NMyc_cyto3_step01.0768.0768.1	1.4639	0.0322	718.28	2	8000.0%	2	K.LNDLNK.S
UGEPH_HUMAN54.9%4411.4%736797485.4(Q9NQX3) Gephyrin 
	TK120303_NMyc_cyto3_step04.3150.3150.2	1.5928	0.1179	2503.81	8	2170.0%	1	K.ELNLILTTGGTGFAPRDVTPEATK.E
*	TK120303_NMyc_cyto3_step02.3867.3867.2	1.4967	0.1094	3058.21	83	1330.0%	1	K.DSGVASTEDSSSSHITAAAIAAKIPDSIISR.G
	TK120303_NMyc_cyto3_step05.2245.2245.1	1.2181	0.1617	1007.48	1	6880.0%	1	R.VLAQDVYAK.D
	TK120303_NMyc_cyto3_step10.2053.2053.2	1.8506	0.2595	2282.12	3	2890.0%	1	K.AFITVLEMTPVLGTEIINYR.D
UP7952254.9%1110.7%253278279.8(P79522) MHC class I region proline rich protein 
*	TK120303_NMyc_cyto3_step03.3568.3568.2	2.0836	0.2392	2822.99	1	2310.0%	1	R.SSPYGRGWWGVNAEPPFPGPGHGGPTR.G
UO8883654.9%2210.1%545617285.7(O88836) Chromosome 6 BAC-284H12 (RESEARCH GENETICS mouse BAC LIBRARY) complete sequence (RESEARCH GENETICS mouse BAC LIBRARY) (Gene rich cluster, B gene) 
*	TK120303_NMyc_cyto3_step08.2714.2714.3	1.8769	0.2132	3528.04	5	1410.0%	1	R.AACEGPEEHQGAEEEGEGSQGGLYEAIAGHWIR.V
*	TK120303_NMyc_cyto3_step12.2587.2587.2	1.6682	0.3461	2682.39	5	1900.0%	1	R.CALALWHTWAPEHSEQEWTEAK.E
UP7019654.9%114.0%530600836.7(P70196) TRAF6 
	TK120303_NMyc_cyto3_step12.2299.2299.3	2.7466	0.1829	2560.09	1	2750.0%	1	K.YECPICLMALREAVQTPCGHR.F
UPERE_HUMAN54.9%5714.3%7158104010.3(P11678) Eosinophil peroxidase precursor (EC 1.11.1.7) (EPO) 
*	TK120303_NMyc_cyto3_step11.3426.3426.3	2.4761	0.2436	4587.52	4	1250.0%	2	K.FLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFR.R
*	TK120303_NMyc_cyto3_step10.2012.2012.1	1.7291	0.0821	1575.77	4	4170.0%	1	K.LNRQDAMLVDELR.D
*	TK120303_NMyc_cyto3_step07.1653.1653.3	1.8298	0.1294	2479.41	11	2250.0%	1	R.WLPAEYEDGLSLPFGWTPSRR.R
*	TK120303_NMyc_cyto3_step01.3735.3735.2	1.5706	0.1097	2928.45	45	1350.0%	1	R.SGPFNVTDVLTEPQLRLLSQASGCALR.D
UQ925S154.8%119.2%218230138.8(Q925S1) MRP5 (Fragment) 
*	TK120303_NMyc_cyto3_step07.3440.3440.2	1.6556	0.342	2268.16	2	2630.0%	1	R.ISCKASGYTFTTAGMQWVQK.M
USM3E_MOUSE54.8%333.6%775895037.8(P70275) Semaphorin 3E precursor (Semaphorin H) (Sema H) 
	TK120303_NMyc_cyto3_step02.1040.1040.1	1.2048	0.0157	1079.49	43	4380.0%	1	K.MDLGLLFLR.V
*	TK120303_NMyc_cyto3_step02.2361.2361.1	1.7192	0.0948	1152.78	2	6110.0%	1	R.LCVNDMGGQR.I
*	TK120303_NMyc_cyto3_step02.2037.2037.1	1.1917	0.0091	1007.83	1	6880.0%	1	R.YYPTGAHAK.R
UTSP3_HUMAN54.8%336.4%9561042014.7(P49746) Thrombospondin 3 precursor 
*	TK120303_NMyc_cyto3_step12.2960.2960.2	2.1577	0.1352	2549.63	2	2290.0%	1	K.LGDQHAGLPALAPIPPAEVDGLEIR.T
*	TK120303_NMyc_cyto3_step01.1496.1496.1	1.0362	0.0185	877.77	17	4170.0%	1	R.NVGWRDK.T
*	TK120303_NMyc_cyto3_step04.3865.3865.2	1.1789	0.0503	3007.28	27	1430.0%	1	K.DTDGNGEGDACDNDVDGDGIPNGLDNCPK.V
UQ9D89154.6%338.7%450502969.1(Q9D891) 0610039J17Rik protein 
	TK120303_NMyc_cyto3_step12.1172.1172.1	1.5047	0.1461	1185.71	1	6250.0%	1	K.ERITMYLMK.A
	TK120303_NMyc_cyto3_step06.1272.1272.2	1.1918	0.1484	1190.07	20	3330.0%	1	K.YADALQEIIR.E
	TK120303_NMyc_cyto3_step02.4439.4439.2	1.0873	0.0672	2017.93	1	2890.0%	1	K.NHYEVLVLGGGAGGITMATR.M
UQ9DAB554.6%113.6%2242609410.1(Q9DAB5) Histone H2B 
*	TK120303_NMyc_cyto3_step03.1150.1150.1	1.4705	0.1534	997.6	1	6430.0%	1	R.RSLHQSIR.E
UICEB_MOUSE54.6%112.7%373427567.1(P70343) Caspase-11 precursor (EC 3.4.22.-) (ICH-3 protease) 
*	TK120303_NMyc_cyto3_step06.1707.1707.1	1.4672	0.1516	1143.55	4	6110.0%	1	K.LVQSNVLKLK.E
USTX5_HUMAN54.6%338.6%301340868.9(Q13190) Syntaxin 5 
	TK120303_NMyc_cyto3_step02.1800.1800.1	1.495	0.1424	1212.71	5	4440.0%	1	R.QRSEFTLMAK.R
	TK120303_NMyc_cyto3_step12.1062.1062.3	1.4111	0.164	1669.1	2	3390.0%	1	R.QNGIQTNKPALRAVR.Q
	TK120303_NMyc_cyto3_step03.0494.0494.1	0.9885	0.0795	1082.34	18	3120.0%	1	R.SEFTLMAKR.I
UQ8TAP654.6%104212.6%659744146.8(Q8TAP6) Hypothetical protein 
*	TK120303_NMyc_cyto3_step03.1800.1800.3	1.5059	0.0537	2611.69	1	2500.0%	1	R.SKPVPCACEPDFHDGFLLEVHR.E
*	TK120303_NMyc_cyto3_step04.3614.3614.2	1.845	0.092	2939.94	2	2500.0%	6	K.ELNFVTDSVEQELPSSPKQPICFDR.Q
*	TK120303_NMyc_cyto3_step12.1592.1592.3	1.6201	0.0571	3819.64	3	1570.0%	2	K.SVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLR.L
UTRFL_MOUSE54.5%4103.7%707778668.6(P08071) Lactotransferrin precursor (Lactoferrin) 
*	TK120303_NMyc_cyto3_step04.1215.1215.1	1.4467	0.159	889.49	1	7140.0%	3	R.SCHTGIGR.S
*	TK120303_NMyc_cyto3_step10.3029.3029.2	1.4444	0.0164	1986.85	27	2350.0%	1	R.LLIPSLIFLEALGLCLAK.A
UAMYP_MOUSE54.5%6148.5%508574177.5(P00688) Alpha-amylase, pancreatic precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) 
	TK120303_NMyc_cyto3_step04.1739.1739.2	1.4742	0.1626	1751.8	19	3120.0%	1	K.VDGNCTGLRVNVGSDGK.A
	TK120303_NMyc_cyto3_step06.3355.3355.2	2.0014	0.164	3011.6	2	2200.0%	3	R.NVVNGQPFSNWWDNNSNQVAFSRGNR.G
UPER3_HUMAN54.5%336.0%12101326726.9(P56645) Period circadian protein 3 (hPER3) 
*	TK120303_NMyc_cyto3_step04.2044.2044.3	1.5445	0.1715	2681.64	2	2020.0%	1	R.NDEHSPSYQQINCIDSVIRYLK.S
*	TK120303_NMyc_cyto3_step11.3181.3181.3	2.8093	0.0666	2878.9	10	2390.0%	1	R.FCTQNGDYIILDSSWSSFVNPWSR.K
*	TK120303_NMyc_cyto3_step04.2772.2772.3	1.771	0.0171	2682.72	23	1630.0%	1	K.SSFKPVTGTRTEPNGGGESANGGGECK.T
UQ9H9X454.5%228.9%372388909.8(Q9H9X4) Hypothetical protein FLJ12489 
*	TK120303_NMyc_cyto3_step07.1365.1365.1	0.8866	0.0018	897.5	1	6250.0%	1	R.GPGPARADR.-
*	TK120303_NMyc_cyto3_step02.3683.3683.3	2.8135	0.1653	2881.85	8	1980.0%	1	K.TPPGALLGAPPPLVPAPRPSSPPRGPGPAR.A
UQ9CUC154.5%224.0%447519905.0(Q9CUC1) Adult male testis cDNA, RIKEN full-length enriched library, clone:4933427D11, full insert sequence (Fragment) 
*	TK120303_NMyc_cyto3_step01.1144.1144.1	1.3463	0.0783	1496.57	1	4090.0%	1	K.LTLLEFVDFLRK.E
	TK120303_NMyc_cyto3_step04.1354.1354.1	1.4412	0.1637	657.53	2	8000.0%	1	K.ILVKGK.K
UQ9D5S654.5%2212.5%255286459.7(Q9D5S6) 4921528I07Rik protein 
*	TK120303_NMyc_cyto3_step10.3424.3424.3	2.8103	0.0136	2979.43	4	2210.0%	1	K.NPVVPMEAEEHQAPTSSSIQKPQNETK.A
*	TK120303_NMyc_cyto3_step09.2093.2093.3	1.6012	0.1087	3608.26	2	1770.0%	1	R.NIHHKNPVVPMEAEEHQAPTSSSIQKPQNETK.A
UQ9CY9954.4%4613.0%499571428.1(Q9CY99) 2610029D06Rik protein 
*	TK120303_NMyc_cyto3_step08.1926.1926.2	0.9974	0.0783	2171.72	33	2500.0%	1	K.GFSQTSLLTEHQRVHTGDR.L
*	TK120303_NMyc_cyto3_step10.3117.3117.3	2.04	0.022	3503.23	24	1450.0%	1	R.LAQLLGNPDKQSLESPSSQDGGFTQMTVTHWK.I
	TK120303_NMyc_cyto3_step04.1904.1904.1	1.5435	0.1167	1584.82	5	3850.0%	2	K.ECGKGFSQSSLLIR.H
UO1515354.4%112.6%10351160396.8(O15153) Sodium bicarbonate cotransporter 
*	TK120303_NMyc_cyto3_step01.3592.3592.2	1.8107	0.2579	2984.26	5	1540.0%	1	R.SSTFLRVVQPMFNHSIFTSAVSPAAER.I
UQ9Y6R754.4%795.8%28433018065.3(Q9Y6R7) Human Fc gamma BP (Fragment) 
*	TK120303_NMyc_cyto3_step03.0388.0388.1	0.8248	0.0050	1499.88	171	2080.0%	1	R.ECHSKLDPQGAVR.D
*	TK120303_NMyc_cyto3_step03.2542.2542.2	1.817	0.2598	2739.98	3	2080.0%	1	R.NPNNDQVFPNGTLAPSIPIWGGSWR.A
*	TK120303_NMyc_cyto3_step03.3774.3774.3	2.4799	0.2274	4366.78	29	970.0%	2	K.LDGPFAVCHDTLDPRPFLEQCVYDLCVVGGERLSLCR.G
*	TK120303_NMyc_cyto3_step03.3067.3067.3	1.8309	0.0021	2440.45	20	1880.0%	1	R.VNGVLTALPVSVADGRISVTQGASK.A
*	TK120303_NMyc_cyto3_step06.2985.2985.3	2.0426	0.0023	3838.78	6	1440.0%	1	R.FNFQGTCEYLLSAPCHGPPLGAENFTVTVANEHR.G
*	TK120303_NMyc_cyto3_step09.2953.2953.3	2.1454	0.0767	3489.18	143	1170.0%	1	K.HTTCNHVVEQLLPTSAWGTHYVVPTLASQSR.Y
UGAK_HUMAN54.3%333.6%13111431905.7(O14976) Cyclin G-associated kinase (EC 2.7.1.-) 
*	TK120303_NMyc_cyto3_step12.3611.3611.2	1.5387	0.1265	2561.73	14	1900.0%	1	K.LCDFGSATTISHYPDYSWSAQR.R
*	TK120303_NMyc_cyto3_step02.2433.2433.2	2.1468	0.1509	2225.65	2	3610.0%	1	K.MFQIQFHTGFVPRNATTVK.F
*	TK120303_NMyc_cyto3_step04.0572.0572.1	0.9734	0.0037	702.72	2	7000.0%	1	R.KQDLAK.D
UQ9Y6Z454.2%3913.8%181194649.5(Q9Y6Z4) HGC6.1.1 protein 
*	TK120303_NMyc_cyto3_step09.3452.3452.2	1.9001	0.0805	3007.54	1	2920.0%	3	R.LRCLHHDQGLTELAWGTWPHSHPVR.H
UMM02_MOUSE54.2%71120.5%662741025.5(P33434) 72 kDa type IV collagenase precursor (EC 3.4.24.24) (72 kDa gelatinase) (Matrix metalloproteinase-2) (MMP-2) (Gelatinase A) 
	TK120303_NMyc_cyto3_step11.2875.2875.3	1.6206	0.054	3642.8	7	1400.0%	1	K.DGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVR.V
*	TK120303_NMyc_cyto3_step03.2604.2604.3	1.8997	0.1375	3389.42	2	1560.0%	1	K.GIQELYGPSPDADTDTGTGPTPTLGPVTPEICK.Q
	TK120303_NMyc_cyto3_step11.2761.2761.2	1.8765	0.0071	2246.71	48	1940.0%	2	K.QDIVFDGIAQIRGEIFFFK.D
*	TK120303_NMyc_cyto3_step02.4177.4177.3	1.7143	0.0661	3857.77	43	1250.0%	1	K.LIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLK.L
	TK120303_NMyc_cyto3_step03.1722.1722.2	2.1521	0.1278	1587.69	3	5000.0%	2	R.IHDGEADIMINFGR.W
UQ9UM0354.2%5510.1%889995738.6(Q9UM03) Protein kinase PKNbeta 
*	TK120303_NMyc_cyto3_step12.4468.4468.2	1.3813	0.2027	2036.3	33	2350.0%	1	R.LGAGEQDAEEIKVQPFFR.T
*	TK120303_NMyc_cyto3_step11.2626.2626.3	1.6114	0.0676	3109.54	7	1720.0%	1	R.LLGCEQLLTAVPGRSPAAALASSPSEGWLR.T
*	TK120303_NMyc_cyto3_step09.2392.2392.2	1.0035	0.0447	1820.08	3	3000.0%	1	R.DLKLDNLLLDAQGFLK.I
*	TK120303_NMyc_cyto3_step11.2698.2698.2	1.1108	0.0568	2606.41	22	2000.0%	1	R.AAVPGYPQPSGTPVKPTALTGTLQVR.L
*	TK120303_NMyc_cyto3_step03.2814.2814.3	2.4578	0.387	4116.79	4	1220.0%	1	R.AAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGR.S
UQ8WV3754.2%228.7%516594648.9(Q8WV37) Hypothetical protein 
*	TK120303_NMyc_cyto3_step11.2903.2903.2	1.6258	0.3979	2674.86	2	2500.0%	1	-.MALPQGHLTFRDVAIEFSQAEWK.C
*	TK120303_NMyc_cyto3_step09.4210.4210.2	1.4011	0.1078	2690.09	54	1900.0%	1	K.VFIQNSHLAQHWRIHTGEKPYK.C
UCGB2_MOUSE54.2%114.8%398454528.9(P30276) G2/mitotic-specific cyclin B2 
*	TK120303_NMyc_cyto3_step11.3231.3231.2	1.7958	0.2612	2020.98	3	3060.0%	1	K.QPKPTASVKPVQMEALAPK.D
USM3B_MOUSE54.1%5514.6%748828948.8(Q62177) Semaphorin 3B precursor (Semaphorin A) (Sema A) 
*	TK120303_NMyc_cyto3_step10.3444.3444.2	1.2759	0.0068	2615.29	71	1520.0%	1	R.QDIRNGDPSTLCSGDSSHSVLLEK.K
*	TK120303_NMyc_cyto3_step12.1436.1436.3	2.4732	0.3679	3746.57	1	1670.0%	1	R.NHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADR.V
*	TK120303_NMyc_cyto3_step11.2775.2775.2	1.1606	0.0341	2229.71	4	2500.0%	1	R.NGDPSTLCSGDSSHSVLLEKK.V
*	TK120303_NMyc_cyto3_step09.3253.3253.3	1.666	0.1353	3439.41	143	1170.0%	1	R.QTPLLYAVFSTSSGVFQGSAVCVYSMNDVRR.A
*	TK120303_NMyc_cyto3_step05.2531.2531.2	1.4469	0.0841	2016.43	7	3060.0%	1	R.LFVGAENHVASLSLDNISK.R
UQ9EQ3054.1%446.5%11001237744.9(Q9EQ30) Ran binding protein 5 (Fragment) 
*	TK120303_NMyc_cyto3_step04.3039.3039.3	1.424	0.0247	3059.0	371	980.0%	1	-.PSATAAAAAEQQQFYLLLGNLLSPDNVVR.K
	TK120303_NMyc_cyto3_step02.1321.1321.1	1.7786	0.03	1038.48	1	6250.0%	1	K.HIVENAVQK.E
*	TK120303_NMyc_cyto3_step01.1304.1304.1	1.3434	0.2027	855.59	2	5710.0%	1	R.VIQAPEAK.T
	TK120303_NMyc_cyto3_step02.3179.3179.3	1.7729	0.0412	3146.27	111	1400.0%	1	R.QDEDYDEQVEESLQDEDDNDVYILTK.V
UQ96MR954.1%92313.8%790911358.7(Q96MR9) Hypothetical protein FLJ31986 
*	TK120303_NMyc_cyto3_step08.4284.4284.3	1.281	0.0032	4149.42	11	1250.0%	1	K.NLSSVGYQLFKPSLISWLEEEEELSTLPRVLQEWK.M
*	TK120303_NMyc_cyto3_step03.2506.2506.2	1.2049	0.1035	1816.33	1	3930.0%	4	R.VHNGEKPYEHKEYGK.A
*	TK120303_NMyc_cyto3_step03.1076.1076.3	1.8959	0.135	2747.16	1	2720.0%	1	K.TFTVPSGFLEHVRTHTGEKPYGCK.E
*	TK120303_NMyc_cyto3_step09.2964.2964.2	1.3498	0.0562	2830.6	4	1960.0%	2	K.AFISYPSLFGHLRVHNGEKPYEHK.E
*	TK120303_NMyc_cyto3_step05.3221.3221.2	1.5062	0.0748	2610.38	53	1430.0%	1	K.AFTCHSDLTNHVRIHTGEKPYK.C
UQ9Z2S554.1%1117.6%131140889.9(Q9Z2S5) ELP 
*	TK120303_NMyc_cyto3_step01.3971.3971.2	2.1608	0.0924	2482.75	4	2730.0%	1	K.CAPLRPASRLPASQTLGQTFGPR.A
UQ9Y3E854.0%398.3%504550128.7(Q9Y3E8) CGI-150 protein 
*	TK120303_NMyc_cyto3_step10.3525.3525.3	2.6893	0.2197	4351.97	1	1280.0%	3	R.NGLDFTIVITLAQPPVPGISFIVAKPRLFPGAGSAGCGLLER.L
UQ9P27553.9%222.3%11231228319.6(Q9P275) Hypothetical protein KIAA1453 (Fragment) 
*	TK120303_NMyc_cyto3_step07.1400.1400.1	1.12	0.0317	1189.44	11	4440.0%	1	R.NFWSVTHPAK.A
*	TK120303_NMyc_cyto3_step03.2655.2655.2	2.1519	0.0345	1942.84	2	4000.0%	1	R.TETVVDDWDEEFDRGK.E
UQ8VI5353.9%2212.9%419457439.4(Q8VI53) Mlx interactor MIR (Fragment) 
*	TK120303_NMyc_cyto3_step11.1746.1746.3	1.5681	0.0977	2751.44	4	1880.0%	1	R.MGFNTLNSLISNNSKQTSHAITLQK.T
