R23B_MOUSE - (P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58) || Number of peptides = 10 || ambiguous || 99.6% Confident
RHOA_MOUSE - (Q9QUI0) Transforming protein RhoA || Number of peptides = 16 || ambiguous || 99.6% Confident
IMD2_MOUSE - (P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) || Number of peptides = 5 || ambiguous || 99.6% Confident
RL21_MOUSE - (O09167) 60S ribosomal protein L21 || Number of peptides = 5 || unambiguous || 99.6% Confident
G25B_HUMAN - (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) || Number of peptides = 11 || ambiguous || 99.6% Confident
Q9CVB6 - (Q9CVB6) 2210023N03Rik protein (Fragment) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q8R081 - (Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L || Number of peptides = 15 || unambiguous || 99.6% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 8 || unambiguous || 99.6% Confident
HBE_MOUSE - (P02104) Hemoglobin epsilon-Y2 chain || Number of peptides = 15 || ambiguous || 99.6% Confident
ZIN_MOUSE - (P58404) Zinedin || Number of peptides = 3 || unambiguous || 99.6% Confident
AAC2_MOUSE - (Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) || Number of peptides = 19 || ambiguous || 99.6% Confident
TPIS_MOUSE - (P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) || Number of peptides = 9 || unambiguous || 99.6% Confident
FKB4_MOUSE - (P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) || Number of peptides = 19 || unambiguous || 99.6% Confident
HS9A_MOUSE - (P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) || Number of peptides = 81 || unambiguous || 99.6% Confident
FLNA_HUMAN - (P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) || Number of peptides = 18 || unambiguous || 99.6% Confident
HBB2_MOUSE - (P02089) Hemoglobin beta-2 chain (B2) (Minor) || Number of peptides = 34 || unambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 73 || ambiguous || 99.6% Confident
H2AG_HUMAN - (P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) || Number of peptides = 2 || ambiguous || 99.6% Confident
TKT_MOUSE - (P40142) Transketolase (EC 2.2.1.1) (TK) (P68) || Number of peptides = 36 || unambiguous || 99.6% Confident
R10A_MOUSE - (P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) || Number of peptides = 15 || ambiguous || 99.6% Confident
Q91ZJ5 - (Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2 || Number of peptides = 3 || unambiguous || 99.6% Confident
DYR_MOUSE - (P00375) Dihydrofolate reductase (EC 1.5.1.3) || Number of peptides = 9 || unambiguous || 99.6% Confident
FUS_MOUSE - (P56959) RNA-binding protein FUS (Pigpen protein) || Number of peptides = 10 || ambiguous || 99.6% Confident
COPP_MOUSE - (O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) || Number of peptides = 5 || unambiguous || 99.6% Confident
RS23_HUMAN - (P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23 || Number of peptides = 14 || ambiguous || 99.6% Confident
LEG1_MOUSE - (P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) || Number of peptides = 4 || ambiguous || 99.6% Confident
RL4_MOUSE - (Q9D8E6) 60S ribosomal protein L4 (L1) || Number of peptides = 15 || ambiguous || 99.6% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 17 || ambiguous || 99.6% Confident
PGK1_MOUSE - (P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) || Number of peptides = 20 || unambiguous || 99.6% Confident
PCB2_MOUSE - (Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) || Number of peptides = 6 || ambiguous || 99.6% Confident
HDGF_MOUSE - (P51859) Hepatoma-derived growth factor (HDGF) || Number of peptides = 14 || ambiguous || 99.6% Confident
Q9CWI5 - (Q9CWI5) Ribosomal protein L15 || Number of peptides = 6 || ambiguous || 99.6% Confident
RAN_HUMAN - (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) || Number of peptides = 46 || ambiguous || 99.6% Confident
Q8VI75 - (Q8VI75) RANBP4 || Number of peptides = 6 || unambiguous || 99.6% Confident
TCPH_MOUSE - (P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9Z2X1 - (Q9Z2X1) Ribonucleoprotein F || Number of peptides = 9 || unambiguous || 99.6% Confident
CRTC_MOUSE - (P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) || Number of peptides = 28 || ambiguous || 99.6% Confident
Q99KR3 - (Q99KR3) Hypothetical 32.8 kDa protein || Number of peptides = 1 || unambiguous || 99.6% Confident
IF5A_HUMAN - (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) || Number of peptides = 19 || ambiguous || 99.6% Confident
RL8_HUMAN - (P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8 || Number of peptides = 4 || ambiguous || 99.6% Confident
RL7A_MOUSE - (P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) || Number of peptides = 14 || ambiguous || 99.6% Confident
IF3A_MOUSE - (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q8R346 - (Q8R346) Similar to alanyl-tRNA synthetase (H. sapiens) || Number of peptides = 10 || ambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 149 || unambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 229 || ambiguous || 99.6% Confident
PSA6_MOUSE - (Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) || Number of peptides = 4 || ambiguous || 99.6% Confident
CAZ2_MOUSE - (P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 37 || ambiguous || 99.6% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 42 || unambiguous || 99.6% Confident
ITH2_MOUSE - (Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) || Number of peptides = 3 || unambiguous || 99.6% Confident
O88568 - (O88568) Heterogenous nuclear ribonucleoprotein U || Number of peptides = 20 || unambiguous || 99.6% Confident
CAH2_MOUSE - (P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) || Number of peptides = 22 || unambiguous || 99.6% Confident
THIO_MOUSE - (P10639) Thioredoxin (ATL-derived factor) (ADF) || Number of peptides = 68 || unambiguous || 99.6% Confident
U2AF_MOUSE - (P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q99K86 - (Q99K86) Lutheran blood group (Auberger b antigen included) || Number of peptides = 5 || unambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 242 || ambiguous || 99.6% Confident
PRO1_MOUSE - (P10924) Profilin I || Number of peptides = 10 || unambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 6 || ambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 30 || ambiguous || 99.6% Confident
PAB1_MOUSE - (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1) || Number of peptides = 14 || unambiguous || 99.6% Confident
TCPE_MOUSE - (P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) || Number of peptides = 12 || ambiguous || 99.6% Confident
TAG2_MOUSE - (Q9WVA4) Transgelin 2 || Number of peptides = 8 || unambiguous || 99.6% Confident
RS29_HUMAN - (P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 || Number of peptides = 3 || ambiguous || 99.6% Confident
RS1A_HUMAN - (P39027) 40S ribosomal protein S15a || Number of peptides = 31 || unambiguous || 99.6% Confident
P2AA_MOUSE - (P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) || Number of peptides = 5 || ambiguous || 99.6% Confident
AOP2_MOUSE - (O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) || Number of peptides = 6 || ambiguous || 99.6% Confident
CYTB_MOUSE - (Q62426) Cystatin B (Stefin B) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q922D8 - (Q922D8) Similar to C1-tetrahydrofolate synthase || Number of peptides = 20 || unambiguous || 99.6% Confident
HBA_HUMAN - (P01922) Hemoglobin alpha chain || Number of peptides = 9 || unambiguous || 99.6% Confident
CH60_MOUSE - (P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9D0E1 - (Q9D0E1) 2610023M21Rik protein || Number of peptides = 11 || unambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 135 || ambiguous || 99.6% Confident
GBLP_HUMAN - (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) || Number of peptides = 34 || ambiguous || 99.6% Confident
Q8R3E6 - (Q8R3E6) Similar to chromosome 14 open reading frame 3 || Number of peptides = 5 || unambiguous || 99.6% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 93 || unambiguous || 99.6% Confident
RS7_HUMAN - (P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) || Number of peptides = 2 || ambiguous || 99.6% Confident
GR78_MOUSE - (P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) || Number of peptides = 25 || unambiguous || 99.6% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 128 || unambiguous || 99.6% Confident
Q9D0K4 - (Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase) || Number of peptides = 6 || unambiguous || 99.6% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 6 || ambiguous || 99.6% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 59 || ambiguous || 99.6% Confident
TBB3_MOUSE - (Q9ERD7) Tubulin beta-3 || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9DAH0 - (Q9DAH0) Four and a half LIM domains 4 || Number of peptides = 2 || unambiguous || 99.6% Confident
YAP1_MOUSE - (P46938) 65 kDa Yes-associated protein (YAP65) || Number of peptides = 2 || unambiguous || 99.6% Confident
MDHC_MOUSE - (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) || Number of peptides = 4 || unambiguous || 99.6% Confident
HS9B_MOUSE - (P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) || Number of peptides = 58 || ambiguous || 99.6% Confident
RS14_HUMAN - (P06366) 40S ribosomal protein S14 (PRO2640) (P06366) 40S ribosomal protein S14 (PRO2640) || Number of peptides = 8 || ambiguous || 99.6% Confident
AMP2_MOUSE - (O08663) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2) (Peptidase M 2) (Initiation factor 2 associated 67 kDa glycoprotein) (p67) (p67eIF2) || Number of peptides = 5 || unambiguous || 99.6% Confident
RL15_MOUSE - (Q9CZM2) 60S ribosomal protein L15 || Number of peptides = 11 || unambiguous || 99.6% Confident
PE15_MOUSE - (Q62048) Astrocytic phosphoprotein PEA-15 || Number of peptides = 4 || ambiguous || 99.6% Confident
NTF2_HUMAN - (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) || Number of peptides = 11 || ambiguous || 99.6% Confident
O08817 - (O08817) CW17 protein || Number of peptides = 3 || ambiguous || 99.6% Confident
LKHA_MOUSE - (P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 15 || unambiguous || 99.6% Confident
CLH1_HUMAN - (Q00610) Clathrin heavy chain 1 (CLH-17) || Number of peptides = 18 || unambiguous || 99.6% Confident
RS3_MOUSE - (P17073) 40S ribosomal protein S3 || Number of peptides = 31 || ambiguous || 99.6% Confident
ICE3_MOUSE - (P70677) Apopain precursor (EC 3.4.22.-) (Cysteine protease CPP32) (Yama protein) (CPP-32) (Caspase-3) (CASP-3) (SREBP cleavage activity 1) (SCA-1) (LICE) || Number of peptides = 1 || unambiguous || 99.6% Confident
FKB1_MOUSE - (P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) || Number of peptides = 20 || ambiguous || 99.6% Confident
ENOA_MOUSE - (P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) || Number of peptides = 61 || unambiguous || 99.6% Confident
Q9CR86 - (Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) || Number of peptides = 12 || ambiguous || 99.6% Confident
MAT3_HUMAN - (P43243) Matrin 3 || Number of peptides = 7 || unambiguous || 99.6% Confident
RL3_MOUSE - (P27659) 60S ribosomal protein L3 (J1 protein) || Number of peptides = 16 || unambiguous || 99.6% Confident
HBAZ_MOUSE - (P06467) Hemoglobin zeta chain || Number of peptides = 37 || unambiguous || 99.6% Confident
TRFE_MOUSE - (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) || Number of peptides = 48 || unambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 61 || ambiguous || 99.6% Confident
G6PI_MOUSE - (P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) || Number of peptides = 4 || ambiguous || 99.6% Confident
APA1_MOUSE - (Q00623) Apolipoprotein A-I precursor (Apo-AI) || Number of peptides = 5 || unambiguous || 99.6% Confident
CABA_MOUSE - (Q99020) CARG-binding factor-A (CBF-A) || Number of peptides = 21 || unambiguous || 99.6% Confident
MCM6_MOUSE - (P97311) DNA replication licensing factor MCM6 (Mis5 homolog) || Number of peptides = 4 || unambiguous || 99.6% Confident
PDX2_MOUSE - (Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) || Number of peptides = 52 || unambiguous || 99.6% Confident
PSA1_MOUSE - (Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) || Number of peptides = 33 || ambiguous || 99.6% Confident
SUCA_MOUSE - (Q9WUM5) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, alpha chain) (SCS-alpha) || Number of peptides = 5 || unambiguous || 99.6% Confident
O00301 - (O00301) KSRP || Number of peptides = 4 || unambiguous || 99.6% Confident
RL30_HUMAN - (P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 || Number of peptides = 10 || ambiguous || 99.6% Confident
RIR1_MOUSE - (P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q9CRK7 - (Q9CRK7) 9430095H01Rik protein (Fragment) || Number of peptides = 17 || ambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 25 || ambiguous || 99.6% Confident
IQG1_MOUSE - (Q9JKF1) Ras GTPase-activating-like protein IQGAP1 || Number of peptides = 12 || unambiguous || 99.6% Confident
Q8VDP4 - (Q8VDP4) Hypothetical 112.5 kDa protein (Fragment) || Number of peptides = 9 || unambiguous || 99.6% Confident
Q96IX3 - (Q96IX3) Peptidylprolyl isomerase A (Cyclophilin A) || Number of peptides = 3 || unambiguous || 99.6% Confident
A1T1_MOUSE - (P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 10 || ambiguous || 99.6% Confident
COF1_MOUSE - (P18760) Cofilin, non-muscle isoform || Number of peptides = 140 || unambiguous || 99.6% Confident
TF1B_MOUSE - (Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) || Number of peptides = 24 || unambiguous || 99.6% Confident
Q9WTQ5 - (Q9WTQ5) SSECKS (PKC binding protein SSECKS) || Number of peptides = 15 || unambiguous || 99.6% Confident
RS17_MOUSE - (P06584) 40S ribosomal protein S17 || Number of peptides = 2 || ambiguous || 99.6% Confident
RL10_MOUSE - (P45634) 60S ribosomal protein L10 (QM protein homolog) || Number of peptides = 17 || ambiguous || 99.6% Confident
SBP1_MOUSE - (P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56) || Number of peptides = 8 || unambiguous || 99.6% Confident
TBA1_HUMAN - (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) || Number of peptides = 197 || ambiguous || 99.6% Confident
Q9Z1R2 - (Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9Z1N5 - (Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1) || Number of peptides = 5 || ambiguous || 99.6% Confident
PDL1_MOUSE - (O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) || Number of peptides = 5 || unambiguous || 99.6% Confident
ANX2_MOUSE - (P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9Z1K1 - (Q9Z1K1) HS1 binding protein 3 || Number of peptides = 4 || unambiguous || 99.6% Confident
MAP4_MOUSE - (P27546) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 5 || unambiguous || 99.6% Confident
KPY2_MOUSE - (P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) || Number of peptides = 101 || unambiguous || 99.6% Confident
FETA_MOUSE - (P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) || Number of peptides = 196 || unambiguous || 99.6% Confident
2AAA_HUMAN - (P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) || Number of peptides = 12 || ambiguous || 99.6% Confident
CALM_HUMAN - (P02593) Calmodulin (P02593) Calmodulin || Number of peptides = 6 || ambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 105 || unambiguous || 99.6% Confident
O88306 - (O88306) DJ-1 || Number of peptides = 14 || ambiguous || 99.6% Confident
PDX1_MOUSE - (P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) || Number of peptides = 47 || unambiguous || 99.6% Confident
GFA1_MOUSE - (P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) || Number of peptides = 13 || unambiguous || 99.6% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 6 || unambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 117 || unambiguous || 99.6% Confident
Q60817 - (Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) || Number of peptides = 1 || ambiguous || 99.6% Confident
O55181 - (O55181) RBP associated molecule RAM14-1 || Number of peptides = 7 || unambiguous || 99.6% Confident
TSN_MOUSE - (Q62348) Translin || Number of peptides = 7 || unambiguous || 99.6% Confident
ARF1_HUMAN - (P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 || Number of peptides = 21 || ambiguous || 99.6% Confident
TALI_MOUSE - (P26039) Talin || Number of peptides = 19 || ambiguous || 99.6% Confident
Q91VW3 - (Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3 || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CSN8 - (Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9R0C4 - (Q9R0C4) Intermediate filament protein nestin || Number of peptides = 6 || unambiguous || 99.6% Confident
IF41_HUMAN - (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) || Number of peptides = 25 || ambiguous || 99.6% Confident
A2HS_MOUSE - (P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) || Number of peptides = 17 || unambiguous || 99.6% Confident
APA4_MOUSE - (P06728) Apolipoprotein A-IV precursor (Apo-AIV) || Number of peptides = 3 || unambiguous || 99.6% Confident
LDHA_MOUSE - (P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) || Number of peptides = 29 || unambiguous || 99.6% Confident
Q9QYB1 - (Q9QYB1) Intracellular chloride channel protein || Number of peptides = 1 || ambiguous || 99.6% Confident
MY9B_HUMAN - (Q13459) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 6 || unambiguous || 99.6% Confident
ILK1_HUMAN - (Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 16 || unambiguous || 99.6% Confident
PSB3_MOUSE - (Q9R1P1) Proteasome subunit beta type 3 (EC 3.4.25.1) (Proteasome theta chain) (Proteasome chain 13) (Proteasome component C10-II) || Number of peptides = 10 || unambiguous || 99.6% Confident
FSC1_HUMAN - (Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) || Number of peptides = 13 || ambiguous || 99.6% Confident
PRSX_HUMAN - (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q8R016 - (Q8R016) Similar to bleomycin hydrolase || Number of peptides = 20 || unambiguous || 99.6% Confident
PUR2_MOUSE - (Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)] || Number of peptides = 9 || unambiguous || 99.6% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 18 || ambiguous || 99.6% Confident
RL24_HUMAN - (P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30) || Number of peptides = 12 || ambiguous || 99.6% Confident
MPK2_MOUSE - (Q63932) Dual specificity mitogen-activated protein kinase kinase 2 (EC 2.7.1.-) (MAP kinase kinase 2) (MAPKK 2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK2) || Number of peptides = 1 || ambiguous || 99.6% Confident
ELV1_MOUSE - (P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q921R2 - (Q921R2) Similar to ribosomal protein S13 || Number of peptides = 13 || ambiguous || 99.6% Confident
Q9D1P4 - (Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) || Number of peptides = 5 || ambiguous || 99.6% Confident
IF32_MOUSE - (Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1) || Number of peptides = 3 || ambiguous || 99.5% Confident
