BLASTX+BEAUTY Search Results
WU-BLAST 2.0 search of the National Center for Biotechnology
Information's NR Protein Database.
BEAUTY post-processing provided by the
Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:
No Repeats Found.
Reference: Gish, Warren (1994-1997). unpublished.
Gish, Warren and David J. States (1993). Identification of protein coding
regions by database similarity search. Nat. Genet. 3:266-72.
Notice: statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.
Query= 'E03F12_F12_12.ab1'
(425 letters)
Translating both strands of query sequence in all 6 reading frames
Database: nr
625,274 sequences; 197,782,623 total letters.
Observed Numbers of Database Sequences Satisfying
Various EXPECTation Thresholds (E parameter values)
Histogram units: = 3 Sequences : less than 3 sequences
EXPECTation Threshold
(E parameter)
|
V Observed Counts-->
10000 646 151 |==================================================
6310 495 138 |==============================================
3980 357 57 |===================
2510 300 73 |========================
1580 227 68 |======================
1000 159 57 |===================
631 102 20 |======
398 82 61 |====================
251 21 12 |====
158 9 3 |=
100 6 0 |
63.1 6 1 |:
39.8 5 0 |
25.1 5 1 |:
15.8 4 2 |:
>>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 2 <<<<<<<<<<<<<<<<<
10.0 2 1 |:
6.31 1 1 |:
Smallest
Sum
Reading High Probability
Sequences producing High-scoring Segment Pairs: Frame Score P(N) N
gi|11528459|gb|AAG37286.1|(AF322247) E1 protein [Huma... -2 61 0.99 1
gi|11528445|gb|AAG37279.1|(AF322240) E1 protein [Huma... -2 59 0.9995 1
Use the 
and 
icons to retrieve links to Entrez:
E = Retrieve Entrez links (e.g., Medline abstracts, FASTA-formatted sequence reports).
R = Retrieve links to Related sequences (neighbors).
Use the 
icon (if present) to retrieve links to the Sequence Retrieval System (SRS).
Use the 
icon (if present) to retrieve links to the Ligand Enzyme and Chemical Compound Database .
Use the 
icon (if present) to retrieve links to the Protein Data Bank database.
>gi|11528459|gb|AAG37286.1| (AF322247) E1 protein [Human papillomavirus]
Length = 75
Frame -2 hits (HSPs): _________________________________
__________________________________________________
Database sequence: | | | | | 75
0 20 40 60
Minus Strand HSPs:
Score = 61 (21.5 bits), Expect = 4.4, P = 0.99
Identities = 13/49 (26%), Positives = 29/49 (59%), Frame = -2
Query: 268 GHV*IAMSCTH*CSVRIFFSPILIHNHL--HSNI---YIYAITTKYRYTN 134
GH +++ C H ++I F P+L+ +++ HS I Y+++ +++ N
Sbjct: 18 GHP-VSLDCKHKAPIQIKFPPLLVTSNIDIHSEIQYKYLHSRVQSFKFPN 66
>gi|11528445|gb|AAG37279.1| (AF322240) E1 protein [Human papillomavirus]
Length = 75
Frame -2 hits (HSPs): _________________________________
__________________________________________________
Database sequence: | | | | | 75
0 20 40 60
Minus Strand HSPs:
Score = 59 (20.8 bits), Expect = 7.5, P = 1.0
Identities = 12/49 (24%), Positives = 29/49 (59%), Frame = -2
Query: 268 GHV*IAMSCTH*CSVRIFFSPILIHNHL--HSNI---YIYAITTKYRYTN 134
GH +++ C H +++ F P+LI +++ H + Y+++ T +++ N
Sbjct: 18 GHP-VSLDCKHKAPIQMKFPPLLITSNICIHEEVQYKYLHSRVTAFKFPN 66
Parameters:
filter=none
matrix=BLOSUM62
V=50
B=50
E=10
gi
H=1
sort_by_pvalue
echofilter
ctxfactor=5.96
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
Std. 0 BLOSUM62 0.318 0.135 0.401
+3 0 BLOSUM62 0.318 0.135 0.401 0.368 0.168 0.624
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
+2 0 BLOSUM62 0.318 0.135 0.401 0.356 0.160 0.613
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
+1 0 BLOSUM62 0.318 0.135 0.401 0.353 0.159 0.579
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
-1 0 BLOSUM62 0.318 0.135 0.401 0.346 0.148 0.508
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
-2 0 BLOSUM62 0.318 0.135 0.401 0.352 0.154 0.548
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
-3 0 BLOSUM62 0.318 0.135 0.401 0.374 0.167 0.622
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+3 0 141 140 10. 73 3 12 22 0.12 33
30 0.11 36
+2 0 141 140 10. 73 3 12 22 0.12 33
30 0.11 36
+1 0 141 141 10. 73 3 12 22 0.12 33
30 0.11 36
-1 0 141 140 10. 73 3 12 22 0.12 33
30 0.11 36
-2 0 141 140 10. 73 3 12 22 0.12 33
30 0.11 36
-3 0 141 140 10. 73 3 12 22 0.12 33
30 0.11 36
Statistics:
Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr
Title: nr
Release date: unknown
Posted date: 4:06 PM CST Feb 28, 2001
Format: BLAST
# of letters in database: 197,782,623
# of sequences in database: 625,274
# of database sequences satisfying E: 2
No. of states in DFA: 595 (59 KB)
Total size of DFA: 182 KB (192 KB)
Time to generate neighborhood: 0.02u 0.00s 0.02t Elapsed: 00:00:00
No. of threads or processors used: 6
Search cpu time: 207.28u 0.90s 208.18t Elapsed: 00:01:38
Total cpu time: 207.32u 0.92s 208.24t Elapsed: 00:01:38
Start: Wed Jan 16 21:31:26 2002 End: Wed Jan 16 21:33:04 2002
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000