*	TK120303_NMyc_cyto3_step06.3567.3567.2	2.1542	0.0911	3106.55	7	2140.0%	1	R.DCPNSGQASPCPSEQSPSPQSPQNNCSGK.S
UQ1335653.9%4421.0%520588238.8(Q13356) Cyclophilin-like protein CYP-60 
	TK120303_NMyc_cyto3_step06.2128.2128.3	1.5663	0.0728	2847.56	12	1830.0%	1	K.VSASFTSTAMVPETTHEAAAIDEDVLR.Y
	TK120303_NMyc_cyto3_step10.3605.3605.3	1.7526	0.0853	2546.25	46	2000.0%	1	K.GDLNLELHCDLTPKTCENFIR.L
	TK120303_NMyc_cyto3_step11.3007.3007.2	2.1549	0.0448	2600.11	4	2710.0%	1	R.NFVIQGGDPTGTGTGGESYWGKPFK.D
	TK120303_NMyc_cyto3_step04.3835.3835.3	1.6987	0.0848	4229.33	22	1140.0%	1	R.LPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWLKK.Y
UQ96KR853.9%664.5%25672852396.9(Q96KR8) Myosin heavy chain 
	TK120303_NMyc_cyto3_step04.2128.2128.2	2.1586	0.0764	1662.93	6	4580.0%	1	K.DREDQEEELEDVR.Q
	TK120303_NMyc_cyto3_step04.2159.2159.2	1.1351	0.0625	2500.18	22	1740.0%	1	K.DGFTLATVLKPDEGTADLPAGRVR.L
*	TK120303_NMyc_cyto3_step10.3242.3242.3	1.7252	0.0284	3059.75	335	1350.0%	1	R.YDLTGWLHRAKPNLSALDAPQVLHQSK.R
	TK120303_NMyc_cyto3_step12.1036.1036.2	1.0832	0.0597	1843.53	17	3570.0%	1	R.CMELEKYVEELAAVR.Q
	TK120303_NMyc_cyto3_step02.3859.3859.2	1.294	0.0339	2796.02	6	1960.0%	1	K.MGEELSQAATSESQQRESSQYYQR.R
	TK120303_NMyc_cyto3_step06.0525.0525.1	0.8593	0.0271	1333.74	22	2500.0%	1	R.GRAGSDEGNLSLR.V
UQ9H1V453.9%71315.9%648727817.8(Q9H1V4) DJ1182A14.3 (Similar to MST1 (Macrophage stimulating 1 (Hepatocyte growth factor-like))) 
*	TK120303_NMyc_cyto3_step01.3932.3932.2	1.3298	0.0050	3106.33	6	1670.0%	1	R.TACTTGGELLPDPDGDSHGPWCYTMDPR.T
*	TK120303_NMyc_cyto3_step10.1818.1818.2	1.0227	0.0286	2872.11	66	1400.0%	1	R.NPDGDPGGPWCHTTDPAVRFQSCGIK.S
*	TK120303_NMyc_cyto3_step12.2788.2788.3	2.106	0.1865	2499.05	6	2160.0%	1	-.MGWLPLLLLLTQCLGVPGAPGHR.A
*	TK120303_NMyc_cyto3_step05.3496.3496.3	2.6091	0.1478	2739.64	6	2000.0%	1	R.ATAPLQAVVPGPWQEDVADAEECAGR.C
UTR85_HUMAN53.9%333.5%14351609406.9(Q9Y2L5) TRS85 homolog 
*	TK120303_NMyc_cyto3_step04.2008.2008.2	1.1668	0.0374	1870.18	3	3670.0%	1	R.QSYTLRQLDNAVSAFR.H
*	TK120303_NMyc_cyto3_step08.2136.2136.1	1.5673	0.0297	1087.51	33	6250.0%	1	R.QLNDQLISR.K
*	TK120303_NMyc_cyto3_step06.3487.3487.2	2.166	0.164	2864.41	8	2080.0%	1	R.LTSEDSDLRSALLLEQAAHCFINMK.S
UQ9BTR753.9%3314.1%384439066.1(Q9BTR7) Hypothetical protein 
	TK120303_NMyc_cyto3_step05.2916.2916.3	1.6883	0.0842	3483.93	4	1640.0%	1	R.LKHLDCNSNLLETIPPELAGMESLELLYLR.R
	TK120303_NMyc_cyto3_step08.3130.3130.2	2.153	0.1363	2578.35	6	2730.0%	1	R.IFTLETILISNNQVGSVDPQKMK.M
	TK120303_NMyc_cyto3_step12.4439.4439.3	1.6867	0.0208	3396.86	8	1700.0%	1	K.HLDCNSNLLETIPPELAGMESLELLYLRR.N
UQ8VBT953.8%4418.9%550597967.0(Q8VBT9) RIKEN cDNA 1190006K01 gene (Similar to alveolar soft part sarcoma chromosome region, candidate 1) 
*	TK120303_NMyc_cyto3_step03.3694.3694.2	1.5803	0.0068	3053.85	11	1610.0%	1	R.LGGPSASLRPLTSPSANSSKSFSGPGGPSKPK.K
	TK120303_NMyc_cyto3_step12.3536.3536.2	1.8165	0.0782	2298.05	43	2110.0%	1	R.HTVKVTPSTVLLQVLEDTCR.R
*	TK120303_NMyc_cyto3_step11.3642.3642.2	2.0075	0.2496	2071.51	1	3250.0%	1	R.AALQNTTLQSLGLTGGSATIR.F
*	TK120303_NMyc_cyto3_step08.2128.2128.3	1.6781	0.0805	3077.04	13	1670.0%	1	R.SKAPGSPVSSLSADQASSSTLLPLNSGEFSR.G
UOPH1_MOUSE53.8%224.4%802919858.0(Q99J31) Oligophrenin 1 
*	TK120303_NMyc_cyto3_step01.2847.2847.1	1.4125	0.0601	1477.41	123	2690.0%	1	K.DVIKDGSALISAMR.N
	TK120303_NMyc_cyto3_step11.3074.3074.2	2.0033	0.2485	2590.97	3	2500.0%	1	R.HNFFESSLDYVYQIQEVQESK.K
UQ9943453.8%4424.0%421486556.7(Q99434) Neuroblastoma (Putative neuroblastoma protein) 
*	TK120303_NMyc_cyto3_step08.3280.3280.3	1.6643	0.1526	3373.41	1	2050.0%	1	K.QADEVTLQQADVVLVLQQEDGWLYGERLR.D
*	TK120303_NMyc_cyto3_step11.3990.3990.3	1.8283	0.01	2987.81	396	1110.0%	1	K.IEPSELPLPGGGNRSSSVPHPFQVTLLR.N
*	TK120303_NMyc_cyto3_step02.3236.3236.2	2.0038	0.2448	2291.46	5	2650.0%	1	R.MERMEQMYTLHTQLDFSK.V
*	TK120303_NMyc_cyto3_step05.3140.3140.3	1.7491	0.077	3107.61	17	1600.0%	1	-.MFEILTSEFSYQHSLSILVEEFLQSK.E
UK1CO_HUMAN53.8%3320.4%456491684.8(P19012) Keratin, type I cytoskeletal 15 (Cytokeratin 15) (K15) (CK 15) 
*	TK120303_NMyc_cyto3_step01.4216.4216.2	1.3292	0.0873	2528.47	1	2500.0%	1	R.YATQLQQIQGLIGGLEAQLSELR.C
*	TK120303_NMyc_cyto3_step06.3039.3039.3	1.678	0.0304	3339.6	17	1430.0%	1	R.TMQELEIELQSQLSMKAGLENSLAETECR.Y
*	TK120303_NMyc_cyto3_step07.2987.2987.3	2.8087	0.1813	3485.54	9	1380.0%	1	R.VCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEK.I
UQ9H9L653.8%71139.2%293320546.9(Q9H9L6) Hypothetical protein FLJ12668 
*	TK120303_NMyc_cyto3_step07.3387.3387.3	2.1315	0.0444	3009.99	12	1900.0%	2	K.ALPLPMACTLSQFLASNRYYFTVQSK.D
*	TK120303_NMyc_cyto3_step09.4178.4178.3	1.9099	0.0174	3173.12	12	1520.0%	2	K.LDSIIDLTKEGLSNCNTESPVSPLESHSK.A
*	TK120303_NMyc_cyto3_step03.1063.1063.1	1.1158	0.1122	895.47	110	3750.0%	1	-.MLSSNGASK.V
*	TK120303_NMyc_cyto3_step12.3143.3143.2	1.4741	0.1027	2045.48	108	2060.0%	1	R.YGPFCDIKSIPGFSENLT.-
*	TK120303_NMyc_cyto3_step06.3583.3583.3	2.1792	0.1956	3552.8	1	1560.0%	1	K.SVSESNNDDVMLISVESPNLTTPTTSNPTDTRK.I
UQ9D5B853.8%1115.2%2102388410.0(Q9D5B8) 4930468A15Rik protein 
*	TK120303_NMyc_cyto3_step05.2127.2127.3	2.8005	0.0556	3420.3	5	1690.0%	1	K.IGTALAMATLSCFLFLVGGIIPLSFTLPPRSR.V
UQ9NXV053.8%248.2%389429555.7(Q9NXV0) Hypothetical protein FLJ20043 
*	TK120303_NMyc_cyto3_step08.4220.4220.3	2.7864	0.0925	3405.31	3	1850.0%	2	K.IYGAQHPMGLDVREDASSPAGTEDSHLNGYGR.G
UQ9BSQ253.8%227.9%505567896.1(Q9BSQ2) Similar to RIKEN cDNA 4632407K17 gene 
	TK120303_NMyc_cyto3_step02.3389.3389.3	2.8013	0.0017	4055.37	9	1410.0%	1	R.GAGRGRPQAKPIPEAEEAQRPEPVGTSSNADSASPDLGPR.G
	TK120303_NMyc_cyto3_step10.3545.3545.3	1.8152	0.0024	3711.96	6	1430.0%	1	R.GRPQAKPIPEAEEAQRPEPVGTSSNADSASPDLGPR.G
UCU05_HUMAN53.8%888.3%22982582306.3(Q9Y3R5) Protein C21orf5 
*	TK120303_NMyc_cyto3_step01.3084.3084.1	1.2825	0.0063	1581.62	315	2140.0%	1	K.LSYTQSGNSLISAIK.E
*	TK120303_NMyc_cyto3_step03.3322.3322.2	1.5329	0.109	2792.63	12	1960.0%	1	R.LHCLAPTANICEDIICHALLDPDK.G
*	TK120303_NMyc_cyto3_step02.2780.2780.2	1.3645	0.0752	2569.29	31	1750.0%	1	K.YPLRGELSEEELPYYVELPDR.T
*	TK120303_NMyc_cyto3_step09.3375.3375.3	2.7967	0.1026	3163.88	3	2050.0%	1	R.VDSDKTQASESFSSDEEADLELQALTTSR.L
*	TK120303_NMyc_cyto3_step04.3014.3014.3	2.08	0.0954	3639.41	6	1420.0%	1	R.WAFIPEVDTEGPAFLSDVEENHQECKPHTVR.I
*	TK120303_NMyc_cyto3_step10.2346.2346.2	1.2754	0.0613	2841.89	9	1820.0%	1	R.KEVLELFLDPAFFQMDTSCVHWK.S
*	TK120303_NMyc_cyto3_step03.0539.0539.2	1.2906	0.1588	1559.43	40	2500.0%	1	K.AVIPGDEDASFPPLK.S
*	TK120303_NMyc_cyto3_step10.2929.2929.3	1.8636	0.0303	3707.83	11	1370.0%	1	R.ALPEDSLFEESLINLGQDQIWSEHPLQIELLK.L
UQ9D4J653.8%245.6%467531728.4(Q9D4J6) 4931428F04Rik protein 
*	TK120303_NMyc_cyto3_step02.3533.3533.2	2.0673	0.239	2979.11	1	2600.0%	2	K.FGTYENFEAATGGQLLTKCQIWSTVR.K
UCFAH_HUMAN53.8%222.6%12311391256.7(P08603) Complement factor H precursor (H factor 1) 
*	TK120303_NMyc_cyto3_step11.2601.2601.2	1.6949	0.2887	2525.98	1	2860.0%	1	K.SSIDIENGFISESQYTYALKEK.A
*	TK120303_NMyc_cyto3_step03.2667.2667.1	1.2212	0.0625	1181.5	3	6110.0%	1	K.DQYKVGEVLK.F
UQ9D7E953.7%1127.9%111130839.2(Q9D7E9) 2310011E08Rik protein 
*	TK120303_NMyc_cyto3_step11.2831.2831.3	2.4664	0.3653	3663.45	3	1420.0%	1	K.EISLFLILCNITLWMMPAFGIHPEFENGLEK.D
USPC3_MOUSE53.7%117.3%191215299.2(Q9D8V7) Microsomal signal peptidase 21 kDa subunit (EC 3.4.-.-) (SPase 21 kDa subunit) (SPC21) 
	TK120303_NMyc_cyto3_step11.1614.1614.1	1.7917	0.079	1525.74	10	3850.0%	1	K.YALLAVMGAYVLLK.R
UAI75_HUMAN53.7%227.6%552622245.5(Q9Y6N9) Autoimmune enteropathy-related antigen AIE-75 (Antigen NY-CO-38/NY-CO-37) (PDZ-73 protein) 
	TK120303_NMyc_cyto3_step04.2892.2892.3	2.109	0.1328	3496.51	130	1250.0%	1	R.KPKYDQGVEPELEPADDLDGGTEEQGEQDFR.K
	TK120303_NMyc_cyto3_step02.2005.2005.1	1.7726	0.0637	1393.65	1	5500.0%	1	K.EMEQIVEEEEK.F
UQ9JME753.7%2415.1%139160186.8(Q9JME7) mRNA, complete cds, clone:2-6 (1810017G16Rik protein) (RIKEN cDNA 1810017G16 gene) 
	TK120303_NMyc_cyto3_step09.3560.3560.2	1.6322	0.0077	2409.23	6	2500.0%	2	K.FHYMVHTSLDVVDEKISAMGK.A
UO4316853.7%687.4%13951568374.7(O43168) Hypothetical protein KIAA0443 
*	TK120303_NMyc_cyto3_step06.3387.3387.3	1.449	0.0598	3431.0	284	1120.0%	1	K.MLLNLSENLFMTKELLSAEAVSEFIGLFNR.E
*	TK120303_NMyc_cyto3_step10.2132.2132.2	0.9617	0.017	2930.92	36	1670.0%	1	R.AETSCDTMQGAEEEEPIIGSWFWTR.V
*	TK120303_NMyc_cyto3_step10.2889.2889.2	1.641	0.0872	2388.16	21	2050.0%	1	R.NSQTNIIASPLVSTDSVLVAKTK.Y
*	TK120303_NMyc_cyto3_step07.1791.1791.2	2.1422	0.1238	1781.69	1	4640.0%	2	K.IGSEEFEELLLLMEK.I
*	TK120303_NMyc_cyto3_step01.2251.2251.1	1.5669	0.0741	1104.65	2	5560.0%	1	R.VGFPSISPFR.F
UQ9DCT953.6%3313.0%616680087.6(Q9DCT9) 0610010I20Rik protein 
	TK120303_NMyc_cyto3_step09.2852.2852.3	1.9134	0.0259	2730.31	2	2100.0%	1	R.VCLVEKAAQIGAHTLSGACLDPAAFK.E
	TK120303_NMyc_cyto3_step02.3404.3404.2	2.1459	0.1097	2103.95	4	3440.0%	1	R.LQINAQNCVHCKTCDIK.D
	TK120303_NMyc_cyto3_step11.3431.3431.3	1.9227	0.197	3979.22	2	1530.0%	1	R.LGHLVSWMGEQAEALGVEVYPGYAAAEVLYHEDGSVK.G
UQ96KG353.5%118.1%186216008.0(Q96KG3) AKAP350C (Fragment) 
*	TK120303_NMyc_cyto3_step06.2284.2284.2	2.1147	0.1532	1770.12	4	4290.0%	1	R.EQESEKPSQGMLYDK.L
UIKKA_MOUSE53.5%5713.2%745847296.8(Q60680) Inhibitor of nuclear factor kappa-B kinase alpha subunit (EC 2.7.1.-) (I kappa-B kinase alpha) (IkBKA) (IKK-alpha) (IKK-A) (IkappaB kinase) (I-kappa-B kinase 1) (IKK1) (Conserved helix-loop-helix ubiquitous kinase) (Nuclear factor NFkappaB inhibitor kinase alpha) (NFKBIKA) 
	TK120303_NMyc_cyto3_step02.1296.1296.2	1.7859	0.2674	2719.18	1	2290.0%	1	R.IERETGINTGSQELLSETGISLDPR.K
	TK120303_NMyc_cyto3_step08.0044.0044.2	1.2029	0.2566	2112.67	13	1470.0%	2	K.VWAEAVHYVSGLKEDYSR.L
*	TK120303_NMyc_cyto3_step04.2736.2736.3	1.4861	0.0164	2116.49	13	2350.0%	1	K.IISFLLPCDESLHSLQSR.I
*	TK120303_NMyc_cyto3_step04.3340.3340.3	2.0997	0.0939	4191.0	16	1180.0%	1	K.LDHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLR.K
UQ96DL653.5%5525.2%404411009.9(Q96DL6) Hypothetical protein FLJ32794 
*	TK120303_NMyc_cyto3_step08.1311.1311.3	1.6616	0.0552	1964.21	61	2630.0%	1	R.ITPALATPASPPTESQAGPR.N
*	TK120303_NMyc_cyto3_step09.2679.2679.2	1.7511	0.0129	2471.57	2	2620.0%	1	R.APSQFPPPLETWKPPPPLPSER.Q
*	TK120303_NMyc_cyto3_step02.2075.2075.1	1.6871	0.092	1537.64	1	4170.0%	1	K.WQRPAGTPVPRIR.R
*	TK120303_NMyc_cyto3_step06.3140.3140.2	1.1788	0.0779	3040.42	1	2310.0%	1	R.APSQFPPPLETWKPPPPLPSERQPADR.R
*	TK120303_NMyc_cyto3_step12.2571.2571.3	1.5116	0.0087	3801.96	78	1100.0%	1	K.SRPSLAPPAASSSLAAKASLGGGGGGGLFAASGAISYAEVLK.Q
UE2K1_MOUSE53.5%4614.1%619696886.0(Q9Z2R9) Eukaryotic translation initiation factor 2 alpha kinase 1 (EC 2.7.1.-) (Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase) (Heme-regulated inhibitor) (HRI) (Heme-controlled repressor) (HCR) (Hemin-sensitive initiation factor-2 alpha kinase) 
*	TK120303_NMyc_cyto3_step04.2654.2654.3	1.5559	0.0925	3315.48	235	1250.0%	1	K.VLAGLQHPNIVGYHTAWIEHVHVVQPQDR.V
*	TK120303_NMyc_cyto3_step07.3199.3199.2	2.1472	0.0919	2553.52	1	2730.0%	1	K.IGDFGLACADIIQNADWTNRNGK.G
*	TK120303_NMyc_cyto3_step07.2604.2604.3	1.9067	0.1608	3783.79	6	1400.0%	2	R.HQLPLGHSSELEGNFTSTDESSEGNLNLLGQTDVR.Y
UQ8VIM653.5%7710.7%18091964035.4(Q8VIM6) Stereocilin 
*	TK120303_NMyc_cyto3_step10.3661.3661.2	1.8347	0.2566	2033.42	3	2500.0%	1	K.EVLETLGPLVGFLGIESTR.R
*	TK120303_NMyc_cyto3_step11.3658.3658.3	2.0331	0.1188	4596.43	170	770.0%	1	R.LLTFLLGPGTGGAETQGMLGQALLLSSLPDNCSFWDAFRPEGR.R
*	TK120303_NMyc_cyto3_step07.1384.1384.3	1.2379	0.0048	3634.97	62	1290.0%	1	R.DFLVHQAGVLGGLVEALLGALVPGGPPAPTRPPCTR.D
*	TK120303_NMyc_cyto3_step03.3331.3331.3	1.8725	0.0137	2661.64	26	1800.0%	1	R.AMLPALQGASVTPAQAVLLFGRLLPK.H
*	TK120303_NMyc_cyto3_step12.3839.3839.2	1.4621	0.0865	3110.14	36	1480.0%	1	K.HDLSLEELCSLHPLLPGLSPQTLQAIPK.R
*	TK120303_NMyc_cyto3_step02.3805.3805.3	1.9019	0.027	3686.68	99	1210.0%	1	R.GWLQACHDQFPDQFLDMICGNLSFSALSGPNR.R
*	TK120303_NMyc_cyto3_step01.2052.2052.1	1.3287	0.0841	1173.76	44	4440.0%	1	K.SVWALRTLVK.A
UQ9H0G753.4%10828.0%464499978.4(Q9H0G7) Hypothetical protein 
	TK120303_NMyc_cyto3_step09.3001.3001.3	2.5161	0.1147	3449.61	3	1640.0%	9	R.GYEYVLEPSPVSLPLDRPQETRVLQVSCGR.A
*	TK120303_NMyc_cyto3_step06.0455.0455.1	0.7042	0.0762	800.74	6	3330.0%	1	R.GHWTAAR.R
UO4319953.3%6107.9%10911228177.8(O43199) Deleted in liver cancer-1 