ADHA_MOUSE - (P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) || Number of peptides = 63 || unambiguous || 99.5% Confident
Q99PC3 - (Q99PC3) CGI-74-like SR-rich protein || Number of peptides = 3 || ambiguous || 99.4% Confident
RS30_HUMAN - (Q05472) 40S ribosomal protein S30 (Q05472) 40S ribosomal protein S30 || Number of peptides = 3 || ambiguous || 99.4% Confident
FSC1_MOUSE - (Q61553) Fascin (Singed-like protein) || Number of peptides = 1 || ambiguous || 99.4% Confident
O35499 - (O35499) Nuclear autoantigenic sperm protein || Number of peptides = 11 || ambiguous || 99.4% Confident
FBL1_MOUSE - (Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) || Number of peptides = 4 || unambiguous || 99.4% Confident
O88179 - (O88179) Guanine nucleotide regulatory protein (Fragment) || Number of peptides = 10 || ambiguous || 99.4% Confident
Q9CSH0 - (Q9CSH0) 2810036L13Rik protein (Fragment) || Number of peptides = 4 || ambiguous || 99.4% Confident
PMG1_MOUSE - (Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) || Number of peptides = 11 || ambiguous || 99.4% Confident
Q9CXT4 - (Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence || Number of peptides = 7 || unambiguous || 99.4% Confident
Q9UEV9 - (Q9UEV9) Actin-binding protein homolog ABP-278 || Number of peptides = 8 || ambiguous || 99.4% Confident
Q91VC3 - (Q91VC3) Unknown (Protein for MGC:6715) (Hypothetical 46.8 kDa protein) || Number of peptides = 2 || ambiguous || 99.4% Confident
DPY2_MOUSE - (O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) || Number of peptides = 15 || unambiguous || 99.4% Confident
O35737 - (O35737) Heterogeneous nuclear ribonucleoprotein H || Number of peptides = 10 || ambiguous || 99.4% Confident
FUMH_MOUSE - (P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) || Number of peptides = 4 || unambiguous || 99.4% Confident
RL26_HUMAN - (Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26 || Number of peptides = 8 || ambiguous || 99.4% Confident
Q91X94 - (Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) || Number of peptides = 5 || ambiguous || 99.4% Confident
Q9JHU9 - (Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9CQ60 - (Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) || Number of peptides = 7 || unambiguous || 99.4% Confident
Q8VDM4 - (Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2) || Number of peptides = 5 || ambiguous || 99.4% Confident
CNBP_MOUSE - (P53996) Cellular nucleic acid binding protein (CNBP) || Number of peptides = 7 || ambiguous || 99.4% Confident
P97315 - (P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) || Number of peptides = 10 || ambiguous || 99.4% Confident
Q9CQM9 - (Q9CQM9) Thioredoxin-like 2 || Number of peptides = 12 || unambiguous || 99.4% Confident
ROA2_MOUSE - (O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) || Number of peptides = 38 || ambiguous || 99.4% Confident
ROA1_MOUSE - (P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) || Number of peptides = 39 || ambiguous || 99.4% Confident
Q9CX86 - (Q9CX86) 3010025E17Rik protein || Number of peptides = 33 || unambiguous || 99.4% Confident
Q9JKX6 - (Q9JKX6) Nudix hydrolase || Number of peptides = 2 || unambiguous || 99.3% Confident
RS4_HUMAN - (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) || Number of peptides = 44 || ambiguous || 99.3% Confident
TEBP_MOUSE - (Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23) || Number of peptides = 3 || ambiguous || 99.3% Confident
MBNL_MOUSE - (Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein) || Number of peptides = 4 || ambiguous || 99.3% Confident
HS74_MOUSE - (Q61316) Heat shock 70-related protein APG-2 || Number of peptides = 6 || unambiguous || 99.3% Confident
Q9EQR0 - (Q9EQR0) Fatty acid synthase || Number of peptides = 14 || unambiguous || 99.3% Confident
UBA1_MOUSE - (Q02053) Ubiquitin-activating enzyme E1 1 || Number of peptides = 6 || unambiguous || 99.3% Confident
EF1G_MOUSE - (Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) || Number of peptides = 13 || unambiguous || 99.3% Confident
Q9Z1A1 - (Q9Z1A1) TFG protein (Trk-fused gene) || Number of peptides = 6 || unambiguous || 99.2% Confident
PCB1_HUMAN - (Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) || Number of peptides = 10 || unambiguous || 99.2% Confident
RS20_HUMAN - (P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 || Number of peptides = 4 || ambiguous || 99.2% Confident
CLI1_MOUSE - (Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) || Number of peptides = 23 || ambiguous || 99.1% Confident
DYNA_MOUSE - (O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) || Number of peptides = 5 || unambiguous || 99.1% Confident
RL1X_MOUSE - (P11249) 60S ribosomal protein L18a || Number of peptides = 13 || ambiguous || 99.1% Confident
EZRI_MOUSE - (P26040) Ezrin (p81) (Cytovillin) (Villin 2) || Number of peptides = 21 || ambiguous || 99.1% Confident
Q9D3R6 - (Q9D3R6) 4933439B08Rik protein || Number of peptides = 2 || unambiguous || 99.1% Confident
TERA_MOUSE - (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] || Number of peptides = 35 || ambiguous || 99.1% Confident
SYG_MOUSE - (Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) || Number of peptides = 2 || ambiguous || 99.1% Confident
ENPL_MOUSE - (P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) || Number of peptides = 18 || unambiguous || 99.1% Confident
Q9D6U5 - (Q9D6U5) 2310057C03Rik protein || Number of peptides = 4 || ambiguous || 99.1% Confident
Q9CYG6 - (Q9CYG6) 5730478E03Rik protein || Number of peptides = 2 || ambiguous || 99.1% Confident
Q99J35 - (Q99J35) Hypothetical 41.0 kDa protein || Number of peptides = 6 || unambiguous || 99.1% Confident
IMB2_HUMAN - (Q92973) Importin beta-2 subunit (Karyopherin beta-2 subunit) (Transportin) (M9 region interaction protein) (MIP) || Number of peptides = 7 || unambiguous || 99.1% Confident
BAG3_MOUSE - (Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) || Number of peptides = 4 || unambiguous || 99.1% Confident
MYO6_MOUSE - (Q64331) Myosin VI || Number of peptides = 7 || unambiguous || 99.0% Confident
PEBP_MOUSE - (P70296) Phosphatidylethanolamine-binding protein (PEBP) || Number of peptides = 3 || unambiguous || 99.0% Confident
LA_MOUSE - (P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) || Number of peptides = 4 || ambiguous || 98.9% Confident
ENOB_HUMAN - (P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) || Number of peptides = 2 || unambiguous || 98.9% Confident
Q9CXZ2 - (Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence || Number of peptides = 6 || ambiguous || 98.9% Confident
K1CI_HUMAN - (P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9) || Number of peptides = 7 || unambiguous || 98.9% Confident
Q8VCI5 - (Q8VCI5) Peroxisomal farnesylated protein || Number of peptides = 4 || unambiguous || 98.9% Confident
O88701 - (O88701) Nucleosome assembly protein 1-like protein 4 || Number of peptides = 3 || unambiguous || 98.8% Confident
SERA_MOUSE - (Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) || Number of peptides = 6 || unambiguous || 98.8% Confident
RNT1_MOUSE - (Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) || Number of peptides = 4 || ambiguous || 98.7% Confident
Q9JK31 - (Q9JK31) ATFa-associated factor || Number of peptides = 7 || unambiguous || 98.6% Confident
Q8QZT1 - (Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial || Number of peptides = 5 || unambiguous || 98.6% Confident
RL7_MOUSE - (P14148) 60S ribosomal protein L7 || Number of peptides = 8 || ambiguous || 98.6% Confident
EF1D_MOUSE - (P57776) Elongation factor 1-delta (EF-1-delta) || Number of peptides = 8 || unambiguous || 98.6% Confident
Q9DAB4 - (Q9DAB4) 1700015E05Rik protein || Number of peptides = 1 || ambiguous || 98.6% Confident
RL27_HUMAN - (P08526) 60S ribosomal protein L27 || Number of peptides = 3 || unambiguous || 98.4% Confident
NUCL_MOUSE - (P09405) Nucleolin (Protein C23) || Number of peptides = 6 || unambiguous || 98.4% Confident
MCM2_MOUSE - (P97310) DNA replication licensing factor MCM2 || Number of peptides = 7 || ambiguous || 98.4% Confident
Q9CY26 - (Q9CY26) 2700085E05Rik protein || Number of peptides = 5 || ambiguous || 98.3% Confident
GBB1_HUMAN - (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) || Number of peptides = 1 || ambiguous || 98.3% Confident
ADK_MOUSE - (P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment) || Number of peptides = 10 || ambiguous || 98.3% Confident
Q9D3T6 - (Q9D3T6) 4933436C10Rik protein || Number of peptides = 1 || ambiguous || 98.2% Confident
Q61166 - (Q61166) APC-binding protein EB1 homolog || Number of peptides = 3 || unambiguous || 98.2% Confident
Q91YZ8 - (Q91YZ8) Hypothetical 67.9 kDa protein || Number of peptides = 3 || unambiguous || 98.1% Confident
RL2B_HUMAN - (P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a || Number of peptides = 5 || ambiguous || 98.1% Confident
Q96A90 - (Q96A90) G6b-C protein precursor || Number of peptides = 11 || unambiguous || 98.0% Confident
TCPQ_MOUSE - (P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta) || Number of peptides = 4 || unambiguous || 97.9% Confident
MCM7_MOUSE - (Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) || Number of peptides = 12 || unambiguous || 97.9% Confident
CATA_MOUSE - (P24270) Catalase (EC 1.11.1.6) || Number of peptides = 3 || unambiguous || 97.8% Confident
143B_MOUSE - (Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 25 || unambiguous || 97.7% Confident
PSB6_MOUSE - (Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y) || Number of peptides = 6 || unambiguous || 97.3% Confident
143Z_MOUSE - (P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) || Number of peptides = 4 || unambiguous || 97.2% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 22 || ambiguous || 97.2% Confident
T2EA_MOUSE - (Q9D0D5) Transcription initiation factor IIE, alpha subunit (TFIIE-alpha) (General transcription factor IIE 56 kDa subunit) || Number of peptides = 3 || unambiguous || 97.2% Confident
CDNC_MOUSE - (P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2) || Number of peptides = 4 || ambiguous || 97.1% Confident
Q922B6 - (Q922B6) Unknown (Protein for MGC:7807) || Number of peptides = 5 || ambiguous || 97.0% Confident
RL23_HUMAN - (P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) || Number of peptides = 12 || ambiguous || 96.7% Confident
Q9CQ99 - (Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) || Number of peptides = 2 || unambiguous || 96.7% Confident
R37A_HUMAN - (P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a || Number of peptides = 15 || ambiguous || 96.7% Confident
Q9CRI0 - (Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) || Number of peptides = 4 || ambiguous || 96.4% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 8 || ambiguous || 96.4% Confident
ADHX_MOUSE - (P28474) Alcohol dehydrogenase class III (EC 1.1.1.1) (Alcohol dehydrogenase 2) (Glutathione-dependent formaldehyde dehydrogenase) (EC 1.2.1.1) (FDH) (FALDH) (Alcohol dehydrogenase-B2) (ADH-B2) || Number of peptides = 3 || unambiguous || 96.3% Confident
Q9CSP7 - (Q9CSP7) 2700017M01Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 96.2% Confident
H11_MOUSE - (P43275) Histone H1.1 (H1 VAR.3) (H1A) || Number of peptides = 1 || unambiguous || 96.1% Confident
Q9CVL3 - (Q9CVL3) 1810024J13Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 96.1% Confident
TS24_MOUSE - (P53995) Protein TSG24 (Meiotic check point regulator) || Number of peptides = 10 || unambiguous || 96.0% Confident
Q9CV45 - (Q9CV45) 2310038O07Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 96.0% Confident
Q8R0L6 - (Q8R0L6) Similar to coronin, actin binding protein, 2A (Fragment) || Number of peptides = 2 || unambiguous || 95.9% Confident
ERF_MOUSE - (P70459) ETS-domain transcription factor ERF || Number of peptides = 7 || unambiguous || 95.9% Confident
Q9UM06 - (Q9UM06) ABP125 || Number of peptides = 5 || ambiguous || 95.9% Confident
U5S1_MOUSE - (O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) || Number of peptides = 5 || unambiguous || 95.6% Confident
Q8VC94 - (Q8VC94) Hypothetical 19.0 kDa protein || Number of peptides = 1 || ambiguous || 95.5% Confident
RL18_MOUSE - (P35980) 60S ribosomal protein L18 || Number of peptides = 6 || unambiguous || 95.5% Confident
VAA1_MOUSE - (P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) || Number of peptides = 6 || unambiguous || 95.4% Confident
RL19_HUMAN - (P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19 || Number of peptides = 13 || ambiguous || 95.3% Confident
O70140 - (O70140) Calcyclin binding protein (Fragment) || Number of peptides = 2 || ambiguous || 95.3% Confident
Q9CZX8 - (Q9CZX8) Ribosomal protein S19 || Number of peptides = 5 || ambiguous || 95.2% Confident
DHCA_MOUSE - (P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) || Number of peptides = 5 || unambiguous || 95.2% Confident
TBA4_HUMAN - (P05215) Tubulin alpha-4 chain (Alpha-tubulin 4) (P05215) Tubulin alpha-4 chain (Alpha-tubulin 4) || Number of peptides = 10 || ambiguous || 95.0% Confident
Q9CXU3 - (Q9CXU3) 3110003A17Rik protein || Number of peptides = 1 || ambiguous || 94.9% Confident
SERC_MOUSE - (Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) || Number of peptides = 8 || unambiguous || 94.9% Confident
Q9DBY6 - (Q9DBY6) 1200009K13Rik protein || Number of peptides = 7 || ambiguous || 94.9% Confident
RS2_MOUSE - (P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein) || Number of peptides = 9 || ambiguous || 94.9% Confident
RL13_MOUSE - (P47963) 60S ribosomal protein L13 (A52) || Number of peptides = 8 || unambiguous || 94.9% Confident
UBCI_HUMAN - (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) || Number of peptides = 6 || ambiguous || 94.9% Confident
PGK2_MOUSE - (P09041) Phosphoglycerate kinase, testis specific (EC 2.7.2.3) || Number of peptides = 1 || ambiguous || 94.8% Confident
KAC_MOUSE - (P01837) Ig kappa chain C region || Number of peptides = 2 || ambiguous || 94.7% Confident
Q9Y2V1 - (Q9Y2V1) Hypothetical protein || Number of peptides = 2 || unambiguous || 94.6% Confident
YB1_MOUSE - (P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) || Number of peptides = 12 || ambiguous || 94.5% Confident
Q8R0B2 - (Q8R0B2) Hypothetical 26.4 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 94.5% Confident
HNT1_MOUSE - (P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) || Number of peptides = 7 || unambiguous || 94.4% Confident
STN1_MOUSE - (P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) || Number of peptides = 4 || unambiguous || 94.3% Confident
NED4_MOUSE - (P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) || Number of peptides = 4 || ambiguous || 94.3% Confident
ABD4_HUMAN - (O14678) ATP-binding cassette, sub-family D, member 4 (Peroxisomal membrane protein 69) (PMP69) (Peroxisomal membrane protein 1-like) (PXMP1-L) (P70R) || Number of peptides = 5 || ambiguous || 94.1% Confident
CAP1_MOUSE - (P40124) Adenylyl cyclase-associated protein 1 (CAP 1) || Number of peptides = 6 || ambiguous || 94.0% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 2 || unambiguous || 93.8% Confident
Q924D2 - (Q924D2) Myosin light chain kinase (Fragment) || Number of peptides = 5 || unambiguous || 93.6% Confident
GTP1_MOUSE - (P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) || Number of peptides = 5 || ambiguous || 93.4% Confident
RBB7_MOUSE - (Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7) || Number of peptides = 6 || ambiguous || 93.2% Confident
GTFI_MOUSE - (Q9ESZ8) General transcription factor II-I (GTFII-I) (TFII-I) (Bruton tyrosine kinase-associated protein-135) (BTK-associated protein-135) (BAP-135) || Number of peptides = 4 || ambiguous || 93.1% Confident
Q9D892 - (Q9D892) 2010016I08Rik protein || Number of peptides = 5 || ambiguous || 93.0% Confident
PUR9_MOUSE - (Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] || Number of peptides = 7 || unambiguous || 92.8% Confident
Q9EST5 - (Q9EST5) Proliferation related acidic leucine rich protein PAL31 (Similar to acidic protein rich in leucines) || Number of peptides = 2 || unambiguous || 92.7% Confident
Q8TDG4 - (Q8TDG4) DNA helicase HEL308 || Number of peptides = 7 || unambiguous || 92.7% Confident
FAS_MOUSE - (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) || Number of peptides = 5 || ambiguous || 92.7% Confident
O95347 - (O95347) Chromosome-associated protein-E || Number of peptides = 1 || unambiguous || 92.5% Confident
Q99LG2 - (Q99LG2) Similar to karyopherin beta 2b, transportin || Number of peptides = 4 || ambiguous || 92.3% Confident
MCM3_MOUSE - (P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) || Number of peptides = 10 || unambiguous || 92.2% Confident
SYD_MOUSE - (Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) || Number of peptides = 8 || ambiguous || 92.2% Confident
Q9CQX8 - (Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) || Number of peptides = 1 || unambiguous || 91.7% Confident
RL29_MOUSE - (P47915) 60S ribosomal protein L29 || Number of peptides = 8 || unambiguous || 91.7% Confident
143E_HUMAN - (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) || Number of peptides = 7 || ambiguous || 91.5% Confident
Q9D0Y4 - (Q9D0Y4) 4831443O22Rik protein || Number of peptides = 4 || ambiguous || 91.3% Confident
ODO1_MOUSE - (Q60597) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) (Fragment) || Number of peptides = 2 || ambiguous || 91.3% Confident
143S_MOUSE - (O70456) 14-3-3 protein sigma (Stratifin) || Number of peptides = 2 || unambiguous || 91.2% Confident
RL31_HUMAN - (P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31 || Number of peptides = 11 || ambiguous || 91.1% Confident
SPH2_MOUSE - (Q9JIA7) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2) || Number of peptides = 2 || unambiguous || 91.0% Confident
Q8R509 - (Q8R509) Polypirimidine tract binding protein || Number of peptides = 4 || ambiguous || 91.0% Confident
PSD4_MOUSE - (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) || Number of peptides = 9 || ambiguous || 90.9% Confident
Q9EPK6 - (Q9EPK6) Sil1 protein precursor || Number of peptides = 7 || unambiguous || 90.9% Confident
AP19_MOUSE - (P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) || Number of peptides = 4 || ambiguous || 90.7% Confident
Q91W83 - (Q91W83) Putative TAT protein (Transactivating regulatory protein) || Number of peptides = 3 || ambiguous || 90.5% Confident
TDBP_MOUSE - (Q921F2) TAR DNA-binding protein-43 (TDP-43) || Number of peptides = 1 || ambiguous || 90.5% Confident
R23A_MOUSE - (P54726) UV excision repair protein RAD23 homolog A (MHR23A) || Number of peptides = 5 || ambiguous || 90.4% Confident
Q9JII6 - (Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase) || Number of peptides = 2 || ambiguous || 90.3% Confident
DRG1_MOUSE - (P32233) Developmentally regulated GTP-binding protein 1 (DRG 1) (Nedd3 protein) || Number of peptides = 3 || ambiguous || 90.3% Confident
Q8TB84 - (Q8TB84) Hypothetical protein || Number of peptides = 1 || unambiguous || 90.1% Confident
SPSY_MOUSE - (P97355) Spermine synthase (EC 2.5.1.22) (Spermidine aminopropyltransferase) (SPMSY) || Number of peptides = 3 || ambiguous || 90.0% Confident
PSA7_MOUSE - (Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1) || Number of peptides = 4 || ambiguous || 89.8% Confident
RADI_MOUSE - (P26043) Radixin || Number of peptides = 5 || ambiguous || 89.7% Confident
ALDR_MOUSE - (P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) || Number of peptides = 7 || ambiguous || 89.3% Confident
ALD1_MOUSE - (P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7) || Number of peptides = 5 || unambiguous || 89.3% Confident
NDKA_MOUSE - (P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) || Number of peptides = 2 || ambiguous || 89.2% Confident
Q9Z332 - (Q9Z332) Keratin 6 alpha || Number of peptides = 3 || ambiguous || 89.2% Confident
Q922K2 - (Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment) || Number of peptides = 9 || ambiguous || 89.1% Confident
Q9DCG9 - (Q9DCG9) 0610038D11Rik protein || Number of peptides = 2 || ambiguous || 89.0% Confident
KPY1_HUMAN - (P14618) Pyruvate kinase, M1 isozyme (EC 2.7.1.40) (Pyruvate kinase muscle isozyme) (Cytosolic thyroid hormone-binding protein) (CTHBP) (THBP1) || Number of peptides = 7 || ambiguous || 88.9% Confident
RAC1_HUMAN - (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) || Number of peptides = 6 || ambiguous || 88.8% Confident
RL2A_MOUSE - (P14115) 60S ribosomal protein L27a (L29) || Number of peptides = 6 || ambiguous || 88.7% Confident
Q61157 - (Q61157) YSK4 (Fragment) || Number of peptides = 1 || unambiguous || 88.6% Confident
Q9Z1F9 - (Q9Z1F9) ARX || Number of peptides = 5 || unambiguous || 88.0% Confident
RL44_HUMAN - (P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a) || Number of peptides = 5 || ambiguous || 87.3% Confident
DCUP_MOUSE - (P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD) || Number of peptides = 2 || unambiguous || 87.2% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 18 || ambiguous || 86.6% Confident
Q9H9J3 - (Q9H9J3) Hypothetical protein FLJ12700 || Number of peptides = 5 || unambiguous || 86.3% Confident
RL6_MOUSE - (P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) || Number of peptides = 16 || unambiguous || 85.8% Confident
EFTU_HUMAN - (P49411) Elongation factor Tu, mitochondrial precursor (P43) || Number of peptides = 2 || unambiguous || 85.7% Confident
Q9D096 - (Q9D096) 2610034N03Rik protein || Number of peptides = 2 || unambiguous || 85.7% Confident
MPRI_MOUSE - (Q07113) Cation-independent mannose-6-phosphate receptor precursor (CI Man-6-P receptor) (CI-MPR) (Insulin-like growth factor II receptor) (300 kDa mannose 6-phosphate receptor) (MPR 300) (MPR300) || Number of peptides = 15 || unambiguous || 85.2% Confident
Q9H8U4 - (Q9H8U4) Hypothetical protein FLJ13220 || Number of peptides = 4 || unambiguous || 84.9% Confident
CO3_MOUSE - (P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] || Number of peptides = 4 || unambiguous || 84.9% Confident
Q9UFU8 - (Q9UFU8) Hypothetical protein (Fragment) || Number of peptides = 11 || unambiguous || 84.8% Confident
CAD2_MOUSE - (P15116) Neural-cadherin precursor (N-cadherin) (Cadherin-2) || Number of peptides = 5 || unambiguous || 84.8% Confident
K22E_HUMAN - (P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e) || Number of peptides = 8 || unambiguous || 84.4% Confident
Q9NVM6 - (Q9NVM6) Hypothetical protein FLJ10634 || Number of peptides = 14 || unambiguous || 84.4% Confident
ALFA_MOUSE - (P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) || Number of peptides = 6 || unambiguous || 84.4% Confident
NPA1_HUMAN - (Q99742) Neuronal PAS domain protein 1 (Neuronal PAS1) (Member of PAS protein 5) (MOP5) || Number of peptides = 1 || unambiguous || 84.2% Confident
ZYX_MOUSE - (Q62523) Zyxin || Number of peptides = 4 || unambiguous || 84.1% Confident
Q91V41 - (Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) || Number of peptides = 4 || unambiguous || 83.8% Confident
Q9EQC8 - (Q9EQC8) Papillary renal cell carcinoma-associated protein || Number of peptides = 3 || unambiguous || 82.8% Confident
Q8WYI3 - (Q8WYI3) MSTP023 || Number of peptides = 2 || ambiguous || 82.8% Confident
Q91X81 - (Q91X81) Unknown (Protein for MGC:18702) || Number of peptides = 3 || ambiguous || 82.8% Confident
O08794 - (O08794) Alpha glucosidase II, alpha subunit || Number of peptides = 8 || unambiguous || 82.8% Confident
CBX1_HUMAN - (P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25) (P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25) || Number of peptides = 2 || ambiguous || 82.8% Confident
RS24_HUMAN - (P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19) || Number of peptides = 6 || ambiguous || 82.5% Confident
O00429 - (O00429) Dynamin-like protein || Number of peptides = 6 || ambiguous || 82.0% Confident
DYHC_MOUSE - (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) || Number of peptides = 19 || unambiguous || 81.6% Confident
Q9D6U4 - (Q9D6U4) 2310057D15Rik protein || Number of peptides = 2 || unambiguous || 81.4% Confident
Q60864 - (Q60864) MSTI1 || Number of peptides = 3 || ambiguous || 81.2% Confident
Q9Z243 - (Q9Z243) NNX3 || Number of peptides = 11 || unambiguous || 81.2% Confident
EZH2_MOUSE - (Q61188) Enhancer of zeste homolog 2 (ENX-1) || Number of peptides = 4 || ambiguous || 81.1% Confident
TRAL_MOUSE - (Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) || Number of peptides = 2 || ambiguous || 81.1% Confident
ACDV_MOUSE - (P50544) Acyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor (EC 1.3.99.-) (VLCAD) (MVLCAD) || Number of peptides = 8 || unambiguous || 80.9% Confident
PRS8_HUMAN - (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) || Number of peptides = 2 || ambiguous || 80.3% Confident
Q9WTM5 - (Q9WTM5) DNA helicase || Number of peptides = 6 || ambiguous || 80.1% Confident
Q9CWI4 - (Q9CWI4) Esterase 10 || Number of peptides = 3 || unambiguous || 80.1% Confident
CSE1_MOUSE - (Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) || Number of peptides = 9 || ambiguous || 79.8% Confident
PESC_MOUSE - (Q9EQ61) Pescadillo homolog 1 || Number of peptides = 2 || unambiguous || 79.8% Confident
Q9D0Z6 - (Q9D0Z6) 1110037P11Rik protein || Number of peptides = 1 || unambiguous || 79.6% Confident
Q9P2E6 - (Q9P2E6) Hypothetical protein KIAA1401 (Fragment) || Number of peptides = 2 || unambiguous || 79.5% Confident
PYR1_HUMAN - (P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] || Number of peptides = 7 || unambiguous || 79.4% Confident
Q9R0H5 - (Q9R0H5) Type II cytokeratin (Keratin protein K6irs) || Number of peptides = 5 || unambiguous || 79.0% Confident
K2C1_MOUSE - (P04104) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (67 kDa cytokeratin) || Number of peptides = 6 || unambiguous || 79.0% Confident
Q9Z1Y4 - (Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) || Number of peptides = 5 || unambiguous || 78.3% Confident
Q8R2Q7 - (Q8R2Q7) Similar to hypothetical protein FLJ20318 || Number of peptides = 2 || unambiguous || 78.2% Confident
KI67_HUMAN - (P46013) Antigen KI-67 || Number of peptides = 28 || unambiguous || 77.6% Confident
Q9CZD2 - (Q9CZD2) 2810018A15Rik protein || Number of peptides = 1 || ambiguous || 77.6% Confident
PRS7_MOUSE - (P46471) 26S protease regulatory subunit 7 (MSS1 protein) || Number of peptides = 5 || ambiguous || 77.4% Confident
Q9CVA3 - (Q9CVA3) 2210415M20Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 77.1% Confident
Q9CXW7 - (Q9CXW7) 3010033P07Rik protein || Number of peptides = 1 || ambiguous || 77.1% Confident
Q9DAU7 - (Q9DAU7) 1600023A02Rik protein (WAP domain protein HE4) || Number of peptides = 1 || unambiguous || 76.7% Confident
SPCO_MOUSE - (Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) || Number of peptides = 9 || unambiguous || 76.6% Confident
Q99JY9 - (Q99JY9) Hypothetical 47.4 kDa protein || Number of peptides = 1 || ambiguous || 76.4% Confident
Q9CWK1 - (Q9CWK1) 2410026J11Rik protein || Number of peptides = 6 || ambiguous || 76.3% Confident
PYRG_MOUSE - (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) || Number of peptides = 8 || unambiguous || 75.7% Confident
Q9H410 - (Q9H410) DJ469A13.2 (Novel protein) || Number of peptides = 7 || unambiguous || 75.6% Confident
Q9CPT4 - (Q9CPT4) DNA segment, Chr 17, Wayne state University 104, expressed (Stromal cell-derived growth factor SF20/IL25) || Number of peptides = 2 || unambiguous || 75.4% Confident
RO60_MOUSE - (O08848) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP) || Number of peptides = 3 || unambiguous || 74.8% Confident
COA1_HUMAN - (Q13085) Acetyl-CoA carboxylase 1 (EC 6.4.1.2) (ACC-alpha) [Includes: Biotin carboxylase (EC 6.3.4.14)] || Number of peptides = 22 || unambiguous || 74.8% Confident
UNRI_MOUSE - (Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) || Number of peptides = 2 || ambiguous || 74.7% Confident
Q99LS3 - (Q99LS3) Similar to phosphoserine phosphatase || Number of peptides = 1 || unambiguous || 74.5% Confident
Q96JP8 - (Q96JP8) Fibrillin3 || Number of peptides = 1 || unambiguous || 74.5% Confident
Q9H1L6 - (Q9H1L6) BA209J19.1.1 (GW112 protein) || Number of peptides = 2 || unambiguous || 74.5% Confident
Q8TEA7 - (Q8TEA7) Hypothetical protein FLJ23725 || Number of peptides = 3 || ambiguous || 74.5% Confident
MK01_MOUSE - (P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) || Number of peptides = 3 || ambiguous || 74.0% Confident
GUAA_HUMAN - (P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase) || Number of peptides = 8 || unambiguous || 73.8% Confident
Q61480 - (Q61480) TRAF5 || Number of peptides = 3 || ambiguous || 73.7% Confident
Q9WUC2 - (Q9WUC2) SH2-containing inositol phosphatase || Number of peptides = 10 || unambiguous || 73.2% Confident
PL10_MOUSE - (P16381) Putative ATP-dependent RNA helicase PL10 || Number of peptides = 4 || ambiguous || 73.1% Confident
CD45_HUMAN - (P08575) Leukocyte common antigen precursor (EC 3.1.3.48) (L-CA) (CD45 antigen) (T200) || Number of peptides = 7 || unambiguous || 72.8% Confident
AAKB_MOUSE - (Q9R078) 5'-AMP-activated protein kinase, beta-1 subunit (AMPK beta-1 chain) (AMPKb) || Number of peptides = 1 || ambiguous || 72.5% Confident
RS12_MOUSE - (P09388) 40S ribosomal protein S12 || Number of peptides = 1 || ambiguous || 72.5% Confident
Z213_HUMAN - (O14771) Zinc finger protein 213 (Putative transcription factor CR53) (Fragment) || Number of peptides = 4 || unambiguous || 72.5% Confident
KCRB_MOUSE - (Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) || Number of peptides = 9 || unambiguous || 71.8% Confident
AAC4_MOUSE - (P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) || Number of peptides = 6 || unambiguous || 71.8% Confident
IDHC_MOUSE - (O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) || Number of peptides = 3 || unambiguous || 71.8% Confident
FAFX_MOUSE - (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.1.2.15) (Ubiquitin thiolesterase FAF-X) (Ubiquitin-specific processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin carboxyl-terminal hydrolase FAM) (Fat facets homolog) || Number of peptides = 7 || unambiguous || 71.5% Confident
Q8VGP3 - (Q8VGP3) Olfactory receptor MOR227-1 || Number of peptides = 10 || ambiguous || 71.4% Confident
Q8WZ42 - (Q8WZ42) Titin || Number of peptides = 88 || unambiguous || 71.4% Confident
K6A1_MOUSE - (P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) || Number of peptides = 1 || unambiguous || 70.9% Confident
SIA1_MOUSE - (Q64685) CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase (EC 2.4.99.1) (Beta-galactoside alpha-2,6-sialyltransferase) (Alpha 2,6-ST) (Sialyltransferase 1) (ST6Gal I) || Number of peptides = 3 || unambiguous || 70.7% Confident
Q91Y37 - (Q91Y37) Cytosolic aminopeptidase P || Number of peptides = 2 || unambiguous || 70.0% Confident
H2B1_MOUSE - (P10853) Histone H2B F (H2B 291A) || Number of peptides = 5 || ambiguous || 70.0% Confident
CASB_MOUSE - (P10598) Beta casein precursor || Number of peptides = 1 || unambiguous || 69.8% Confident
Q96JJ4 - (Q96JJ4) Hypothetical protein KIAA1833 (Fragment) || Number of peptides = 3 || unambiguous || 69.8% Confident
O95996 - (O95996) APCL protein || Number of peptides = 8 || unambiguous || 69.7% Confident
MUC5_HUMAN - (P98088) Tracheobronchial mucin (TBM) (Major airway glycoprotein) (Fragment) || Number of peptides = 2 || unambiguous || 69.7% Confident
CDC2_MOUSE - (P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) || Number of peptides = 7 || unambiguous || 69.2% Confident
GTM1_MOUSE - (P10649) Glutathione S-transferase Mu 1 (EC 2.5.1.18) (GST class-mu 1) (Glutathione S-transferase GT8.7) (pmGT10) (GST 1-1) || Number of peptides = 1 || unambiguous || 69.1% Confident
Q9NQH7 - (Q9NQH7) Hypothetical protein || Number of peptides = 4 || ambiguous || 68.0% Confident
Q9BVA7 - (Q9BVA7) Hypothetical protein || Number of peptides = 6 || unambiguous || 68.0% Confident
Q8VCF4 - (Q8VCF4) Similar to hypothetical protein FLJ13213 || Number of peptides = 2 || unambiguous || 68.0% Confident
HS9B_HUMAN - (P08238) Heat shock protein HSP 90-beta (HSP 84) (HSP 90) || Number of peptides = 1 || unambiguous || 67.9% Confident
COPB_MOUSE - (Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP) || Number of peptides = 9 || unambiguous || 67.8% Confident
RS16_MOUSE - (P14131) 40S ribosomal protein S16 || Number of peptides = 4 || ambiguous || 67.8% Confident
Q9Y602 - (Q9Y602) Cysteine sulfinic acid decarboxylase-related protein 1 || Number of peptides = 7 || unambiguous || 67.5% Confident
O54988 - (O54988) Serine/threonine protein kinase || Number of peptides = 5 || ambiguous || 67.4% Confident
Q9D3U4 - (Q9D3U4) 4933434H11Rik protein || Number of peptides = 4 || unambiguous || 67.4% Confident
Q9DC45 - (Q9DC45) 1200003J11Rik protein || Number of peptides = 3 || unambiguous || 67.4% Confident
Q9D5T8 - (Q9D5T8) 4921522E24Rik protein || Number of peptides = 4 || unambiguous || 67.4% Confident
DDX5_HUMAN - (P17844) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5) || Number of peptides = 1 || unambiguous || 67.1% Confident
H10_MOUSE - (P10922) Histone H1' (H1.0) (H1(0)) || Number of peptides = 8 || unambiguous || 67.1% Confident
ROG_MOUSE - (O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G) || Number of peptides = 3 || ambiguous || 67.1% Confident
Q91W48 - (Q91W48) Archain 1 || Number of peptides = 4 || ambiguous || 67.0% Confident
ATY2_MOUSE - (Q9EPE9) Probable cation-transporting ATPase 2 (EC 3.6.3.-) (CATP) || Number of peptides = 15 || unambiguous || 66.8% Confident
O60290 - (O60290) Hypothetical protein KIAA0543 (Fragment) || Number of peptides = 5 || unambiguous || 66.8% Confident
IRS2_MOUSE - (P81122) Insulin receptor substrate-2 (IRS-2) (4PS) || Number of peptides = 4 || unambiguous || 66.8% Confident
DLP2_HUMAN - (Q9P1A6) Disks large-associated protein 2 (DAP-2) (SAP90/PSD-95-associated protein 2) (SAPAP2) (PSD-95/SAP90 binding protein 2) (Fragment) || Number of peptides = 7 || unambiguous || 66.4% Confident
KTHY_HUMAN - (P23919) Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) || Number of peptides = 1 || unambiguous || 66.2% Confident
3BP5_MOUSE - (Q9Z131) SH3 domain-binding protein 5 (SH3 domain-binding protein that preferentially associates with BTK) || Number of peptides = 3 || unambiguous || 65.9% Confident
TCPD_MOUSE - (P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) || Number of peptides = 2 || unambiguous || 65.8% Confident
PDA4_MOUSE - (P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) || Number of peptides = 9 || unambiguous || 65.8% Confident
Q9NXE8 - (Q9NXE8) Hypothetical protein FLJ20291 || Number of peptides = 2 || unambiguous || 65.7% Confident
Q9CZ85 - (Q9CZ85) 2810038F24Rik protein || Number of peptides = 8 || unambiguous || 65.7% Confident
Q96RT1 - (Q96RT1) Densin-180-like protein || Number of peptides = 2 || unambiguous || 65.6% Confident
Q99J10 - (Q99J10) Hypothetical 43.8 kDa protein || Number of peptides = 3 || unambiguous || 65.6% Confident
GLYC_MOUSE - (P50431) Serine hydroxymethyltransferase, cytosolic (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) || Number of peptides = 2 || unambiguous || 65.5% Confident
Q9Y5A8 - (Q9Y5A8) NY-REN-6 antigen (Fragment) || Number of peptides = 3 || unambiguous || 65.5% Confident
Q9NUV8 - (Q9NUV8) Hypothetical protein FLJ11111 || Number of peptides = 5 || unambiguous || 65.5% Confident
RS6_HUMAN - (P10660) 40S ribosomal protein S6 (Phosphoprotein NP33) (P10660) 40S ribosomal protein S6 (Phosphoprotein NP33) || Number of peptides = 3 || ambiguous || 65.1% Confident
Q96S42 - (Q96S42) Nodal-related protein || Number of peptides = 2 || unambiguous || 65.0% Confident
Q9Y4W7 - (Q9Y4W7) Poly(ADP-ribose) glycohydrolase || Number of peptides = 2 || unambiguous || 64.8% Confident
LHX4_MOUSE - (P53776) LIM/homeobox protein Lhx4 || Number of peptides = 5 || ambiguous || 64.7% Confident
HBD_HUMAN - (P02042) Hemoglobin delta chain || Number of peptides = 3 || unambiguous || 64.7% Confident
RL28_MOUSE - (P41105) 60S ribosomal protein L28 || Number of peptides = 6 || unambiguous || 64.2% Confident
ANX6_MOUSE - (P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II) || Number of peptides = 9 || ambiguous || 64.2% Confident
Q9DBI6 - (Q9DBI6) 1300007E16Rik protein || Number of peptides = 1 || ambiguous || 64.1% Confident
VIME_MOUSE - (P20152) Vimentin || Number of peptides = 4 || unambiguous || 64.0% Confident
O35126 - (O35126) DRPLA || Number of peptides = 2 || ambiguous || 63.6% Confident
RL39_HUMAN - (P02404) 60S ribosomal protein L39 || Number of peptides = 3 || unambiguous || 63.0% Confident
Q9D7R0 - (Q9D7R0) 1500031J01Rik protein || Number of peptides = 10 || ambiguous || 62.9% Confident
Q61984 - (Q61984) N-methyl-D-aspartate receptor subunit NR2C || Number of peptides = 2 || unambiguous || 62.2% Confident
CAPB_MOUSE - (P47757) F-actin capping protein beta subunit (CapZ beta) || Number of peptides = 4 || ambiguous || 62.2% Confident
143G_HUMAN - (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 9 || ambiguous || 62.2% Confident
Q8WZ64 - (Q8WZ64) PARX protein || Number of peptides = 15 || ambiguous || 62.1% Confident
GALT_HUMAN - (O60755) Galanin receptor type 3 (GAL3-R) (GALR3) || Number of peptides = 5 || unambiguous || 62.0% Confident
PSD1_HUMAN - (Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) || Number of peptides = 6 || unambiguous || 61.9% Confident
LMA1_MOUSE - (P19137) Laminin alpha-1 chain precursor (Laminin A chain) || Number of peptides = 8 || unambiguous || 61.9% Confident
Q96MQ2 - (Q96MQ2) Hypothetical protein FLJ32053 || Number of peptides = 1 || unambiguous || 61.5% Confident
Q9EQ00 - (Q9EQ00) cAMP-dependent protein kinase regulatory subunit || Number of peptides = 3 || unambiguous || 61.3% Confident
HCC1_MOUSE - (Q9D1J3) Nuclear protein Hcc-1 || Number of peptides = 1 || ambiguous || 61.2% Confident
RL32_HUMAN - (P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32 || Number of peptides = 4 || ambiguous || 61.2% Confident