	TK120303_NMyc_cyto3_step06.3472.3472.2	1.3122	0.0030	1968.32	7	2780.0%	1	K.ALTNGSFSPSGNNGSVNWR.T
	TK120303_NMyc_cyto3_step06.3581.3581.2	1.9873	0.2514	3006.57	2	2140.0%	2	K.QDLVPGSPDDSHPKDGPSPGGTLMDLSER.Q
	TK120303_NMyc_cyto3_step06.1593.1593.2	1.038	0.0259	1945.45	89	2060.0%	2	K.LGLIISGPILQEGMDEEK.L
	TK120303_NMyc_cyto3_step03.2198.2198.2	1.0823	0.0406	2342.0	8	2370.0%	1	R.SDDSDEDEPCAISGKWTFQR.D
USKD1_MOUSE53.3%114.1%444493897.5(P46467) SKD1 protein (Vacuolar sorting protein 4b) 
	TK120303_NMyc_cyto3_step11.1878.1878.2	1.9949	0.2526	2050.55	1	4120.0%	1	K.KLQNQLQGAIVIERPNVK.W
UQ96MM153.3%3529.8%1811960310.1(Q96MM1) Hypothetical protein FLJ32169 
*	TK120303_NMyc_cyto3_step09.3489.3489.2	1.9848	0.2507	2158.01	1	3420.0%	1	R.VQGPDNPRGLWAPGTSLWGF.-
*	TK120303_NMyc_cyto3_step09.2776.2776.3	1.8701	0.0982	3755.03	1	1590.0%	2	K.GSYLEETRGLHLGQNQGQEISWSQGTLEPSTPPR.V
UQ96S0853.3%8813.1%11841293549.4(Q96S08) Some homology with holliday junction DNA helicase RUVB like 
	TK120303_NMyc_cyto3_step09.4144.4144.2	1.5324	0.1818	2608.96	1	2610.0%	1	R.VLHAAASAGEHEKVVQGLFDNFLR.L
	TK120303_NMyc_cyto3_step10.3488.3488.3	2.701	0.1669	4461.57	3	1250.0%	1	R.IEAATQMESVLGAGGKPNCLVIDEIDGAPVAAINVLLSILNRK.G
	TK120303_NMyc_cyto3_step09.2743.2743.2	1.4426	0.1279	1751.22	251	2500.0%	1	K.QQAFLLHFPPTLPSR.L
	TK120303_NMyc_cyto3_step03.2043.2043.2	1.6126	0.142	2711.72	3	2050.0%	1	K.WKSHEQVLEEMLEAGLDPSQRPK.Q
	TK120303_NMyc_cyto3_step05.1087.1087.1	1.0096	0.0134	847.47	27	5710.0%	1	R.RMGTAVGR.S
	TK120303_NMyc_cyto3_step03.2988.2988.2	1.0685	0.0183	2271.68	6	2370.0%	1	R.EKQQLASLVGTMLAYSLTYR.Q
*	TK120303_NMyc_cyto3_step11.1365.1365.2	1.3292	0.0467	1781.74	36	2780.0%	1	R.AVQAPDAVPGAGSSRAPAR.W
	TK120303_NMyc_cyto3_step11.1626.1626.2	1.0194	0.016	2120.76	7	2940.0%	1	R.QLKQQAFLLHFPPTLPSR.L
UQ9Z1K353.3%9910.3%20552189725.0(Q9Z1K3) Multiple PDZ domain protein 
*	TK120303_NMyc_cyto3_step07.2401.2401.2	1.1893	0.1068	2318.11	97	2140.0%	1	R.KDNSQTPAVPAPDLEPIPSPSR.S
	TK120303_NMyc_cyto3_step09.3480.3480.2	2.1353	0.0754	3064.24	1	2410.0%	1	R.LKPGDHILAVDDEVVAGCPVEKFISLLK.T
	TK120303_NMyc_cyto3_step03.1971.1971.2	1.1157	0.1397	1417.85	115	3330.0%	1	K.LEPSGIFVKSITK.S
	TK120303_NMyc_cyto3_step12.4067.4067.3	1.7321	0.0195	2750.04	11	2000.0%	1	K.RGDQIIAVNGQSLEGVTHEEAVAILK.R
	TK120303_NMyc_cyto3_step11.1750.1750.3	2.6678	0.0908	2952.47	5	1940.0%	1	R.SSTPAVFASDPATCPIIPGCETTIEISK.G
	TK120303_NMyc_cyto3_step10.1046.1046.3	1.5342	0.0633	2936.46	27	1520.0%	1	R.NADAVNQMAVCPGIAADSPSSTSDSPQNK.E
	TK120303_NMyc_cyto3_step11.4177.4177.3	2.1032	0.1854	3905.12	13	1220.0%	1	K.KGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQK.L
	TK120303_NMyc_cyto3_step05.0382.0382.1	0.5342	0.0277	919.51	7	3120.0%	1	K.GTVTLMVLS.-
	TK120303_NMyc_cyto3_step03.1846.1846.2	1.8968	0.065	1763.19	41	2670.0%	1	R.GDTAKDVDLPAENCEK.D
UUBP7_HUMAN53.3%7135.3%11021282725.6(Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15) (Ubiquitin thiolesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus associated ubiquitin-specific protease) 
*	TK120303_NMyc_cyto3_step03.4200.4200.2	0.9863	0.1428	1419.45	2	2920.0%	1	K.SQGYRDGPGNPLR.H
*	TK120303_NMyc_cyto3_step09.1685.1685.1	1.1767	0.1979	954.03	2	5710.0%	1	K.FDDDVVSR.C
*	TK120303_NMyc_cyto3_step04.2218.2218.1	1.6396	0.1517	1546.71	6	3850.0%	1	K.DDPENDNSELPTAK.E
*	TK120303_NMyc_cyto3_step09.2887.2887.3	2.7709	0.1859	2613.8	10	2050.0%	1	K.TIPNDPGFVVTLSNRMNYFQVAK.T
UQ9P1P153.3%4662.9%105113038.9(Q9P1P1) PRO0398 
*	TK120303_NMyc_cyto3_step10.4160.4160.2	1.1962	0.0261	3037.76	20	1850.0%	1	R.AVPSSQENPLLPNIHTACSLSSFKSLLK.C
*	TK120303_NMyc_cyto3_step03.0971.0971.2	0.9662	0.0197	3106.06	15	1430.0%	1	K.AQVLPAVHKALHTLPCPFPALPSSLSPPR.S
*	TK120303_NMyc_cyto3_step01.2986.2986.2	1.9907	0.2481	2012.85	1	3820.0%	2	-.MAPTFLCVKAQVLPAVHK.A
UQ9R0P253.3%3316.6%373436866.0(Q9R0P2) KIAA312p (Fragment) 
	TK120303_NMyc_cyto3_step03.2923.2923.2	1.977	0.2445	2467.62	1	3250.0%	1	R.LPSAHTCFNQLDLPAYESFEK.L
	TK120303_NMyc_cyto3_step06.2341.2341.3	2.2651	0.087	2839.71	113	1410.0%	1	R.VTYTINPSSHCNPNHLSYFKFVGR.I
	TK120303_NMyc_cyto3_step07.1360.1360.2	1.2218	0.0018	1881.73	102	2500.0%	1	R.DLKPNGANILVTEENKK.E
ULEG4_HUMAN53.3%3313.9%323359419.2(P56470) Galectin-4 (Lactose-binding lectin 4) (L-36 lactose binding protein) (L36LBP) (Antigen NY-CO-27) 
*	TK120303_NMyc_cyto3_step01.0646.0646.1	0.6615	0.0849	740.33	124	4000.0%	1	R.SMPFKK.G
*	TK120303_NMyc_cyto3_step02.2795.2795.2	2.1316	0.0012	2244.49	1	3250.0%	1	K.SFAINFKVGSSGDIALHINPR.M
*	TK120303_NMyc_cyto3_step06.4208.4208.2	1.8602	0.1842	2075.91	2	3240.0%	1	K.KITHNPFGPGQFFDLSIR.C
UQ9H5M753.3%114.1%579661596.0(Q9H5M7) Hypothetical protein FLJ23293 
*	TK120303_NMyc_cyto3_step04.4286.4286.2	2.1418	0.0147	2868.78	3	2170.0%	1	R.YMYNKDSQSWIGGNNEPLTGFTWR.G
UQ924I153.3%226.5%433459849.2(Q924I1) Matrix extracellular phosphoglycoprotein precursor 
*	TK120303_NMyc_cyto3_step06.1785.1785.1	0.7713	0.0559	1108.21	31	3000.0%	1	R.EGHGGSAYATR.D
*	TK120303_NMyc_cyto3_step08.1936.1936.2	2.1198	0.1484	1771.62	7	3750.0%	1	K.KTPSDLEGSGSPDLLVR.G
UFL3L_HUMAN53.3%2222.6%235264167.7(P49771) SL cytokine precursor (Fms-related tyrosine kinase 3 ligand) (Flt3 ligand) (Flt3L) 
*	TK120303_NMyc_cyto3_step06.2696.2696.2	2.1284	0.0387	2407.8	1	3570.0%	1	R.TPRPGEQVPPVPSPQDLLLVEH.-
*	TK120303_NMyc_cyto3_step01.3423.3423.3	1.6506	0.0215	3654.07	18	1330.0%	1	K.IRELSDYLLQDYPVTVASNLQDEELCGGLWR.L
UQ9D7V453.2%113.2%312353075.2(Q9D7V4) 2210401K11Rik protein 
	TK120303_NMyc_cyto3_step01.2399.2399.1	1.5062	0.1338	1072.62	1	6670.0%	1	R.VVLKGDISLK.N
UO9581353.2%2219.5%267300847.8(O95813) Cerberus-related protein (Cerberus-related 1) 
*	TK120303_NMyc_cyto3_step07.2608.2608.3	2.5591	0.3049	3624.82	1	1890.0%	1	R.ELPTGNHEEAEEKPDLFVAVPHLVATSPAGEGQR.Q
*	TK120303_NMyc_cyto3_step06.0626.0626.2	1.1466	0.2086	2033.69	7	2350.0%	1	R.HQDGRQNQSSLSPVLLPR.N
UQ9JI4753.1%225.5%495548079.1(Q9JI47) Erbb2-interacting protein ERBIN (Fragment) 
*	TK120303_NMyc_cyto3_step03.3848.3848.2	1.7526	0.274	1991.93	1	3440.0%	1	K.QNPQIDPVSFPPQRLPR.S
	TK120303_NMyc_cyto3_step06.1737.1737.1	1.2199	0.0037	1265.58	3	5560.0%	1	R.EQLIDYLMLK.V
UQ9GZU253.1%465.2%15881808265.5(Q9GZU2) Paternally expressed gene 3 isoform 1 (Kruppel-type zinc finger protein) 
*	TK120303_NMyc_cyto3_step03.3682.3682.2	1.3505	0.0018	2640.5	28	2380.0%	1	R.CLLCGQGFIHSSALNEHMRLHR.E
*	TK120303_NMyc_cyto3_step03.3551.3551.2	1.7258	0.2732	2832.18	1	2200.0%	1	R.SVIHSLVASKPPRSHNGNELVESNEK.G
*	TK120303_NMyc_cyto3_step08.3556.3556.3	1.8326	0.0956	3910.32	2	1520.0%	2	K.SWAPNLYELDSDLTKEPDVIIGEGPTDSEFFHQR.F
UQ9D4Z353.1%1112.8%1251344510.6(Q9D4Z3) 4930535B06Rik protein 
*	TK120303_NMyc_cyto3_step09.2887.2887.2	1.7412	0.2731	1742.87	1	3670.0%	1	R.TIVTNGVRTTVGNDHR.N
UQ9H9J353.1%118.4%155172029.6(Q9H9J3) Hypothetical protein FLJ12700 
*	TK120303_NMyc_cyto3_step01.2730.2730.1	1.5512	0.1109	1252.85	3	4580.0%	1	K.GRSPATGAALTPR.F
UCAG2_MOUSE53.0%137117.4%533592128.6(Q09200) Beta-1,4 N-acetylgalactosaminyltransferase (EC 2.4.1.92) ((N-acetylneuraminyl)-galactosylglucosylceramide) (GM2/GD2 synthase) (GalNAc-T) 
*	TK120303_NMyc_cyto3_step10.2393.2393.2	1.4689	0.1502	2536.89	22	1960.0%	1	R.LYPPSSLPQGAEYNISALVTIATK.T
*	TK120303_NMyc_cyto3_step07.3296.3296.2	1.5877	0.0578	2224.93	11	2780.0%	8	R.RFYPTVTIVIADDSDKPER.I
	TK120303_NMyc_cyto3_step01.2456.2456.1	1.7586	0.0687	1099.69	2	6250.0%	1	R.YAHIPVRIK.E
*	TK120303_NMyc_cyto3_step06.3488.3488.2	1.8861	0.0349	2074.34	4	3330.0%	1	R.QLLSVEPGAPGLGNCFRQK.Q
*	TK120303_NMyc_cyto3_step11.2271.2271.2	1.1049	0.044	2371.53	39	1670.0%	2	R.ALYALVLLLACASLGLLYSSTR.N
UITAM_MOUSE53.0%13699.5%11531274817.3(P05555) Integrin alpha-M precursor (Cell surface glycoprotein MAC-1 alpha subunit) (CR-3 alpha chain) (CD11b) (Leukocyte adhesion receptor MO1) 
*	TK120303_NMyc_cyto3_step03.1998.1998.3	1.8519	0.0074	1660.66	1	3750.0%	8	K.LLLKAIVASENNMSR.T
*	TK120303_NMyc_cyto3_step01.1095.1095.1	1.7589	0.0596	519.79	1	7500.0%	1	K.TNGAR.E
*	TK120303_NMyc_cyto3_step04.2274.2274.2	1.3371	0.0607	1935.05	17	2810.0%	1	R.QYKDMMNEAAPQDAPPQ.-
*	TK120303_NMyc_cyto3_step08.2912.2912.3	1.6852	0.265	3435.94	34	1330.0%	1	K.VEPYEVHNPVPLIVGSSIGGLVLLALITAGLYK.L
*	TK120303_NMyc_cyto3_step04.1736.1736.1	1.4392	0.0097	1346.59	130	3500.0%	1	K.EFVSTVMEQFK.K
*	TK120303_NMyc_cyto3_step04.1191.1191.3	1.3078	0.0179	3184.84	39	1480.0%	1	K.LILPDCVDDSVSPIILRLNYTLVGEPLR.S
UQ9CTE853.0%112.5%356403218.5(Q9CTE8) 1500026A19Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step01.1784.1784.1	1.5427	0.1067	1109.63	2	6880.0%	1	R.YLTGAWRLK.Q
URFX3_MOUSE53.0%2211.6%189214619.4(P48381) DNA-binding protein RFX3 (Fragment) 
	TK120303_NMyc_cyto3_step04.0971.0971.2	0.7016	0.0028	1118.15	146	2500.0%	1	K.LDPVNAASFGK.L
	TK120303_NMyc_cyto3_step07.2392.2392.1	1.5429	0.1156	1416.67	2	5000.0%	1	R.LQEDMQYMAMR.Q
UDBS_HUMAN53.0%5510.5%11081239846.6(O15068) Guanine nucleotide exchange factor DBS (DBL's big sister) (MCF2 transforming sequence-like protein) (Fragment) 
*	TK120303_NMyc_cyto3_step11.2379.2379.3	1.387	0.0745	2813.07	44	1700.0%	1	R.QTRPVQPVAPRPEALAKSPCPSPGIR.R
*	TK120303_NMyc_cyto3_step07.1297.1297.1	1.5257	0.1188	1234.55	1	5560.0%	1	K.QASMEEVFHR.R
*	TK120303_NMyc_cyto3_step08.3362.3362.2	1.363	0.0059	2523.51	10	2200.0%	1	R.GGAGPSPASHGPTHGPSDPRTCLPGR.G
*	TK120303_NMyc_cyto3_step01.4711.4711.3	1.705	0.0080	4457.04	62	1030.0%	1	R.GALGCCGLCSFYTCHGAAGDEIMHQDIVPLCAADIQDQLK.K
*	TK120303_NMyc_cyto3_step06.1940.1940.2	1.1414	0.0793	1554.8	3	4230.0%	1	K.LVPGKYTVVADHEK.G
UQ9CTY853.0%117.5%3053503611.0(Q9CTY8) 2310047I15Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step07.3316.3316.2	1.8171	0.2557	2411.81	1	2730.0%	1	R.VTFKDSFLSGHAAEAGDATQETK.K
UCANS_MOUSE52.8%3325.3%269284635.6(O88456) Calcium-dependent protease, small subunit (Calpain regulatory subunit) (Calcium-activated neutral proteinase) (CANP) 
	TK120303_NMyc_cyto3_step09.1937.1937.2	1.0799	0.0014	2446.31	12	1740.0%	1	R.ILGGVISAISEAAAQYNPEPPPPR.S
*	TK120303_NMyc_cyto3_step11.2799.2799.3	2.3739	0.1172	3890.04	15	1320.0%	1	R.FDTDRSGTIGSHELPGAFEAAGFHLNEHLYSMIIR.R
	TK120303_NMyc_cyto3_step01.2303.2303.1	1.6704	0.0933	1101.16	2	6250.0%	1	-.MFLVNSFLK.G
UQ9DAB452.8%114.3%391428906.7(Q9DAB4) 1700015E05Rik protein 
	TK120303_NMyc_cyto3_step03.4312.4312.2	1.6562	0.3109	1815.89	2	3440.0%	1	K.HQSLGGQYGVQGFPTIK.I
UQ8VG7152.8%5252.3%310349428.0(Q8VG71) Olfactory receptor MOR165-5 
*	TK120303_NMyc_cyto3_step12.4091.4091.1	0.9946	0.1133	762.6	31	5000.0%	5	K.KTITIGK.F
UO7516752.8%4410.1%634696908.2(O75167) Hypothetical protein KIAA0680 
*	TK120303_NMyc_cyto3_step01.0910.0910.1	1.3699	0.2269	627.42	2	8000.0%	1	K.SPVPPK.G
*	TK120303_NMyc_cyto3_step05.0419.0419.1	1.2418	0.1551	1123.62	4	4000.0%	1	K.SEEGNGSVSEK.T
*	TK120303_NMyc_cyto3_step12.0813.0813.2	1.0412	0.1374	1388.05	21	2730.0%	1	K.TPPLEEQAEDKK.E
*	TK120303_NMyc_cyto3_step12.2459.2459.3	1.5873	0.0782	3900.07	155	1100.0%	1	K.ELPDQDGDVTVNFENSNGHMIPIGEESTREENVVK.S
UQ9BW0452.8%4412.3%601639748.6(Q9BW04) Hypothetical protein 
*	TK120303_NMyc_cyto3_step07.2163.2163.1	1.4128	0.124	1204.56	45	4500.0%	1	K.SMPIPIPKAPR.A
*	TK120303_NMyc_cyto3_step01.4084.4084.3	1.8646	0.0674	3663.1	18	1410.0%	1	R.QAPASPQEAALDLDVVLIPPPEAFRDTQPEQCR.E
*	TK120303_NMyc_cyto3_step02.1163.1163.1	1.3753	0.2284	1091.37	1	5560.0%	1	R.LAPLTTPKPR.K
*	TK120303_NMyc_cyto3_step03.4352.4352.2	1.0963	0.0445	2166.54	110	1580.0%	1	K.DFAGIQVGKLADLEQEQSSK.R
UQ8WYU452.8%3316.0%420457719.6(Q8WYU4) Hypothetical protein 
*	TK120303_NMyc_cyto3_step02.4431.4431.1	1.3658	0.231	1158.66	3	4380.0%	1	R.QHNKDKPYK.C
*	TK120303_NMyc_cyto3_step03.2224.2224.3	1.5184	0.021	2988.11	1	1940.0%	1	R.TPSVSTSESSAGAGTGTGTSTPSTPTTTSQSR.L
*	TK120303_NMyc_cyto3_step11.2953.2953.2	1.323	0.1308	2619.98	8	1800.0%	1	K.IKAENPGGPPVLVVPYPILASGETAK.E
UQ9HBQ952.8%2211.6%3533726810.6(Q9HBQ9) Hypothetical protein 
*	TK120303_NMyc_cyto3_step01.4460.4460.1	1.5363	0.1126	1584.97	2	3570.0%	1	R.AFRPYGLHGGEPGAR.G
*	TK120303_NMyc_cyto3_step10.3870.3870.3	2.0117	0.2025	2195.79	5	2100.0%	1	R.LPGAGAGWAQLGGGLGGQAGVGAGGR.G
UNEST_HUMAN52.7%669.9%16181767054.4(P48681) Nestin 
*	TK120303_NMyc_cyto3_step05.4325.4325.2	0.971	0.1695	2671.72	7	1820.0%	1	K.SLGEEIQESLKTLENQSHETLER.E