Q8TBY9 - (Q8TBY9) Hypothetical protein || Number of peptides = 5 || unambiguous || 61.1% Confident
LAM1_HUMAN - (P20700) Lamin B1 || Number of peptides = 2 || unambiguous || 60.8% Confident
Z147_MOUSE - (Q61510) Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp) || Number of peptides = 3 || unambiguous || 60.7% Confident
Q8R0K1 - (Q8R0K1) Hypothetical 87.3 kDa protein (Fragment) || Number of peptides = 19 || ambiguous || 60.5% Confident
RA18_MOUSE - (Q9QXK2) Postreplication repair protein RAD18 (mRAD18Sc) || Number of peptides = 3 || unambiguous || 60.5% Confident
Q96MZ8 - (Q96MZ8) Hypothetical protein FLJ31638 || Number of peptides = 1 || ambiguous || 60.4% Confident
LAG3_HUMAN - (P18627) Lymphocyte activation gene-3 protein precursor (LAG-3) (FDC protein) (CD223 antigen) || Number of peptides = 4 || unambiguous || 60.2% Confident
RL9_MOUSE - (P51410) 60S ribosomal protein L9 || Number of peptides = 4 || unambiguous || 60.2% Confident
Q8VDW0 - (Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family || Number of peptides = 3 || unambiguous || 60.1% Confident
Q9ULF2 - (Q9ULF2) Hypothetical protein KIAA1268 (Fragment) || Number of peptides = 7 || unambiguous || 60.1% Confident
Q9CT27 - (Q9CT27) 2610015J01Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 60.1% Confident
TGR2_MOUSE - (Q62312) TGF-beta receptor type II precursor (EC 2.7.1.37) (TGFR-2) (TGF-beta type II receptor) || Number of peptides = 13 || unambiguous || 60.1% Confident
Q9NSE6 - (Q9NSE6) C21orf258 protein || Number of peptides = 3 || unambiguous || 59.7% Confident
Q9DC92 - (Q9DC92) 0710008M05Rik protein (Non-canonical ubiquitin conjugating enzyme 1) || Number of peptides = 5 || ambiguous || 59.6% Confident
Q96NK2 - (Q96NK2) Hypothetical protein FLJ30691 (Fragment) || Number of peptides = 2 || unambiguous || 59.5% Confident
Q925I4 - (Q925I4) Candidate taste receptor T1R2 || Number of peptides = 20 || unambiguous || 59.5% Confident
MTM1_HUMAN - (Q13496) Myotubularin (EC 3.1.3.48) || Number of peptides = 2 || unambiguous || 59.5% Confident
Q9D3P6 - (Q9D3P6) DNA segment, human D0S6743E || Number of peptides = 2 || ambiguous || 59.4% Confident
Q9H5R9 - (Q9H5R9) Hypothetical protein FLJ23129 || Number of peptides = 3 || unambiguous || 58.8% Confident
Q9UPV8 - (Q9UPV8) Hypothetical protein KIAA1043 (Fragment) || Number of peptides = 6 || unambiguous || 58.7% Confident
GDFF_MOUSE - (Q9Z0J7) Growth/differentiation factor 15 precursor (GDF-15) || Number of peptides = 3 || unambiguous || 58.6% Confident
Q9NXW1 - (Q9NXW1) Hypothetical protein FLJ20030 || Number of peptides = 2 || unambiguous || 58.4% Confident
Q9CZY5 - (Q9CZY5) 2610312E17Rik protein || Number of peptides = 7 || unambiguous || 58.3% Confident
Q9R0U5 - (Q9R0U5) Matrin3 || Number of peptides = 2 || ambiguous || 58.3% Confident
Q9CQU0 - (Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene) || Number of peptides = 1 || unambiguous || 58.2% Confident
MKK2_MOUSE - (P49138) MAP kinase-activated protein kinase 2 (EC 2.7.1.-) (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAPK-2) (Fragment) || Number of peptides = 4 || ambiguous || 58.2% Confident
TRFL_MOUSE - (P08071) Lactotransferrin precursor (Lactoferrin) || Number of peptides = 3 || unambiguous || 58.0% Confident
Q9JHK4 - (Q9JHK4) RAB geranylgeranyl transferase alpha subunit (Rab geranylgeranyl transferase, a subunit) || Number of peptides = 2 || unambiguous || 57.9% Confident
Q8VHQ0 - (Q8VHQ0) SPI3L2 || Number of peptides = 16 || unambiguous || 57.8% Confident
143T_MOUSE - (P35216) 14-3-3 protein tau (14-3-3 protein theta) || Number of peptides = 5 || ambiguous || 57.5% Confident
SPCB_MOUSE - (P15508) Spectrin beta chain, erythrocyte (Beta-I spectrin) || Number of peptides = 5 || unambiguous || 57.3% Confident
Q60873 - (Q60873) P58 || Number of peptides = 3 || ambiguous || 57.3% Confident
Q8WWL5 - (Q8WWL5) TPIP alpha lipid phosphatase || Number of peptides = 6 || unambiguous || 57.2% Confident
Q9CXI2 - (Q9CXI2) 3300001A09Rik protein || Number of peptides = 6 || unambiguous || 57.2% Confident
KRAC_MOUSE - (P31750) RAC-alpha serine/threonine kinase (EC 2.7.1.-) (RAC-PK-alpha) (AKT1 kinase) (Protein kinase B) (PKB) (C-AKT) (Thymoma viral proto-oncogene) || Number of peptides = 3 || ambiguous || 57.1% Confident
Q8VEE4 - (Q8VEE4) Similar to replication protein A1 (70 kDa) || Number of peptides = 2 || unambiguous || 57.0% Confident
Q9NZ45 - (Q9NZ45) Uncharacterized hematopoietic stem/progenitor cells protein MDS029 || Number of peptides = 3 || unambiguous || 56.9% Confident
Q9JKY0 - (Q9JKY0) FL10 (2610007F23RIK protein) || Number of peptides = 2 || ambiguous || 56.9% Confident
Q8TEC4 - (Q8TEC4) Hypothetical protein FLJ23656 || Number of peptides = 4 || unambiguous || 56.8% Confident
RL35_HUMAN - (P42766) 60S ribosomal protein L35 || Number of peptides = 2 || unambiguous || 56.7% Confident
Q8VE71 - (Q8VE71) Hypothetical 72.9 kDa protein (Fragment) || Number of peptides = 2 || ambiguous || 56.7% Confident
Q91VS8 - (Q91VS8) Similar to KIAA0793 gene product || Number of peptides = 9 || unambiguous || 56.7% Confident
Q91ZU8 - (Q91ZU8) Bullous pemphigoid antigen 1-e || Number of peptides = 7 || unambiguous || 56.6% Confident
Q15170 - (Q15170) Transcription factor S-II-related protein (PP21) || Number of peptides = 8 || unambiguous || 56.1% Confident
Q9QXT0 - (Q9QXT0) Putative secreted protein ZSIG9 (5330432A10RIK protein) (Transmembrane protein 4) || Number of peptides = 2 || unambiguous || 55.6% Confident
TLR7_HUMAN - (Q9NYK1) Toll-like receptor 7 precursor || Number of peptides = 6 || unambiguous || 55.5% Confident
IF4H_MOUSE - (Q9WUK2) Eukaryotic translation initiation factor 4H (eIF-4H) (Williams-Beuren syndrome chromosome region 1 protein homolog) || Number of peptides = 5 || ambiguous || 55.5% Confident
Q9NZS2 - (Q9NZS2) Lectin-like receptor F1 (Activating coreceptor NKp80) || Number of peptides = 4 || ambiguous || 55.0% Confident
IRA2_HUMAN - (O43187) Interleukin-1 receptor-associated kinase-2 (EC 2.7.1.-) (IRAK-2) || Number of peptides = 4 || unambiguous || 54.7% Confident
O35243 - (O35243) Antigen containing epitope to monoclonal antibody MMS-85/12 (Fragment) || Number of peptides = 4 || unambiguous || 54.6% Confident
Q9CRM0 - (Q9CRM0) 4921528N06Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 54.4% Confident
NU4M_MOUSE - (P03911) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) || Number of peptides = 1 || unambiguous || 54.1% Confident
Q9Y4D4 - (Q9Y4D4) Hypothetical protein KIAA0648 (Fragment) || Number of peptides = 3 || unambiguous || 54.1% Confident
MDHM_MOUSE - (P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37) || Number of peptides = 2 || unambiguous || 54.1% Confident
Q9NQ10 - (Q9NQ10) DJ412I7.1 (Similar to radial spokehead protein) (Fragment) || Number of peptides = 2 || unambiguous || 54.0% Confident
NER3_HUMAN - (Q9UQ49) Sialidase 3 (EC 3.2.1.18) (Membrane sialidase) (Ganglioside sialidase) (N-acetyl-alpha-neuraminidase 3) || Number of peptides = 12 || unambiguous || 53.9% Confident
UBC7_HUMAN - (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) || Number of peptides = 1 || ambiguous || 53.8% Confident
MIF_MOUSE - (P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) || Number of peptides = 6 || unambiguous || 53.8% Confident
O54972 - (O54972) ETO/MTG8-related protein ETO-2 || Number of peptides = 3 || unambiguous || 53.7% Confident
RL11_MOUSE - (Q9CXW4) 60S ribosomal protein L11 || Number of peptides = 4 || unambiguous || 53.5% Confident
U520_HUMAN - (O75643) U5 small nuclear ribonucleoprotein 200 kDa helicase (U5 snRNP-specific 200 kDa protein) (U5-200KD) (Fragment) || Number of peptides = 7 || ambiguous || 53.5% Confident
RXRG_MOUSE - (P28705) Retinoic acid receptor RXR-gamma || Number of peptides = 2 || ambiguous || 53.4% Confident
Q9CXS4 - (Q9CXS4) 3110013H01Rik protein || Number of peptides = 3 || unambiguous || 53.3% Confident
Q9CR16 - (Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) || Number of peptides = 4 || unambiguous || 53.3% Confident
O43304 - (O43304) Hypothetical protein KIAA0420 (Fragment) || Number of peptides = 6 || unambiguous || 53.3% Confident
SMD3_HUMAN - (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) || Number of peptides = 1 || ambiguous || 53.0% Confident
Q9BV02 - (Q9BV02) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 53.0% Confident
DD15_MOUSE - (O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15) || Number of peptides = 4 || ambiguous || 52.8% Confident
Q96QC2 - (Q96QC2) Hypothetical protein KIAA0170 || Number of peptides = 8 || unambiguous || 52.8% Confident
Q9CQC1 - (Q9CQC1) 1200013P10Rik protein (Crooked neck protein) || Number of peptides = 3 || unambiguous || 52.8% Confident
RET3_MOUSE - (P02695) Retinoic acid-binding protein I, cellular (CRABP-I) || Number of peptides = 4 || ambiguous || 52.7% Confident
Q9P2F6 - (Q9P2F6) Hypothetical protein KIAA1391 (Fragment) || Number of peptides = 3 || unambiguous || 52.5% Confident
Q9JLT4 - (Q9JLT4) Thioredoxin reductase 2, mitochondrial precursor (EC 1.6.4.5) || Number of peptides = 2 || unambiguous || 52.4% Confident
Q9CXP5 - (Q9CXP5) 3110043A19Rik protein || Number of peptides = 2 || ambiguous || 52.4% Confident
CYA8_MOUSE - (P97490) Adenylate cyclase, type VIII (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Ca(2+)/calmodulin activated adenylyl cyclase) || Number of peptides = 4 || ambiguous || 52.4% Confident
O00312 - (O00312) MNK1 || Number of peptides = 6 || ambiguous || 52.3% Confident
MYHB_MOUSE - (O08638) Myosin heavy chain, smooth muscle isoform (SMMHC) || Number of peptides = 5 || ambiguous || 52.3% Confident
RBL2_HUMAN - (Q08999) Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (PRB2) (P130) (RBR-2) || Number of peptides = 2 || unambiguous || 52.2% Confident
Q9CYD6 - (Q9CYD6) 5730525G14Rik protein || Number of peptides = 7 || unambiguous || 52.1% Confident
Q9CQT6 - (Q9CQT6) 1700019N19Rik protein || Number of peptides = 6 || unambiguous || 51.7% Confident
XPB_HUMAN - (P19447) TFIIH basal transcription factor complex helicase XPB subunit (EC 3.6.1.-) (Basic transcription factor 2 89 kDa subunit) (BTF2-p89) (TFIIH 89 kDa subunit) (DNA-repair protein complementing XP-B cells) (Xeroderma pigmentosum group B complementing protein) (DNA excision repair protein ERCC-3) || Number of peptides = 1 || unambiguous || 51.6% Confident
NUEM_HUMAN - (Q16795) NADH-ubiquinone oxidoreductase 39 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-39KD) (CI-39KD) || Number of peptides = 4 || unambiguous || 51.6% Confident
O35929 - (O35929) Ras-like GTP-binding protein Rem || Number of peptides = 1 || unambiguous || 51.3% Confident
LSM5_HUMAN - (Q9Y4Y9) U6 snRNA-associated Sm-like protein LSm5 || Number of peptides = 4 || unambiguous || 51.1% Confident
TIE2_HUMAN - (Q02763) Angiopoietin 1 receptor precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor TIE-2) (Tyrosine-protein kinase receptor TEK) (P140 TEK) (Tunica interna endothelial cell kinase) (CD202b antigen) || Number of peptides = 28 || unambiguous || 51.0% Confident
Q9H0R5 - (Q9H0R5) Hypothetical protein || Number of peptides = 3 || ambiguous || 51.0% Confident
Q91VH6 - (Q91VH6) CGI-27 protein (C21orf19-like protein) || Number of peptides = 2 || ambiguous || 50.8% Confident
RANG_MOUSE - (P34022) Ran-specific GTPase-activating protein (Ran binding protein 1) (RANBP1) || Number of peptides = 2 || ambiguous || 50.7% Confident
Y218_HUMAN - (Q93075) Putative deoxyribonuclease KIAA0218 (EC 3.1.21.-) || Number of peptides = 7 || unambiguous || 50.7% Confident
RS26_HUMAN - (P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26 || Number of peptides = 8 || ambiguous || 50.7% Confident
O35600 - (O35600) ATP-binding cassette transporter || Number of peptides = 5 || unambiguous || 50.7% Confident
Q9EQ20 - (Q9EQ20) Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27) || Number of peptides = 1 || ambiguous || 50.4% Confident
Q8VCN4 - (Q8VCN4) Hypothetical 83.4 kDa protein || Number of peptides = 5 || unambiguous || 50.3% Confident
UD11_MOUSE - (Q63886) UDP-glucuronosyltransferase 1-1 precursor, microsomal (EC 2.4.1.17) (UDPGT) (UGT1*1) (UGT1-01) (UGT1.1) (UGT1A1) (UGTBR1) || Number of peptides = 3 || ambiguous || 50.2% Confident
SNX8_HUMAN - (Q9Y5X2) Sorting nexin 8 || Number of peptides = 3 || unambiguous || 50.2% Confident
ACLY_MOUSE - (Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) || Number of peptides = 9 || ambiguous || 50.1% Confident
Q96JX9 - (Q96JX9) Hypothetical protein FLJ14906 || Number of peptides = 2 || unambiguous || 50.1% Confident
Q8QZU6 - (Q8QZU6) Similar to unknown (Protein for IMAGE:3534875) (Fragment) || Number of peptides = 3 || unambiguous || 50.1% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/data/search/2002-TK-LungDevo/lung_E16_cyto_1
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
UR23B_MOUSE99.6%10547.2%416435174.8(P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58)
	TK280802_E16_cyto_2D_step10.3194.3194.2	2.2144	0.3202	1264.52	1	6500.0%	7	K.NFVVVMVTKPK.A
	TK280802_E16_cyto_2D_step01.3951.3951.2	1.8107	0.3787	2132.37	1	3890.0%	1	R.QIIQQNPSLLPALLQQIGR.E
URHOA_MOUSE99.6%1613018.1%193217826.1(Q9QUI0) Transforming protein RhoA
	TK280802_E16_cyto_2D_step05.2063.2063.2	1.7403	0.1775	1429.31	3	4550.0%	2	K.MKQEPVKPEEGR.D
	TK280802_E16_cyto_2D_step04.3436.3436.2	1.7858	0.1679	1609.62	1	5380.0%	2	K.HFCPNVPIILVGNK.K
	TK280802_E16_cyto_2D_step07.3792.3792.1	1.9441	0.433	1083.16	2	6250.0%	11	K.TCLLIVFSK.D
UIMD2_MOUSE99.6%5177.6%514557857.3(P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2)
	TK280802_E16_cyto_2D_step12.2009.2009.2	3.1925	0.5992	2074.81	1	5000.0%	4	K.RTSSAQVEGGVHSLHSYEK.R
	TK280802_E16_cyto_2D_step13.3069.3069.2	1.6851	0.3171	2050.49	1	3420.0%	1	R.RFGVPVIADGGIQNVGHIAK.A
URL21_MOUSE99.6%5259.4%1591843110.5(O09167) 60S ribosomal protein L21
*	TK280802_E16_cyto_2D_step05.3225.3225.2	1.5285	0.4009	1658.15	1	3570.0%	5	R.VYNVTQHAVGIIVNK.Q
UG25B_HUMAN99.6%115712.6%191213116.0(P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog)
	TK280802_E16_cyto_2D_step03.3784.3784.2	2.1785	0.1694	1473.96	1	5830.0%	2	K.TPFLLVGTQIDLR.D
	TK280802_E16_cyto_2D_step10.2869.2869.2	1.7842	0.23	1406.82	1	6500.0%	7	K.WVPEITHHCPK.T
UQ9CVB699.6%5137.6%170199138.4(Q9CVB6) 2210023N03Rik protein (Fragment)
	TK280802_E16_cyto_2D_step12.2551.2551.2	1.3133	0.1797	1452.89	1	4580.0%	2	R.ASHTAPQVLFSHR.E
UQ8R08199.6%156116.9%555601237.1(Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L
	TK280802_E16_cyto_2D_step07.2676.2676.2	2.6654	0.4386	1078.39	1	8330.0%	3	K.TPASPVVHIR.G
	TK280802_E16_cyto_2D_step05.4083.4083.3	2.7515	0.4234	4392.68	1	1670.0%	5	R.QALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQK.I
*	TK280802_E16_cyto_2D_step15.2970.2970.3	1.5066	0.0558	3775.32	1	1620.0%	5	R.YGPQYGHPPPPPPPPDYGPHADSPVLMVYGLDQSK.M
	TK280802_E16_cyto_2D_step09.2217.2217.1	0.814	0.0216	907.69	14	4380.0%	1	R.MGPPVGGHR.R
UQ91V8699.6%8508.2%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence)
*	TK280802_E16_cyto_2D_step05.2834.2834.2	1.4381	0.2809	1110.13	2	4550.0%	7	K.VVAGVAAALAHK.Y
UHBE_MOUSE99.6%154943.8%146160058.2(P02104) Hemoglobin epsilon-Y2 chain
	TK280802_E16_cyto_2D_step01.2595.2595.1	1.2589	0.0164	1067.3	3	5560.0%	2	K.VLTAFGESIK.N
	TK280802_E16_cyto_2D_step01.2006.2006.1	1.4593	0.1812	1331.22	17	2920.0%	5	K.VNVEEVGGEALGR.L
	TK280802_E16_cyto_2D_step01.2644.2644.1	2.7572	0.3976	1195.05	1	6500.0%	3	K.KVLTAFGESIK.N
	TK280802_E16_cyto_2D_step01.3199.3199.1	1.7438	0.3195	1033.12	2	5000.0%	3	K.TLINGLWSK.V
	TK280802_E16_cyto_2D_step02.3726.3726.2	3.8705	0.5685	2021.68	1	5560.0%	1	R.FFDSFGNLSSASAIMGNPR.V
	TK280802_E16_cyto_2D_step01.2472.2472.1	1.0642	0.0631	1167.2	5	4550.0%	1	K.LVAGVATALSHK.Y
UZIN_MOUSE99.6%3510.5%760816015.4(P58404) Zinedin
*	TK280802_E16_cyto_2D_step10.5105.5105.3	1.1749	0.0958	4314.76	7	990.0%	1	K.ALVPEMEDEDEEDDSEDAINEFDFLGSGEDGEGSPDPRR.C
*	TK280802_E16_cyto_2D_step11.2611.2611.3	3.3152	0.6227	3600.32	1	2310.0%	2	R.AAAAVASAASSCRPLGSGTAPNPTAAAPASSPAPGPGPVGK.G
UAAC2_MOUSE99.6%199314.2%8941036535.5(Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein)
	TK280802_E16_cyto_2D_step09.2658.2658.2	2.0234	0.4636	1755.6	1	6070.0%	3	R.KHEAFESDLAAHQDR.V
	TK280802_E16_cyto_2D_step01.0035.0035.1	0.9498	0.1275	1187.73	22	2780.0%	1	R.DQSLQEELAR.Q
	TK280802_E16_cyto_2D_step15.4421.4421.3	1.7673	0.0584	4578.04	37	1050.0%	4	K.RAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFK.A
	TK280802_E16_cyto_2D_step13.2825.2825.3	1.0488	0.0266	3470.05	305	920.0%	1	R.ETADTDTAEQVIASFRILASDKPYILAEELR.R
	TK280802_E16_cyto_2D_step01.3211.3211.1	1.2228	0.1791	1200.19	6	3330.0%	1	R.DLLLDPAWEK.Q
	TK280802_E16_cyto_2D_step08.2704.2704.2	1.2715	0.3379	1304.09	1	5560.0%	1	K.HTNYTMEHIR.V
	TK280802_E16_cyto_2D_step08.4339.4339.2	4.0015	0.4324	1375.42	1	8180.0%	8	K.LMLLLEVISGER.L
UTPIS_MOUSE99.6%93921.4%248265817.3(P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM)
	TK280802_E16_cyto_2D_step01.0052.0052.1	1.6098	0.4873	1327.09	1	4170.0%	1	R.IIYGGSVTGATCK.E
	TK280802_E16_cyto_2D_step01.2826.2826.1	1.6407	0.411	954.87	1	7860.0%	1	K.FFVGGNWK.M
	TK280802_E16_cyto_2D_step09.3024.3024.2	3.2019	0.441	1618.15	1	6150.0%	1	R.RHVFGESDELIGQK.V
*	TK280802_E16_cyto_2D_step04.3713.3713.2	1.3305	0.0761	1827.28	1	4120.0%	6	K.VSHALAEGLGVIACIGEK.L
UFKB4_MOUSE99.6%199719.5%457514415.7(P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59)
*	TK280802_E16_cyto_2D_step07.4882.4882.2	2.4814	0.3852	1686.48	1	6430.0%	5	R.RGEAHLAVNDFDLAR.A
	TK280802_E16_cyto_2D_step03.3583.3583.2	1.3267	0.1978	1638.07	6	3080.0%	1	R.VFVHYTGWLLDGTK.F
	TK280802_E16_cyto_2D_step09.4332.4332.2	2.9254	0.5624	1995.88	1	6880.0%	2	K.IPPNATLVFEVELFEFK.G
*	TK280802_E16_cyto_2D_step01.1767.1767.1	0.759	0.0136	1063.1	4	3120.0%	1	K.VLQLYPSNK.A
	TK280802_E16_cyto_2D_step09.3726.3726.2	1.829	0.3386	2042.51	2	3060.0%	8	K.GEHSIVYLKPSYAFGSVGK.E
	TK280802_E16_cyto_2D_step08.2853.2853.2	1.4155	0.1839	1691.36	100	3570.0%	1	K.GEDLTEEEDGGIIRR.I
UHS9A_MOUSE99.6%81376316.9%732846575.0(P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA)
	TK280802_E16_cyto_2D_step07.3007.3007.1	1.3069	0.0339	725.28	23	4000.0%	61	K.VILHLK.E
	TK280802_E16_cyto_2D_step06.2839.2839.1	1.009	0.0517	903.86	30	5000.0%	1	K.TKPIWTR.N
	TK280802_E16_cyto_2D_step01.2803.2803.1	1.8342	0.1896	1515.98	1	3850.0%	2	R.GVVDSEDLPLNISR.E
*	TK280802_E16_cyto_2D_step01.2894.2894.1	1.8956	0.2145	1166.15	22	5000.0%	2	K.ELHINLIPSK.Q
	TK280802_E16_cyto_2D_step01.2902.2902.1	2.2098	0.4492	1352.13	1	5000.0%	4	R.TLTIVDTGIGMTK.A
	TK280802_E16_cyto_2D_step06.2335.2335.2	1.2632	0.0679	1300.34	6	4500.0%	1	K.LGIHEDSQNRK.K
	TK280802_E16_cyto_2D_step01.0192.0192.1	1.2424	0.0446	731.32	34	6000.0%	1	K.LSELLR.Y
	TK280802_E16_cyto_2D_step01.2970.2970.1	1.594	0.1705	817.56	5	6670.0%	2	R.ALLFVPR.R
	TK280802_E16_cyto_2D_step01.2804.2804.1	1.3817	0.1323	1246.04	1	5910.0%	2	K.ADLINNLGTIAK.S
	TK280802_E16_cyto_2D_step08.4569.4569.3	1.3326	0.0088	3005.97	22	1920.0%	1	K.DLVILLYETALLSSGFSLEDPQTHANR.I
	TK280802_E16_cyto_2D_step02.4906.4906.1	0.9657	0.1847	1351.33	22	2000.0%	2	K.HFSVEGQLEFR.A
UFLNA_HUMAN99.6%18308.9%26472807596.1(P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin)