*	TK120303_NMyc_cyto3_step12.1940.1940.2	1.3774	0.1942	1864.77	230	2190.0%	1	R.AHADDELAALRALVDQR.W
*	TK120303_NMyc_cyto3_step10.3810.3810.3	1.4317	0.0035	3214.95	29	1500.0%	1	R.VGLNAQAACAPRLPAPPRPPAPAPEVEELAR.R
*	TK120303_NMyc_cyto3_step10.3938.3938.2	1.2441	0.0346	2511.57	17	1900.0%	1	R.SPEVGDEEALRPLTKENQEPLR.S
	TK120303_NMyc_cyto3_step07.1805.1805.3	1.9827	0.0478	2882.69	21	1630.0%	1	K.TALETESQDSAEPSGSEEESDPVSLER.E
*	TK120303_NMyc_cyto3_step12.3563.3563.3	2.58	0.2785	4064.78	1	1470.0%	1	R.TPTLASTPIPPTPQAPSPAVDAEIRAQDAPLSLLQTQGGR.K
UQ9ULI652.7%61215.0%727791538.7(Q9ULI6) Hypothetical protein KIAA1234 (Fragment) 
*	TK120303_NMyc_cyto3_step11.3401.3401.3	1.6295	0.0013	3866.89	2	1520.0%	1	R.QDFCRQLHWAMDPPQVVFGQAPPLETGDDAILGR.L
*	TK120303_NMyc_cyto3_step10.1608.1608.1	1.7797	0.1047	1470.65	9	3460.0%	3	K.QRPAVGAEKSNPSK.R
*	TK120303_NMyc_cyto3_step12.2607.2607.3	1.9979	0.1903	3690.36	14	1290.0%	1	K.SFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGR.L
*	TK120303_NMyc_cyto3_step03.2912.2912.3	1.7533	0.0677	2902.55	23	1880.0%	1	K.NDPPSLRPMPRGSCLPCPCVQGTFR.N
UQ9Y4A352.7%2217.1%299323686.4(Q9Y4A3) R33590_1 
*	TK120303_NMyc_cyto3_step09.3329.3329.3	1.4962	0.0464	4657.85	8	1250.0%	1	R.LYECSPELCTTMLPPAWLLMLCQAPRPQDPDPRLTQPEK.S
	TK120303_NMyc_cyto3_step05.1281.1281.1	1.7786	0.0882	1347.63	7	4090.0%	1	R.HVELGEGWGHVK.D
UQ1411452.7%113.2%9631057165.0(Q14114) Apolipoprotein E receptor 2 precursor 
*	TK120303_NMyc_cyto3_step12.4183.4183.2	1.9751	0.245	3164.73	1	2170.0%	1	R.SDEAAELCGRPGPGATSAPAACATVSQFACR.S
UO7036552.7%222.5%22382575615.4(O70365) Golgi autoantigen golgin subtype a4 
*	TK120303_NMyc_cyto3_step05.3577.3577.3	2.0102	0.0695	4043.94	3	1390.0%	1	R.ESLNQLDLDCSAAAFDPPSDMESEAEDAPWNSDGLSR.E
*	TK120303_NMyc_cyto3_step10.3072.3072.2	1.9692	0.2424	2033.95	1	4120.0%	1	K.QMELESVSSELSEALRAR.D
USGCA_MOUSE52.6%4419.6%387432876.5(P82350) Alpha-sarcoglycan precursor (Alpha-SG) (Adhalin) (50 kDa dystrophin-associated glycoprotein) (50DAG) 
*	TK120303_NMyc_cyto3_step10.2468.2468.2	2.1154	0.0981	2283.61	1	3330.0%	1	-.MAAAVTWIPLLAGLLAGLRDTK.A
	TK120303_NMyc_cyto3_step05.1844.1844.1	1.1455	0.1026	1128.29	9	5000.0%	1	R.DSFDTTRQR.L
*	TK120303_NMyc_cyto3_step05.2847.2847.2	1.1281	0.136	2348.92	7	1900.0%	1	K.VGSATPFSTCLKMVASPDSYAR.C
*	TK120303_NMyc_cyto3_step09.4278.4278.2	1.0827	0.0268	2729.54	29	1820.0%	1	R.DMATSDIQMFHHCSIHGNTEELR.Q
UPTPM_MOUSE52.5%6610.6%14521635946.6(P28828) Protein-tyrosine phosphatase MU precursor (EC 3.1.3.48) (R-PTP-MU) 
	TK120303_NMyc_cyto3_step08.3284.3284.3	2.0122	0.1129	3139.86	19	1830.0%	1	R.EIRQFHFTGWPDHGVPYHATGLLGFVR.Q
*	TK120303_NMyc_cyto3_step12.2782.2782.2	1.3275	0.1814	2104.72	5	2940.0%	1	K.DIKVTLIDTELLAEYVIR.T
	TK120303_NMyc_cyto3_step05.2772.2772.2	1.6905	0.2838	2674.01	1	3180.0%	1	R.HGPIQVEFVSADLEEDIISRIFR.I
*	TK120303_NMyc_cyto3_step10.1514.1514.2	1.4803	0.201	2024.72	3	2940.0%	1	K.REAADVPYQTGQLHPAIR.V
	TK120303_NMyc_cyto3_step11.2899.2899.3	1.9794	0.012	3823.32	1	1740.0%	1	R.EPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGR.V
	TK120303_NMyc_cyto3_step01.4308.4308.3	1.8646	0.0266	3566.94	2	1590.0%	1	K.IGHLDPDTEYEISVLLTRPGEGGTGSPGPALRTR.T
UMCT2_MOUSE52.5%3521.7%244267328.4(P15119) Mast cell protease 2 precursor (EC 3.4.21.-) (MMCP-2) 
*	TK120303_NMyc_cyto3_step03.3515.3515.3	1.9281	0.1929	3528.74	178	1020.0%	1	R.CGGFLIAPQFVMTAAHCNGSEISVILGAHNINK.N
*	TK120303_NMyc_cyto3_step03.4231.4231.2	1.6906	0.2817	2274.25	1	3160.0%	2	K.DHSDYDYQLQVCAGSPTTSK.S
UQ8VCN952.5%2215.2%341381255.3(Q8VCN9) Similar to tubulin-specific chaperone c 
*	TK120303_NMyc_cyto3_step10.1582.1582.3	1.6558	0.0554	2819.71	1	2210.0%	1	-.MEGVDCSMALADAAAGSPRDLSLVPER.L
*	TK120303_NMyc_cyto3_step07.2877.2877.2	1.6903	0.2805	2350.29	1	3330.0%	1	K.KDAAGTAQVDAAPVTSAAPSPPVTK.E
UCIW6_HUMAN52.5%228.6%313337476.5(Q9Y257) Potassium channel subfamily K member 6 (Inward rectifying potassium channel protein TWIK-2) (TWIK-originated similarity sequence) 
*	TK120303_NMyc_cyto3_step05.3621.3621.3	2.7647	0.0389	2936.58	4	2020.0%	1	R.VDILGPQPESHQQLSASSHTDYASIPR.-
UQ9UJX552.5%225.6%808919925.5(Q9UJX5) Anaphase-promoting complex subunit 4 
*	TK120303_NMyc_cyto3_step04.3500.3500.3	2.7361	0.0388	4466.93	3	1320.0%	1	R.LLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTR.T
*	TK120303_NMyc_cyto3_step01.1800.1800.2	1.386	0.0651	2066.49	17	2500.0%	1	R.LDEQCSAIPTRTMHFEK.H
UQ9H46252.5%336.8%10311131278.6(Q9H462) BA416N2.2 (Similar to murine FISH (An SH3 and PX domain-containing protein, and Src substrate)) (Fragment) 
	TK120303_NMyc_cyto3_step12.2238.2238.3	2.7662	0.0391	2745.07	3	2280.0%	1	R.NSIPVSPVRPKPIEKSQFIHNNLK.D
	TK120303_NMyc_cyto3_step06.2713.2713.3	1.5712	0.0039	3944.62	14	1280.0%	1	K.NHSSASFSSSITINTTCCSSSSSSSSSLSKTSGDLKPR.S
	TK120303_NMyc_cyto3_step07.3507.3507.3	2.3026	0.0383	3918.41	2	1490.0%	1	K.NAQAEMGKNHSSASFSSSITINTTCCSSSSSSSSSLSK.T
UQ9H50152.5%227.9%851987965.1(Q9H501) BA526K24.1 (Novel protein) 
*	TK120303_NMyc_cyto3_step03.4263.4263.3	1.8303	0.0724	4407.6	77	900.0%	1	R.ASGDDDGSEDDEEEDEDEEEDEDEDSEDDDKSDSGPDLAR.G
*	TK120303_NMyc_cyto3_step10.2936.2936.3	2.7409	0.0334	3008.53	1	2310.0%	1	K.ALAEEASEEELPSDVDLNDPYFAEEVK.Q
UQ9P1Y652.5%12547.8%16541790538.9(Q9P1Y6) Hypothetical protein KIAA1542 (Fragment) 
*	TK120303_NMyc_cyto3_step12.4111.4111.3	1.5414	0.0017	3912.13	261	940.0%	1	R.DQAVGTPENCAHYFCLDCIVEWSKNANSCPVDR.T
*	TK120303_NMyc_cyto3_step02.2020.2020.1	1.2337	0.0288	1522.6	2	3750.0%	1	K.NANSCPVDRTLFK.C
*	TK120303_NMyc_cyto3_step10.3140.3140.2	1.4094	0.105	2542.24	9	2050.0%	1	R.RPVHSSCIPSVLKPVEPSLGLLR.A
*	TK120303_NMyc_cyto3_step03.4078.4078.2	0.9945	0.0189	1920.13	2	2810.0%	1	R.VTWNLQESESSAPAEDR.A
*	TK120303_NMyc_cyto3_step02.3525.3525.3	1.9913	0.0943	4367.36	144	880.0%	7	R.RLPAAVPEPDLEEEPVPDLLGSILSGQSLLMLGSSDVIIHR.D
*	TK120303_NMyc_cyto3_step10.1886.1886.1	1.1517	0.136	1096.64	77	4000.0%	1	K.HTLPLASAASK.I
UP11G_MOUSE52.5%5114.5%11021263627.2(Q9JHG7) Phosphatidylinositol 3-kinase catalytic subunit, gamma isoform (EC 2.7.1.137) (PI3-kinase p110 subunit gamma) (PtdIns-3-kinase p110) (PI3K) (PI3Kgamma) 
*	TK120303_NMyc_cyto3_step10.3697.3697.3	2.418	0.0844	3040.77	3	1900.0%	3	K.QLTSLIGYDVTDISNVHDDELEFTRR.R
*	TK120303_NMyc_cyto3_step03.2687.2687.2	1.0322	0.3127	1879.28	8	2500.0%	1	K.CADPTVLSNETIGIIFK.H
	TK120303_NMyc_cyto3_step05.0402.0402.1	0.6306	0.0446	777.61	35	4170.0%	1	K.SFLGINK.E
UQ9QZR952.5%8810.1%16821640968.5(Q9QZR9) Alpha 4 collagen IV 
*	TK120303_NMyc_cyto3_step12.2430.2430.3	2.7682	0.1799	3356.71	6	1810.0%	1	R.SYISRCAVCEAPAQAVAVHSQDQSIPPCPR.T
*	TK120303_NMyc_cyto3_step02.2445.2445.2	1.2882	0.091	2300.53	153	1590.0%	1	K.GDLGDRGYPGPPGILLTPAPPLK.G
*	TK120303_NMyc_cyto3_step06.1761.1761.1	1.359	0.0961	746.55	8	5000.0%	1	R.KGEVGEK.G
*	TK120303_NMyc_cyto3_step12.1626.1626.3	1.787	0.1765	2824.07	13	1720.0%	1	R.GVIGFPGFPGDQGDPGSPGPPGFPGDDGAR.G
*	TK120303_NMyc_cyto3_step02.0928.0928.2	0.8369	0.019	3164.95	42	1090.0%	1	R.GEPGSHGPPGFPGFKGIQGAAGEPGLFGFLGPK.G
*	TK120303_NMyc_cyto3_step11.2933.2933.3	2.0105	0.077	4762.59	1	1450.0%	1	R.SLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFVECQGR.Q
*	TK120303_NMyc_cyto3_step12.2807.2807.2	1.187	0.0963	1688.87	110	2190.0%	1	R.GYPGPPGILLTPAPPLK.G
*	TK120303_NMyc_cyto3_step03.4126.4126.3	1.2407	0.0279	3191.2	30	930.0%	1	R.CAVCEAPAQAVAVHSQDQSIPPCPRTWR.S
UQ9WVG952.5%4420.6%466534839.6(Q9WVG9) Male-specific lethal-3 homolog 1 (Drosophila) 
	TK120303_NMyc_cyto3_step12.2154.2154.2	1.5167	0.0595	1488.57	81	4500.0%	1	K.QLEDDCYYINR.R
*	TK120303_NMyc_cyto3_step02.2784.2784.3	2.76	0.0154	3431.87	1	1720.0%	1	R.SQEELSPSPPLLNPSTPQSTESQPPTGEPATPK.R
*	TK120303_NMyc_cyto3_step07.2471.2471.3	1.5894	0.1664	2611.8	4	2000.0%	1	R.ITFDYTLPLVLLYPYEQTQYK.R
	TK120303_NMyc_cyto3_step01.2764.2764.3	1.2849	0.0214	3573.7	1	1830.0%	1	K.LPCQTNIITILESYVKHFAINAAFSANERPR.H
UO6028052.5%111714.6%11241240006.5(O60280) Hypothetical protein KIAA0528 (Fragment) 
*	TK120303_NMyc_cyto3_step09.3532.3532.2	1.4827	0.1	3052.51	59	1430.0%	1	K.EHLESASSNSGIPAAQRATSVDYSSFADR.C
*	TK120303_NMyc_cyto3_step07.2824.2824.3	1.5329	0.0888	4380.98	11	1180.0%	1	K.VYIDIDPLLYSEAATVISGWFPIYDTIHGIRGEINVVVK.V
*	TK120303_NMyc_cyto3_step12.4403.4403.2	1.2398	2.0E-4	1946.5	116	2060.0%	1	R.SQSESSDEVTELDLSHGK.K
*	TK120303_NMyc_cyto3_step04.1250.1250.1	1.3213	0.0269	633.43	64	6000.0%	1	K.EGGPFK.A
*	TK120303_NMyc_cyto3_step10.2776.2776.2	1.5693	0.1804	2381.89	4	2380.0%	1	R.GNAVVGYLQCFDLEGESGLVVR.A
*	TK120303_NMyc_cyto3_step09.1759.1759.3	1.3241	0.0198	1905.61	18	2340.0%	1	R.IHNPAFVGIMGNTRSYK.L
*	TK120303_NMyc_cyto3_step04.3518.3518.2	1.8135	0.0736	2853.22	3	2730.0%	1	K.LLDWNSFNSDEPETRDAWWAEIR.Q
*	TK120303_NMyc_cyto3_step04.3308.3308.3	1.7122	0.0408	3415.44	7	1610.0%	1	R.GNAVVGYLQCFDLEGESGLVVRAIGTACTLDK.L
UP9735852.4%336.7%586679538.1(P97358) TAFI68 
*	TK120303_NMyc_cyto3_step10.1359.1359.2	1.3822	0.2266	1574.97	2	5000.0%	1	K.YYCTSCHNVTDR.S
*	TK120303_NMyc_cyto3_step06.1365.1365.1	0.8671	0.0363	704.52	10	6250.0%	1	K.RPLYR.S
*	TK120303_NMyc_cyto3_step03.3566.3566.2	2.1144	0.0495	2508.91	2	2620.0%	1	K.YDVQAMAVIVVVLKLLFLLDDK.L
UO9538152.4%5715.7%713787675.4(O95381) Connector enhancer of KSR-like protein CNK1 
	TK120303_NMyc_cyto3_step08.2722.2722.2	1.3942	0.2775	2795.83	8	1740.0%	1	K.EGTVLRICSHVAGICHNILVCCPK.E
*	TK120303_NMyc_cyto3_step01.3914.3914.2	1.6287	0.0416	2505.01	4	2140.0%	2	R.LQIQPGDEVVQINEQVVVGWPR.K
	TK120303_NMyc_cyto3_step12.3722.3722.3	2.3529	0.1847	4759.41	10	1060.0%	1	R.EEDCYSETEAEDPDDEAGSHSASPSPAQAGSPLHGDTSPAATPTQR.S
	TK120303_NMyc_cyto3_step04.2963.2963.2	1.4166	0.0448	2238.59	13	2110.0%	1	K.LQELQVLEEVLGDPELTGEK.F
UQ99PK252.4%5515.2%855982586.0(Q99PK2) Ubiquitin-protein ligase Nedd4-2 
	TK120303_NMyc_cyto3_step07.3789.3789.2	0.7656	0.1024	2590.56	102	1360.0%	1	R.LQITPDSNGEQFSSLIQREPSSR.L
*	TK120303_NMyc_cyto3_step11.4159.4159.2	1.7696	0.2626	2071.5	3	3240.0%	1	K.MGYMPKNGGQDEENSEQR.D
	TK120303_NMyc_cyto3_step03.0822.0822.3	1.5703	0.0796	4199.5	2	1280.0%	1	R.LLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEK.L
	TK120303_NMyc_cyto3_step10.2144.2144.2	1.5864	0.0656	2248.88	42	1940.0%	1	K.QITLNDMESVDSEYYNSLK.W
*	TK120303_NMyc_cyto3_step11.2346.2346.3	1.4706	0.0105	3344.97	354	1050.0%	1	R.ARSSTVTGGEESTPSVAYVHTTPGLPSGWEER.K
UQ9BTJ152.3%1419619.0%8494789.1(Q9BTJ1) Ribosomal protein S27 
*	TK120303_NMyc_cyto3_step05.2221.2221.2	1.4735	0.0294	1881.43	7	2670.0%	14	-.MPLARDLLHPSLEEEK.K
UQ9HAW452.3%447.3%13321501754.8(Q9HAW4) Hu-Claspin 
*	TK120303_NMyc_cyto3_step06.2983.2983.2	1.4094	0.2884	2162.51	6	2500.0%	1	R.LYQERYLADGDLHSDGPGR.M
*	TK120303_NMyc_cyto3_step02.2263.2263.2	1.9374	0.2486	2460.83	1	3410.0%	1	K.ESSMGDPMEEALALCSGSFPTDK.E
*	TK120303_NMyc_cyto3_step02.3804.3804.3	1.4908	0.0057	4395.15	24	1080.0%	1	R.LVSNDNEFDSDEDEHSDSGNDLALEDHEDDDEEELLKR.S
*	TK120303_NMyc_cyto3_step08.2675.2675.3	1.5755	0.0191	2024.47	26	2190.0%	1	R.LIRESALNLPYHMPENK.T
UHEY1_HUMAN52.3%116.2%304326139.0(Q9Y5J3) Hairy/enhancer-of-split related with YRPW motif 1 (Hairy and enhancer of split related-1) (HESR-1) (Cardiovascular helix-loop-helix factor 2) (HES-related repressor protein 2 HERP2) 
*	TK120303_NMyc_cyto3_step08.1807.1807.2	1.6092	0.3572	1763.88	1	3330.0%	1	R.APPSGSLGPVLPVVTSASK.L
UK1CL_HUMAN52.3%5517.2%494535114.8(Q99456) Keratin, type I cytoskeletal 12 (Cytokeratin 12) 
*	TK120303_NMyc_cyto3_step11.2330.2330.2	1.3827	0.1031	2581.09	64	1820.0%	1	K.TVVQEMVNGEVVSSQVQEIEELM.-
*	TK120303_NMyc_cyto3_step10.3628.3628.2	1.2019	0.0186	2381.37	123	1670.0%	1	R.RLLDGEAQGDGLEESLFVTDSK.S
*	TK120303_NMyc_cyto3_step08.1900.1900.2	1.9232	0.2508	2225.64	1	3000.0%	1	R.LLDGEAQGDGLEESLFVTDSK.S
*	TK120303_NMyc_cyto3_step05.2171.2171.1	1.2518	0.0312	1466.07	44	3330.0%	1	K.EISTNTEQLQSSK.S
*	TK120303_NMyc_cyto3_step03.3167.3167.2	1.1738	0.0192	2799.68	75	1150.0%	1	R.VGGPGEVSVEMDAAPGVDLTRLLNDMR.A
UQ9QUS352.3%573.6%12171415557.2(Q9QUS3) BAMACAN 
	TK120303_NMyc_cyto3_step03.1271.1271.1	1.235	0.0206	780.57	2	6670.0%	2	R.QIAAIHK.D
	TK120303_NMyc_cyto3_step02.0539.0539.1	0.9708	0.1021	1413.82	2	3330.0%	1	K.VSHIDVITAEMAK.D
	TK120303_NMyc_cyto3_step01.2806.2806.1	0.8908	0.0659	936.71	6	5000.0%	1	K.AFKHVFGK.T
	TK120303_NMyc_cyto3_step04.2651.2651.2	1.9222	0.2427	1966.02	4	3330.0%	1	K.NLEQYNKLDQDLNEVK.A
USPBP_MOUSE52.2%4631.2%199219665.0(P15501) Prostatic spermine-binding protein precursor (SBP) (Major prostatic secretory glycoprotein) (P25) 
	TK120303_NMyc_cyto3_step10.1203.1203.1	0.9498	0.2218	1288.74	103	3180.0%	1	R.GRYFSDTGGSDK.H
*	TK120303_NMyc_cyto3_step05.1523.1523.3	1.557	0.1463	1732.19	4	3040.0%	1	K.WGNINANGNDHYNNK.E
	TK120303_NMyc_cyto3_step08.2687.2687.3	1.9485	0.1547	3917.82	3	1470.0%	2	R.SDNFIDFLLEDGEHVIKVEGSAVICLTSLTFTTNK.G
UERR1_HUMAN52.2%227.1%519554406.7(P11474) Steroid hormone receptor ERR1 (Estrogen-related receptor, alpha) (ERR-alpha) (Estrogen receptor-like 1) 
*	TK120303_NMyc_cyto3_step12.3470.3470.2	2.0822	0.2193	2062.5	1	3500.0%	1	K.GSSETETEPPVALAPGPAPTR.C
*	TK120303_NMyc_cyto3_step07.1888.1888.2	2.0856	0.2108	1552.23	46	3000.0%	1	R.AAGLGELGAALLQLVR.R
UQ9DAE052.2%114.1%315350208.3(Q9DAE0) 1700012K17Rik protein (Attaches to Cre) 
	TK120303_NMyc_cyto3_step02.1671.1671.1	1.7619	0.0186	1533.64	1	4170.0%	1	R.VAACSEQNQKLQR.K
UBSS4_HUMAN52.1%6364.4%317337327.6(Q9GZN4) Brain-specific serine protease 4 precursor (EC 3.4.21.-) (BSSP-4) (SP001LA) 
*	TK120303_NMyc_cyto3_step02.2367.2367.1	1.493	0.0142	1575.67	3	4230.0%	6	K.EGACADIALVRLER.S
UQ9H6Y252.0%114.2%383421234.9(Q9H6Y2) Hypothetical protein FLJ21702 
	TK120303_NMyc_cyto3_step11.3987.3987.2	1.8816	0.2489	1988.02	2	3000.0%	1	K.FWDMAQLRAVVVDDYR.R
UQ0107852.0%222.9%747831944.7(Q01078) Protein PC326 
*	TK120303_NMyc_cyto3_step09.2352.2352.2	1.6453	0.3103	1754.03	1	3570.0%	1	K.FLPNCNDAILAMCGR.D
*	TK120303_NMyc_cyto3_step04.1108.1108.1	0.8403	0.0108	739.7	47	5000.0%	1	R.QAHPASK.L
UQ9H4F352.0%3325.6%246280118.3(Q9H4F3) 28kD interferon responsive protein 
	TK120303_NMyc_cyto3_step11.1731.1731.2	1.083	0.0454	2646.15	188	1500.0%	1	R.CQKCSWSQYEMPEFSSDSTMR.I
	TK120303_NMyc_cyto3_step06.1569.1569.1	1.388	0.2078	907.73	1	6670.0%	1	R.MRLFGQR.C
	TK120303_NMyc_cyto3_step06.2772.2772.3	1.7262	0.1004	3803.62	34	1180.0%	1	R.KSPEMPVILEVSLEGSHDTANCEACTLGICGQGLK.S
UQ9NPM352.0%8648.2%462507097.4(Q9NPM3) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step04.4343.4343.3	2.2944	0.1881	4108.93	1	1490.0%	8	R.FQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSK.L
UQ9DAF752.0%119.0%290316567.6(Q9DAF7) 1700011M07Rik protein 
	TK120303_NMyc_cyto3_step05.2691.2691.3	2.7047	0.1313	2944.63	1	2000.0%	1	R.NLISQGWPVNIITADHVSPLHEACLR.G
UWDR6_HUMAN51.9%6813.6%11211217246.9(Q9NNW5) WD-repeat protein 6 
*	TK120303_NMyc_cyto3_step02.2667.2667.3	1.2505	0.042	4243.81	239	970.0%	1	K.CWEQLLEDKHFQSYCLLEAAPGPEGFGLCAMANGEGR.V
	TK120303_NMyc_cyto3_step07.3192.3192.2	1.2155	0.011	2483.22	12	2000.0%	1	R.LFLLQDSGRILQLLAETFHHK.R
	TK120303_NMyc_cyto3_step04.1860.1860.3	2.1879	0.1585	3681.08	58	1210.0%	1	R.VLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQR.L
*	TK120303_NMyc_cyto3_step07.2932.2932.2	1.3289	0.0534	3154.94	73	1300.0%	1	K.QGVTSVTCHGGYVYTTGRDGAYYQLFVR.D
*	TK120303_NMyc_cyto3_step08.2730.2730.3	1.7885	0.1482	3321.26	2	1640.0%	2	R.GYEELLLLASGPGGVVACLEISAAPSGKAIFVK.E
UCA28_MOUSE51.9%1122.4%170181116.8(P25318) Collagen alpha 2(VIII) chain (Endothelial collagen) (Fragment) 
*	TK120303_NMyc_cyto3_step12.2567.2567.3	2.7028	0.1601	3916.1	2	1350.0%	1	K.GGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVRFDR.T
UNICA_MOUSE51.9%6821.9%708784896.3(P57716) Nicastrin precursor 
*	TK120303_NMyc_cyto3_step05.4356.4356.3	1.1524	0.0714	4469.64	24	1050.0%	1	K.QCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMR.R
*	TK120303_NMyc_cyto3_step07.1620.1620.3	1.8553	0.0999	2527.98	8	2070.0%	1	R.ALYELAGGTNFSSSIQADPQTVTR.L
*	TK120303_NMyc_cyto3_step05.3235.3235.3	2.2572	0.1074	4706.58	8	1160.0%	1	R.IAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKK.T
*	TK120303_NMyc_cyto3_step02.3752.3752.3	1.9829	0.0118	3749.43	2	1850.0%	1	K.TLWNELGNGLAYEDFSFPIFLLEDENETKVIK.Q
*	TK120303_NMyc_cyto3_step06.1944.1944.2	1.8596	0.2475	2016.7	1	3670.0%	2	K.DLYEYSWVQGPWNSNR.T
UCLAT_HUMAN51.9%242.5%748825688.6(P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase) (Choline acetylase) (ChAT) 
*	TK120303_NMyc_cyto3_step05.2459.2459.2	1.4967	0.0325	2258.52	9	2220.0%	2	K.QKCSPDAFIQVALQLAFYR.L
UQ9262451.9%113.7%681765676.6(Q92624) Hypothetical protein KIAA0228 (Fragment) 
*	TK120303_NMyc_cyto3_step09.1576.1576.3	2.4629	0.3535	2527.43	1	2290.0%	1	R.CFLSHFLLGPASAAAVPQFAPGGGR.A
UCAS2_MOUSE51.9%2211.2%143169116.1(P02664) Epsilon casein precursor 
*	TK120303_NMyc_cyto3_step11.1793.1793.1	1.4804	0.1326	1548.7	2	3460.0%	1	K.FIILTCLLAVALAK.Q
*	TK120303_NMyc_cyto3_step04.2083.2083.2	1.4163	0.1266	1808.57	14	3330.0%	1	-.MKFIILTCLLAVALAK.Q
UCIK4_MOUSE51.8%469.3%654734745.3(Q61423) Voltage-gated potassium channel protein Kv1.4 
	TK120303_NMyc_cyto3_step10.3005.3005.3	2.6957	0.1958	3008.79	1	2300.0%	2	R.ETENEEQTQLTQNAVSCPYLPSNLLK.K
	TK120303_NMyc_cyto3_step09.2163.2163.3	1.7768	0.0262	2249.58	177	1940.0%	1	R.NRPSFDAILYYYQSGGRLK.R
	TK120303_NMyc_cyto3_step10.3904.3904.2	1.3024	0.0527	1813.57	61	2330.0%	1	K.TLAQFPETLLGDPEKR.T
UQ96NB751.7%1119.2%1301459612.0(Q96NB7) Hypothetical protein FLJ31132 
*	TK120303_NMyc_cyto3_step12.3732.3732.2	1.633	0.3167	2643.64	1	2500.0%	1	R.LQGRPLHGFLPSQVSRGQLLPGGAR.N
UMYH3_HUMAN51.7%332.8%19402240345.8(P11055) Myosin heavy chain, fast skeletal muscle, embryonic (Muscle embryonic myosin heavy chain) (SMHCE) 
*	TK120303_NMyc_cyto3_step06.2507.2507.2	1.3291	0.1681	2130.11	1	3060.0%	1	-.MSSDTEMEVFGIAAPFLRK.S
*	TK120303_NMyc_cyto3_step05.2733.2733.2	1.3979	0.0869	2595.75	55	1520.0%	1	K.VGNEYVTKGQTVDQVHHAVNALSK.S
*	TK120303_NMyc_cyto3_step02.1611.1611.1	1.6522	0.0912	1416.97	2	4550.0%	1	K.LAEQELLDSNER.V
UQ9BYK851.7%777.2%25672858247.4(Q9BYK8) DJ697K14.6 (Novel protein, KIAA1769) 
*	TK120303_NMyc_cyto3_step02.2144.2144.1	1.6378	0.0896	1589.77	1	4230.0%	1	-.MAVWEAEQLGGLQR.G
*	TK120303_NMyc_cyto3_step07.3320.3320.3	2.1107	0.1449	4202.32	4	1280.0%	1	K.TALQTPALNMLFAPPGALYAEVPVPSSLMPDTDQGFLLGR.A
	TK120303_NMyc_cyto3_step07.2344.2344.3	1.9634	0.0427	3307.82	38	1330.0%	1	R.VPLSLHLGHHLHGGGGSPPDTRLHLLASLWK.Q
	TK120303_NMyc_cyto3_step01.2971.2971.2	1.304	0.0298	3148.21	26	1610.0%	1	K.EEAVRGLEEASPLVTSIALGRPVPQPLCR.V
	TK120303_NMyc_cyto3_step03.2530.2530.3	1.673	0.0164	2604.06	92	1740.0%	1	R.YLDVVLQRQILLALGHGGSAYSAR.D
*	TK120303_NMyc_cyto3_step04.3901.3901.3	1.3918	0.119	3639.31	1	1720.0%	1	K.FELCPKPDLCEYGDACTKAHSAQELQEWVR.R
	TK120303_NMyc_cyto3_step10.1938.1938.2	1.1603	0.0157	1972.15	2	3440.0%	1	R.MHEGICAFPSVAFYKSK.L
UQ8TEH951.7%2212.6%174189388.5(Q8TEH9) FLJ00218 protein (Fragment) 
*	TK120303_NMyc_cyto3_step04.3528.3528.1	1.1107	0.0839	1191.5	84	4550.0%	1	K.DAGGADVSLACR.R
*	TK120303_NMyc_cyto3_step09.1787.1787.1	1.6398	0.0888	1031.57	4	5560.0%	1	R.LPPHQGLGGR.D
UAD20_HUMAN51.7%338.3%726817116.5(O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 20) 
*	TK120303_NMyc_cyto3_step03.2262.2262.1	1.5229	0.1092	1404.63	1	4170.0%	1	R.GAKAPGWLSYSLR.F
*	TK120303_NMyc_cyto3_step05.1895.1895.2	1.1327	0.1555	2761.65	1	1960.0%	1	K.EIFGQDARSASQSCYQEINTQGNR.F
*	TK120303_NMyc_cyto3_step09.4334.4334.3	0.713	0.0159	2694.13	98	1020.0%	1	K.DPCCLLNCTLHPGAACAFGICCK.D
UORP8_HUMAN51.7%225.7%847969567.5(Q9BZF1) Oxysterol binding protein-related protein 8 (OSBP-related protein 8) (ORP-8) 
*	TK120303_NMyc_cyto3_step08.2440.2440.3	2.5642	0.3019	2581.76	3	2270.0%	1	R.EGKEHDLSVSSDSTHVTFYGLLR.A
*	TK120303_NMyc_cyto3_step01.4148.4148.2	1.5676	0.2071	2968.79	21	1670.0%	1	K.FADTRPWDPLNDMIQFEKDGVIQTK.V
UQ96IF851.7%3529.3%1911848811.7(Q96IF8) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step12.1966.1966.2	1.5315	0.1043	2216.46	3	2750.0%	2	R.QSEDELGNLLAMVSGPLALVR.S
*	TK120303_NMyc_cyto3_step10.3502.3502.2	1.123	0.017	3086.27	81	1030.0%	1	R.SGVSPAARPLLLSLLPPGATAGAGAGLGGVGGSPR.F
UKLKF_HUMAN51.7%117.0%256280878.0(Q9H2R5) Kallikrein 15 precursor (EC 3.4.21.-) (ACO protease) 
*	TK120303_NMyc_cyto3_step08.2083.2083.2	1.8349	0.2514	1941.29	1	4120.0%	1	K.SYPGRLTNTMVCAGAEGR.G
UQ8R5C951.7%4410.7%810914656.3(Q8R5C9) Hypothetical 91.5 kDa protein (Fragment) 
*	TK120303_NMyc_cyto3_step02.2133.2133.3	1.8842	0.0732	3843.43	10	1290.0%	1	K.DILTYTELVLDSQGQLVEMNRLPGCNEVGMVAFK.M
*	TK120303_NMyc_cyto3_step05.3473.3473.2	1.8306	0.2442	2067.89	4	2810.0%	1	-.LFITNESGYYLDISLYR.E
*	TK120303_NMyc_cyto3_step01.3336.3336.2	1.2346	0.0891	3080.61	17	1670.0%	1	R.SGNIMFHSFGNKQGSLHGMLINTPYVTK.D
*	TK120303_NMyc_cyto3_step06.1788.1788.1	1.5972	0.0036	966.94	15	5000.0%	1	R.EIEFTPTK.A
UQ9UND251.7%3327.6%1701940211.2(Q9UND2) Homeobox protein DUX3 
	TK120303_NMyc_cyto3_step02.2767.2767.1	0.6656	0.0344	1488.51	128	2500.0%	1	R.EELARETGLPESR.I
	TK120303_NMyc_cyto3_step04.3094.3094.2	1.8364	0.245	1500.73	4	3850.0%	1	K.RTAITGSQTALLLR.A
	TK120303_NMyc_cyto3_step04.3070.3070.2	1.7352	0.0652	2100.0	6	2630.0%	1	-.MALLTALDDTLPEEAQGPGR.R
UUTY_MOUSE51.7%667.4%12121367377.5(P79457) Ubiquitously transcribed Y chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein ON the Y chromosome) (Male-specific histocompatibility antigen H-YDB) 
*	TK120303_NMyc_cyto3_step11.2779.2779.3	1.8742	0.1806	3873.29	2	1450.0%	1	K.HFQLALIDCNVCTLSSVEIQFHIAHLYETQRK.Y
*	TK120303_NMyc_cyto3_step10.2273.2273.2	1.8061	0.3296	1907.75	14	3000.0%	1	K.VYTQCFTAQKLQSFGK.D
*	TK120303_NMyc_cyto3_step04.1880.1880.3	1.4758	0.0077	2627.59	456	1360.0%	1	K.ATVLQQLGWMHHNMDLIGDNTTK.E
*	TK120303_NMyc_cyto3_step11.2317.2317.3	2.5587	0.255	3748.12	1	1830.0%	1	K.HFQLALIDCNVCTLSSVEIQFHIAHLYETQR.K
*	TK120303_NMyc_cyto3_step04.1068.1068.3	1.6846	0.0064	2138.27	10	2640.0%	1	K.HSNHIYQISSVPISSLNNK.E
ULYOX_MOUSE51.6%4419.0%411467018.4(P28301) Protein-lysine 6-oxidase precursor (EC 1.4.3.13) (Lysyl oxidase) (RAS excision protein) 
	TK120303_NMyc_cyto3_step11.4163.4163.3	1.5271	0.102	3881.23	128	1290.0%	1	R.YSWEWHSCHQHYHSMDEFSHYDLLDANTQR.R
	TK120303_NMyc_cyto3_step10.1868.1868.2	0.9341	0.0252	2251.64	183	1580.0%	1	K.VSVNPSYLVPESDYTNNVVR.C
*	TK120303_NMyc_cyto3_step01.2584.2584.1	1.4618	0.1467	1300.78	3	4500.0%	1	R.MVGDDPYNPYK.Y
*	TK120303_NMyc_cyto3_step12.2291.2291.2	1.6572	0.0892	1651.05	29	2500.0%	1	R.TPSPSGVAAGRPRPAAR.H
UQ91W4851.6%224.3%511572306.2(Q91W48) Archain 1 
	TK120303_NMyc_cyto3_step01.2648.2648.1	1.7502	0.0257	1114.64	4	5620.0%	1	R.LHVENEDKK.G
	TK120303_NMyc_cyto3_step09.1184.1184.1	1.2837	0.0569	1235.72	9	4580.0%	1	K.VAPAPARPSGPSK.A
UQ8R3S951.6%391.4%503584478.8(Q8R3S9) Hypothetical 58.4 kDa protein (Fragment) 
	TK120303_NMyc_cyto3_step02.1127.1127.1	1.7406	0.023	784.57	3	6670.0%	3	R.QISAVHK.E
UIQG2_HUMAN51.6%446.0%15751806125.6(Q13576) Ras GTPase-activating-like protein IQGAP2 
*	TK120303_NMyc_cyto3_step10.2892.2892.3	1.851	0.018	3263.06	21	1610.0%	1	K.LGDSESVSKVLWLDEIQQAVDEANVDEDR.A
*	TK120303_NMyc_cyto3_step03.1726.1726.1	1.4871	0.0968	1060.61	2	6250.0%	1	K.YTAAKLHEK.G
*	TK120303_NMyc_cyto3_step01.2679.2679.1	1.4796	0.1364	1588.84	3	3850.0%	1	K.DLNLMDIKIGLLVK.N
*	TK120303_NMyc_cyto3_step02.3020.3020.3	1.8602	0.0531	4373.72	22	980.0%	1	K.NDLLSELLGSLGEVPTVESFLGEGAVDPNDPNKANTLSQLSK.T
UQ9NSP451.6%2218.9%180197377.2(Q9NSP4) Hypothetical protein 
*	TK120303_NMyc_cyto3_step12.2967.2967.2	1.4447	0.0658	2441.09	163	1750.0%	1	K.YSLQNTEESLRHVDASFFLGK.V
*	TK120303_NMyc_cyto3_step01.2172.2172.1	1.4772	0.1389	1592.2	1	4580.0%	1	R.ESHCSIHRHTVVK.L
UQ9D5C051.5%1113.2%281314338.3(Q9D5C0) 4930467E23Rik protein 
*	TK120303_NMyc_cyto3_step11.2151.2151.3	2.6752	0.2184	4004.66	1	1880.0%	1	R.DNVDCASVLLTHNADPNLIDSSGNTAFHHAISRGNIR.I
UDM3L_HUMAN51.5%4432.8%387436705.9(Q9UJW3) DNA (cytosine-5)-methyltransferase 3-like 
*	TK120303_NMyc_cyto3_step02.3893.3893.3	2.1	0.0884	4406.24	29	1070.0%	1	-.MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVK.A
*	TK120303_NMyc_cyto3_step06.2272.2272.2	1.3886	0.1446	2121.6	3	3120.0%	1	R.ESENPLEMFETVPVWRR.Q
*	TK120303_NMyc_cyto3_step06.2795.2795.3	1.5425	0.0158	4189.84	22	1250.0%	1	K.DVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHR.L
*	TK120303_NMyc_cyto3_step01.3846.3846.3	2.675	0.2154	3758.09	2	1690.0%	1	R.NIEDICICCGSLQVHTQHPLFEGGICAPCKDK.F
UO7549751.5%115.8%534590189.5(O75497) Cell cycle-regulated factor p78 
*	TK120303_NMyc_cyto3_step03.3862.3862.2	1.8242	0.2507	3087.45	2	1830.0%	1	R.ILGGPNPTISLLARSQGLLDSSLMASGTASR.S
UIL6B_MOUSE51.5%71311.1%9171024525.5(Q00560) Interleukin-6 receptor beta chain precursor (IL-6R-beta) (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (GP130) 