*	TK280802_E16_cyto_2D_step05.2163.2163.1	1.3238	0.3195	1108.81	28	3500.0%	2	R.ALTQTGGPHVK.A
*	TK280802_E16_cyto_2D_step13.1541.1541.2	3.3832	0.6545	1635.85	1	7000.0%	1	R.VHGPGIQSGTTNKPNK.F
*	TK280802_E16_cyto_2D_step01.2019.2019.1	1.2392	0.2609	1573.22	1	3530.0%	1	R.GAGTGGLGLAVEGPSEAK.M
*	TK280802_E16_cyto_2D_step04.5092.5092.2	0.6422	0.0015	2439.41	7	1430.0%	1	R.VSGQGLHEGHTFEPAEFIIDTR.D
*	TK280802_E16_cyto_2D_step13.3930.3930.3	1.5827	0.3743	4787.8	21	890.0%	1	K.DAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVK.Y
*	TK280802_E16_cyto_2D_step12.2639.2639.2	1.3985	0.1063	1426.26	1	5420.0%	2	R.LRNGHVGISFVPK.E
*	TK280802_E16_cyto_2D_step08.2995.2995.2	1.7414	0.3352	1701.44	1	4670.0%	2	R.TGVELGKPTHFTVNAK.A
*	TK280802_E16_cyto_2D_step14.1885.1885.2	0.8021	0.0081	1077.08	1	5000.0%	1	K.LKPGAPLRPK.L
*	TK280802_E16_cyto_2D_step04.2515.2515.1	0.9571	0.0692	711.64	55	4000.0%	1	K.ETADFK.V
*	TK280802_E16_cyto_2D_step12.2230.2230.2	1.2145	0.1118	1912.97	8	2810.0%	1	R.EGPYSISVLYGDEEVPR.S
*	TK280802_E16_cyto_2D_step12.4496.4496.3	1.3151	0.0843	3999.14	20	970.0%	1	R.FLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSK.V
	TK280802_E16_cyto_2D_step04.1884.1884.1	0.4097	0.0012	1220.73	29	1000.0%	1	R.ESIKLVSIDSK.A
*	TK280802_E16_cyto_2D_step04.3042.3042.2	0.9111	0.1558	1286.8	1	3640.0%	3	K.VTVLFAGQHIAK.S
UHBB2_MOUSE99.6%3455450.7%146157478.1(P02089) Hemoglobin beta-2 chain (B2) (Minor)
*	TK280802_E16_cyto_2D_step01.2490.2490.1	1.2005	0.191	1220.24	1	4500.0%	1	K.KVITAFNEGLK.N
*	TK280802_E16_cyto_2D_step15.4669.4669.2	3.1254	0.5915	1657.97	1	6000.0%	23	R.LLGNAIVIVLGHHLGK.D
*	TK280802_E16_cyto_2D_step01.2558.2558.1	1.614	0.2574	1023.26	1	6250.0%	2	K.SAVSCLWAK.V
	TK280802_E16_cyto_2D_step01.0004.0004.1	1.5119	0.0079	716.85	3	8000.0%	1	K.NLDNLK.G
*	TK280802_E16_cyto_2D_step01.0078.0078.1	1.8778	0.3599	1314.85	1	5000.0%	1	K.VNPDEVGGEALGR.L
*	TK280802_E16_cyto_2D_step01.2290.2290.1	1.5109	0.1401	1093.21	1	5560.0%	3	K.VITAFNEGLK.N
*	TK280802_E16_cyto_2D_step02.3598.3598.2	2.5834	0.5711	2010.19	1	4720.0%	3	R.YFDSFGDLSSASAIMGNPK.V
UACTA_HUMAN99.6%73196328.6%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2)
	TK280802_E16_cyto_2D_step01.2112.2112.1	2.5	0.2839	1164.2	3	5500.0%	4	K.EITALAPSTMK.I
	TK280802_E16_cyto_2D_step01.2098.2098.1	0.894	0.0924	645.3	5	6000.0%	4	R.GILTLK.Y
	TK280802_E16_cyto_2D_step07.3330.3330.2	1.3542	0.2384	1201.2	1	5000.0%	3	R.AVFPSIVGRPR.H
	TK280802_E16_cyto_2D_step01.3022.3022.2	1.4311	0.2262	1964.65	26	3000.0%	2	K.YPIEHGIITNWDDMEK.I
	TK280802_E16_cyto_2D_step04.3840.3840.2	1.7102	0.3654	2538.83	1	3180.0%	2	K.LCYVALDFENEMATAASSSSLEK.S
	TK280802_E16_cyto_2D_step01.2951.2951.1	2.5033	0.3357	1001.21	1	7860.0%	2	R.DLTDYLMK.I
	TK280802_E16_cyto_2D_step07.2184.2184.1	0.6871	6.0E-4	516.94	5	5000.0%	1	R.EIVR.D
	TK280802_E16_cyto_2D_step01.2742.2742.2	1.701	0.2799	1959.06	1	4710.0%	1	R.VAPEEHPTLLTEAPLNPK.A
	TK280802_E16_cyto_2D_step03.2410.2410.2	2.5445	0.4601	1174.61	1	7500.0%	12	R.HQGVMVGMGQK.D
UH2AG_HUMAN99.6%2227.9%1291397610.9(P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3)
	TK280802_E16_cyto_2D_step02.4523.4523.3	3.4828	0.4564	2917.89	1	2500.0%	1	R.VGAGAPVYLAAVLEYLTAEILELAGNAAR.D
	TK280802_E16_cyto_2D_step09.2888.2888.1	1.0725	0.0040	850.81	83	5000.0%	1	R.HLQLAIR.N
UTKT_MOUSE99.6%3615419.1%623676317.5(P40142) Transketolase (EC 2.2.1.1) (TK) (P68)
*	TK280802_E16_cyto_2D_step09.2688.2688.2	1.485	0.1328	1164.72	6	6110.0%	5	K.EAWHGKPLPK.N
*	TK280802_E16_cyto_2D_step13.3081.3081.2	1.8403	0.0662	2644.61	3	2380.0%	1	K.RCEAFGWHTIIVDGHSVEELCK.A
	TK280802_E16_cyto_2D_step04.2299.2299.1	1.2319	0.0847	980.69	1	4380.0%	6	K.HQPTAIIAK.T
	TK280802_E16_cyto_2D_step05.2554.2554.2	1.874	0.3992	1395.46	1	6250.0%	3	R.KISSDLDGHPVPK.Q
*	TK280802_E16_cyto_2D_step05.3718.3718.3	2.0155	0.2189	3192.35	4	1670.0%	3	R.ILTVEDHYYEGGIGEAVSAAVVGEPGVTVTR.L
*	TK280802_E16_cyto_2D_step01.0383.0383.1	1.5642	0.1024	808.32	24	5710.0%	2	K.AYGLALAK.L
*	TK280802_E16_cyto_2D_step02.4183.4183.2	0.9803	0.0544	2625.54	8	2000.0%	5	K.SKDDQVTVIGAGVTLHEALAAAESLK.K
UR10A_MOUSE99.6%1512528.1%2172491610.0(P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6)
	TK280802_E16_cyto_2D_step01.3086.3086.1	1.8764	0.2743	1484.87	2	4580.0%	1	K.KYDAFLASESLIK.Q
	TK280802_E16_cyto_2D_step01.3062.3062.1	2.1739	0.2886	1451.89	1	5000.0%	1	K.AVDIPHMDIEALK.K
	TK280802_E16_cyto_2D_step08.3428.3428.2	2.3464	0.5197	1269.32	1	6820.0%	11	K.VLCLAVAVGHVK.M
	TK280802_E16_cyto_2D_step10.2893.2893.2	1.0092	0.141	1902.42	40	2670.0%	1	R.DTLYEAVREVLHGNQR.K
	TK280802_E16_cyto_2D_step07.2303.2303.1	1.0276	0.1011	822.88	12	5000.0%	1	K.RFSGTVR.L
UQ91ZJ599.6%3310.0%508569797.6(Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2
	TK280802_E16_cyto_2D_step05.3459.3459.3	1.0418	0.1076	1474.84	82	1610.0%	1	K.LNGGLGTSMGCKGPK.S
	TK280802_E16_cyto_2D_step06.4004.4004.2	1.8024	0.3785	2420.82	5	2500.0%	1	K.TYNTDVPLVLMNSFNTDEDTK.K
*	TK280802_E16_cyto_2D_step11.2774.2774.2	2.6688	0.5513	1714.25	1	5360.0%	1	K.ILTTAASHEFEHTKK.D
UDYR_MOUSE99.6%93526.3%186214758.6(P00375) Dihydrofolate reductase (EC 1.5.1.3)
*	TK280802_E16_cyto_2D_step12.3259.3259.2	2.2974	0.4066	1958.64	1	4410.0%	3	-.VRPLNCIVAVSQNMGIGK.N
*	TK280802_E16_cyto_2D_step11.3930.3930.2	1.4579	0.1672	2675.64	7	2390.0%	1	K.VDMVWIVGGSSVYQEAMNQPGHLR.L
*	TK280802_E16_cyto_2D_step04.2502.2502.1	1.3986	0.2669	744.89	1	5830.0%	5	R.GAHFLAK.S
UFUS_MOUSE99.6%103613.3%518526739.4(P56959) RNA-binding protein FUS (Pigpen protein)
	TK280802_E16_cyto_2D_step01.1384.1384.1	1.4367	0.0029	673.88	25	6000.0%	1	K.QIGIIK.T
	TK280802_E16_cyto_2D_step01.5265.5265.2	1.0768	0.2339	3187.18	6	1330.0%	1	R.NECNQCKAPKPDGPGGGPGGSHMGGNYGDDR.R
	TK280802_E16_cyto_2D_step04.4002.4002.3	3.8163	0.5867	3589.49	1	2180.0%	3	R.HDSEQDNSDNNTIFVQGLGENVTIESVADYFK.Q
	TK280802_E16_cyto_2D_step10.2294.2294.2	1.4781	0.353	2254.8	2	2830.0%	5	K.APKPDGPGGGPGGSHMGGNYGDDR.R
UCOPP_MOUSE99.6%5713.4%9051024495.3(O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102)
*	TK280802_E16_cyto_2D_step13.3845.3845.3	1.2404	0.1483	4433.05	4	1310.0%	2	K.CQFSLAQECLHHAQDYGGLLLLATASGNASMVNKLAEGAER.D
	TK280802_E16_cyto_2D_step01.2932.2932.1	1.0503	0.0539	1346.94	29	4000.0%	1	K.QYPLVTPNEER.N
	TK280802_E16_cyto_2D_step04.5053.5053.3	0.9861	0.0099	3827.89	11	1030.0%	1	K.TCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVR.I
*	TK280802_E16_cyto_2D_step13.2262.2262.3	3.0235	0.6438	3667.26	1	2200.0%	1	K.GFQPSRPTAQQEPDGKPASSPVIMASQTTHKEEK.S
URS23_HUMAN99.6%143028.0%1431580810.5(P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23
	TK280802_E16_cyto_2D_step12.2161.2161.2	1.793	0.3142	1208.1	1	5450.0%	3	R.KGHAVGDIPGVR.F
	TK280802_E16_cyto_2D_step03.2592.2592.1	0.9829	0.0122	914.69	36	2140.0%	1	K.QPNSAIRK.C
	TK280802_E16_cyto_2D_step05.2434.2434.1	1.2899	0.0826	811.91	5	5000.0%	3	K.AHLGTALK.A
	TK280802_E16_cyto_2D_step13.1849.1849.2	2.0028	0.171	939.26	1	8120.0%	1	K.KAHLGTALK.A
	TK280802_E16_cyto_2D_step04.2295.2295.2	1.4799	0.3092	1058.68	3	4500.0%	2	K.ANPFGGASHAK.G
ULEG1_MOUSE99.6%4644.0%134147355.5(P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin)
	TK280802_E16_cyto_2D_step13.3590.3590.3	1.234	0.0867	2831.16	90	1770.0%	1	R.FNAHGDANTIVCNTKEDGTWGTEHR.E
	TK280802_E16_cyto_2D_step09.4277.4277.2	1.9034	0.419	2926.9	1	2000.0%	2	R.EPAFPFQPGSITEVCITFDQADLTIK.L
	TK280802_E16_cyto_2D_step01.2814.2814.1	1.8851	0.2746	878.76	3	6430.0%	1	K.SFVLNLGK.D
URL4_MOUSE99.6%154713.6%4194715411.0(Q9D8E6) 60S ribosomal protein L4 (L1)
	TK280802_E16_cyto_2D_step06.1521.1521.1	0.7712	0.0591	600.47	7	4000.0%	3	K.KPAVGK.K
	TK280802_E16_cyto_2D_step06.1941.1941.1	1.2214	0.11	599.57	8	6250.0%	1	K.KNPLK.N
	TK280802_E16_cyto_2D_step01.3198.3198.1	2.7097	0.3696	1271.16	1	6820.0%	2	R.NIPGITLLNVSK.L
	TK280802_E16_cyto_2D_step01.2874.2874.1	1.9654	0.4403	991.28	1	7500.0%	2	K.NVTLPAVFK.A
	TK280802_E16_cyto_2D_step13.3441.3441.2	1.4475	0.062	1863.98	1	4000.0%	5	K.APIRPDIVNFVHTNLR.K
	TK280802_E16_cyto_2D_step06.2041.2041.1	0.8852	0.0122	865.77	3	5000.0%	2	K.LAPGGHVGR.F
UPDA3_MOUSE99.6%176912.3%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57)
	TK280802_E16_cyto_2D_step12.1709.1709.1	0.7008	0.0539	1348.49	37	1820.0%	1	K.RLAPEYEAAATR.L
	TK280802_E16_cyto_2D_step01.1112.1112.1	1.2309	0.0452	878.05	43	5000.0%	3	K.LNFAVASR.K
	TK280802_E16_cyto_2D_step01.3040.3040.1	1.7591	0.4404	1343.87	1	5000.0%	2	K.GFPTIYFSPANK.K
	TK280802_E16_cyto_2D_step06.1765.1765.1	0.7753	0.0209	587.15	2	5000.0%	7	K.KLTPK.K
	TK280802_E16_cyto_2D_step08.2589.2589.1	1.6545	0.0774	915.8	1	5710.0%	2	K.KFLDAGHK.L
	TK280802_E16_cyto_2D_step13.2434.2434.1	0.3272	0.0372	675.83	11	2000.0%	1	K.DLIQGK.D
	TK280802_E16_cyto_2D_step07.2517.2517.1	1.5394	0.1746	1124.79	1	5500.0%	1	K.KQAGPASVPLR.T
UPGK1_MOUSE99.6%204827.4%416444057.6(P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3)
	TK280802_E16_cyto_2D_step01.3649.3649.2	1.6719	0.2652	1771.47	1	5000.0%	1	K.ALESPERPFLAILGGAK.V
	TK280802_E16_cyto_2D_step01.2795.2795.1	2.1492	0.2395	735.13	3	8000.0%	1	K.DVLFLK.D
*	TK280802_E16_cyto_2D_step09.2177.2177.3	0.8129	0.0631	1719.07	12	1670.0%	1	K.YSLEPVAAELKSLLGK.D
*	TK280802_E16_cyto_2D_step01.3078.3078.1	1.0505	0.0564	1085.59	35	2500.0%	2	K.VLPGVDALSNV.-
	TK280802_E16_cyto_2D_step06.2736.2736.2	3.0927	0.4471	1371.16	1	6670.0%	4	R.AHSSMVGVNLPQK.A
	TK280802_E16_cyto_2D_step01.0247.0247.1	1.1545	0.0357	723.91	90	5000.0%	1	K.AGGFLMK.K
*	TK280802_E16_cyto_2D_step14.3791.3791.2	0.8933	0.0040	2929.9	294	1150.0%	1	K.FCLDNGANSVVLMSHLGRPDGVPMPDK.Y
	TK280802_E16_cyto_2D_step01.2991.2991.1	1.6153	0.1365	1202.22	1	5560.0%	1	K.IQLINNMLDK.V
*	TK280802_E16_cyto_2D_step01.2659.2659.1	1.8101	0.2179	1222.14	3	4500.0%	2	K.YSLEPVAAELK.S
*	TK280802_E16_cyto_2D_step14.3655.3655.3	1.0198	0.0433	3595.28	37	910.0%	1	K.AAVPSIKFCLDNGANSVVLMSHLGRPDGVPMPDK.Y
UPCB2_MOUSE99.6%61414.1%362382226.8(Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP)
	TK280802_E16_cyto_2D_step12.4123.4123.3	4.0398	0.3554	3356.78	1	2670.0%	2	K.AFAMIIDKLEEDISSSMTNSTAASRPPVTLR.L
	TK280802_E16_cyto_2D_step01.2350.2350.1	1.2825	0.3443	1428.86	3	2690.0%	1	R.LVVPASQCGSLIGK.G
	TK280802_E16_cyto_2D_step06.2464.2464.1	1.2499	0.0907	700.87	12	5000.0%	3	R.LLMHGK.E
UHDGF_MOUSE99.6%1417011.0%237262694.8(P51859) Hepatoma-derived growth factor (HDGF)
	TK280802_E16_cyto_2D_step12.3710.3710.2	1.4074	0.1512	1992.9	10	2190.0%	13	K.YQVFFFGTHETAFLGPK.D
	TK280802_E16_cyto_2D_step12.1663.1663.1	1.0728	0.3835	955.16	1	3750.0%	1	K.ASGYQSSQK.K
UQ9CWI599.6%6147.8%2042404711.6(Q9CWI5) Ribosomal protein L15
	TK280802_E16_cyto_2D_step13.1760.1760.2	1.4525	0.3371	1012.54	1	5000.0%	1	K.FHHTIGGSR.R
	TK280802_E16_cyto_2D_step04.2234.2234.1	1.2288	0.108	881.72	35	5830.0%	2	R.NTLQLHR.Y
URAN_HUMAN99.6%4672031.5%216244237.5(P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24)
	TK280802_E16_cyto_2D_step05.3754.3754.2	1.8515	0.2942	2055.25	1	3530.0%	25	K.YVATLGVEVHPLVFHTNR.G
	TK280802_E16_cyto_2D_step01.1192.1192.1	1.1697	0.0218	960.7	20	4290.0%	1	R.HLTGEFEK.K
	TK280802_E16_cyto_2D_step01.1232.1232.1	1.4896	0.2371	1216.85	1	5560.0%	4	K.NLQYYDISAK.S
	TK280802_E16_cyto_2D_step04.2319.2319.2	1.4188	0.0992	924.68	1	6670.0%	1	K.NVPNWHR.D
	TK280802_E16_cyto_2D_step01.0158.0158.1	1.6889	0.2414	1015.95	1	6500.0%	1	K.LVLVGDGGTGK.T
	TK280802_E16_cyto_2D_step01.2582.2582.1	1.9827	0.3786	1517.83	1	5830.0%	1	R.VCENIPIVLCGNK.V
	TK280802_E16_cyto_2D_step10.3002.3002.2	1.3557	0.0837	1118.96	1	6250.0%	7	K.RHLTGEFEK.K
UQ8VI7599.6%688.8%10821192755.0(Q8VI75) RANBP4
*	TK280802_E16_cyto_2D_step14.4095.4095.2	0.9749	0.1364	3108.09	7	1610.0%	1	R.ERPVVMAVLESLTGVLRTCGSLALQPPGR.L
*	TK280802_E16_cyto_2D_step10.4158.4158.2	4.1913	0.5623	1812.88	1	5880.0%	2	K.AGFLVLAVLSDGAGDHIR.Q
*	TK280802_E16_cyto_2D_step10.3522.3522.2	1.4222	0.1041	1867.33	9	3440.0%	1	R.ERPVVMAVLESLTGVLR.T
*	TK280802_E16_cyto_2D_step10.4099.4099.3	1.344	0.0644	2841.96	86	1440.0%	1	R.SSSDPSSSPVLQTSLARVMPAYMQAVK.V
*	TK280802_E16_cyto_2D_step05.4031.4031.3	1.4375	0.0052	2572.98	100	1880.0%	1	K.LCPHVMPMLEEALRSEDPYQR.K
UTCPH_MOUSE99.6%7919.5%544596527.8(P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta)
	TK280802_E16_cyto_2D_step02.4188.4188.2	2.3133	0.5395	2254.78	1	3810.0%	1	K.SQDAEVGDGTTSVTLLAAEFLK.Q
*	TK280802_E16_cyto_2D_step08.2519.2519.2	1.0015	0.0639	1522.28	1	3930.0%	1	K.NPRSTVDPPAPSAGR.G
	TK280802_E16_cyto_2D_step10.2182.2182.3	1.1035	0.0998	2292.27	3	1430.0%	1	R.INALTAASEAACLIVSVDETIK.N
*	TK280802_E16_cyto_2D_step14.2032.2032.1	0.4073	0.0176	716.18	28	2000.0%	1	R.GQARFH.-
	TK280802_E16_cyto_2D_step12.4086.4086.2	1.5238	0.211	2892.51	1	2610.0%	1	R.VHTVEDYQAIVDAEWNILYDKLEK.I
	TK280802_E16_cyto_2D_step08.3419.3419.2	1.8521	0.3366	2021.84	1	3440.0%	2	K.QVKPYVEEGLHPQIIIR.A
UQ9Z2X199.6%91726.5%415457305.5(Q9Z2X1) Ribonucleoprotein F
	TK280802_E16_cyto_2D_step12.3153.3153.2	1.1264	0.1123	1937.2	5	2500.0%	3	K.FMSVQRPGPYDRPGTAR.R
	TK280802_E16_cyto_2D_step03.2984.2984.3	0.9431	0.0782	3811.06	37	730.0%	1	R.DLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMR.G
	TK280802_E16_cyto_2D_step01.0291.0291.1	0.9551	0.2377	879.76	351	2860.0%	2	R.GLPFGCTK.E
	TK280802_E16_cyto_2D_step01.2280.2280.1	1.8918	0.2435	800.59	2	8000.0%	1	R.YIEVFK.S
*	TK280802_E16_cyto_2D_step02.3898.3898.2	1.3369	0.2718	3150.56	1	1720.0%	1	R.SGAYSAGYGGYEEYSGLSDGYGFTTDLFGR.D
	TK280802_E16_cyto_2D_step02.3886.3886.2	2.8301	0.5358	1869.67	1	6250.0%	1	K.ITGEAFVQFASQELAEK.A
UCRTC_MOUSE99.6%282627.9%416479954.5(P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60)
	TK280802_E16_cyto_2D_step14.2423.2423.1	2.2865	0.3702	1149.14	1	5620.0%	2	K.KVHVIFNYK.G
	TK280802_E16_cyto_2D_step07.3342.3342.2	1.8884	0.2718	1222.74	1	6000.0%	5	K.GQTLVVQFTVK.H
	TK280802_E16_cyto_2D_step09.2965.2965.2	1.1285	0.0742	1476.0	23	3330.0%	1	K.HEQNIDCGGGYVK.L
	TK280802_E16_cyto_2D_step05.3083.3083.1	1.9065	0.4306	1022.14	1	6430.0%	6	K.VHVIFNYK.G
UQ99KR399.6%116.2%288327546.3(Q99KR3) Hypothetical 32.8 kDa protein
*	TK280802_E16_cyto_2D_step11.2936.2936.2	3.567	0.2218	1903.06	1	5000.0%	1	K.ANIIYPGHGPVIHNAEAK.I
UIF5A_HUMAN99.6%197545.8%153167015.2(P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor)
	TK280802_E16_cyto_2D_step10.3751.3751.2	1.0269	0.0417	1832.18	15	2810.0%	1	K.HGHAKVHLVGIDIFTGK.K
	TK280802_E16_cyto_2D_step06.0596.0596.1	0.7517	0.0	646.65	3	3750.0%	1	K.EIEQK.Y
	TK280802_E16_cyto_2D_step10.4498.4498.2	1.0047	0.2829	2629.49	1	1960.0%	4	K.YDCGEEILITVLSAMTEEAAVAIK.A
	TK280802_E16_cyto_2D_step02.4967.4967.1	0.9435	0.2224	1301.09	1	3180.0%	4	K.VHLVGIDIFTGK.K
	TK280802_E16_cyto_2D_step04.4120.4120.2	3.4115	0.5816	2584.34	1	5000.0%	2	R.NDFQLIGIQDGYLSLLQDSGEVR.E
	TK280802_E16_cyto_2D_step04.4054.4054.3	2.4072	0.0432	2740.94	1	2610.0%	1	K.RNDFQLIGIQDGYLSLLQDSGEVR.E
URL8_HUMAN99.6%41010.1%2572802511.0(P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8
	TK280802_E16_cyto_2D_step08.2504.2504.1	1.0265	0.2071	888.81	1	6000.0%	1	K.RNCWPR.V
	TK280802_E16_cyto_2D_step03.3460.3460.2	2.6579	0.5549	2244.02	1	3420.0%	3	R.TELFIAAEGIHTGQFVYCGK.K
URL7A_MOUSE99.6%143230.2%2652984510.6(P12970) 60S ribosomal protein L7a (Surfeit locus protein 3)
	TK280802_E16_cyto_2D_step12.1849.1849.1	1.1729	5.0E-4	739.47	3	5000.0%	4	K.RPPVLR.A
	TK280802_E16_cyto_2D_step11.4310.4310.2	2.7636	0.5536	2690.8	1	3700.0%	2	K.AQLVVIAHDVDPIELVVFLPALCR.K
	TK280802_E16_cyto_2D_step01.2339.2339.1	1.7006	0.0701	946.03	29	5710.0%	1	K.VVNPLFEK.R
	TK280802_E16_cyto_2D_step13.1940.1940.1	1.6572	0.1533	833.42	1	7500.0%	2	R.LGHLVHR.K
	TK280802_E16_cyto_2D_step05.2290.2290.2	1.349	0.2622	982.38	1	5000.0%	1	K.KVAPAPAVVK.K
	TK280802_E16_cyto_2D_step01.2092.2092.1	1.8034	0.2449	1219.35	11	4500.0%	1	K.NFGIGQDIQPK.R
	TK280802_E16_cyto_2D_step01.3208.3208.1	1.3619	0.228	1569.93	17	2690.0%	1	K.VPPAINQFTQALDR.Q
UIF3A_MOUSE99.6%14585.0%13441619506.8(P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin)
*	TK280802_E16_cyto_2D_step10.3191.3191.2	1.4705	0.2011	1618.13	2	4230.0%	2	K.AIEVIRPAHILQEK.E
	TK280802_E16_cyto_2D_step11.2571.2571.2	1.5846	0.0468	995.44	4	5620.0%	7	R.RVPPPALSR.D
	TK280802_E16_cyto_2D_step11.2940.2940.2	3.524	0.4961	1413.04	1	7500.0%	1	K.SGNALFHASTLHR.L
*	TK280802_E16_cyto_2D_step02.4422.4422.3	1.3334	0.0609	2862.15	32	1600.0%	1	R.NQLTAMSSVLAKAIEVIRPAHILQEK.E
	TK280802_E16_cyto_2D_step10.1588.1588.1	0.4923	0.2047	542.34	1	3750.0%	1	R.GPPLR.S
	TK280802_E16_cyto_2D_step07.4028.4028.2	1.1369	0.0391	1785.46	21	2690.0%	1	K.LCDNLRMHLSQIQR.H
UQ8R34699.6%106614.7%367393188.2(Q8R346) Similar to alanyl-tRNA synthetase (H. sapiens)
	TK280802_E16_cyto_2D_step14.4636.4636.2	0.9429	0.2346	2633.99	9	1520.0%	1	K.NVGCLQEALQLATSFAQLRLGDVK.N
	TK280802_E16_cyto_2D_step08.3611.3611.2	1.9984	0.4671	1846.29	1	4710.0%	8	R.NSSHAGAFVIVTEEAIAK.G
	TK280802_E16_cyto_2D_step08.2129.2129.2	1.2406	0.1133	1240.57	128	3180.0%	1	R.RIVAVTGAEAQK.A
UHS7C_MOUSE99.6%149739140.4%646708715.5(P08109) Heat shock cognate 71 kDa protein
	TK280802_E16_cyto_2D_step03.2878.2878.2	2.0313	0.4561	1484.41	1	4620.0%	4	K.SQIHDIVLVGGSTR.I
	TK280802_E16_cyto_2D_step14.1252.1252.1	0.8707	0.0495	858.09	125	2140.0%	1	R.GTLDPVEK.A
	TK280802_E16_cyto_2D_step14.2213.2213.1	0.2425	0.0	1234.78	12	560.0%	1	R.MVNHFIAEFK.R
	TK280802_E16_cyto_2D_step01.3096.3096.1	1.0249	0.01	1255.31	11	3890.0%	1	R.FEELNADLFR.G
	TK280802_E16_cyto_2D_step03.3827.3827.2	1.2012	0.2328	2260.63	1	2270.0%	1	K.SINPDEAVAYGAAVQAAILSGDK.S
	TK280802_E16_cyto_2D_step12.3249.3249.2	1.925	0.4251	1656.25	1	4230.0%	4	K.HWPFMVVNDAGRPK.V
	TK280802_E16_cyto_2D_step01.0036.0036.1	1.4056	0.0554	944.92	8	6430.0%	1	K.VCNPIITK.L
	TK280802_E16_cyto_2D_step15.4445.4445.2	2.1288	0.5145	3002.24	1	2690.0%	68	R.TLSSSTQASIEIDSLYEGIDFYTSITR.A
	TK280802_E16_cyto_2D_step08.4663.4663.2	5.0596	0.568	2518.77	1	5220.0%	52	R.GVPQIEVTFDIDANGILNVSAVDK.S
	TK280802_E16_cyto_2D_step02.3431.3431.2	1.8944	0.0304	2264.72	2	2860.0%	2	K.GPAVGIDLGTTYSCVGVFQHGK.V
	TK280802_E16_cyto_2D_step15.4531.4531.2	2.1888	0.4521	2915.73	1	2690.0%	2	R.NVLIFDLGGGTFDVSILTIEDGIFEVK.S
	TK280802_E16_cyto_2D_step01.2702.2702.1	1.993	0.5124	1304.25	1	6000.0%	1	K.NSLESYAFNMK.A
	TK280802_E16_cyto_2D_step01.2815.2815.1	1.0932	0.0458	1200.27	21	3640.0%	1	K.DAGTIAGLNVLR.I
	TK280802_E16_cyto_2D_step01.3182.3182.1	1.7488	0.3528	1083.41	1	5620.0%	1	K.LLQDFFNGK.E
	TK280802_E16_cyto_2D_step15.1433.1433.2	0.992	0.1234	1649.88	15	3210.0%	1	K.NQVAMNPTNTVFDAK.R
	TK280802_E16_cyto_2D_step01.0134.0134.1	1.936	0.27	994.71	4	5620.0%	1	K.EIAEAYLGK.T
	TK280802_E16_cyto_2D_step05.1991.1991.2	1.7134	0.08	932.89	13	6430.0%	1	K.RNTTIPTK.Q
*	TK280802_E16_cyto_2D_step01.3311.3311.1	1.6174	0.1373	1279.34	4	5560.0%	1	K.CNEIISWLDK.N
UEF11_MOUSE99.6%229963338.1%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu)
	TK280802_E16_cyto_2D_step06.4367.4367.2	3.8587	0.5568	2914.23	1	3570.0%	76	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK280802_E16_cyto_2D_step01.0178.0178.1	1.6762	0.2512	1027.51	1	5000.0%	3	K.IGGIGTVPVGR.V
	TK280802_E16_cyto_2D_step08.4311.4311.3	2.6075	0.3525	3470.2	1	2270.0%	6	K.NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTR.E
	TK280802_E16_cyto_2D_step01.3715.3715.2	1.3467	0.2711	2519.81	3	1960.0%	9	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK280802_E16_cyto_2D_step01.2044.2044.1	1.1091	0.0237	917.16	14	5000.0%	1	R.QTVAVGVIK.A
	TK280802_E16_cyto_2D_step01.1100.1100.2	0.8903	0.0784	1123.9	18	3890.0%	3	K.STTTGHLIYK.C