*	TK120303_NMyc_cyto3_step03.2967.2967.2	1.8191	0.2497	2309.73	1	3100.0%	1	R.RLFQEGSTADALGTGADGQMER.F
*	TK120303_NMyc_cyto3_step12.3047.3047.3	2.3567	0.1473	3701.55	4	1480.0%	1	K.ILDYEVILTQSKSVSQTYTVTGTELTVNLTNDR.Y
*	TK120303_NMyc_cyto3_step08.2806.2806.2	1.7844	0.0023	2146.75	5	2940.0%	3	K.QQQVSDHISQPYGSEQRR.L
*	TK120303_NMyc_cyto3_step01.1826.1826.1	1.3691	0.0375	1093.67	1	5560.0%	1	R.YVASLAARNK.V
*	TK120303_NMyc_cyto3_step08.2538.2538.2	1.1863	0.0060	2300.83	45	2370.0%	1	K.NEAVLAWDQIPVDDQNGFIR.N
UM3K2_HUMAN51.5%51111.0%618695388.3(Q9Y2U5) Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.1.-) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2) 
*	TK120303_NMyc_cyto3_step01.3795.3795.3	1.5737	0.0217	4104.5	103	1010.0%	1	R.TQGNQLTSPVSFSPTDHSLSTSSGSSIFTPEYDDSRIR.R
*	TK120303_NMyc_cyto3_step09.2783.2783.2	1.6454	0.1773	2484.0	23	2110.0%	3	K.YTRQILEGVHYLHSNMILHR.D
*	TK120303_NMyc_cyto3_step08.1378.1378.2	1.0366	0.0485	1253.56	1	6670.0%	1	K.RILQFPRPVK.L
UQ9ULW451.5%113.9%811899276.9(Q9ULW4) RIE2 sid2705 (Hypothetical protein) 
*	TK120303_NMyc_cyto3_step11.2927.2927.2	1.8245	0.2502	3030.19	1	1940.0%	1	-.MPLSSPNAAATASDMDKNSGSNSSSASSGSSK.G
UQ9CQ7651.5%222.5%512577058.2(Q9CQ76) 5730521E12Rik protein 
*	TK120303_NMyc_cyto3_step01.0822.0822.1	0.9656	0.0389	795.42	21	5000.0%	1	R.ISALDFK.A
*	TK120303_NMyc_cyto3_step01.0196.0196.1	1.6572	0.0989	687.36	1	8000.0%	1	R.EVLKAK.G
UPSPB_MOUSE51.4%112.9%377417286.2(P50405) Pulmonary surfactant-associated protein B precursor (SP-B) (Pulmonary surfactant-associated proteolipid SPL(Phe)) 
*	TK120303_NMyc_cyto3_step06.1700.1700.1	1.4734	0.1363	1296.5	1	5000.0%	1	K.AICNHVGLCPR.G
UQ9Y5A051.4%3528.3%173198688.6(Q9Y5A0) NY-REN-37 antigen (Fragment) 
	TK120303_NMyc_cyto3_step03.2154.2154.2	1.1776	0.0013	2592.39	3	2500.0%	1	K.YWPACKNGDECAYHHPISPCK.A
	TK120303_NMyc_cyto3_step04.3252.3252.3	2.6622	0.2349	3068.49	1	2130.0%	2	R.IPVLSPKPVAPPAPPSSSQLCRYFPACK.K
UQ9HCH051.4%5511.9%10031047499.2(Q9HCH0) Hypothetical protein KIAA1602 (Fragment) 
	TK120303_NMyc_cyto3_step06.1725.1725.1	1.644	0.0963	1383.58	2	5000.0%	1	R.LQGQERAPGAEVK.H
	TK120303_NMyc_cyto3_step10.3918.3918.3	1.6557	0.2078	4365.29	1	1440.0%	1	R.HPSMPAFPALLPAAPGHRGHETCPDDPCEDPGPTPPVQLAK.N
	TK120303_NMyc_cyto3_step02.3925.3925.2	1.5836	0.1058	2349.75	3	2630.0%	1	K.SWREPKPEYGDFQPVSSDPK.S
*	TK120303_NMyc_cyto3_step09.2411.2411.2	1.2613	0.0501	2301.57	1	2730.0%	1	K.SKLQIGPPSPGEAQGPLLPSPAR.G
*	TK120303_NMyc_cyto3_step03.1763.1763.3	1.3756	0.0669	2373.74	19	2260.0%	1	R.SPGVPPSPCLPESYPYGSPQEK.S
UQ9H6L251.4%5178.5%316360597.9(Q9H6L2) Hypothetical protein FLJ22167 
*	TK120303_NMyc_cyto3_step05.2277.2277.1	1.2916	0.0119	1177.07	9	5500.0%	4	K.QPLSCGGLDAR.Y
*	TK120303_NMyc_cyto3_step11.3782.3782.2	1.133	0.0434	1996.55	2	3000.0%	1	-.MALYELFSHPVERSYR.A
UPSA3_MOUSE51.4%223.1%254282745.4(O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) 
	TK120303_NMyc_cyto3_step09.1507.1507.1	1.3733	0.1314	935.65	51	5000.0%	1	K.GRHEIVPK.D
	TK120303_NMyc_cyto3_step02.1340.1340.1	1.3439	0.2424	722.57	3	8000.0%	1	R.HEIVPK.D
UY539_HUMAN51.4%778.0%22482523166.4(O60287) Hypothetical protein KIAA0539 (Fragment) 
*	TK120303_NMyc_cyto3_step10.1635.1635.3	1.7595	0.0897	2943.49	1	2190.0%	1	R.YQDHTFLKMLLTAVQLLYSPESSVR.T
*	TK120303_NMyc_cyto3_step01.3452.3452.3	1.8637	0.0987	3788.24	7	1360.0%	1	R.EAWLLQAQGSPSPPALPLASSFTALLQAAYESQALR.D
*	TK120303_NMyc_cyto3_step05.2847.2847.3	1.2954	0.0534	3522.88	30	1370.0%	1	R.AEADLFLDMESVASLELANDQTLEEVLVAILR.H
*	TK120303_NMyc_cyto3_step10.3965.3965.3	1.7627	0.1598	3128.44	21	1520.0%	1	K.LLLGTGNEAAENVVTYLTAVLTDLLHTQR.D
*	TK120303_NMyc_cyto3_step10.1711.1711.3	1.3872	0.0061	2857.53	19	1800.0%	1	R.QAYVQFALSFLIAGDDSTIVQVLEVK.E
*	TK120303_NMyc_cyto3_step04.1830.1830.1	1.3469	0.2402	1037.56	3	6250.0%	1	K.ERHLNALGK.T
*	TK120303_NMyc_cyto3_step04.0934.0934.2	0.8379	0.0401	2511.42	30	1900.0%	1	K.GVISEQGLREEVPPILQHHMLK.V
UCP8B_HUMAN51.3%6814.6%501580788.7(Q9UNU6) Cytochrome P450 8B1 (EC 1.14.-.-) (CYPVIIIB1) (Sterol 12-alpha-hydroxylase) (7 alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase) 
*	TK120303_NMyc_cyto3_step11.2397.2397.2	1.4637	0.1204	2327.2	2	2780.0%	1	R.FCYYILFTAGYLSLFGYTK.D
*	TK120303_NMyc_cyto3_step09.1667.1667.2	1.3258	0.1854	1670.04	1	4620.0%	1	R.LFHKMLSVSHSQEK.E
*	TK120303_NMyc_cyto3_step08.2670.2670.1	1.412	0.0193	1010.83	2	6250.0%	1	R.LRAAPTLLR.L
*	TK120303_NMyc_cyto3_step07.1584.1584.2	1.0087	0.0093	1826.17	94	2860.0%	1	K.EQDLLQAGELFMEFR.K
*	TK120303_NMyc_cyto3_step03.4339.4339.3	2.6088	0.2363	4278.49	3	1400.0%	2	K.GWSLDASCWHEDSLFRFCYYILFTAGYLSLFGYTK.D
UQ8WZ4251.3%1091216.0%3435038161116.3(Q8WZ42) Titin 
	TK120303_NMyc_cyto3_step08.2367.2367.2	1.8825	0.1286	2631.46	53	1820.0%	1	K.GEVQEEEPFVLPLTQRLSIDNSK.K
	TK120303_NMyc_cyto3_step06.4289.4289.3	1.5886	0.0122	3086.93	3	1800.0%	1	K.MHFRNNVATLVFNQVDINDSGEYICK.A
	TK120303_NMyc_cyto3_step12.4364.4364.2	1.2512	0.0163	2462.97	25	1900.0%	1	K.AGEDVQVLIPFKGRPPPTVTWR.K
	TK120303_NMyc_cyto3_step10.3837.3837.2	1.5792	0.0202	2641.98	17	1880.0%	1	K.GEAALKIDSTVSQDSAWYTATAINK.A
	TK120303_NMyc_cyto3_step05.1223.1223.1	1.109	0.0102	714.42	66	4000.0%	1	K.KIVPEK.K
	TK120303_NMyc_cyto3_step07.3300.3300.3	1.8431	0.0343	3468.78	9	1480.0%	1	R.VKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLK.E
	TK120303_NMyc_cyto3_step08.2650.2650.3	1.6192	0.0059	3377.72	24	1300.0%	1	R.HEVSAEEEWSYSEEEEGVSISVYREEER.E
	TK120303_NMyc_cyto3_step02.2449.2449.3	1.8951	0.2169	3249.08	5	1850.0%	1	K.DIEQTVGLPVTLTCRLNGSAPIQVCWYR.D
	TK120303_NMyc_cyto3_step07.4467.4467.1	0.7756	0.0359	1496.67	30	2080.0%	1	R.AYTLEEEAVSVQR.E
	TK120303_NMyc_cyto3_step03.3644.3644.2	1.4628	0.0538	2685.81	11	1900.0%	2	K.TIIHDTQFKAQNLEEGIEYEFR.V
	TK120303_NMyc_cyto3_step01.3658.3658.3	1.618	0.0282	2700.84	5	1880.0%	1	K.GFCQVNVVDRPGPPVGPVSFDEVTK.D
	TK120303_NMyc_cyto3_step10.3641.3641.2	1.5264	0.0278	2369.69	7	2250.0%	2	K.LTWFSPEDDGGSPITNYVIEK.R
	TK120303_NMyc_cyto3_step04.1016.1016.3	0.8581	0.0135	3211.89	11	830.0%	1	K.VHFLSILTIDTSDAEDYSCVLVEDENVK.T
	TK120303_NMyc_cyto3_step01.0326.0326.1	1.1582	0.0443	787.63	38	5830.0%	1	K.NNVAQLK.F
	TK120303_NMyc_cyto3_step11.1921.1921.3	1.5415	0.0258	2297.89	35	2110.0%	1	K.MFFASHTEEEVSVTVPEVQK.E
	TK120303_NMyc_cyto3_step02.2384.2384.2	1.6741	0.0408	1594.0	5	4580.0%	1	R.NLCTLELFSVNRK.D
	TK120303_NMyc_cyto3_step09.2877.2877.3	2.3705	0.146	3240.96	150	1250.0%	1	K.GNAICSGKLYVEPAAPLGAPTYIPTLEPVSR.I
	TK120303_NMyc_cyto3_step01.4202.4202.2	1.3641	0.0448	2732.12	37	1740.0%	1	R.ELAESVIAKDILHPPEVELDVTCR.D
	TK120303_NMyc_cyto3_step09.1575.1575.2	1.0325	0.0831	1242.08	35	4550.0%	1	R.VLDTPGPVSDLK.V
	TK120303_NMyc_cyto3_step02.3195.3195.2	1.2075	0.0023	2486.69	42	1740.0%	1	R.VLAVNAAGESDPAHVPEPVLVKDR.L
	TK120303_NMyc_cyto3_step10.1339.1339.3	1.4053	0.0105	2886.97	49	1770.0%	1	K.MCLLNWSDPEDDGGSEITGFIIERK.D
	TK120303_NMyc_cyto3_step10.3002.3002.2	1.2587	7.0E-4	1780.5	8	3000.0%	1	K.VAGTPELSVEWYKDGK.L
	TK120303_NMyc_cyto3_step09.3464.3464.3	2.0162	0.0258	3179.89	120	1380.0%	1	R.LADFSVETGSPIVLEATYTGTPPISVSWIK.D
	TK120303_NMyc_cyto3_step10.2785.2785.3	2.101	0.0694	3785.41	10	1410.0%	1	R.IEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSK.I
	TK120303_NMyc_cyto3_step08.2408.2408.3	2.0472	0.0511	2860.86	3	2070.0%	1	K.WVRCNTAPHQIPQEEYTATGLEEK.A
	TK120303_NMyc_cyto3_step01.0351.0351.1	0.7967	0.0122	738.44	49	5000.0%	1	K.QTHVVR.A
	TK120303_NMyc_cyto3_step11.3861.3861.2	1.3893	0.0069	2616.71	4	2080.0%	1	K.EPATITEEAVSIDVTQGDPATLQVK.F
	TK120303_NMyc_cyto3_step09.4247.4247.2	1.4774	0.0288	2214.49	9	2500.0%	1	R.LDQTGGVDFQAANVKSSAHLR.V
	TK120303_NMyc_cyto3_step03.1404.1404.1	1.0406	0.1047	841.36	4	5000.0%	1	K.KVEAPPAK.V
	TK120303_NMyc_cyto3_step10.2501.2501.2	1.4029	0.0524	2651.42	23	1740.0%	1	K.HILILHNCQLGMTGEVSFQAANAK.S
	TK120303_NMyc_cyto3_step04.1090.1090.1	0.9009	0.103	769.52	2	5830.0%	1	K.KPTPVPK.K
	TK120303_NMyc_cyto3_step02.3668.3668.2	1.7736	0.0119	2992.97	15	1800.0%	1	K.DSMVVCWGHPDSDGGSEIINYIVERR.D
	TK120303_NMyc_cyto3_step08.1295.1295.1	0.8209	0.0608	545.15	24	6250.0%	1	K.GIVVR.A
	TK120303_NMyc_cyto3_step12.3308.3308.2	1.9842	0.153	2117.89	2	3240.0%	1	R.MYGITDFRGLLQAFELLK.Q
	TK120303_NMyc_cyto3_step07.1767.1767.1	1.2738	0.214	1132.42	2	5560.0%	1	K.TSGKLDIEDR.E
	TK120303_NMyc_cyto3_step05.1821.1821.2	1.2308	0.0916	2907.89	1	1730.0%	1	R.DHGESLDKASIESTSSYTLLIVGNVNR.F
	TK120303_NMyc_cyto3_step02.3643.3643.2	0.9974	0.0351	2889.96	2	1790.0%	1	R.ATNSVGSKDSSGALIVQEPPSFVTKPGSK.D
	TK120303_NMyc_cyto3_step09.3185.3185.3	1.6529	0.0714	3536.5	71	1250.0%	1	K.FGADICQAELIIIDKPHFIKELEPVQSAINK.K
	TK120303_NMyc_cyto3_step04.2084.2084.2	1.8415	0.1299	908.76	4	7860.0%	1	K.KPELPPVK.V
	TK120303_NMyc_cyto3_step04.3310.3310.2	1.6746	0.0829	1478.83	2	4580.0%	1	R.VTGIPTPVVKFYR.D
	TK120303_NMyc_cyto3_step10.1213.1213.2	0.9768	0.0565	2161.74	27	2500.0%	1	K.VLDRPGPPEGPLKVTGVTAEK.C
	TK120303_NMyc_cyto3_step11.4071.4071.2	1.3909	0.1401	2779.55	10	2080.0%	1	K.QEGYVASSSEAEMRETTLTTSTQIR.T
	TK120303_NMyc_cyto3_step04.1836.1836.2	1.891	0.193	1633.13	2	3930.0%	1	K.KTGGSPITGYHLEFK.E
	TK120303_NMyc_cyto3_step05.1409.1409.2	1.7272	0.0878	1486.73	122	3460.0%	1	K.AVSPTETKPTPTEK.V
	TK120303_NMyc_cyto3_step02.3288.3288.2	1.5245	0.0574	2132.66	132	1750.0%	1	K.ATNDVGSDTCVGSIALKAPPR.F
	TK120303_NMyc_cyto3_step02.2260.2260.3	1.6594	0.0070	2826.66	9	2000.0%	1	K.VNTEDHQGEYVCEALNDSGKTATSAK.L
	TK120303_NMyc_cyto3_step08.2290.2290.3	1.5005	0.0201	3947.02	1	1530.0%	1	R.ICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLR.K
	TK120303_NMyc_cyto3_step03.4359.4359.2	1.5203	0.0362	2642.28	43	1460.0%	1	K.AVSPTETKPTPTEKVQHLPVSAPPK.I
	TK120303_NMyc_cyto3_step11.2362.2362.2	1.3822	0.212	2982.69	4	1800.0%	1	K.TPFFFRVLAENEIGIGEPCETTEPVK.A
	TK120303_NMyc_cyto3_step04.2496.2496.3	1.5659	0.1012	1765.28	15	3040.0%	1	K.AYATITNNCTKTTFR.I
	TK120303_NMyc_cyto3_step08.1304.1304.1	0.9953	0.0401	856.4	7	5830.0%	1	K.VPMKPKR.V
	TK120303_NMyc_cyto3_step05.2469.2469.2	0.978	5.0E-4	2484.61	25	2050.0%	1	K.VVHATKSTMLVTWQVPVNDGGSR.V
	TK120303_NMyc_cyto3_step01.3172.3172.1	1.3271	0.1116	1387.64	18	3750.0%	1	R.DEIDAPNASLDPK.Y
	TK120303_NMyc_cyto3_step07.1663.1663.2	0.9921	0.0933	1113.79	23	5000.0%	1	K.MPVKDTTYR.V
	TK120303_NMyc_cyto3_step02.3224.3224.2	1.4835	0.228	3008.23	23	1430.0%	1	K.AGMNDAGLYTCKVSNDAGSALCTSSIVIK.E
	TK120303_NMyc_cyto3_step10.2578.2578.2	2.056	0.0422	2515.86	24	1900.0%	1	R.NNVATLVFNQVDINDSGEYICK.A
	TK120303_NMyc_cyto3_step05.1629.1629.3	1.5798	0.0118	2186.16	93	1810.0%	1	R.VNFETTATSTILNINECVR.S
	TK120303_NMyc_cyto3_step12.1506.1506.2	1.2144	0.0144	2193.47	171	1840.0%	1	R.GTEYTISGLTTGAEYVFRVK.S
	TK120303_NMyc_cyto3_step12.1792.1792.3	1.7021	0.0255	2792.47	71	1520.0%	1	K.MELRDALCAIIYEEIDILTAEGPR.I
	TK120303_NMyc_cyto3_step08.2063.2063.2	1.364	0.0329	1508.69	2	4580.0%	1	K.WFKDGQELTLGSK.Y
	TK120303_NMyc_cyto3_step01.2112.2112.1	1.0541	0.0256	1003.0	6	5000.0%	1	K.GMHISSQIK.K
	TK120303_NMyc_cyto3_step02.4220.4220.3	1.7444	0.1675	4248.63	10	1000.0%	2	R.IGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLK.W
	TK120303_NMyc_cyto3_step10.1039.1039.2	1.5392	0.0578	1961.01	17	2810.0%	1	R.TEEGYYEAITAVELKSR.K
	TK120303_NMyc_cyto3_step08.3623.3623.3	2.1109	0.1482	3725.49	22	1360.0%	1	R.VSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFK.D
*	TK120303_NMyc_cyto3_step01.4240.4240.2	1.3786	0.0458	2333.08	8	1900.0%	1	K.KVPEAIPPKPESPPPEVPEAPK.E
	TK120303_NMyc_cyto3_step05.2139.2139.3	1.4647	0.0073	2730.09	55	1820.0%	1	R.DVEELQFTVEDLVEGGEYEFRVK.A
	TK120303_NMyc_cyto3_step11.2790.2790.2	1.3251	0.1209	2642.33	135	1250.0%	1	K.LEIRNAAHEDGGIYSLTVENPAGSK.T
	TK120303_NMyc_cyto3_step10.4052.4052.3	2.0286	0.0935	2184.33	1	2640.0%	1	K.ATMRFNTEITAENLTINLK.E
	TK120303_NMyc_cyto3_step11.4017.4017.3	1.5251	0.1519	3215.75	14	1940.0%	1	K.WTTDGSEIKTDEHYTVETDNFSSVLTIK.N
	TK120303_NMyc_cyto3_step01.2152.2152.2	1.5783	0.1112	2264.53	73	2110.0%	1	R.DALCAIIYEEIDILTAEGPR.I
	TK120303_NMyc_cyto3_step03.4323.4323.2	1.2521	0.011	2326.8	208	1360.0%	1	R.VIAKNAAGAISPPSEPSDAITCR.D
	TK120303_NMyc_cyto3_step02.0396.0396.1	1.0189	0.1277	1264.58	1	4500.0%	1	K.GSPVIQVTWFK.N
	TK120303_NMyc_cyto3_step01.3722.3722.2	1.2856	0.1105	2725.07	5	2050.0%	1	R.EPREPGHLEESYAQQTTLEYGYK.E
	TK120303_NMyc_cyto3_step12.3116.3116.3	1.9727	0.0978	3184.14	1	2120.0%	1	K.NIEVPETKTASFECEVSHFNVPSMWLK.N
	TK120303_NMyc_cyto3_step01.2766.2766.1	1.2966	0.0043	1136.84	58	4500.0%	1	R.VYAENIAGIGK.C
	TK120303_NMyc_cyto3_step12.3535.3535.3	2.2654	0.0945	3079.86	8	1830.0%	1	K.MDSIKGSFIDLECIVAGSHPISIQWFK.D
	TK120303_NMyc_cyto3_step09.3209.3209.2	1.1881	0.0147	2631.69	4	2270.0%	1	K.NSECYVARDPCDPPGTPEPIMVK.R
	TK120303_NMyc_cyto3_step04.2814.2814.2	1.7655	0.0265	1910.82	1	3670.0%	1	K.NNIEIQPTSNCEITFK.N
	TK120303_NMyc_cyto3_step03.3520.3520.3	1.8624	0.0224	2838.3	62	1670.0%	1	K.DSMVVCWGHPDSDGGSEIINYIVER.R
	TK120303_NMyc_cyto3_step12.1938.1938.3	1.9118	0.1511	3876.38	223	960.0%	1	R.ETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNR.I
	TK120303_NMyc_cyto3_step12.3300.3300.3	2.5773	0.1457	3057.84	1	2140.0%	1	K.VSVGDSASLQCQLAGTPEIGVSWYKGDTK.L
	TK120303_NMyc_cyto3_step02.1373.1373.1	1.2426	0.0442	753.56	4	8000.0%	1	K.HIKDIK.V
	TK120303_NMyc_cyto3_step02.1013.1013.2	1.0515	0.1355	1879.77	17	2810.0%	1	K.DSVTLHWDLPLIDGGSR.I
	TK120303_NMyc_cyto3_step06.3023.3023.2	1.2748	0.0808	1982.32	4	2810.0%	1	K.DTITFEVTVNYEGISYK.W
	TK120303_NMyc_cyto3_step09.1336.1336.1	0.865	0.012	727.59	8	7000.0%	1	R.KLVIVR.A
	TK120303_NMyc_cyto3_step11.3050.3050.3	2.3459	0.189	3877.32	4	1520.0%	1	K.FYSAELHDSGQYTFEISNEVGSSSCETTFTVLDR.D
	TK120303_NMyc_cyto3_step11.2086.2086.3	1.4732	0.0484	2087.31	53	2350.0%	3	R.TTHFKVTTISAGLIYEFR.V
	TK120303_NMyc_cyto3_step01.2063.2063.1	0.9526	0.0394	770.47	11	5830.0%	1	K.EVAPPVR.V
	TK120303_NMyc_cyto3_step02.3397.3397.2	1.451	0.056	2223.75	189	1580.0%	1	R.DTTTTTWHMVSATVARTTIK.I
	TK120303_NMyc_cyto3_step05.2601.2601.2	1.1729	0.0463	2331.49	1	2630.0%	1	K.FGADICQAELIIIDKPHFIK.E
	TK120303_NMyc_cyto3_step07.1565.1565.1	1.0373	0.1052	1069.84	3	5000.0%	1	K.APKEEAAKPK.G
	TK120303_NMyc_cyto3_step11.3046.3046.2	1.3707	0.0191	2986.68	2	2000.0%	1	K.DSMTVCWNRPDSDGGSEIIGYIVEKR.D
	TK120303_NMyc_cyto3_step12.3355.3355.3	2.6132	0.236	3085.47	1	2410.0%	1	R.DVQETVGLPVVFDCAISGSEPISVSWYK.D
	TK120303_NMyc_cyto3_step08.4287.4287.3	1.7234	0.2039	3943.72	1	1500.0%	1	R.CDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEK.R
	TK120303_NMyc_cyto3_step04.1395.1395.1	1.2195	0.1108	1006.54	1	5620.0%	1	K.YLDATPVTK.G
	TK120303_NMyc_cyto3_step12.4506.4506.3	1.4255	0.3513	3801.54	1	1320.0%	1	K.DDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVR.F
	TK120303_NMyc_cyto3_step11.1602.1602.3	1.5017	9.0E-4	1861.03	80	2830.0%	1	R.MYFVNSEAILDITDVK.V
	TK120303_NMyc_cyto3_step07.3191.3191.3	1.978	0.0333	3822.96	2	1590.0%	1	K.NPEVTTITKDSMVVCWGHPDSDGGSEIINYIVER.R
	TK120303_NMyc_cyto3_step01.3792.3792.3	1.8752	0.0625	4347.33	1	1250.0%	1	R.IPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKK.E
	TK120303_NMyc_cyto3_step03.3600.3600.2	1.2784	0.098	3177.7	12	2040.0%	1	R.WDTAMTVRAEDLSATVTDVVEGQEYSFR.V
	TK120303_NMyc_cyto3_step02.3268.3268.2	1.736	0.0082	2211.97	20	2220.0%	1	R.VKEQQEVVFNCEVNTEGAK.A
	TK120303_NMyc_cyto3_step10.4274.4274.2	0.9557	3.0E-4	1720.28	10	3000.0%	1	R.LAWTVVASEVVTNSLK.V
	TK120303_NMyc_cyto3_step08.1182.1182.1	1.0681	0.0014	795.14	11	5830.0%	1	K.EKVPPPK.V
	TK120303_NMyc_cyto3_step01.3548.3548.2	1.3259	0.1033	3156.23	10	1380.0%	1	K.VDDLIALGGQTVTLQAAVRGSEPISVTWMK.G
UQ9H9V551.2%226.7%734830654.7(Q9H9V5) Hypothetical protein FLJ12525 
*	TK120303_NMyc_cyto3_step02.1572.1572.1	1.7443	0.0472	1432.62	3	4580.0%	1	K.AMGQGLPDEEQEK.L
*	TK120303_NMyc_cyto3_step10.1966.1966.3	1.3697	0.0403	4070.24	80	1210.0%	1	R.EAVLDAFLDDGFLVPTFEQLAALQIEYEDGQTEVQR.G
UQ96CR151.1%3316.3%404455588.6(Q96CR1) Hypothetical protein 
*	TK120303_NMyc_cyto3_step03.2964.2964.2	1.6324	0.0105	2756.32	4	2170.0%	1	K.HISCPLLILHAEDDPVVPFQLGRK.L
*	TK120303_NMyc_cyto3_step07.4279.4279.2	2.0958	0.2064	2281.14	4	2750.0%	1	R.ILRPQQGPGSSPDPSMWSELV.-
*	TK120303_NMyc_cyto3_step04.2591.2591.2	1.4426	0.0416	1956.33	67	2750.0%	1	R.CAAAGSSSSGSAAAALDADCR.L
UQ9UHJ151.1%113.3%305341449.5(Q9UHJ1) Cytochrome b5 reductase 1 
	TK120303_NMyc_cyto3_step01.1552.1552.1	1.7245	0.0138	1184.69	4	5560.0%	1	K.GHFNIQPNKK.S
UMM15_HUMAN51.1%111.3%669758077.5(P51511) Matrix metalloproteinase-15 precursor (EC 3.4.24.-) (MMP-15) (Membrane-type matrix metalloproteinase 2) (MT-MMP 2) (MTMMP2) (Membrane-type-2 matrix metalloproteinase) (MT2-MMP) (MT2MMP) (SMCP-2) 
*	TK120303_NMyc_cyto3_step01.4659.4659.1	1.4743	0.1346	1144.9	2	5000.0%	1	R.QDGRFVFFK.G
UQ6183051.0%779.8%14561650666.9(Q61830) Macrophage mannose receptor precursor 
*	TK120303_NMyc_cyto3_step02.0315.0315.2	1.0853	0.1091	3116.92	18	1540.0%	1	R.NDCVVLASSSGLWNNIHCSSYKGFICK.M
*	TK120303_NMyc_cyto3_step02.0489.0489.1	0.9262	0.0806	1465.58	18	2500.0%	1	K.DPLTGILYQINSK.S
*	TK120303_NMyc_cyto3_step07.2501.2501.3	1.591	0.1038	2721.85	4	1880.0%	1	K.TLLPEPTPAPQDNPPVTADGWVIYK.D
*	TK120303_NMyc_cyto3_step01.4724.4724.2	1.4466	0.149	3037.87	2	1800.0%	1	R.HGFYCYLIGSTLSTFTDANHTCTNEK.A
*	TK120303_NMyc_cyto3_step03.2935.2935.3	2.0769	0.1023	3800.02	21	1450.0%	1	K.LPWHEAETYCKDHTSLLASILDPYSNAFAWMK.M
*	TK120303_NMyc_cyto3_step02.2324.2324.1	1.1802	0.2209	886.95	1	5000.0%	1	K.DGFVTYGK.S
	TK120303_NMyc_cyto3_step06.1495.1495.1	1.4181	0.1799	1462.57	1	5000.0%	1	R.QFLIYNEDHKR.C
UQ9H2Q851.0%5510.4%10011090766.7(Q9H2Q8) GREB1a (Fragment) 
	TK120303_NMyc_cyto3_step12.2635.2635.2	1.3347	0.1046	2961.69	37	1300.0%	1	K.CQQLAKNNLLALPRPSALGILSNSGPPK.K
*	TK120303_NMyc_cyto3_step01.2964.2964.3	1.7167	0.0148	4634.65	1	1130.0%	1	K.VDSLGAFFSTLCPEGDIDILLDKFHQENQGHISSSLAASSVTK.A
*	TK120303_NMyc_cyto3_step10.1565.1565.3	1.4066	0.1177	2728.43	33	1850.0%	1	R.ILSESLLTPAEYQKEVNYELVTGK.V
*	TK120303_NMyc_cyto3_step08.2220.2220.1	1.4664	0.1386	1163.53	4	5000.0%	1	K.QRVEQYVLK.L
UQ9BSS351.0%3511.4%508575868.3(Q9BSS3) Hypothetical protein 
*	TK120303_NMyc_cyto3_step10.3301.3301.2	1.9793	0.1721	3030.64	1	2500.0%	2	K.VMKNWGVIGGIAAALAAGIYVIWGPITER.K
*	TK120303_NMyc_cyto3_step07.3520.3520.3	2.7209	0.0638	2922.72	6	2050.0%	1	K.LNKNPGPTLELQDGPGAPTPVLNQPGAPK.T
UMOT4_HUMAN51.0%2213.5%465494698.0(O15427) Monocarboxylate transporter 4 (MCT 4) (MCT 3) 
*	TK120303_NMyc_cyto3_step01.2312.2312.3	1.3717	0.0456	3633.85	3	1560.0%	1	K.APDGGWGWAVLFGCFVITGFSYAFPKAVSVFFK.E
*	TK120303_NMyc_cyto3_step07.3616.3616.3	2.7006	0.1824	3249.05	6	1550.0%	1	R.SIIQVYLTTGVITGLGLALNFQPSLIMLNR.Y
UQ9CPV651.0%2424.8%145165114.5(Q9CPV6) 2310007G06Rik protein 
*	TK120303_NMyc_cyto3_step08.2838.2838.3	2.7048	0.343	3965.05	8	1500.0%	2	R.QLISKDLHDDDEDEEMAETADGDSMNVEESSQGQVP.-
UITAH_HUMAN51.0%81014.6%11891336106.8(Q9UKX5) Integrin alpha-11 precursor 
*	TK120303_NMyc_cyto3_step08.3318.3318.3	1.7602	0.1673	3173.35	35	1480.0%	2	R.DATCLAAFLCFTPIFLAPHFQTTTVGIR.Y
*	TK120303_NMyc_cyto3_step05.2124.2124.1	1.0553	0.0184	1531.63	92	2500.0%	1	R.YDGIGPPFSCIFR.I
*	TK120303_NMyc_cyto3_step08.1116.1116.1	0.905	0.0696	913.56	48	4290.0%	1	K.EDNVAPLR.F
*	TK120303_NMyc_cyto3_step10.2478.2478.3	1.6507	0.0731	3785.7	58	1130.0%	1	R.DFLTDEVANTSCNIWGNSTEYRPTPVEEDLRR.A
*	TK120303_NMyc_cyto3_step02.3503.3503.2	1.1979	0.0298	2673.3	10	2170.0%	1	K.SIFLHHLEIELAAGSDSNERDSTK.E
*	TK120303_NMyc_cyto3_step12.3486.3486.3	2.7095	0.0027	3120.6	1	2120.0%	1	R.VLRKPAQDCSAYTLSFDTTVFIIESTR.Q
*	TK120303_NMyc_cyto3_step12.1667.1667.3	1.9202	0.0441	4695.43	15	1060.0%	1	R.INFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLR.V
UQ99LE651.0%2210.5%628717827.0(Q99LE6) Similar to ATP-binding cassette, sub-family F (GCN20), member 2 
	TK120303_NMyc_cyto3_step02.3313.3313.3	2.7013	0.2798	4387.91	6	1190.0%	1	R.AVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGR.R
	TK120303_NMyc_cyto3_step12.1791.1791.3	1.7337	0.0332	2867.62	114	1670.0%	1	K.TLSFYFPPCGKIPPPVIMVQNVSFK.Y
UO6034651.0%4411.9%858944705.1(O60346) Hypothetical protein KIAA0606 (Fragment) 
*	TK120303_NMyc_cyto3_step09.2587.2587.3	1.7803	0.0304	3029.06	4	1900.0%	1	R.LERTSVEVLDVQHNQLLELPPNLLMK.A
*	TK120303_NMyc_cyto3_step09.3483.3483.3	2.7101	0.0159	3123.13	1	2240.0%	1	R.CFKIDQPSTGDASGAPAVWSHGYTEASGVK.N
*	TK120303_NMyc_cyto3_step01.3159.3159.1	1.3727	0.1793	1519.72	11	3460.0%	1	R.SHNVIEVATDAPLR.K
*	TK120303_NMyc_cyto3_step09.2459.2459.3	1.7532	0.0314	3650.03	44	1290.0%	1	K.CVDLSCNELSEVTLPENLPPKLQELDLTGNPR.L
UQ9WVS351.0%668.2%17151925357.4(Q9WVS3) Sif and Tiam1-like exchange factor 
*	TK120303_NMyc_cyto3_step10.1301.1301.3	1.3324	0.0079	2093.34	9	2500.0%	1	K.KLPSNSRPAHNSADLDPFK.F
*	TK120303_NMyc_cyto3_step03.3578.3578.3	2.7122	0.1038	2967.28	1	2310.0%	1	K.GNEITSLNGEPVSDLDIQQMEALFSEK.S
*	TK120303_NMyc_cyto3_step12.4504.4504.2	0.9382	0.1117	1983.85	83	2220.0%	1	R.RHSAAGSPSSQRPSPTDSR.L
*	TK120303_NMyc_cyto3_step08.0013.0013.2	0.4498	7.0E-4	2492.4	85	450.0%	1	K.ISEESDVHPVGQQPLTESGEQPK.L
*	TK120303_NMyc_cyto3_step03.2316.2316.2	1.321	0.0664	2378.15	10	2000.0%	1	R.HQSLDSHPETASIDLNLVLER.E
*	TK120303_NMyc_cyto3_step04.3018.3018.3	1.4582	0.0445	3614.83	29	1290.0%	1	K.DAQEGLAEFPDGLIKESDILSDEDEDFHHPLK.Q
UQ9HCD351.0%449.0%13191420496.9(Q9HCD3) Hypothetical protein KIAA1639 (Fragment) 
*	TK120303_NMyc_cyto3_step01.4648.4648.2	1.3856	0.0095	2968.18	4	1900.0%	1	R.STEAPAPPASPEGAGPPAAQGCVPRHSVIR.S
*	TK120303_NMyc_cyto3_step05.3603.3603.3	2.5419	0.3068	3545.36	1	1800.0%	1	R.DLSGDAEAADTISLDISEVDPAYLNLSDLYDIK.Y
*	TK120303_NMyc_cyto3_step07.3543.3543.3	1.5801	0.0458	4557.75	135	760.0%	1	K.DYLWQMLSATQYLHNQHILHLDLRSENMIITEYNLLK.V
*	TK120303_NMyc_cyto3_step12.2504.2504.2	1.4381	0.093	1960.4	114	1940.0%	1	R.SIPELLRGPPDSPSLGVAR.H
UQ8R0C751.0%115.6%463530886.8(Q8R0C7) Similar to hypothetical protein FLJ10900 (Fragment) 
*	TK120303_NMyc_cyto3_step11.0076.0076.3	2.5372	0.306	3049.11	2	2200.0%	1	R.FEEGMEVKHCALSLVGEPIMYPEINR.L
USPCP_HUMAN50.9%999.1%23902712936.1(O15020) Spectrin beta chain, brain 2 (Spectrin, non-erythroid beta chain 2) (Beta-III spectrin) 
*	TK120303_NMyc_cyto3_step10.3817.3817.2	1.4538	0.0293	3144.27	46	1380.0%	1	R.QAEGVLSSQEYVLSHTEMPGTLQAADAAIK.K
*	TK120303_NMyc_cyto3_step03.2798.2798.3	2.3043	0.1579	2844.88	2	2130.0%	1	R.TQTAVASEEGPATLPEAEALLAQHAALR.G
*	TK120303_NMyc_cyto3_step12.1566.1566.2	1.3181	0.1026	2182.27	4	2500.0%	1	K.VIESTQGLGNDLAGVLALQRK.L
*	TK120303_NMyc_cyto3_step07.4239.4239.2	1.8012	0.2481	2014.35	3	3060.0%	1	R.HMQAVAEAWAQLQGSSAAR.R
*	TK120303_NMyc_cyto3_step11.1319.1319.2	1.0762	0.0461	2400.95	17	2140.0%	1	R.SHRPTLDALREQAAALPPTLSR.T
*	TK120303_NMyc_cyto3_step12.1908.1908.3	1.4656	0.0385	2540.48	7	1880.0%	1	R.LEHSSFPEGPGPGSGDEANGPRGER.Q
*	TK120303_NMyc_cyto3_step09.2011.2011.3	1.8369	0.0757	2183.74	1	2630.0%	1	K.QQQLPDGTGRDLNAAEALQR.R
*	TK120303_NMyc_cyto3_step11.3094.3094.2	1.479	0.1508	3005.29	258	1350.0%	1	R.FETLEPEMNTLAAQITAVNDIAEQLLK.A
*	TK120303_NMyc_cyto3_step05.4222.4222.2	1.0966	0.0111	3048.57	10	1800.0%	1	R.LTLGLVWTIILRFQIQDISVETEDNK.E
UK1CS_MOUSE50.9%4613.6%403445425.4(P19001) Keratin, type I cytoskeletal 19 (Cytokeratin 19) (K19) (CK 19) 
*	TK120303_NMyc_cyto3_step04.2896.2896.2	1.6836	0.1941	1899.81	11	2630.0%	2	R.GGSFSGTLAVSDGLLSGNEK.I
*	TK120303_NMyc_cyto3_step10.3648.3648.2	1.8013	0.2446	2527.29	1	2950.0%	1	R.YGVQLSQIQSVISGFEAQLSDVR.A
	TK120303_NMyc_cyto3_step04.0521.0521.1	0.8871	0.0373	1419.73	118	3180.0%	1	R.DWYQKQGPGPSR.D
UQ8WWW850.9%225.8%586655897.2(Q8WWW8) GAB3 
*	TK120303_NMyc_cyto3_step04.1747.1747.2	1.0529	0.0421	1432.1	12	4090.0%	1	R.RQEEWSTHSGSK.K
*	TK120303_NMyc_cyto3_step02.2853.2853.2	1.7908	0.2424	2498.64	3	2380.0%	1	K.ELDIMSNTPPPRPPKPSHLSER.R
UQ9D0A950.9%116.2%1461746110.4(Q9D0A9) 2610030F17Rik protein 
	TK120303_NMyc_cyto3_step08.1163.1163.1	1.4891	0.1235	982.52	4	4380.0%	1	R.QSAILPQPK.K
UMY15_HUMAN50.9%10126.4%35303951769.2(Q9UKN7) Myosin XV (Unconventional myosin-15) 
*	TK120303_NMyc_cyto3_step07.3639.3639.3	2.014	5.0E-4	3092.4	1	2040.0%	1	R.SRSIYASGEPLGFLPFEDEAPFHHSGSR.K
*	TK120303_NMyc_cyto3_step08.2467.2467.2	1.5839	0.0387	2198.66	237	1840.0%	1	R.VHTHPQSCHLGPGAACLSLR.G
*	TK120303_NMyc_cyto3_step04.2863.2863.3	2.2151	0.0573	2542.14	9	2170.0%	1	R.ALGENPPHLFAVANLAFAKMLDAK.Q
*	TK120303_NMyc_cyto3_step01.3579.3579.2	1.0258	0.0066	2535.2	50	1820.0%	1	K.GDIIHLQPLEPPRVGYSAGCVVR.R
*	TK120303_NMyc_cyto3_step12.2854.2854.3	1.9641	0.1286	4241.82	2	1520.0%	1	K.GQMTHLAAAPGTQVSREAVALVKPVTSAPRPSMAPTSALPSR.S
*	TK120303_NMyc_cyto3_step07.1333.1333.2	1.1237	0.0423	1215.87	80	5000.0%	1	R.NGFQAVCQHR.L