	TK280802_E16_cyto_2D_step06.3212.3212.2	1.7908	0.5124	1408.23	1	4550.0%	6	K.YYVTIIDAPGHR.D
	TK280802_E16_cyto_2D_step01.3120.3120.1	2.5504	0.4232	1316.97	1	5910.0%	4	R.EHALLAYTLGVK.Q
	TK280802_E16_cyto_2D_step15.3469.3469.3	4.935	0.5887	4390.18	1	2310.0%	29	K.NDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK.F
	TK280802_E16_cyto_2D_step01.2211.2211.1	1.8095	0.122	977.52	1	6430.0%	5	R.LPLQDVYK.I
	TK280802_E16_cyto_2D_step14.3381.3381.1	0.7122	0.0022	1592.83	17	1790.0%	5	K.THINIVVIGHVDSGK.S
UPSA6_MOUSE99.6%4108.1%246273726.7(Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain)
	TK280802_E16_cyto_2D_step02.3798.3798.2	3.1128	0.5699	1981.5	1	4710.0%	3	R.ILTEAEIDAHLVALAERD.-
	TK280802_E16_cyto_2D_step09.2122.2122.3	1.0825	0.1114	2169.39	23	1670.0%	1	K.FRILTEAEIDAHLVALAER.D
UCAZ2_MOUSE99.6%51712.2%286329675.8(P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2)
*	TK280802_E16_cyto_2D_step01.3088.3088.1	1.115	0.0817	1590.78	3	3210.0%	1	K.FTVTPSTTQVVGILK.I
*	TK280802_E16_cyto_2D_step12.3061.3061.2	2.3685	0.4487	2304.39	1	4210.0%	4	K.KVDGQQTIIACIESHQFQAK.N
UQ9CY4099.6%3753124.6%122131848.8(Q9CY40) Hemoglobin, beta adult major chain
	TK280802_E16_cyto_2D_step13.3873.3873.2	3.4859	0.6488	2996.33	1	2930.0%	15	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK280802_E16_cyto_2D_step01.5268.5268.2	3.0334	0.5166	2867.97	1	3570.0%	4	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UCYPH_MOUSE99.6%4264446.6%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18)
	TK280802_E16_cyto_2D_step01.1420.1420.1	1.2631	0.1155	1136.99	3	4440.0%	4	K.KITISDCGQL.-
*	TK280802_E16_cyto_2D_step13.2036.2036.3	1.0248	0.0613	3046.58	2	1540.0%	1	-.VNPTVFFDITADDEPLGRVSFELFADK.V
	TK280802_E16_cyto_2D_step05.1736.1736.1	0.8115	0.1511	690.84	196	4000.0%	1	K.GSSFHR.I
	TK280802_E16_cyto_2D_step06.3627.3627.3	2.1206	0.4151	2795.64	1	2500.0%	5	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
	TK280802_E16_cyto_2D_step04.2510.2510.1	1.5388	0.3575	689.24	2	6000.0%	24	K.HVVFGK.V
	TK280802_E16_cyto_2D_step01.3290.3290.1	1.159	0.13	1056.22	16	5620.0%	3	R.VSFELFADK.V
UITH2_MOUSE99.6%332.9%9461059287.3(Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2)
	TK280802_E16_cyto_2D_step01.0363.0363.1	0.9285	0.0328	879.81	6	5000.0%	1	R.GLQKDYR.T
	TK280802_E16_cyto_2D_step13.2092.2092.2	2.9942	0.5693	1470.71	1	6670.0%	1	K.AHVSFKPTVAQQR.K
*	TK280802_E16_cyto_2D_step06.2342.2342.1	1.3139	0.3301	792.89	1	6670.0%	1	K.IHLQPGK.L
UO8856899.6%20769.3%798878926.3(O88568) Heterogenous nuclear ribonucleoprotein U
	TK280802_E16_cyto_2D_step01.0150.0150.1	0.8032	0.0692	857.95	11	5000.0%	1	K.LNTLLQR.A
	TK280802_E16_cyto_2D_step05.1769.1769.1	0.9299	0.1521	784.23	9	4170.0%	5	K.KALPPEK.K
	TK280802_E16_cyto_2D_step01.2840.2840.1	1.7203	0.1818	1382.88	1	5910.0%	1	K.YNILGTNTIMDK.M
*	TK280802_E16_cyto_2D_step08.4179.4179.3	3.5665	0.5252	4348.02	1	2000.0%	5	K.TCNCETEDYGEKFDENDVITCFANFETDEVELSYAK.N
	TK280802_E16_cyto_2D_step01.1331.1331.1	1.3703	0.1848	785.04	11	5830.0%	4	K.MMVAGFK.K
	TK280802_E16_cyto_2D_step07.1945.1945.1	0.608	0.0041	613.17	11	3750.0%	2	R.EDHGR.G
*	TK280802_E16_cyto_2D_step04.4140.4140.2	1.0076	0.0595	2857.91	6	1960.0%	2	K.FDENDVITCFANFETDEVELSYAK.N
UCAH2_MOUSE99.6%2214029.0%259289607.0(P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II)
	TK280802_E16_cyto_2D_step09.2518.2518.1	1.4659	0.2496	1119.73	1	5620.0%	3	K.HNGPENWHK.D
	TK280802_E16_cyto_2D_step01.2498.2498.1	1.629	0.2941	1010.23	1	5000.0%	1	K.VLEALHSIK.T
	TK280802_E16_cyto_2D_step14.4171.4171.2	1.0318	0.1602	2515.35	7	2140.0%	2	R.LIQFHFHWGSSDGQGSEHTVNK.K
	TK280802_E16_cyto_2D_step12.2989.2989.2	3.7008	0.4182	1585.38	1	7500.0%	10	K.YAAELHLVHWNTK.Y
*	TK280802_E16_cyto_2D_step11.2371.2371.3	0.9935	0.0117	2388.37	16	1430.0%	1	K.YGDFGKAVQQPDGLAVLGYFLK.I
UTHIO_MOUSE99.6%68261050.0%104115444.9(P10639) Thioredoxin (ATL-derived factor) (ADF)
	TK280802_E16_cyto_2D_step07.3952.3952.2	1.6725	0.2658	1742.37	3	3930.0%	20	K.LVVVDFSATWCGPCK.M
*	TK280802_E16_cyto_2D_step01.2475.2475.1	2.9458	0.3522	1323.17	1	6250.0%	1	K.EAFQEALAAAGDK.L
*	TK280802_E16_cyto_2D_step06.4511.4511.2	3.2	0.6016	2793.73	1	3480.0%	47	K.YSNVVFLEVDVDDCQDVAADCEVK.C
UU2AF_MOUSE99.6%358.6%475535179.1(P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit)
	TK280802_E16_cyto_2D_step13.3348.3348.3	2.4268	0.3816	3563.93	1	2030.0%	2	R.RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK.L
	TK280802_E16_cyto_2D_step09.3129.3129.1	0.9987	0.0253	911.85	29	4290.0%	1	K.EEHGGLIR.S
UQ99K8699.6%5118.3%650708586.5(Q99K86) Lutheran blood group (Auberger b antigen included)
*	TK280802_E16_cyto_2D_step07.3711.3711.2	0.8825	0.1252	1394.8	17	2310.0%	1	K.EGGGGWEGAFLQGM.-
	TK280802_E16_cyto_2D_step09.2776.2776.2	3.2258	0.3398	2155.48	1	4720.0%	3	R.DANFHCAAHYDLPSGQHGR.L
	TK280802_E16_cyto_2D_step09.2909.2909.3	1.8455	0.15	2131.6	3	3000.0%	1	R.DYVCVVKAGAAGTSEATSSVR.V
UHBA_MOUSE99.6%2421112256.7%141149548.2(P01942) Hemoglobin alpha chain
	TK280802_E16_cyto_2D_step01.3703.3703.1	1.4327	0.1597	1255.49	1	5450.0%	11	K.FLASVSTVLTSK.Y
	TK280802_E16_cyto_2D_step01.2414.2414.1	1.4916	0.2434	1032.09	1	5000.0%	6	R.MFASFPTTK.T
	TK280802_E16_cyto_2D_step08.3460.3460.2	1.1748	0.0153	1823.96	33	2670.0%	78	K.TYFPHFDVSHGSAQVK.G
	TK280802_E16_cyto_2D_step01.1543.1543.2	1.8705	0.1976	1533.21	1	5360.0%	24	K.IGGHGAEYGAEALER.M
	TK280802_E16_cyto_2D_step14.4411.4411.3	4.9551	0.5422	3055.46	1	3800.0%	37	K.LLSHCLLVTLASHHPADFTPAVHASLDK.F
	TK280802_E16_cyto_2D_step13.3349.3349.3	1.7209	0.1775	2832.11	1	1980.0%	1	R.MFASFPTTKTYFPHFDVSHGSAQVK.G
UPRO1_MOUSE99.6%101842.4%139148268.3(P10924) Profilin I
	TK280802_E16_cyto_2D_step01.2230.2230.1	2.4144	0.2878	1215.98	1	6360.0%	1	K.DSPSVWAAVPGK.T
*	TK280802_E16_cyto_2D_step01.3299.3299.1	1.859	0.4779	1457.95	1	4230.0%	3	R.SSFFVNGLTLGGQK.C
	TK280802_E16_cyto_2D_step07.2551.2551.1	1.5903	0.1737	1152.79	37	4000.0%	2	K.EGVHGGLINKK.C
	TK280802_E16_cyto_2D_step01.3135.3135.1	1.1766	0.225	876.53	2	5710.0%	1	K.TLVLLMGK.E
	TK280802_E16_cyto_2D_step01.0876.0876.1	1.1929	0.0416	1023.89	45	4440.0%	1	K.EGVHGGLINK.K
*	TK280802_E16_cyto_2D_step02.3578.3578.2	3.2357	0.4299	1642.78	1	6540.0%	1	R.DSLLQDGEFTMDLR.T
UHS47_MOUSE99.6%6267.2%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6)
	TK280802_E16_cyto_2D_step01.2927.2927.1	1.9501	0.3512	1340.21	1	4580.0%	1	K.HLAGLGLTEAIDK.N
	TK280802_E16_cyto_2D_step11.3848.3848.2	2.3917	0.3893	1987.39	1	5310.0%	5	K.LSSLIILMPHHVEPLER.L
UHMG1_MOUSE99.6%3044421.0%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30)
	TK280802_E16_cyto_2D_step09.4836.4836.1	1.365	0.2515	1524.18	4	3210.0%	9	K.IKGEHPGLSIGDVAK.K
	TK280802_E16_cyto_2D_step07.3048.3048.2	0.9707	0.0962	1591.53	49	3080.0%	1	K.HPDASVNFSEFSKK.C
	TK280802_E16_cyto_2D_step08.4160.4160.2	0.8331	0.0765	2247.08	85	1760.0%	1	K.RPPSAFFLFCSEYRPKIK.G
UPAB1_MOUSE99.6%145614.5%636706439.5(P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1)
	TK280802_E16_cyto_2D_step11.1912.1912.3	0.7199	0.056	1406.41	70	1460.0%	1	K.SGVGNIFIKNLDK.S
*	TK280802_E16_cyto_2D_step13.3008.3008.2	1.2626	0.0238	1394.61	1	4580.0%	1	K.ELFGKFGPALSVK.V
	TK280802_E16_cyto_2D_step01.3007.3007.1	1.2151	0.0992	1158.75	13	4000.0%	1	K.FSPAGPILSIR.V
	TK280802_E16_cyto_2D_step01.1380.1380.1	1.0312	0.0284	819.71	32	5710.0%	1	K.FGPALSVK.V
	TK280802_E16_cyto_2D_step12.2854.2854.3	1.1941	0.2671	4461.17	3	1060.0%	4	R.NPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQK.Q
	TK280802_E16_cyto_2D_step06.3455.3455.2	0.956	0.1971	1546.1	7	2690.0%	6	R.IVATKPLYVALAQR.K
UTCPE_MOUSE99.6%12709.4%541596246.0(P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon)
	TK280802_E16_cyto_2D_step06.3955.3955.3	1.4912	0.1342	3917.51	33	970.0%	1	K.LMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
	TK280802_E16_cyto_2D_step09.2713.2713.2	1.1833	0.0904	1499.74	8	3080.0%	1	K.SHIMAAKAVANTMR.T
	TK280802_E16_cyto_2D_step04.4312.4312.2	2.9785	0.5854	3118.02	1	2930.0%	8	K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
	TK280802_E16_cyto_2D_step05.2113.2113.1	1.3733	0.2363	758.77	3	5830.0%	2	K.SHIMAAK.A
UTAG2_MOUSE99.6%81426.9%212235977.1(Q9WVA4) Transgelin 2
	TK280802_E16_cyto_2D_step07.2760.2760.3	0.9973	0.0369	1594.42	1	3270.0%	1	R.DDGLFSGDPNWFPK.K
*	TK280802_E16_cyto_2D_step01.2351.2351.1	0.9003	0.0217	1528.95	25	2690.0%	1	K.LINSLYPEGQAPVK.K
	TK280802_E16_cyto_2D_step13.4180.4180.2	1.8788	0.3691	2396.71	1	3610.0%	2	K.QYDADLEQILIQWITTQCR.E
*	TK280802_E16_cyto_2D_step05.2747.2747.2	1.323	0.0793	1112.49	3	5560.0%	2	K.KIQASSMAFK.Q
URS29_HUMAN99.6%3329.1%55654610.1(P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29
	TK280802_E16_cyto_2D_step06.2482.2482.1	1.3088	0.0892	595.69	9	7500.0%	1	R.HGLIR.K
	TK280802_E16_cyto_2D_step13.2264.2264.2	3.2048	0.5251	1409.62	1	7500.0%	1	-.GHQQLYWSHPR.K
URS1A_HUMAN99.6%3149527.1%1291470810.1(P39027) 40S ribosomal protein S15a
*	TK280802_E16_cyto_2D_step09.4213.4213.2	1.8308	0.2061	2226.42	1	3160.0%	21	R.QFGFIVLTTSAGIMDHEEAR.R
*	TK280802_E16_cyto_2D_step07.4214.4214.3	3.2989	0.515	3335.3	1	2230.0%	7	K.WQNNLLPSRQFGFIVLTTSAGIMDHEEAR.R
*	TK280802_E16_cyto_2D_step01.4411.4411.1	0.7868	0.2568	744.5	3	4000.0%	1	K.ILGFFF.-
UP2AA_MOUSE99.6%5117.4%309356085.5(P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha)
	TK280802_E16_cyto_2D_step07.3284.3284.2	1.8868	0.41	1917.23	1	4640.0%	3	R.AHQLVMEGYNWCHDR.N
	TK280802_E16_cyto_2D_step10.1927.1927.2	1.1526	0.1151	952.23	6	5000.0%	1	R.RGEPHVTR.R
UAOP2_MOUSE99.6%61023.3%223247396.0(O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx)
	TK280802_E16_cyto_2D_step01.2939.2939.2	1.4507	0.1604	2155.97	2	2890.0%	1	R.VVDSLQLTGTKPVATPVDWK.K
	TK280802_E16_cyto_2D_step01.3156.3156.1	1.7669	0.2207	1059.5	1	5000.0%	2	K.LPFPIIDDK.G
	TK280802_E16_cyto_2D_step01.3162.3162.1	1.9196	0.3204	1022.47	1	6250.0%	1	R.VVFIFGPDK.K
	TK280802_E16_cyto_2D_step01.4405.4405.1	3.1585	0.5202	1529.4	1	6540.0%	2	R.DLAILLGMLDPVEK.D
UCYTB_MOUSE99.6%1314521.4%98110467.4(Q62426) Cystatin B (Stefin B)
*	TK280802_E16_cyto_2D_step11.3274.3274.2	3.2413	0.4782	2445.53	1	4000.0%	12	R.VFQPLPHENKPLTLSSYQTNK.E
UQ922D899.6%204813.7%9351012567.1(Q922D8) Similar to C1-tetrahydrofolate synthase
	TK280802_E16_cyto_2D_step04.2016.2016.1	0.98	0.1175	737.91	7	5000.0%	2	R.HAVVVGR.S
	TK280802_E16_cyto_2D_step09.3216.3216.2	3.3303	0.5601	1536.74	1	6000.0%	4	K.MHGGGPTVTAGLPLPK.A
*	TK280802_E16_cyto_2D_step02.3899.3899.2	2.1389	0.5531	1640.05	1	4670.0%	1	K.STTTIGLVQALGAHLR.Q
	TK280802_E16_cyto_2D_step12.3483.3483.2	1.5298	0.1713	2579.77	1	3180.0%	1	K.IVGAPMHDLLLWNNATVTTCHSK.T
*	TK280802_E16_cyto_2D_step11.3582.3582.2	1.4253	0.2127	1739.79	2	4000.0%	1	R.YSGLQPHVVVLVATVR.A
	TK280802_E16_cyto_2D_step08.2611.2611.2	2.963	0.2186	1392.63	1	7270.0%	3	K.THLSLSHNPEQK.G
	TK280802_E16_cyto_2D_step01.3196.3196.1	1.2024	0.1283	1036.19	3	4290.0%	1	K.FSDIQIRR.L
*	TK280802_E16_cyto_2D_step08.3941.3941.3	1.2722	0.1298	2100.93	7	2500.0%	1	K.AYTEEDLDLVEKGFSNLR.K
	TK280802_E16_cyto_2D_step15.1675.1675.1	0.4269	0.0073	1291.9	15	1360.0%	1	R.KVVGDVAYDEAK.E
UHBA_HUMAN99.6%98110.6%141151268.7(P01922) Hemoglobin alpha chain
*	TK280802_E16_cyto_2D_step01.2066.2066.1	3.0256	0.0060	1531.89	1	6430.0%	9	K.VGAHAGEYGAEALER.M
UCH60_MOUSE99.6%71912.4%573609566.2(P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65)
*	TK280802_E16_cyto_2D_step12.3299.3299.2	1.609	0.2033	2036.16	1	3330.0%	4	K.KISSVQSIVPALEIANAHR.K
	TK280802_E16_cyto_2D_step06.4073.4073.2	1.0486	0.1512	2609.54	1	1960.0%	1	R.KPLVIIAEDVDGEALSTLVLNRLK.V
*	TK280802_E16_cyto_2D_step04.4240.4240.3	1.694	0.3181	2844.39	1	1570.0%	1	R.TALLDAAGVASLLTTAEAVVTEIPKEEK.D
UQ9D0E199.6%114311.0%729776498.6(Q9D0E1) 2610023M21Rik protein
*	TK280802_E16_cyto_2D_step15.3217.3217.3	5.1558	0.4597	3796.39	1	2360.0%	4	K.GDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLSK.G
	TK280802_E16_cyto_2D_step01.3654.3654.1	1.2767	0.1764	1167.96	6	5000.0%	1	R.NLPFDFTWK.M
	TK280802_E16_cyto_2D_step01.3353.3353.1	1.2856	0.0933	1265.93	14	3500.0%	1	R.AFITNIPFDVK.W
	TK280802_E16_cyto_2D_step08.3253.3253.2	1.9807	0.4169	2037.06	1	2950.0%	5	R.GNFGGSFAGSFGGAGGHAPGVAR.K
UACTB_HUMAN99.6%135641538.9%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin)
	TK280802_E16_cyto_2D_step03.3950.3950.3	1.7714	0.1918	3234.01	1	2130.0%	2	R.CPEALFQPSFLGMESCGIHETTFNSIMK.C
	TK280802_E16_cyto_2D_step09.0007.0007.3	1.2853	0.0067	4101.78	27	1210.0%	1	K.YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR.K
	TK280802_E16_cyto_2D_step12.4591.4591.1	1.1182	0.2108	1519.65	1	5000.0%	26	K.IWHHTFYNELR.V
	TK280802_E16_cyto_2D_step01.2735.2735.2	2.2755	0.4728	1955.58	1	5000.0%	1	R.VAPEEHPVLLTEAPLNPK.A
	TK280802_E16_cyto_2D_step04.3936.3936.2	6.0402	0.6406	2554.76	1	5000.0%	73	K.LCYVALDFEQEMATAASSSSLEK.S
	TK280802_E16_cyto_2D_step01.3515.3515.3	2.9181	0.507	3187.41	1	2160.0%	1	R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L
UGBLP_HUMAN99.6%3461620.2%317350777.7(P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase)
	TK280802_E16_cyto_2D_step12.2609.2609.2	2.4668	0.4748	2747.84	1	2690.0%	24	K.TNHIGHTGYLNTVTVSPDGSLCASGGK.D
	TK280802_E16_cyto_2D_step01.0251.0251.1	0.9912	0.1553	1006.48	1	6430.0%	1	K.VWNLANCK.L
	TK280802_E16_cyto_2D_step04.1904.1904.1	0.9469	0.1188	689.02	2	5000.0%	1	R.FVGHTK.D
	TK280802_E16_cyto_2D_step01.2823.2823.1	1.6022	0.0134	1366.92	1	5000.0%	1	R.YWLCAATGPSIK.I
	TK280802_E16_cyto_2D_step01.2660.2660.1	0.8403	0.1236	1266.13	25	3000.0%	1	R.LWDLTTGTTTR.R
UQ8R3E699.6%51311.5%338381175.5(Q8R3E6) Similar to chromosome 14 open reading frame 3
	TK280802_E16_cyto_2D_step05.4075.4075.2	1.3924	0.3372	1964.93	1	3750.0%	3	K.SWPEGHFATITLTFIDK.N
*	TK280802_E16_cyto_2D_step01.4117.4117.2	3.7934	0.628	2417.67	1	4760.0%	2	R.VFTTQELVQAFTHAPAALEADR.G
UALBU_MOUSE99.6%93113529.1%608686936.1(P07724) Serum albumin precursor
*	TK280802_E16_cyto_2D_step14.2231.2231.2	0.7822	0.0249	1752.65	228	2310.0%	1	K.ECCHGDLLECADDR.A
*	TK280802_E16_cyto_2D_step05.4197.4197.2	4.1455	0.5237	1483.29	1	7500.0%	22	K.GLVLIAFSQYLQK.C
*	TK280802_E16_cyto_2D_step01.2347.2347.1	2.2728	0.3934	1151.97	1	6670.0%	2	K.LVQEVTDFAK.T
*	TK280802_E16_cyto_2D_step01.2008.2008.1	1.5889	0.4489	1598.9	1	4620.0%	3	K.DTCFSTEGPNLVTR.C
*	TK280802_E16_cyto_2D_step01.1242.1242.1	1.4745	0.0057	900.98	3	6670.0%	18	R.VCLLHEK.T
*	TK280802_E16_cyto_2D_step01.3163.3163.1	1.2697	0.2789	1479.99	1	4580.0%	1	K.LGEYGFQNAILVR.Y
*	TK280802_E16_cyto_2D_step13.2972.2972.2	1.7795	0.3704	1457.89	1	5450.0%	4	R.RHPDYSVSLLLR.L
*	TK280802_E16_cyto_2D_step01.0006.0006.1	1.4212	0.1246	761.66	1	6670.0%	1	K.LATDLTK.V
*	TK280802_E16_cyto_2D_step05.5066.5066.2	1.0115	0.0404	1903.06	73	2670.0%	3	K.ENPTTFMGHYLHEVAR.R
*	TK280802_E16_cyto_2D_step03.3967.3967.2	2.4116	0.3788	1612.46	1	6250.0%	6	K.DVFLGTFLYEYSR.R
	TK280802_E16_cyto_2D_step01.2727.2727.1	1.3497	0.3352	1018.91	1	5620.0%	1	K.SLHTLFGDK.L
*	TK280802_E16_cyto_2D_step08.3375.3375.2	1.3134	0.0469	1885.85	6	2670.0%	12	R.RPCFSALTVDETYVPK.E
*	TK280802_E16_cyto_2D_step01.2514.2514.1	1.7576	0.2301	1103.24	2	5560.0%	3	K.KQTALAELVK.H
*	TK280802_E16_cyto_2D_step01.0167.0167.1	1.5541	0.3952	1441.91	2	3460.0%	3	K.APQVSTPTLVEAAR.N
*	TK280802_E16_cyto_2D_step01.0344.0344.1	1.2629	0.1373	997.86	1	5620.0%	1	K.TPVSEHVTK.C
URS7_HUMAN99.6%2411.3%1942212710.1(P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8)
	TK280802_E16_cyto_2D_step01.4239.4239.2	3.5344	0.4969	2370.98	1	4290.0%	2	R.TLTAVHDAILEDLVFPSEIVGK.R
UGR78_MOUSE99.6%2521317.4%655724225.2(P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP)
	TK280802_E16_cyto_2D_step11.2911.2911.2	1.6454	0.4163	1734.21	1	3670.0%	1	K.KTKPYIQVDIGGGQTK.T
	TK280802_E16_cyto_2D_step11.3244.3244.2	2.063	0.3793	2020.17	1	3240.0%	6	K.KVTHAVVTVPAYFNDAQR.Q
	TK280802_E16_cyto_2D_step06.4673.4673.2	1.3169	0.2098	2002.76	19	2650.0%	13	R.GVPQIEVTFEIDVNGILR.V
*	TK280802_E16_cyto_2D_step03.3859.3859.2	1.8146	0.4092	2150.77	1	5000.0%	1	R.IEIESFFEGEDFSETLTR.A
	TK280802_E16_cyto_2D_step01.3485.3485.1	1.2741	0.0919	1537.82	1	4230.0%	1	K.TFAPEEISAMVLTK.M
	TK280802_E16_cyto_2D_step01.2964.2964.1	2.3065	0.2813	1399.88	1	6360.0%	2	K.ELEEIVQPIISK.L
	TK280802_E16_cyto_2D_step06.4873.4873.3	0.8974	0.1107	3914.74	3	790.0%	1	K.DNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILR.V
UEF2_MOUSE99.6%128168837.8%857951836.8(P58252) Elongation factor 2 (EF-2)
	TK280802_E16_cyto_2D_step01.1918.1918.1	1.408	0.2973	1124.28	1	6110.0%	1	K.STLTDSLVCK.A
	TK280802_E16_cyto_2D_step07.5019.5019.2	2.5148	0.4763	1619.47	1	5380.0%	28	K.TGTITTFEHAHNMR.V
	TK280802_E16_cyto_2D_step06.2715.2715.2	2.3867	0.4402	1311.37	1	6820.0%	11	R.NMSVIAHVDHGK.S
	TK280802_E16_cyto_2D_step01.0019.0019.1	0.9711	0.1056	759.01	42	5000.0%	1	K.AGIIASAR.A
	TK280802_E16_cyto_2D_step01.1714.1714.1	0.9297	0.095	890.77	5	5000.0%	1	K.FSVSPVVR.V
	TK280802_E16_cyto_2D_step08.3099.3099.1	1.9248	0.0665	1075.75	4	5620.0%	11	R.IKPVLMMNK.M
	TK280802_E16_cyto_2D_step12.4532.4532.2	1.2984	0.3173	2121.45	2	2780.0%	4	K.RGHVFEESQVAGTPMFVVK.A
	TK280802_E16_cyto_2D_step09.1397.1397.1	0.3067	7.0E-4	445.86	4	1670.0%	18	K.SPNK.H
*	TK280802_E16_cyto_2D_step01.2335.2335.1	1.5621	0.1971	1094.99	4	4500.0%	1	R.VFSGVVSTGLK.V
	TK280802_E16_cyto_2D_step01.4389.4389.2	2.1749	0.4455	2991.79	1	2400.0%	1	R.LMEPIYLVEIQCPEQVVGGIYGVLNR.K
*	TK280802_E16_cyto_2D_step04.3616.3616.1	0.6626	0.056	775.01	11	2860.0%	1	K.SANSPDGK.K
	TK280802_E16_cyto_2D_step08.2128.2128.1	0.9333	0.0351	514.05	3	6670.0%	6	K.KLPR.T
	TK280802_E16_cyto_2D_step01.5018.5018.2	1.5395	0.391	2603.98	1	4350.0%	2	R.WLPAGDALLQMITIHLPSPVTAQK.Y
	TK280802_E16_cyto_2D_step11.4442.4442.3	1.8894	0.3634	3353.59	1	2070.0%	5	K.SDPMVQCIIEESGEHIIAGAGELHLEICLK.D
	TK280802_E16_cyto_2D_step08.3175.3175.3	1.2228	0.0952	3150.17	7	1570.0%	1	K.IWCFGPDGTGPNILTDITKGVQYLNEIK.D
	TK280802_E16_cyto_2D_step01.4322.4322.1	1.6798	0.1886	1448.52	1	5000.0%	3	K.EGIPALDNFLDKL.-
	TK280802_E16_cyto_2D_step01.3963.3963.1	2.8507	0.4053	1496.99	1	6360.0%	2	R.TFCQLILDPIFK.V
	TK280802_E16_cyto_2D_step09.4136.4136.2	0.9107	0.1114	2580.16	1	2610.0%	6	R.VTDGALVVVDCVSGVCVQTETVLR.Q
*	TK280802_E16_cyto_2D_step02.4360.4360.2	1.408	0.2238	2822.0	2	1920.0%	4	K.DGSGFLINLIDSPGHVDFSSEVTAALR.V
	TK280802_E16_cyto_2D_step10.4197.4197.2	2.8491	0.3364	2207.27	1	5560.0%	6	K.STAISLFYELSENDLNFIK.Q
	TK280802_E16_cyto_2D_step01.2224.2224.1	1.0258	0.1744	1594.59	5	3080.0%	1	R.ETVSEESNVLCLSK.S
UQ9D0K499.6%6366.6%241255707.8(Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase)
*	TK280802_E16_cyto_2D_step06.3299.3299.2	1.7605	0.3464	1674.97	1	4000.0%	6	K.RPNSGSLIQVVTTDGK.T
UP2G4_MOUSE99.6%6209.1%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4)
	TK280802_E16_cyto_2D_step07.2747.2747.2	1.0417	0.0973	1929.07	17	2810.0%	4	R.LVKPGNQNTQVTEAWNK.V
	TK280802_E16_cyto_2D_step11.3646.3646.2	4.0443	0.5943	2170.68	1	5830.0%	2	K.VAHSFNCTPIEGMLSHQLK.Q
UTBBX_HUMAN99.6%5983139.4%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain
	TK280802_E16_cyto_2D_step02.4122.4122.2	4.5681	0.4623	1962.9	1	6470.0%	12	K.GHYTEGAELVDSVLDVVR.K
	TK280802_E16_cyto_2D_step01.3071.3071.1	1.0808	0.0105	1145.08	2	5000.0%	1	K.LAVNMVPFPR.L
	TK280802_E16_cyto_2D_step01.2664.2664.1	1.7401	0.3585	1322.1	1	5000.0%	2	R.IMNTFSVVPSPK.V
	TK280802_E16_cyto_2D_step05.4221.4221.2	4.0692	0.3044	1873.37	1	6880.0%	7	K.MAVTFIGNSTAIQELFK.R
	TK280802_E16_cyto_2D_step10.2683.2683.3	1.1747	0.1979	3050.27	21	1200.0%	1	R.TLKLTTPTYGDLNHLVSATMSGVTTCLR.F