*	TK120303_NMyc_cyto3_step07.2496.2496.2	1.6805	0.2877	2463.76	1	2380.0%	2	R.EVMQQIKILEATPLLESFGNAK.T
*	TK120303_NMyc_cyto3_step04.2128.2128.3	2.1491	0.0824	2493.89	4	2380.0%	1	R.MKALFAQNQLDTQKPLVTESVK.R
*	TK120303_NMyc_cyto3_step05.3931.3931.3	1.0582	0.1187	3926.2	3	1210.0%	1	R.NLIYTYIGSILVSVNPYQMFGIYGPEQVQQYNGR.A
ULAD1_HUMAN50.9%6813.5%517571579.7(O00515) Ladinin 1 (Lad-1) (120 kDa linear IgA bullous dermatosis antigen) (97 kDa linear IgA bullous dermatosis antigen) (Linear IgA disease antigen homolog) (LadA) 
*	TK120303_NMyc_cyto3_step04.0630.0630.1	0.7545	0.0473	1471.45	26	2080.0%	1	R.GPWPLEEESLVGR.E
	TK120303_NMyc_cyto3_step05.1852.1852.2	0.9597	0.0173	1553.79	27	3080.0%	1	K.ENSETTLTRSASMK.L
	TK120303_NMyc_cyto3_step06.2249.2249.2	1.2632	0.0145	2355.92	2	2390.0%	1	K.RATASEQPLAQEPPASGGSPATTK.E
	TK120303_NMyc_cyto3_step06.1443.1443.1	1.1043	0.0914	1291.49	9	4090.0%	1	K.SLVSDKTSISEK.V
	TK120303_NMyc_cyto3_step04.1139.1139.1	1.4032	0.1966	717.42	1	6670.0%	2	R.AEPASSR.K
UCU56_MOUSE50.9%4416.1%342381648.1(Q9D9W0) Putative protein C21orf56 homolog 
*	TK120303_NMyc_cyto3_step04.1742.1742.1	1.4453	0.153	1590.76	2	3850.0%	1	K.DGRIVGEIAFQLDR.R
*	TK120303_NMyc_cyto3_step03.3604.3604.2	1.4156	0.0973	1724.91	19	2860.0%	1	K.VCFSESNLPTGDRSR.R
*	TK120303_NMyc_cyto3_step03.2044.2044.2	1.5815	0.0912	1907.77	8	3330.0%	1	R.RTYYLNEIQSFSGAEK.D
*	TK120303_NMyc_cyto3_step03.1676.1676.1	1.5395	0.0612	1111.68	4	5560.0%	1	-.MAEGSELMSR.L
UQ9EQ1750.8%351.4%18982115136.6(Q9EQ17) Tyrosine phosphatase LAR 
	TK120303_NMyc_cyto3_step10.1118.1118.1	1.3758	0.0286	899.75	5	4290.0%	1	K.RTHSPSSK.D
	TK120303_NMyc_cyto3_step11.1701.1701.2	1.056	0.0057	2125.18	111	2060.0%	2	K.LIADLQPNTEYSFVLMNR.G
UQ91YW850.8%356.1%719778219.6(Q91YW8) Hypothetical 77.8 kDa protein 
	TK120303_NMyc_cyto3_step06.0578.0578.3	2.0585	0.158	2925.8	7	1900.0%	1	R.VQGDNYGFVTYRYAEEAFAAIESGHK.L
	TK120303_NMyc_cyto3_step03.2724.2724.2	1.712	0.2672	2056.65	1	2940.0%	2	R.SYSDLDSNREDFDPAPVK.S
UQ96MZ350.8%2417.2%1281438711.6(Q96MZ3) Hypothetical protein FLJ31668 
*	TK120303_NMyc_cyto3_step06.2887.2887.2	1.4027	0.0058	2540.27	2	2860.0%	2	R.TPWFHQFPQIPVAPDLSSRGTR.R
UHD_HUMAN50.7%10127.0%31443478596.2(P42858) Huntingtin (Huntington's disease protein) (HD protein) 
*	TK120303_NMyc_cyto3_step12.3926.3926.3	2.212	0.1088	3110.4	18	1700.0%	1	R.SMITTHPALVLLWCQILLLVNHTDYR.W
*	TK120303_NMyc_cyto3_step01.4043.4043.3	1.5285	0.1217	4557.29	15	1160.0%	1	R.LSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVK.S
*	TK120303_NMyc_cyto3_step06.2269.2269.3	2.1158	0.1445	2839.65	31	1900.0%	1	R.NSAASGLFIQAIQSRCENLSTPTMLK.K
*	TK120303_NMyc_cyto3_step04.3136.3136.2	1.4163	0.0167	1921.78	44	2350.0%	1	K.LLSPQMSGEEEDSDLAAK.L
*	TK120303_NMyc_cyto3_step03.1431.1431.1	1.5056	0.1076	1355.58	2	4550.0%	1	R.RTPAILISEVVR.S
*	TK120303_NMyc_cyto3_step12.4454.4454.2	1.2068	0.0085	2663.58	3	1880.0%	1	R.HSLSSTKLLSPQMSGEEEDSDLAAK.L
*	TK120303_NMyc_cyto3_step02.3444.3444.2	1.3342	0.0255	2896.19	1	2140.0%	1	R.TPPPELLQTLTAVGGIGQLTAAKEESGGR.S
*	TK120303_NMyc_cyto3_step05.1841.1841.3	1.2388	0.0174	3008.85	25	1700.0%	2	K.QEEVWPALGDRALVPMVEQLFSHLLK.V
*	TK120303_NMyc_cyto3_step01.3540.3540.3	1.6623	0.0288	3666.22	13	1250.0%	1	R.VPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEK.E
UATPJ_HUMAN50.7%2233.8%6878029.4(P56385) ATP synthase e chain, mitochondrial (EC 3.6.3.14) 
	TK120303_NMyc_cyto3_step05.0319.0319.1	0.8357	0.0241	761.34	81	5000.0%	1	K.KQDELK.R
*	TK120303_NMyc_cyto3_step03.3178.3178.2	1.5828	0.3213	1815.99	5	3120.0%	1	K.LGRYSALFLGVAYGATR.Y
UQ9NVM650.7%354.9%304346878.5(Q9NVM6) Hypothetical protein FLJ10634 
*	TK120303_NMyc_cyto3_step04.1528.1528.1	1.3611	0.0708	1100.48	3	4440.0%	1	K.EDESKGGYSK.D
*	TK120303_NMyc_cyto3_step08.2664.2664.1	1.6327	0.0609	1109.79	56	3890.0%	2	K.GGYSKDVLLR.L
UQ9Y40850.7%113.4%381439136.7(Q9Y408) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step02.1972.1972.1	1.7584	0.0049	1470.61	3	4580.0%	1	K.IAVFYVAEGQEDK.H
UNUD6_HUMAN50.7%396.6%316356798.0(P53370) Nucleoside diphosphate-linked moiety X motif 6 (Protein GFG) (GFG-1) (Antisense basic fibroblast growth factor) 
*	TK120303_NMyc_cyto3_step01.2519.2519.2	1.7299	0.0595	2164.71	1	2500.0%	3	R.LPGYASHQVGVAGAVFDESTR.K
UQ9BQU850.7%1115.5%207231415.7(Q9BQU8) BA261N11.2.1 (Novel protein, isoform 1) 
*	TK120303_NMyc_cyto3_step06.2788.2788.3	2.6224	0.2293	3924.98	1	1610.0%	1	R.LRYVMYTLWAAVWVTWNVFIICFYLEVGGLLK.D
UCR2_HUMAN50.6%334.9%10331129747.5(P20023) Complement receptor type 2 precursor (Cr2) (Complement C3d receptor) (Epstein-Barr virus receptor) (EBV receptor) (CD21 antigen) 
*	TK120303_NMyc_cyto3_step03.1791.1791.2	1.3895	0.3119	2235.21	3	3060.0%	1	K.QIRCNAQGTWEPSAPVCEK.E
*	TK120303_NMyc_cyto3_step07.3383.3383.2	1.4335	0.0050	2214.78	51	2220.0%	1	K.MPVCEEIFCPSPPPILNGR.H
*	TK120303_NMyc_cyto3_step01.3180.3180.1	1.6008	0.0917	1472.2	1	4170.0%	1	K.ECQAPPNILNGQK.E
UARI1_HUMAN50.5%5257.5%557641185.1(Q9Y4X5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein) (HHARI) (H7-AP2) (HUSSY-27) (MOP-6) 
*	TK120303_NMyc_cyto3_step06.3131.3131.3	2.6689	0.1997	3617.72	3	1460.0%	5	R.DGLLCGETGGGGGSALGPGGGGGGGGGGGGGGPGHEQEEDYR.Y
UO5497850.4%665.2%15711788245.5(O54978) Zinc finger protein 
	TK120303_NMyc_cyto3_step06.1432.1432.1	1.4631	0.0286	1092.59	2	5560.0%	1	K.EPYGKEPSGK.E
	TK120303_NMyc_cyto3_step03.1530.1530.1	1.4223	0.1629	1150.69	2	5000.0%	1	K.EPHGDEPQDK.E
	TK120303_NMyc_cyto3_step09.2204.2204.1	0.9397	0.0217	1226.59	1	5000.0%	1	R.RYHFDSDER.G
	TK120303_NMyc_cyto3_step01.4320.4320.2	1.286	0.138	2602.21	24	1900.0%	1	K.DEPYEYGPSYTHASFLTEPLRK.H
	TK120303_NMyc_cyto3_step01.4646.4646.2	1.2939	0.1183	2504.56	216	1360.0%	1	K.SHASVIIFEPANAPGECSGYIER.A
	TK120303_NMyc_cyto3_step01.1042.1042.1	0.7658	0.1211	1050.27	293	3570.0%	1	R.FIQEQVRK.F
UKNG_MOUSE50.3%339.2%661731026.5(O08677) Kininogen precursor [Contains: Bradykinin] 
	TK120303_NMyc_cyto3_step02.3860.3860.3	1.6553	0.0296	3668.28	20	1360.0%	1	K.EGNCSAQSGLAWQDCDFKDAEEAATGECTATVGK.R
*	TK120303_NMyc_cyto3_step06.1900.1900.2	1.2045	0.0203	2030.6	5	2650.0%	1	R.DAETEQGPTHGHGWLHEK.Q
	TK120303_NMyc_cyto3_step12.1852.1852.2	2.1049	0.1678	1061.18	1	9380.0%	1	R.RPPGFSPFR.S
UABC1_HUMAN50.3%443.8%22612542846.9(O95477) ATP-binding cassette, sub-family A, member 1 (ATP-binding cassette transporter 1) (ATP-binding cassette 1) (ABC-1) (Cholesterol efflux regulatory protein) 
*	TK120303_NMyc_cyto3_step09.2000.2000.3	1.554	0.039	2550.02	31	1790.0%	1	K.SEEMIQLGDQEVSELCGLPREK.L
*	TK120303_NMyc_cyto3_step12.4064.4064.3	1.4892	0.0183	3875.74	3	1440.0%	1	R.ANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLK.I
*	TK120303_NMyc_cyto3_step03.2251.2251.1	1.4616	0.1284	1378.41	1	5000.0%	1	K.SYWFGEESDEK.S
*	TK120303_NMyc_cyto3_step04.4309.4309.3	1.8069	0.1143	4340.19	20	1080.0%	1	K.VFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPR.E
UQ9291850.3%4612.4%833912978.3(Q92918) Hematopoietic progenitor kinase 
*	TK120303_NMyc_cyto3_step02.2463.2463.3	1.3774	0.0949	3507.65	139	1130.0%	1	R.KQLSESSDDDYDDVDIPTPAEDTPPPLPPKPK.F
*	TK120303_NMyc_cyto3_step09.2320.2320.3	2.6854	0.12	2927.01	1	1960.0%	1	K.GANILINDAGEVRLADFGISAQIGATLAR.R
*	TK120303_NMyc_cyto3_step01.4671.4671.3	2.2458	0.1135	4404.14	40	980.0%	2	K.FLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGK.S
UQ9H7S950.3%447.5%590582228.8(Q9H7S9) Hypothetical protein FLJ14299 
*	TK120303_NMyc_cyto3_step05.1336.1336.3	1.9761	0.264	2411.58	1	2380.0%	1	R.FATSEELLSHLRTHTALPGAEK.L
*	TK120303_NMyc_cyto3_step02.3001.3001.2	1.9907	0.2339	1842.48	4	2940.0%	1	K.RPAVPAAVSLLPPADPLR.Q
*	TK120303_NMyc_cyto3_step06.3317.3317.2	1.5132	0.2216	2309.66	5	2380.0%	1	K.RPAVPAAVSLLPPADPLRQANR.L
*	TK120303_NMyc_cyto3_step03.1364.1364.1	1.3486	0.1233	1025.37	3	5560.0%	1	R.THTALPGAEK.L
UO3524350.2%81014.4%15671648994.6(O35243) Antigen containing epitope to monoclonal antibody MMS-85/12 (Fragment) 
*	TK120303_NMyc_cyto3_step02.3320.3320.2	1.2479	0.1321	3097.94	2	1850.0%	1	K.GSTEALSGCSVEADPEEVEEEEKQISQR.N
*	TK120303_NMyc_cyto3_step11.3347.3347.3	1.5992	0.0886	4253.53	1	1460.0%	2	K.GIVESSVTSALAGNSDRPPVLCGSEGPMASASSHHSDSQLTR.K
*	TK120303_NMyc_cyto3_step03.4383.4383.3	1.4469	0.0561	2724.09	28	1700.0%	1	K.SQGNGLMISTSTNACTPQISAVIDVR.G
*	TK120303_NMyc_cyto3_step08.3175.3175.2	1.1045	0.0208	2336.37	91	1900.0%	1	K.TNSSTGLEDRDEFSSSEGTGEK.T
*	TK120303_NMyc_cyto3_step02.3895.3895.2	1.3944	0.0246	2530.73	3	2500.0%	1	K.DECALISTSIAEECEASVFGVSR.N
*	TK120303_NMyc_cyto3_step03.3708.3708.3	2.5473	0.278	4148.68	2	1470.0%	1	K.HPLQVGAEASECTVFAAAEEGKGVVTEGFAESEILLTSSK.E
*	TK120303_NMyc_cyto3_step02.2675.2675.3	1.3829	0.0171	4382.62	36	1050.0%	1	K.DDAVTSAGSEEKCGGSACTVEGTATFIGEVESDGAVTSAGTEIR.A
UQ9CVS850.2%2212.6%293318429.6(Q9CVS8) 2810002D23Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step09.2265.2265.1	1.4689	0.1262	1311.69	5	4550.0%	1	R.TIADSSFSRTAR.F
*	TK120303_NMyc_cyto3_step04.1822.1822.3	1.9769	0.084	2699.74	1	2710.0%	1	-.AEQPLSHVARVLSSEPGDNAVLNHR.E
UQ99JS950.2%2212.9%412449716.4(Q99JS9) Similar to hypothetical protein MGC2744 
*	TK120303_NMyc_cyto3_step12.2726.2726.3	1.8403	0.0437	3636.87	193	1130.0%	1	R.FDHMQQHSGQHLITAVADLLFGLKTTSWELGR.L
*	TK120303_NMyc_cyto3_step02.2000.2000.2	1.9165	0.2413	2212.62	1	3250.0%	1	R.GAQADHFTESPLSPGSQVQVR.V
UQ8VEK750.2%4163.0%2372729410.3(Q8VEK7) Hypothetical 27.3 kDa protein 
	TK120303_NMyc_cyto3_step03.2010.2010.1	1.6421	0.1142	910.64	10	6670.0%	4	R.QHMKVHK.E
UACHE_HUMAN50.2%4418.3%493546975.3(Q04844) Acetylcholine receptor protein, epsilon chain precursor 
*	TK120303_NMyc_cyto3_step01.3055.3055.2	1.6085	0.2953	2942.58	5	1670.0%	1	K.IDIDTEAYTENGEWAIDFCPGVIRR.H
*	TK120303_NMyc_cyto3_step05.1936.1936.1	1.5168	0.1112	1072.76	7	5560.0%	1	R.RASSVGLLLR.A
*	TK120303_NMyc_cyto3_step08.2728.2728.3	1.6375	0.0228	3569.56	2	1610.0%	1	R.MGNALDNICFWAALVLFSVGSSLIFLGAYFNR.V
*	TK120303_NMyc_cyto3_step11.2355.2355.2	1.3597	0.0316	2558.89	21	1820.0%	1	R.EPEDTVTISLKVTLTNLISLNEK.E
ULOXR_MOUSE50.2%338.7%701805786.7(O70582) Arachidonate 12-lipoxygenase, 12R type (EC 1.13.11.-) (Epidermis-type lipoxygenase 12) (12R-lipoxygenase) 
*	TK120303_NMyc_cyto3_step09.2060.2060.3	1.5375	0.1147	2457.04	12	2120.0%	1	R.NPNRPEWDGYIPGFPILINIK.A
*	TK120303_NMyc_cyto3_step11.1590.1590.2	1.5605	0.382	2151.14	1	3250.0%	1	K.GGLSARAMSLGLEGFAQVMVR.G
*	TK120303_NMyc_cyto3_step10.2494.2494.2	1.2049	0.011	2358.76	93	1670.0%	1	K.TTCIVLLVLWTLCREPDDR.R
UQ9D6U950.1%2210.5%552613318.2(Q9D6U9) 2310051N18Rik protein 
*	TK120303_NMyc_cyto3_step03.2680.2680.3	2.5473	0.2552	2833.79	2	2600.0%	1	R.SPTVFGAITSYVEQFFETVGISLANR.Q
	TK120303_NMyc_cyto3_step07.2857.2857.3	1.6751	0.026	3741.33	1	1690.0%	1	R.SDAVSWYSCGPTVYDHAHLGHACSYVRFDIIR.R
UQ9CUG850.1%2224.4%156161328.9(Q9CUG8) 4930557B21Rik protein (Fragment) 
*	TK120303_NMyc_cyto3_step11.1970.1970.1	1.3864	0.2001	1559.6	1	3750.0%	1	R.TVGGSGPSGGGDRPTTR.F
*	TK120303_NMyc_cyto3_step11.1995.1995.2	1.1117	0.0457	2102.81	10	2500.0%	1	R.MLCRPPPAPSPHPASAAADGV.-
UACRO_HUMAN50.1%4418.5%421458009.0(P10323) Acrosin precursor (EC 3.4.21.10) 
*	TK120303_NMyc_cyto3_step12.2984.2984.2	1.2284	0.0696	3113.99	5	1610.0%	1	R.VQPTNVCAGYPVGKIDTCQGDSGGPLMCK.D
*	TK120303_NMyc_cyto3_step05.2241.2241.2	1.5691	0.3136	2313.95	1	3330.0%	1	R.WVLTAAHCFVGKNNVHDWR.L
*	TK120303_NMyc_cyto3_step03.0590.0590.3	1.1415	0.0012	3492.27	64	1120.0%	1	K.APRPSSILMEARVDLIDLDLCNSTQWYNGR.V
UQ9CS1750.1%114.9%284322047.8(Q9CS17) 5730502P04Rik protein (Fragment) 
	TK120303_NMyc_cyto3_step01.2868.2868.1	1.7371	0.0094	1592.69	10	3460.0%	1	R.NKYLINGVNANNTR.V
UQ9D3Q450.1%1110.4%106123227.8(Q9D3Q4) 5033428A16Rik protein 
*	TK120303_NMyc_cyto3_step05.1868.1868.1	1.7504	0.1172	1229.59	9	4500.0%	1	R.VVAPSMYPLPR.V
UQ8WUC750.1%1115.4%1041054011.6(Q8WUC7) Hypothetical protein (Fragment) 
*	TK120303_NMyc_cyto3_step01.2631.2631.1	1.7296	0.0699	1598.63	6	3330.0%	1	R.RPGGAAMLAESPSVPR.L
UQ8TC8550.0%2212.8%327372816.6(Q8TC85) Similar to RIKEN cDNA 4930453N24 gene 
*	TK120303_NMyc_cyto3_step12.2250.2250.2	2.097	0.204	1838.15	4	3670.0%	1	R.GNTCLGIFEQIFGLIR.C
*	TK120303_NMyc_cyto3_step04.2795.2795.3	2.0179	0.1302	2950.25	18	1600.0%	1	R.LVQPQDRQDAVHAILAYSQSAEELLR.R
ProteinsPeptide IDsCopies
Unfiltered219974920649731
Filtered1521807433872