	TK280802_E16_cyto_2D_step01.5097.5097.2	2.2753	0.3494	2802.93	1	2600.0%	7	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK280802_E16_cyto_2D_step01.0086.0086.1	1.9328	0.1636	1446.68	1	6360.0%	1	K.EVDEQMLNVQNK.N
	TK280802_E16_cyto_2D_step01.3961.3961.2	4.0979	0.6343	2709.79	1	4380.0%	1	K.LTTPTYGDLNHLVSATMSGVTTCLR.F
	TK280802_E16_cyto_2D_step10.3370.3370.2	2.3784	0.3265	1273.41	3	5500.0%	2	R.KLAVNMVPFPR.L
	TK280802_E16_cyto_2D_step01.0083.0083.1	1.3397	0.3265	1301.81	3	4090.0%	1	R.ISVYYNEATGGK.Y
	TK280802_E16_cyto_2D_step05.4218.4218.3	5.4187	0.7449	4598.3	1	2430.0%	24	K.VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFR.T
UTBB3_MOUSE99.6%3311.8%450504194.9(Q9ERD7) Tubulin beta-3
	TK280802_E16_cyto_2D_step01.0100.0100.1	0.7464	1.0E-4	1029.92	84	3120.0%	1	K.VAVCDIPPR.G
	TK280802_E16_cyto_2D_step14.4489.4489.2	0.9735	0.1243	3081.94	10	1540.0%	1	K.FWEVISDEHGIDPSGNYVGDSDLQLER.I
	TK280802_E16_cyto_2D_step02.4199.4199.2	3.3115	0.3253	1875.59	1	5940.0%	1	K.MSSTFIGNSTAIQELFK.R
UQ9DAH099.6%228.2%279319247.6(Q9DAH0) Four and a half LIM domains 4
*	TK280802_E16_cyto_2D_step10.3145.3145.2	1.0759	0.0057	1830.87	47	2860.0%	1	K.NCFVCTNCKDIIGTK.N
	TK280802_E16_cyto_2D_step01.0136.0136.1	1.7834	0.4416	835.1	1	6430.0%	1	K.NPITGFGK.G
UYAP1_MOUSE99.6%2210.2%472507035.0(P46938) 65 kDa Yes-associated protein (YAP65)
*	TK280802_E16_cyto_2D_step14.2911.2911.3	5.1411	0.6551	3437.31	1	2640.0%	1	R.AHSSPASLQLGAVSPGTLTASGVVSGPAAAPAAQHLR.Q
	TK280802_E16_cyto_2D_step06.3756.3756.1	0.6742	0.0011	1214.74	2	2500.0%	1	K.TANVPQTVPMR.L
UMDHC_MOUSE99.6%4109.9%333363466.6(P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)
*	TK280802_E16_cyto_2D_step01.3902.3902.1	1.1528	0.0538	1373.18	26	2080.0%	1	K.DLDVAVLVGSMPR.R
	TK280802_E16_cyto_2D_step02.3264.3264.2	1.3134	0.1768	2283.51	87	1840.0%	3	K.NVIIWGNHSSTQYPDVNHAK.V
UHS9B_MOUSE99.6%5859816.2%723831945.0(P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA)
	TK280802_E16_cyto_2D_step04.3850.3850.2	1.2806	0.1231	1784.21	4	2860.0%	1	K.HLEINPDHPIVETLR.Q
	TK280802_E16_cyto_2D_step13.2702.2702.2	1.8106	0.3047	1912.97	1	4330.0%	6	K.KHLEINPDHPIVETLR.Q
	TK280802_E16_cyto_2D_step11.4566.4566.3	2.6765	0.4759	2993.19	1	2400.0%	9	K.DLVVLLFETALLSSGFSLEDPQTHSNR.I
	TK280802_E16_cyto_2D_step06.2422.2422.2	1.4832	0.0524	1299.04	16	4000.0%	2	K.LGIHEDSTNRR.R
	TK280802_E16_cyto_2D_step02.3164.3164.2	3.2343	0.5183	1529.21	1	7080.0%	1	K.SLTNDWEDHLAVK.H
	TK280802_E16_cyto_2D_step01.0030.0030.1	1.0661	0.2785	733.76	4	5830.0%	1	K.SLVSVTK.E
	TK280802_E16_cyto_2D_step01.0164.0164.1	2.3139	0.3833	1277.79	1	5910.0%	2	R.ELISNASDALDK.I
	TK280802_E16_cyto_2D_step01.1440.1440.1	1.2315	0.0193	1163.88	3	4440.0%	16	K.SIYYITGESK.E
	TK280802_E16_cyto_2D_step04.2315.2315.2	1.645	0.3034	1009.97	1	5710.0%	1	K.AKFENLCK.L
	TK280802_E16_cyto_2D_step01.2902.2902.1	2.2098	0.4492	1352.13	1	5000.0%	4	R.TLTLVDTGIGMTK.A
URS14_HUMAN99.6%84033.1%1511627310.1(P06366) 40S ribosomal protein S14 (PRO2640) (P06366) 40S ribosomal protein S14 (PRO2640)
	TK280802_E16_cyto_2D_step01.2908.2908.1	1.9601	0.26	1096.9	2	5560.0%	2	K.ELGITALHIK.L
	TK280802_E16_cyto_2D_step12.4122.4122.3	1.3129	0.0594	4380.3	6	1030.0%	6	K.EEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK.E
UAMP2_MOUSE99.6%5117.9%478529225.8(O08663) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2) (Peptidase M 2) (Initiation factor 2 associated 67 kDa glycoprotein) (p67) (p67eIF2)
*	TK280802_E16_cyto_2D_step01.1567.1567.1	1.1829	0.1343	1176.33	6	4440.0%	1	K.QLESQALEEK.E
	TK280802_E16_cyto_2D_step08.3420.3420.1	0.962	0.0095	1168.35	53	3330.0%	1	R.EAAEAHRQVR.K
	TK280802_E16_cyto_2D_step11.3454.3454.2	1.8009	0.474	2124.48	1	4120.0%	3	K.GSYTAQFEHTILLRPTCK.E
URL15_MOUSE99.6%112518.7%2142466811.1(Q9CZM2) 60S ribosomal protein L15
	TK280802_E16_cyto_2D_step08.2879.2879.2	2.0629	0.4595	1565.55	1	5420.0%	3	R.NPDTQWITKPVHK.H
	TK280802_E16_cyto_2D_step13.1848.1848.2	1.6651	0.0845	1708.34	1	4670.0%	3	K.GATYGKPVHHGVNQLK.F
	TK280802_E16_cyto_2D_step05.1885.1885.1	1.0516	0.0083	713.22	30	6000.0%	1	R.HCGALR.V
	TK280802_E16_cyto_2D_step13.2340.2340.2	2.2985	0.3893	1722.97	1	4620.0%	2	R.RNPDTQWITKPVHK.H
*	TK280802_E16_cyto_2D_step06.2999.2999.1	0.9845	0.1663	510.61	3	6670.0%	1	K.IHIQ.-
UPE15_MOUSE99.6%41614.6%130150545.0(Q62048) Astrocytic phosphoprotein PEA-15
	TK280802_E16_cyto_2D_step09.3994.3994.2	2.3192	0.5488	2173.25	1	3610.0%	4	K.SEEITTGSAWFSFLESHNK.L
UNTF2_HUMAN99.6%116121.3%127144785.4(P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15)
	TK280802_E16_cyto_2D_step10.3926.3926.3	4.4246	0.6629	3007.16	1	3270.0%	6	K.IQHSITAQDHQPTPDSCIISMVVGQLK.A
UO0881799.6%354.0%653704088.8(O08817) CW17 protein
	TK280802_E16_cyto_2D_step12.3471.3471.3	3.883	0.6191	2925.55	1	3200.0%	2	R.HTLITEMVALNPDFKPPADYKPPATR.V
ULKHA_MOUSE99.6%15678.4%610688906.4(P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase)
	TK280802_E16_cyto_2D_step11.4000.4000.2	2.268	0.5303	2411.05	1	3810.0%	7	K.SLSNVIAHEISHSWTGNLVTNK.T
	TK280802_E16_cyto_2D_step08.3015.3015.2	2.0891	0.2995	947.62	1	7500.0%	1	K.APLPLGHIK.R
*	TK280802_E16_cyto_2D_step08.0373.0373.2	3.6039	0.5115	1582.43	1	7920.0%	3	K.SHDQAVHTYQEHK.A
	TK280802_E16_cyto_2D_step13.1912.1912.1	1.2795	0.1293	906.67	9	5000.0%	2	R.TQHLHLR.C
UCLH1_HUMAN99.6%185410.9%16751916135.7(Q00610) Clathrin heavy chain 1 (CLH-17)
*	TK280802_E16_cyto_2D_step01.4009.4009.2	1.1965	0.069	2883.57	2	1800.0%	1	R.RPLIDQVVQTALSETQDPEEVSVTVK.A
*	TK280802_E16_cyto_2D_step13.2589.2589.3	1.0708	0.0566	2580.07	33	1360.0%	1	K.AVDVFFPPEAQNDFPVAMQISEK.H
*	TK280802_E16_cyto_2D_step04.2162.2162.2	1.4359	0.1546	1368.28	1	5450.0%	1	K.NNRPSEGPLQTR.L
*	TK280802_E16_cyto_2D_step01.2863.2863.1	1.5076	0.2684	1304.94	1	5000.0%	1	R.NNLAGAEELFAR.K
*	TK280802_E16_cyto_2D_step12.4015.4015.2	2.5188	0.4572	2372.45	1	4000.0%	6	R.KFDVNTSAVQVLIEHIGNLDR.A
*	TK280802_E16_cyto_2D_step06.2594.2594.3	1.621	0.0654	1619.39	1	3960.0%	1	R.ALEHFTDLYDIKR.A
	TK280802_E16_cyto_2D_step10.2819.2819.2	0.9123	0.0378	1487.24	3	3180.0%	1	K.RDPHLACVAYER.G
*	TK280802_E16_cyto_2D_step05.3541.3541.3	1.5798	0.044	3232.0	1	1830.0%	1	K.DAMQYASESKDTELAEELLQWFLQEEK.R
*	TK280802_E16_cyto_2D_step01.2623.2623.1	1.4303	0.0573	910.82	23	6670.0%	1	K.YLQMARK.K
	TK280802_E16_cyto_2D_step01.3908.3908.1	1.0261	0.0246	1357.34	143	3180.0%	1	R.NLQNLLILTAIK.A
*	TK280802_E16_cyto_2D_step11.3118.3118.2	2.1739	0.4339	1846.33	1	4380.0%	3	R.KVSQPIEGHAASFAQFK.M
URS3_MOUSE99.6%3127923.9%243266749.7(P17073) 40S ribosomal protein S3
	TK280802_E16_cyto_2D_step01.2104.2104.1	1.1666	0.2948	1574.79	14	2000.0%	1	K.GGKPEPPAMPQPVPTA.-
	TK280802_E16_cyto_2D_step01.2783.2783.1	1.7493	0.1711	897.16	2	7140.0%	1	K.FVADGIFK.A
	TK280802_E16_cyto_2D_step01.2610.2610.1	1.511	0.1593	1290.03	1	5450.0%	1	R.GLCAIAQAESLR.Y
	TK280802_E16_cyto_2D_step05.3254.3254.1	1.3498	0.0262	1031.93	3	5000.0%	9	R.TEIIILATR.T
	TK280802_E16_cyto_2D_step09.3226.3226.2	2.7273	0.5177	1462.57	1	7080.0%	13	K.KPLPDHVSIVEPK.D
UICE3_MOUSE99.6%119.4%277314756.9(P70677) Apopain precursor (EC 3.4.22.-) (Cysteine protease CPP32) (Yama protein) (CPP-32) (Caspase-3) (CASP-3) (SREBP cleavage activity 1) (SCA-1) (LICE)
*	TK280802_E16_cyto_2D_step05.3946.3946.2	3.1189	0.5921	2778.46	1	3400.0%	1	R.SSFVCVILSHGDEGVIYGTNGPVELK.K
UFKB1_MOUSE99.6%2036215.9%107117918.2(P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12)
	TK280802_E16_cyto_2D_step10.2930.2930.2	3.599	0.652	1955.13	1	5940.0%	19	K.RGQTCVVHYTGMLEDGK.K
UENOA_MOUSE99.6%6146360.0%433470106.8(P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1)
	TK280802_E16_cyto_2D_step06.3043.3043.3	1.3058	0.1161	1961.04	6	2500.0%	1	K.DATNVGDEGGFAPNILENK.E
	TK280802_E16_cyto_2D_step01.2374.2374.1	1.5229	0.1069	815.92	2	6670.0%	1	K.EALELLK.T
*	TK280802_E16_cyto_2D_step01.3966.3966.2	2.9042	0.5636	2972.92	1	3750.0%	1	K.SFVQNYPVVSIEDPFDQDDWGAWQK.F
	TK280802_E16_cyto_2D_step01.0103.0103.1	1.3274	0.163	902.13	1	5620.0%	3	K.TIAPALVSK.K
*	TK280802_E16_cyto_2D_step04.3870.3870.2	3.0536	0.5359	2195.62	1	4740.0%	8	K.AGYTDQVVIGMDVAASEFYR.S
	TK280802_E16_cyto_2D_step01.2471.2471.1	2.1091	0.067	1409.03	1	5420.0%	2	R.GNPTVEVDLYTAK.G
*	TK280802_E16_cyto_2D_step01.5137.5137.2	2.8555	0.4499	3025.24	1	2410.0%	1	R.HIADLAGNPEVILPVPAFNVINGGSHAGNK.L
	TK280802_E16_cyto_2D_step01.1631.1631.1	1.2877	0.2328	803.02	1	7000.0%	8	K.YDLDFK.S
*	TK280802_E16_cyto_2D_step10.3247.3247.3	1.2417	0.0675	3157.45	133	1340.0%	1	K.VNQIGSVTESLQACKLAQSNGWGVMVSHR.S
	TK280802_E16_cyto_2D_step02.3228.3228.2	1.0614	0.0107	2035.76	1	2630.0%	8	K.FTASAGIQVVGDDLTVTNPK.R
	TK280802_E16_cyto_2D_step01.2090.2090.1	1.855	0.1726	1145.15	9	5560.0%	1	R.IGAEVYHNLK.N
	TK280802_E16_cyto_2D_step03.4072.4072.2	1.997	0.3209	1523.66	3	4290.0%	7	K.FGANAILGVSLAVCK.A
	TK280802_E16_cyto_2D_step02.3551.3551.2	3.314	0.5353	1808.71	1	6180.0%	1	R.AAVPSGASTGIYEALELR.D
*	TK280802_E16_cyto_2D_step01.3131.3131.1	2.2794	0.438	1442.07	1	6360.0%	2	R.YITPDQLADLYK.S
*	TK280802_E16_cyto_2D_step03.4878.4878.2	0.8314	0.0181	2676.6	68	1460.0%	1	K.TAIAKAGYTDQVVIGMDVAASEFYR.S
	TK280802_E16_cyto_2D_step11.4616.4616.2	2.1508	0.5958	2357.05	1	3100.0%	14	R.SGETEDTFIADLVVGLCTGQIK.T
	TK280802_E16_cyto_2D_step05.3019.3019.2	1.3007	0.332	1544.64	1	3080.0%	1	K.LAQSNGWGVMVSHR.S
UQ9CR8699.6%1212217.6%148160628.2(Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene)
	TK280802_E16_cyto_2D_step04.3593.3593.2	2.6604	0.5836	1678.94	1	5330.0%	11	K.LQAVEVVITHLAPGTK.H
	TK280802_E16_cyto_2D_step01.3272.3272.1	0.9172	0.02	1203.37	126	2780.0%	1	K.MCSIPPKNEK.L
UMAT3_HUMAN99.6%7216.1%847946236.3(P43243) Matrin 3
	TK280802_E16_cyto_2D_step10.3199.3199.2	2.378	0.4751	2040.65	1	3890.0%	4	R.VIHLSNLPHSGYSDSAVLK.L
	TK280802_E16_cyto_2D_step09.2544.2544.2	2.2374	0.5381	1474.12	1	5450.0%	2	K.NTHCSSLPHYQK.L
*	TK280802_E16_cyto_2D_step08.3180.3180.3	1.1648	0.2048	2439.72	9	1750.0%	1	R.YQLLQLVEPFGVISNHLILNK.I
URL3_MOUSE99.6%163422.1%4024599310.2(P27659) 60S ribosomal protein L3 (J1 protein)
	TK280802_E16_cyto_2D_step05.2418.2418.1	1.1827	0.1567	885.01	8	5000.0%	2	K.AGMTHIVR.E
	TK280802_E16_cyto_2D_step04.2276.2276.3	1.2911	0.0372	1438.45	26	1820.0%	1	K.TVFAEHISDECK.R
*	TK280802_E16_cyto_2D_step02.4260.4260.2	1.6675	0.3352	2453.88	1	3100.0%	1	K.SINPLGGFVHYGEVTNDFIMLK.G
	TK280802_E16_cyto_2D_step06.2695.2695.3	1.9716	0.4235	1363.85	11	3180.0%	2	R.KVACIGAWHPAR.V
	TK280802_E16_cyto_2D_step09.3030.3030.2	2.2928	0.3064	1828.0	1	5310.0%	2	K.KAHLMEIQVNGGTVAEK.L
	TK280802_E16_cyto_2D_step06.1952.1952.1	0.7473	0.0053	571.71	4	6670.0%	1	R.WHTK.K
*	TK280802_E16_cyto_2D_step06.2316.2316.1	1.1862	0.0445	971.7	6	5000.0%	3	R.IIAHTQMR.L
	TK280802_E16_cyto_2D_step07.2313.2313.1	1.1502	0.141	705.64	24	6000.0%	1	R.KFSAPR.H
UHBAZ_MOUSE99.6%3727950.4%141161047.6(P06467) Hemoglobin zeta chain
*	TK280802_E16_cyto_2D_step01.0084.0084.1	1.8706	0.3326	1005.01	1	6670.0%	1	K.IMTAVGDAVK.S
*	TK280802_E16_cyto_2D_step06.3592.3592.2	1.8971	0.4929	1487.94	1	5420.0%	9	K.LLSHCLLVTMAAR.F
*	TK280802_E16_cyto_2D_step01.2302.2302.1	0.9889	0.0585	1148.85	132	3000.0%	1	K.SIDNLSSALTK.L
*	TK280802_E16_cyto_2D_step01.3255.3255.1	1.3338	0.2334	1111.26	2	5000.0%	1	R.AIIMSMWEK.M
*	TK280802_E16_cyto_2D_step05.3710.3710.2	1.0715	0.1144	2286.72	35	2110.0%	1	R.VDPVNFKLLSHCLLVTMAAR.F
*	TK280802_E16_cyto_2D_step13.4288.4288.2	2.3137	0.4572	1987.15	1	4330.0%	8	K.TYFPHFDLHHGSQQLR.A
*	TK280802_E16_cyto_2D_step07.1957.1957.1	1.0733	0.4885	561.24	1	6250.0%	9	R.AHGFK.I
UTRFE_MOUSE99.6%4834021.2%697767247.2(Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin)
*	TK280802_E16_cyto_2D_step01.2408.2408.1	1.3091	0.2063	1479.04	1	3330.0%	1	K.KGTDFQLNQLEGK.K
	TK280802_E16_cyto_2D_step04.1878.1878.1	1.1721	0.1742	887.81	5	5000.0%	2	K.SCHTGLGR.S
*	TK280802_E16_cyto_2D_step01.3322.3322.1	2.5481	0.4053	1241.78	1	6500.0%	2	K.DFQLFSSPLGK.D
*	TK280802_E16_cyto_2D_step02.3866.3866.2	2.074	0.3202	2555.45	1	3410.0%	1	K.AVLTSQETLFGGSDCTGNFCLFK.S
*	TK280802_E16_cyto_2D_step05.5070.5070.2	1.729	0.3004	2011.21	1	4410.0%	13	K.DFASCHLAQAPNHVVVSR.K
*	TK280802_E16_cyto_2D_step01.4387.4387.1	0.9193	0.1268	1561.98	2	3080.0%	1	R.SAGWVIPIGLLFCK.L
*	TK280802_E16_cyto_2D_step12.2571.2571.2	1.5391	0.1958	1959.41	5	2940.0%	2	K.GDVAFVKHQTVLDNTEGK.N
*	TK280802_E16_cyto_2D_step05.5130.5130.2	0.8735	0.1397	1934.68	303	1670.0%	1	K.NLKQEDFELLCPDGTR.K
*	TK280802_E16_cyto_2D_step05.2227.2227.2	1.1083	0.0311	952.11	1	5000.0%	5	R.IPSHAVVAR.K
*	TK280802_E16_cyto_2D_step03.2840.2840.1	1.2386	0.0884	879.91	106	4290.0%	2	K.DSAFGLLR.V
*	TK280802_E16_cyto_2D_step09.2817.2817.1	1.2839	0.1302	1257.72	1	4440.0%	3	R.LLEACTFHKH.-
*	TK280802_E16_cyto_2D_step01.2336.2336.1	0.9536	0.1481	1352.29	4	2730.0%	1	K.GTDFQLNQLEGK.K
UPDI_MOUSE99.6%6194324.6%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59)
	TK280802_E16_cyto_2D_step01.3679.3679.1	1.9245	0.2015	969.46	2	6430.0%	2	R.ILEFFGLK.K
	TK280802_E16_cyto_2D_step12.4059.4059.2	1.205	0.1356	1743.82	22	2500.0%	1	K.LGETYKDHENIIIAK.M
	TK280802_E16_cyto_2D_step15.3790.3790.2	1.3471	0.0424	3144.08	1	1830.0%	1	K.RTGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK280802_E16_cyto_2D_step07.4367.4367.3	2.5853	0.5283	2989.54	1	2410.0%	7	R.TGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK280802_E16_cyto_2D_step12.2213.2213.2	0.943	0.1267	1965.91	19	2810.0%	1	K.HNQLPLVIEFTEQTAPK.I
	TK280802_E16_cyto_2D_step01.3067.3067.1	1.3322	0.0687	749.14	23	7000.0%	1	K.LLDFIK.H
	TK280802_E16_cyto_2D_step05.2918.2918.1	0.9548	0.0923	931.09	4	4290.0%	10	K.VHSFPTLK.F
	TK280802_E16_cyto_2D_step05.3783.3783.1	1.0938	0.0572	1083.19	16	3750.0%	2	K.THILLFLPK.S
	TK280802_E16_cyto_2D_step04.3845.3845.2	2.379	0.2975	1837.65	1	5000.0%	27	K.ILFIFIDSDHTDNQR.I
	TK280802_E16_cyto_2D_step09.4966.4966.2	1.2245	0.0624	1956.21	26	2670.0%	2	K.IKPHLMSQEVPEDWDK.Q
UG6PI_MOUSE99.6%486.8%557626377.9(P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK)
	TK280802_E16_cyto_2D_step10.3675.3675.3	2.0563	0.2901	3319.45	1	1900.0%	2	R.VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK.M
	TK280802_E16_cyto_2D_step04.2833.2833.2	1.3662	0.3882	880.77	1	5710.0%	2	R.AVLHVALR.N
UAPA1_MOUSE99.6%5535.2%264305875.9(Q00623) Apolipoprotein A-I precursor (Apo-AI)
*	TK280802_E16_cyto_2D_step13.3088.3088.1	0.9277	0.0236	1523.02	158	2730.0%	1	K.QKVQPYLDEFQK.K
*	TK280802_E16_cyto_2D_step10.2391.2391.3	1.4596	0.0875	2107.95	3	2210.0%	1	R.THVDSLRTQLAPHSEQMR.E
*	TK280802_E16_cyto_2D_step03.4150.4150.3	4.6326	0.6081	4100.97	1	2790.0%	1	R.DYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQER.L
*	TK280802_E16_cyto_2D_step01.2674.2674.1	1.9555	0.3025	1242.33	1	6500.0%	1	K.DFANVYVDAVK.D
*	TK280802_E16_cyto_2D_step11.3394.3394.2	0.7981	0.0706	1873.44	120	1670.0%	1	K.LQELQGRLSPVAEEFR.D
UCABA_MOUSE99.6%218121.4%285308317.9(Q99020) CARG-binding factor-A (CBF-A)
*	TK280802_E16_cyto_2D_step06.3822.3822.2	1.9793	0.3686	1657.78	1	4620.0%	7	R.GFVFITFKEEDPVK.K
	TK280802_E16_cyto_2D_step05.3295.3295.1	0.8029	0.1281	1036.97	16	3750.0%	1	K.MDPNTGRSR.G
	TK280802_E16_cyto_2D_step13.1465.1465.1	2.7702	0.4912	992.34	1	6880.0%	3	K.KFHTVSGSK.C
	TK280802_E16_cyto_2D_step01.0171.0171.1	1.6395	0.236	1168.97	1	6670.0%	3	K.FGEVVDCTIK.M
	TK280802_E16_cyto_2D_step01.3841.3841.1	1.6944	0.2628	928.83	2	6430.0%	1	R.GFGFILFK.D
	TK280802_E16_cyto_2D_step02.3878.3878.1	1.402	0.2636	960.25	1	6430.0%	3	R.GFVFITFK.E
	TK280802_E16_cyto_2D_step05.2057.2057.1	0.8256	0.0627	862.75	2	5000.0%	1	K.FHTVSGSK.C
	TK280802_E16_cyto_2D_step14.1628.1628.2	1.0036	0.0274	1336.62	36	3500.0%	1	R.RGGHQNNYKPY.-
UMCM6_MOUSE99.6%464.4%821928675.5(P97311) DNA replication licensing factor MCM6 (Mis5 homolog)
*	TK280802_E16_cyto_2D_step08.3404.3404.2	1.6295	0.2454	1596.78	2	4620.0%	1	R.LVFLACHVAPTNPR.F
	TK280802_E16_cyto_2D_step11.3810.3810.2	2.6668	0.6589	1953.15	1	5000.0%	2	R.LTHYDHVLIELTQAGLK.G
	TK280802_E16_cyto_2D_step06.1997.1997.1	0.9529	0.0073	648.66	37	6250.0%	1	R.QFKPK.I
UPDX2_MOUSE99.6%52147645.5%198217795.4(Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA)
	TK280802_E16_cyto_2D_step12.3363.3363.3	1.7818	0.2714	2830.42	16	1880.0%	1	K.LGCEVLGVSVDSQFTHLAWINTPRK.E
	TK280802_E16_cyto_2D_step10.3994.3994.3	2.4209	0.3667	2703.85	1	2500.0%	10	K.LGCEVLGVSVDSQFTHLAWINTPR.K
*	TK280802_E16_cyto_2D_step01.3578.3578.1	1.0128	0.0593	1599.41	10	2670.0%	1	K.SAPDFTATAVVDGAFK.E
	TK280802_E16_cyto_2D_step04.4280.4280.3	1.1249	0.1353	4561.12	1	1120.0%	1	R.SVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSK.E
*	TK280802_E16_cyto_2D_step01.3066.3066.1	1.6184	0.0226	877.21	44	6430.0%	2	R.GLFIIDAK.G
UPSA1_MOUSE99.6%3369519.4%263295476.4(Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain)
	TK280802_E16_cyto_2D_step13.2962.2962.2	1.4587	0.0787	1333.68	84	4000.0%	1	R.FVFDRPLPVSR.L
	TK280802_E16_cyto_2D_step08.2350.2350.2	0.9608	0.0311	1240.08	5	3500.0%	1	K.RAQSELAAHQK.K
	TK280802_E16_cyto_2D_step11.3679.3679.2	1.319	0.1778	2089.17	1	2630.0%	4	K.ILHVDNHIGISIAGLTADAR.L
	TK280802_E16_cyto_2D_step04.2863.2863.1	1.9459	0.0846	954.17	1	5620.0%	26	K.THAVLVALK.R
USUCA_MOUSE99.6%5179.6%333349949.4(Q9WUM5) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, alpha chain) (SCS-alpha)
*	TK280802_E16_cyto_2D_step01.2115.2115.1	1.0143	0.0261	1594.79	40	2500.0%	1	K.GGQKHLGLPVFNTVK.E
*	TK280802_E16_cyto_2D_step12.3287.3287.2	2.9665	0.5246	1683.04	1	5000.0%	4	K.AKPVVSFIAGITAPPGR.R
UO0030199.6%4105.3%711731617.3(O00301) KSRP
*	TK280802_E16_cyto_2D_step06.2178.2178.2	2.5578	0.5718	2110.48	1	4720.0%	3	K.KIGQQPQQPGAPPQQDYTK.A
*	TK280802_E16_cyto_2D_step10.2831.2831.3	1.2562	0.0193	2033.99	341	1940.0%	1	K.QDDGTGPEKIAHIMGPPDR.C
URL30_HUMAN99.6%1010016.7%114126539.6(P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30
	TK280802_E16_cyto_2D_step09.3056.3056.2	1.5893	0.1765	2018.31	1	4170.0%	10	K.TGVHHYSGNNIELGTACGK.Y
URIR1_MOUSE99.6%9655.3%792902196.9(P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain)
	TK280802_E16_cyto_2D_step08.3196.3196.2	2.171	0.4405	1574.33	2	3850.0%	8	R.TRPAANPIQFTLNK.E
	TK280802_E16_cyto_2D_step08.4476.4476.3	1.6357	0.0981	2914.53	19	1570.0%	1	R.ATGSYIAGTNGNSNGLVPMLRVYNNTAR.Y
UQ9CRK799.6%1725716.1%118128626.8(Q9CRK7) 9430095H01Rik protein (Fragment)
	TK280802_E16_cyto_2D_step10.3310.3310.2	2.7744	0.6098	2083.01	1	3890.0%	16	K.TITGFQTHTTPVLLAHGER.A
UQ922Y799.6%253133.2%464510285.3(Q922Y7) Unknown (Protein for MGC:6388)
	TK280802_E16_cyto_2D_step03.3399.3399.2	2.1711	0.4166	1522.57	1	5000.0%	12	R.LLIHQSLAGGIIGVK.G
UIQG1_MOUSE99.6%12225.2%16571887556.5(Q9JKF1) Ras GTPase-activating-like protein IQGAP1
	TK280802_E16_cyto_2D_step13.2626.2626.3	1.3238	0.0739	3191.15	6	1610.0%	1	K.TLQALQIPAAKLEGVLAEVAQHYQDTLIR.A
	TK280802_E16_cyto_2D_step01.1000.1000.1	1.1054	0.208	936.86	22	5000.0%	3	K.QDKMTNAK.N
	TK280802_E16_cyto_2D_step01.2451.2451.1	1.3579	0.0261	1155.27	1	5000.0%	1	K.TLQALQIPAAK.L
*	TK280802_E16_cyto_2D_step09.3620.3620.3	2.8377	0.4853	3522.49	1	2080.0%	1	K.GGYHYYHNLETQAGGWAEPPDFVQNSVQLSR.E
*	TK280802_E16_cyto_2D_step12.2125.2125.2	3.371	0.4891	1541.56	1	7500.0%	1	R.LAYLHSHKDEVVK.I
	TK280802_E16_cyto_2D_step06.2412.2412.1	1.1764	0.0192	589.98	4	6250.0%	2	K.KISLK.Y
*	TK280802_E16_cyto_2D_step12.2083.2083.1	1.1636	0.1122	969.85	15	4290.0%	1	R.LAYLHSHK.D
UQ8VDP499.6%9514.5%9991124725.8(Q8VDP4) Hypothetical 112.5 kDa protein (Fragment)
	TK280802_E16_cyto_2D_step10.3782.3782.3	1.0834	0.0093	3079.51	28	1470.0%	1	K.STKPGAAPTEHKGLVPHNGSLINVGSLLQR.A
*	TK280802_E16_cyto_2D_step11.3362.3362.2	3.3671	0.5123	1502.28	1	7860.0%	7	K.SPAPPLLHVAALGQK.Q
UQ96IX399.6%3516.4%165180127.8(Q96IX3) Peptidylprolyl isomerase A (Cyclophilin A)
*	TK280802_E16_cyto_2D_step09.3612.3612.3	3.3755	0.084	2794.52	1	2500.0%	1	K.HTGPGILSMANAGPITNGSQFFICTAK.T
UA1T1_MOUSE99.6%103611.4%413460035.7(P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT)
	TK280802_E16_cyto_2D_step07.3214.3214.2	1.3357	0.3964	984.46	1	6430.0%	3	R.LAQIHFPR.L
	TK280802_E16_cyto_2D_step07.3779.3779.2	0.6652	0.1109	2203.11	46	1670.0%	5	K.NHYQAEVFSVNFAESEEAK.K
	TK280802_E16_cyto_2D_step12.5093.5093.2	1.3568	0.0765	2006.37	10	2780.0%	1	R.IFNNGADLSGITEENAPLK.L
	TK280802_E16_cyto_2D_step09.3349.3349.2	1.9337	0.4597	2327.04	1	3950.0%	1	K.NHYQAEVFSVNFAESEEAKK.V
UCOF1_MOUSE99.6%1401041251.8%166185608.1(P18760) Cofilin, non-muscle isoform
	TK280802_E16_cyto_2D_step01.2943.2943.1	1.6179	0.398	1184.43	1	5560.0%	2	K.AVLFCLSEDK.K
*	TK280802_E16_cyto_2D_step11.4471.4471.2	2.3579	0.4401	2021.36	1	3750.0%	99	K.KEDLVFIFWAPENAPLK.S
	TK280802_E16_cyto_2D_step01.3263.3263.1	1.2655	0.1568	1343.28	3	2690.0%	4	K.LGGSAVISLEGKPL.-
	TK280802_E16_cyto_2D_step04.2223.2223.1	1.6837	0.1919	660.01	1	7000.0%	6	K.KLTGIK.H
*	TK280802_E16_cyto_2D_step01.3959.3959.2	1.9149	0.1878	3093.65	1	2040.0%	1	K.NIILEEGKEILVGDVGQTVDDPYTTFVK.M
	TK280802_E16_cyto_2D_step01.0896.0896.2	0.851	0.1268	1341.16	5	3000.0%	5	R.YALYDATYETK.E
UTF1B_MOUSE99.6%2415823.7%834888475.8(Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1)
	TK280802_E16_cyto_2D_step04.2554.2554.1	1.0021	0.0134	872.07	18	4290.0%	1	R.KLLASLVK.R
	TK280802_E16_cyto_2D_step01.3187.3187.1	1.7039	0.119	947.98	1	5710.0%	1	K.MAILQIMK.E
*	TK280802_E16_cyto_2D_step08.5080.5080.3	1.343	0.2708	4190.73	3	1100.0%	1	R.LLPCLHSACSACLGPATPAAANNSGDGGSAGDGAMVDCPVCK.Q
*	TK280802_E16_cyto_2D_step08.2564.2564.3	2.8213	0.589	2008.56	1	4470.0%	1	K.IVAERPGTNSTGPGPMAPPR.A
*	TK280802_E16_cyto_2D_step09.3237.3237.3	3.1411	0.4534	3326.94	1	2280.0%	11	K.RPAASSAAAASAAASSPAGGGGEAQELLEHCGVCR.E
*	TK280802_E16_cyto_2D_step14.4235.4235.3	1.3277	0.0055	4339.71	18	1150.0%	1	R.VLLALFCHEPCRPLHQLATDSTFSMEQPGGTLDLTLIR.A
*	TK280802_E16_cyto_2D_step15.4590.4590.3	1.6288	0.1294	4506.03	8	1090.0%	4	K.VFPGSTTEDYNLIVIERGAAAAAAGQAGTVPPGAPGAPPLPGMAIVK.E
UQ9WTQ599.6%15795.1%16841806944.4(Q9WTQ5) SSECKS (PKC binding protein SSECKS)
*	TK280802_E16_cyto_2D_step05.2794.2794.1	1.1139	0.0387	1138.26	1	5000.0%	1	R.EGITPWASFK.K
*	TK280802_E16_cyto_2D_step02.4324.4324.3	1.1209	0.0138	4481.13	40	830.0%	2	K.GQGGAEVEGDVVVEGSGESLPPEKLAETQEVPQEAEPVEELMK.T
*	TK280802_E16_cyto_2D_step01.1976.1976.1	0.9527	0.0222	1570.77	171	2500.0%	3	K.TLVHTVSVAVIDGTR.A
*	TK280802_E16_cyto_2D_step09.1716.1716.3	0.9864	0.0205	1994.39	216	1030.0%	1	R.RVDTSVSWEALICVGSSK.K
URS17_MOUSE99.6%2224.6%134153939.8(P06584) 40S ribosomal protein S17
	TK280802_E16_cyto_2D_step05.0435.0435.1	0.5469	0.0824	1304.54	125	1500.0%	1	R.GISIKLQEEER.E
	TK280802_E16_cyto_2D_step02.3671.3671.2	4.3201	0.6406	2492.97	1	5480.0%	1	R.DNYVPEVSALDQEIIEVDPDTK.E
URL10_MOUSE99.6%177516.4%2132447310.1(P45634) 60S ribosomal protein L10 (QM protein homolog)
	TK280802_E16_cyto_2D_step05.2315.2315.2	2.3213	0.4	1189.89	1	5910.0%	1	R.GAFGKPQGTVAR.V
	TK280802_E16_cyto_2D_step01.0956.0956.1	1.0762	0.0797	745.99	12	7000.0%	1	K.NKPYPK.S
	TK280802_E16_cyto_2D_step07.2967.2967.1	0.8214	0.0818	768.79	1	5000.0%	4	K.KWGFTK.F
	TK280802_E16_cyto_2D_step11.3559.3559.2	2.8626	0.5016	1254.74	1	8000.0%	2	R.VHIGQVIMSIR.T
USBP1_MOUSE99.6%81422.0%472523526.4(P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56)
	TK280802_E16_cyto_2D_step09.2920.2920.2	1.5912	0.0808	1464.13	4	4170.0%	1	K.LHKVIEASEIQAK.C
	TK280802_E16_cyto_2D_step08.3459.3459.2	2.6103	0.5289	1712.55	1	5330.0%	3	K.RIPGGPQMIQLSLDGK.R
*	TK280802_E16_cyto_2D_step10.4129.4129.2	1.61	0.0879	1560.36	2	4170.0%	1	R.FYKNAEGTWSVEK.V
	TK280802_E16_cyto_2D_step07.3472.3472.2	0.883	0.0345	1262.83	292	3000.0%	1	K.LNPNFLVDFGK.E
*	TK280802_E16_cyto_2D_step01.3385.3385.1	1.0039	0.175	1069.22	5	3890.0%	1	K.LILPGLISSR.I
*	TK280802_E16_cyto_2D_step12.4545.4545.3	1.4874	0.0697	4578.3	1	1190.0%	1	R.HEIIQTLQMTDGLIPLEIRFLHDPSATQGFVGCASAPNIQR.F
UTBA1_HUMAN99.6%197865555.2%451501525.1(P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1)
	TK280802_E16_cyto_2D_step03.3311.3311.2	2.3796	0.3795	2751.69	1	3700.0%	2	K.AYHEQLSVAEITNACFEPANQMVK.C
	TK280802_E16_cyto_2D_step08.2876.2876.2	1.9088	0.2535	1876.12	1	4290.0%	1	R.RNLDIERPTYTNLNR.L
	TK280802_E16_cyto_2D_step03.3556.3556.2	1.6772	0.3539	1760.48	1	4000.0%	4	R.IHFPLATYAPVISAEK.A
	TK280802_E16_cyto_2D_step09.3828.3828.2	1.3676	0.2421	1868.38	1	3440.0%	5	R.AVCMLSNTTAIAEAWAR.L
	TK280802_E16_cyto_2D_step10.4174.4174.3	3.8284	0.5714	3395.53	1	2580.0%	6	K.LADQCTGLQGFLVFHSFGGGTGSGFTSLLMER.L
	TK280802_E16_cyto_2D_step01.1950.1950.1	1.5572	0.0346	1019.1	15	5000.0%	28	K.DVNAAIATIK.T
	TK280802_E16_cyto_2D_step01.3393.3393.1	2.0416	0.3183	1586.83	2	3750.0%	2	R.SIQFVDWCPTGFK.V
	TK280802_E16_cyto_2D_step02.4318.4318.2	4.1834	0.5903	1490.84	1	7310.0%	5	R.LISQIVSSITASLR.F
	TK280802_E16_cyto_2D_step03.4554.4554.2	1.7631	0.3181	2412.69	1	2750.0%	2	R.FDGALNVDLTEFQTNLVPYPR.I
	TK280802_E16_cyto_2D_step04.5077.5077.3	4.5408	0.5971	4302.29	1	2090.0%	60	R.ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDK.T
	TK280802_E16_cyto_2D_step01.2678.2678.2	2.1767	0.3927	1827.6	2	3820.0%	1	K.VGINYQPPTVVPGGDLAK.V
	TK280802_E16_cyto_2D_step07.3722.3722.2	4.0086	0.5363	2334.51	1	5260.0%	63	R.AFVHWYVGEGMEEGEFSEAR.E
	TK280802_E16_cyto_2D_step04.2154.2154.1	1.1717	0.0934	777.88	4	5000.0%	13	R.GHYTIGK.E
	TK280802_E16_cyto_2D_step07.1685.1685.1	0.4768	0.0185	509.08	1	3330.0%	4	K.HVPR.A
UQ9Z1R299.6%12369.6%11541210375.7(Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3)
	TK280802_E16_cyto_2D_step13.3605.3605.2	1.1028	0.1405	2928.82	58	1540.0%	1	K.AAGARPLTSPESLSRDLEAPEVQESYR.Q
*	TK280802_E16_cyto_2D_step07.2556.2556.3	3.776	0.574	2820.99	1	2670.0%	3	R.APPQTQLPSGASSGTGSASATHGGAPLPGTR.G
	TK280802_E16_cyto_2D_step13.2772.2772.2	1.7328	0.2077	2217.07	1	3610.0%	1	R.SFFHQHYLGGQEPTPSNIR.M
	TK280802_E16_cyto_2D_step03.3906.3906.3	1.7887	0.1845	3860.11	1	1360.0%	4	R.LLELCNQGLFECLALNLHCLGGQQMELAAVINGR.I
UQ9Z1N599.6%573.0%428490355.7(Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1)
	TK280802_E16_cyto_2D_step13.1997.1997.2	3.2644	0.523	1437.25	1	7080.0%	1	K.KNCPHIVVGTPGR.I
	TK280802_E16_cyto_2D_step05.2530.2530.2	2.3941	0.4578	1309.75	1	5910.0%	2	K.NCPHIVVGTPGR.I
UPDL1_MOUSE99.6%51115.6%326357176.8(O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin)
*	TK280802_E16_cyto_2D_step09.4173.4173.2	1.4448	0.2297	1897.92	4	3750.0%	1	K.QSTSFLVLQEILESDGK.G
*	TK280802_E16_cyto_2D_step04.2523.2523.3	0.9468	0.0818	1441.33	56	1070.0%	1	K.APVTKVAASVGNAQK.L
	TK280802_E16_cyto_2D_step09.3341.3341.2	2.1183	0.3683	2105.53	1	3330.0%	3	K.MNLASEPQEVLHIGSAHNR.S
UANX2_MOUSE99.6%3311.5%338385457.7(P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV)
	TK280802_E16_cyto_2D_step05.3937.3937.2	1.7102	0.276	1543.92	1	5000.0%	1	K.GVDEVTIVNILTNR.S
	TK280802_E16_cyto_2D_step01.4716.4716.1	1.1432	0.0679	960.86	44	3750.0%	1	K.LMVALAKGR.R
	TK280802_E16_cyto_2D_step02.4327.4327.2	5.3119	0.5287	1653.7	1	7000.0%	1	K.SALSGHLETVILGLLK.T
UQ9Z1K199.6%41010.6%396437695.0(Q9Z1K1) HS1 binding protein 3
*	TK280802_E16_cyto_2D_step13.2652.2652.3	1.1426	0.0558	2600.85	179	1140.0%	1	R.TSRQVQNAHTGLDLSVPQHQEVR.G
*	TK280802_E16_cyto_2D_step08.2515.2515.2	2.5869	0.5382	1836.44	1	4440.0%	3	R.KPTLPASVGPSEPGSGPQK.Q
UMAP4_MOUSE99.6%555.8%11251176755.0(P27546) Microtubule-associated protein 4 (MAP 4)
*	TK280802_E16_cyto_2D_step13.1686.1686.2	2.6593	0.517	1653.14	1	5310.0%	1	R.TSPSKPSSAPALKPGPK.T
*	TK280802_E16_cyto_2D_step10.2523.2523.2	0.9001	0.156	1502.43	4	2690.0%	1	K.DMSPLPESEVTLGK.D
*	TK280802_E16_cyto_2D_step13.2102.2102.2	2.8485	0.5589	1579.78	1	5000.0%	1	K.KPMSLASGSVPAAPHK.R
*	TK280802_E16_cyto_2D_step08.3197.3197.2	0.9005	0.0518	1820.96	82	2650.0%	1	R.VKPMSAPSRSSGALSVDK.K
UKPY2_MOUSE99.6%101265944.2%530577567.5(P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40)
	TK280802_E16_cyto_2D_step11.3955.3955.2	2.629	0.5201	1888.02	1	4330.0%	46	R.LNFSHGTHEYHAETIK.N
	TK280802_E16_cyto_2D_step12.3982.3982.2	1.8878	0.0756	1503.16	2	4640.0%	1	R.TGLIKGSGTAEVELK.K
	TK280802_E16_cyto_2D_step07.4390.4390.2	4.2187	0.6585	1863.34	1	6670.0%	8	K.FGVEQDVDMVFASFIR.K
*	TK280802_E16_cyto_2D_step01.1830.1830.1	1.4374	0.0508	1174.06	2	4500.0%	1	R.LDIDSAPITAR.N
	TK280802_E16_cyto_2D_step01.2398.2398.1	2.1102	0.3477	1143.44	1	5000.0%	1	R.GDLGIEIPAEK.V
	TK280802_E16_cyto_2D_step01.2106.2106.1	1.1751	0.1563	1362.18	3	3750.0%	1	R.NTGIICTIGPASR.S
	TK280802_E16_cyto_2D_step07.2609.2609.1	1.2626	0.1638	870.81	2	5830.0%	17	R.MQHLIAR.E
	TK280802_E16_cyto_2D_step11.3962.3962.2	1.1482	0.128	2264.96	31	2250.0%	1	K.GDVVIVLTGWRPGSGFTNTMR.V
	TK280802_E16_cyto_2D_step01.3038.3038.1	1.5866	0.3077	933.03	1	6430.0%	1	R.GIFPVLCK.D
	TK280802_E16_cyto_2D_step01.0130.0130.1	1.6788	0.2401	841.87	1	5710.0%	2	R.APIIAVTR.N
	TK280802_E16_cyto_2D_step02.3846.3846.2	4.197	0.524	2497.89	1	4380.0%	1	R.AEGSDVANAVLDGADCIMLSGETAK.G
	TK280802_E16_cyto_2D_step01.1556.1556.1	1.0519	0.0354	1197.93	1	5000.0%	1	K.ITLDNAYMEK.C
	TK280802_E16_cyto_2D_step01.2787.2787.2	2.9539	0.5728	1767.28	1	5880.0%	1	K.KGVNLPGAAVDLPAVSEK.D
	TK280802_E16_cyto_2D_step04.3898.3898.2	1.5425	0.2729	1935.69	2	3330.0%	13	R.EAEAAIYHLQLFEELR.R
	TK280802_E16_cyto_2D_step05.1513.1513.1	1.0024	0.2258	769.55	13	3330.0%	1	R.SAHQVAR.Y
*	TK280802_E16_cyto_2D_step01.3507.3507.2	1.4124	0.2834	2496.5	11	2270.0%	1	R.EATESFASDPILYRPVAVALDTK.G
*	TK280802_E16_cyto_2D_step01.0175.0175.1	1.0712	0.0909	946.99	1	5620.0%	1	R.VNLAMDVGK.A
UFETA_MOUSE99.6%196438245.0%605673375.9(P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein)
*	TK280802_E16_cyto_2D_step01.3178.3178.1	1.1339	0.0685	1069.87	3	5620.0%	1	K.QELLINLVK.Q
*	TK280802_E16_cyto_2D_step02.4286.4286.3	1.2972	0.2594	3656.16	1	1480.0%	1	K.LPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDR.N
*	TK280802_E16_cyto_2D_step01.2947.2947.2	3.1243	0.5633	1687.4	1	7000.0%	1	R.KAPQLTSAELIDLTGK.M
*	TK280802_E16_cyto_2D_step08.3799.3799.2	1.2809	0.173	1349.41	1	4090.0%	39	R.THPNLPVSVILR.I
*	TK280802_E16_cyto_2D_step12.4099.4099.2	1.9372	0.4115	3086.06	1	2120.0%	12	K.NSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK280802_E16_cyto_2D_step06.4075.4075.2	2.6985	0.6203	1634.83	1	6670.0%	15	K.IMFMASFLHEYSR.T
*	TK280802_E16_cyto_2D_step01.0147.0147.1	1.7526	0.3344	1497.69	1	5000.0%	1	R.DETYAPPPFSEDK.F
*	TK280802_E16_cyto_2D_step14.4000.4000.3	1.0944	0.0030	4414.54	33	990.0%	1	K.IAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDR.N
*	TK280802_E16_cyto_2D_step01.0098.0098.1	1.6822	0.0704	1023.93	4	6430.0%	1	K.TYQEILEK.C
*	TK280802_E16_cyto_2D_step11.3700.3700.2	1.8562	0.252	1167.92	1	6880.0%	2	R.RLCITSFLR.D
*	TK280802_E16_cyto_2D_step01.1606.1606.1	1.5073	0.2354	916.1	2	5830.0%	22	R.FIYEVSR.R
*	TK280802_E16_cyto_2D_step01.2344.2344.1	1.7325	0.3582	1068.72	3	5000.0%	2	K.MTSDVLAAMK.K
*	TK280802_E16_cyto_2D_step07.2580.2580.2	1.7158	0.3589	900.22	1	8330.0%	4	R.HQCLLAR.K
*	TK280802_E16_cyto_2D_step01.3052.3052.1	2.3107	0.5152	1558.78	1	5000.0%	4	K.APQLTSAELIDLTGK.M
*	TK280802_E16_cyto_2D_step01.0107.0107.1	1.5807	0.22	1186.71	1	6670.0%	1	R.NFAQFSSEEK.I
*	TK280802_E16_cyto_2D_step12.4102.4102.2	3.486	0.5251	2684.77	1	3260.0%	3	K.NVLSIATITFTQFVPEATEEEVNK.M
*	TK280802_E16_cyto_2D_step01.3957.3957.2	1.7893	0.4925	2521.75	2	2270.0%	4	K.QKPELTEEQLAAVTADFSGLLEK.C
*	TK280802_E16_cyto_2D_step10.4049.4049.2	2.3756	0.5367	2182.91	1	3610.0%	14	K.WSGCGEGMADIFIGHLCIR.N
*	TK280802_E16_cyto_2D_step01.2895.2895.2	1.8006	0.4387	3027.69	1	2600.0%	1	K.LALDVAHIHEECCQGNSLECLQDGEK.V
U2AAA_HUMAN99.6%122623.1%588650925.1(P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein)
	TK280802_E16_cyto_2D_step09.2397.2397.1	0.8738	0.0718	962.03	6	3750.0%	1	R.EAATSNLKK.L
	TK280802_E16_cyto_2D_step04.5081.5081.3	1.301	0.1905	2754.6	7	2160.0%	1	K.DNTIEHLLPLFLAQLKDECPEVR.L
	TK280802_E16_cyto_2D_step01.1958.1958.1	0.6197	0.021	1427.96	166	1670.0%	1	K.YFAQEALTVLSLA.-
	TK280802_E16_cyto_2D_step12.3211.3211.2	0.6385	0.0030	2217.19	25	1580.0%	4	R.AISHEHSPSDLEAHFVPLVK.R
	TK280802_E16_cyto_2D_step01.4343.4343.1	2.286	0.5152	1560.09	1	5330.0%	2	K.SALASVIMGLSPILGK.D
	TK280802_E16_cyto_2D_step07.3670.3670.2	0.9693	0.1213	1373.81	3	4580.0%	1	K.KLSTIALALGVER.T
	TK280802_E16_cyto_2D_step07.3844.3844.2	0.7947	0.0503	2193.8	2	1320.0%	1	K.IGPILDNSTLQSEVKPILEK.L
	TK280802_E16_cyto_2D_step07.3222.3222.3	1.0284	0.0365	2496.54	4	1790.0%	1	R.LAIIEYMPLLAGQLGVEFFDEK.L
UCALM_HUMAN99.6%61428.4%148167064.2(P02593) Calmodulin (P02593) Calmodulin
	TK280802_E16_cyto_2D_step01.0168.0168.1	1.2736	0.1754	1266.71	3	4090.0%	1	K.DGNGYISAAELR.H
	TK280802_E16_cyto_2D_step01.2891.2891.1	1.9068	0.3202	958.67	2	6430.0%	2	K.EAFSLFDK.D
	TK280802_E16_cyto_2D_step03.3680.3680.2	2.0194	0.509	2494.7	1	2620.0%	3	R.EADIDGDGQVNYEEFVQMMTAK.-
UG3P_MOUSE99.6%105181949.4%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH)
	TK280802_E16_cyto_2D_step05.1651.1651.1	0.5849	0.0217	474.01	4	5000.0%	1	K.KVVK.Q
*	TK280802_E16_cyto_2D_step01.0044.0044.1	2.6987	0.3686	1371.62	1	5000.0%	2	R.GAAQNIIPASTGAAK.A
	TK280802_E16_cyto_2D_step12.3169.3169.2	4.5372	0.5719	2373.71	1	4290.0%	23	K.RVIISAPSADAPMFVMGVNHEK.Y
	TK280802_E16_cyto_2D_step01.3258.3258.2	1.993	0.2883	2214.42	1	3750.0%	1	R.VIISAPSADAPMFVMGVNHEK.Y
*	TK280802_E16_cyto_2D_step02.4234.4234.3	0.9996	0.0332	4054.16	25	1010.0%	16	K.GILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVK.L
*	TK280802_E16_cyto_2D_step05.3826.3826.2	3.9616	0.6492	2295.44	1	5250.0%	24	K.WGEAGAEYVVESTGVFTTMEK.A
	TK280802_E16_cyto_2D_step01.2696.2696.1	1.7036	0.261	1559.04	3	3460.0%	1	R.VPTPNVSVVDLTCR.L
*	TK280802_E16_cyto_2D_step01.3203.3203.2	1.367	0.2879	1630.9	1	4620.0%	1	K.LVINGKPITIFQER.D
	TK280802_E16_cyto_2D_step06.1609.1609.1	0.8532	0.0565	596.82	52	4000.0%	4	K.AGAHLK.G
	TK280802_E16_cyto_2D_step14.4059.4059.2	5.2004	0.6437	2599.48	1	5220.0%	18	K.VIHDNFGIVEGLMTTVHAITATQK.T
*	TK280802_E16_cyto_2D_step08.3601.3601.2	1.6533	0.371	2297.52	1	2890.0%	1	K.LVINGKPITIFQERDPTNIK.W
UO8830699.6%146442.2%173183526.3(O88306) DJ-1
	TK280802_E16_cyto_2D_step04.2015.2015.1	1.8506	0.2881	868.88	1	6430.0%	5	K.VTTHPLAK.D
	TK280802_E16_cyto_2D_step07.5027.5027.2	0.4975	0.0028	2455.21	20	870.0%	1	R.KGLIAAICAGPTALLAHEVGFGCK.V
	TK280802_E16_cyto_2D_step03.1864.1864.1	0.4333	0.0065	875.95	3	2140.0%	1	K.DGLILTSR.G
	TK280802_E16_cyto_2D_step07.4447.4447.2	4.5721	0.6757	1909.14	1	5560.0%	6	R.GPGTSFEFALAIVEALVGK.D
	TK280802_E16_cyto_2D_step01.2159.2159.1	1.0031	0.1861	1597.03	1	4230.0%	1	R.DVMICPDTSLEDAK.T
UPDX1_MOUSE99.6%4746554.8%199221768.1(P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein)
*	TK280802_E16_cyto_2D_step01.1640.1640.1	1.7765	0.2261	1009.1	1	6250.0%	4	K.IGYPAPNFK.A
*	TK280802_E16_cyto_2D_step01.3308.3308.2	2.2672	0.3337	1638.38	1	5330.0%	1	K.QGGLGPMNIPLISDPK.R
	TK280802_E16_cyto_2D_step01.2670.2670.1	1.3386	0.2164	1199.94	1	5560.0%	2	R.LVQAFQFTDK.H
	TK280802_E16_cyto_2D_step01.3054.3054.1	2.3921	0.1697	923.39	4	6430.0%	2	R.GLFIIDDK.G
*	TK280802_E16_cyto_2D_step11.3682.3682.3	2.159	0.2994	2770.81	1	2170.0%	5	K.LNCQVIGASVDSHFCHLAWINTPK.K
*	TK280802_E16_cyto_2D_step01.0118.0118.1	1.5502	0.2897	954.87	1	7140.0%	1	K.DISLSEYK.G
*	TK280802_E16_cyto_2D_step07.3654.3654.2	1.7888	0.2077	1767.51	1	4060.0%	5	K.KQGGLGPMNIPLISDPK.R
	TK280802_E16_cyto_2D_step01.0087.0087.1	1.3322	0.0407	1164.95	6	3500.0%	1	K.ATAVMPDGQFK.D
*	TK280802_E16_cyto_2D_step08.5071.5071.2	4.1649	0.4747	2396.49	1	3810.0%	18	K.HGEVCPAGWKPGSDTIKPDVNK.S
UGFA1_MOUSE99.6%13877.5%680765926.8(P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1)
*	TK280802_E16_cyto_2D_step05.1798.1798.1	0.8454	0.0128	739.46	12	4170.0%	1	K.GSCGLSR.V
*	TK280802_E16_cyto_2D_step10.2534.2534.2	2.7824	0.5308	1830.79	1	4330.0%	9	R.WATHGEPNPVNSHPQR.S
	TK280802_E16_cyto_2D_step11.3234.3234.2	2.2127	0.3408	1069.46	1	6670.0%	2	R.RGSPLLIGVR.S
	TK280802_E16_cyto_2D_step06.3411.3411.2	1.0693	0.2191	1962.04	2	2650.0%	1	R.RLILIACGTSYHAGVATR.Q
UG3P1_HUMAN99.6%61021.6%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12)
*	TK280802_E16_cyto_2D_step01.0044.0044.1	2.6987	0.3686	1371.62	1	5000.0%	2	R.GAAQNLIPASTGAAK.A
*	TK280802_E16_cyto_2D_step01.0090.0090.1	1.4287	0.0711	870.98	10	5000.0%	1	K.VIPELDGK.L
*	TK280802_E16_cyto_2D_step02.4356.4356.2	0.6172	0.0387	2948.91	150	770.0%	1	R.DPENIKWGDAGTAYVVESTGVFTTMEK.A
*	TK280802_E16_cyto_2D_step12.2974.2974.2	1.711	0.1547	2390.28	1	2620.0%	2	K.RIVISAPSADAPMFVMGVNHFK.Y
UHBB1_MOUSE99.6%117217995.9%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major)
	TK280802_E16_cyto_2D_step04.2923.2923.2	1.537	0.3637	1140.36	1	4090.0%	21	K.VVAGVATALAHK.Y
	TK280802_E16_cyto_2D_step01.3142.3142.2	4.1658	0.5935	1758.24	1	7000.0%	1	K.VITAFNDGLNHLDSLK.G
	TK280802_E16_cyto_2D_step01.2430.2430.1	2.3885	0.5203	1466.84	1	5000.0%	6	K.GTFASLSELHCDK.L
	TK280802_E16_cyto_2D_step11.3050.3050.2	3.5825	0.5676	1438.59	1	7690.0%	3	K.VVAGVATALAHKYH.-
*	TK280802_E16_cyto_2D_step01.2168.2168.1	1.6601	0.0462	994.06	3	5000.0%	7	K.AAVSCLWGK.V
	TK280802_E16_cyto_2D_step01.2042.2042.1	3.1838	0.5247	1297.14	1	6360.0%	9	K.DFTPAAQAAFQK.V
	TK280802_E16_cyto_2D_step08.4863.4863.2	1.0854	0.0519	2576.43	2	2380.0%	7	K.GTFASLSELHCDKLHVDPENFR.L
	TK280802_E16_cyto_2D_step01.0074.0074.1	1.7643	0.3077	912.79	1	7140.0%	1	-.VHLTDAEK.A
	TK280802_E16_cyto_2D_step05.3657.3657.2	2.5975	0.5271	1888.99	1	5310.0%	36	K.KVITAFNDGLNHLDSLK.G
	TK280802_E16_cyto_2D_step14.4609.4609.2	0.9816	0.0279	1717.75	29	3000.0%	9	R.LLGNMIVIVLGHHLGK.D
	TK280802_E16_cyto_2D_step02.3580.3580.2	3.9659	0.6589	1983.81	1	5830.0%	3	R.YFDSFGDLSSASAIMGNAK.V
	TK280802_E16_cyto_2D_step01.0020.0020.1	1.5385	0.2752	1304.7	1	7080.0%	2	K.VNSDEVGGEALGR.L
	TK280802_E16_cyto_2D_step01.3337.3337.2	1.9942	0.4258	1276.78	1	6110.0%	1	R.LLVVYPWTQR.Y
UQ6081799.6%116.5%215233844.6(Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein)
	TK280802_E16_cyto_2D_step01.2698.2698.1	2.4698	0.4527	1487.02	1	5380.0%	1	K.SPASDTYIVFGEAK.I
UO5518199.6%71918.6%280318898.4(O55181) RBP associated molecule RAM14-1
*	TK280802_E16_cyto_2D_step01.3810.3810.1	0.9501	0.1678	1558.0	51	3500.0%	1	R.YWHDNCFRCAK.C
*	TK280802_E16_cyto_2D_step10.2923.2923.2	1.7817	0.3046	2071.12	1	3670.0%	1	K.RFVFHNEQVYCPDCAK.K
*	TK280802_E16_cyto_2D_step04.1773.1773.1	0.6818	0.0895	717.55	10	3750.0%	1	R.HCCLK.C
	TK280802_E16_cyto_2D_step06.3210.3210.2	2.8953	0.5485	2418.56	1	4740.0%	4	K.GSSVVAYEGQSWHDYCFHCK.K
UTSN_MOUSE99.6%72115.8%228262016.4(Q62348) Translin
*	TK280802_E16_cyto_2D_step01.3566.3566.2	1.8741	0.339	2197.49	1	3950.0%	2	R.EILTLLQGVHQGTGFQDIPK.R
*	TK280802_E16_cyto_2D_step01.0920.0920.1	1.0453	0.0527	936.76	277	3120.0%	1	K.ETAAACGEK.-
	TK280802_E16_cyto_2D_step05.2412.2412.1	1.5798	0.153	801.34	11	5000.0%	4	K.THLTSLK.T
UARF1_HUMAN99.6%2126342.2%180205666.8(P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1
	TK280802_E16_cyto_2D_step09.3709.3709.2	2.783	0.5042	2157.15	1	4710.0%	16	R.HYFQNTQGLIFVVDSNDR.E
	TK280802_E16_cyto_2D_step07.2903.2903.1	1.0587	0.0302	796.03	3	5000.0%	1	K.LGLHSLR.H
	TK280802_E16_cyto_2D_step01.2843.2843.1	1.4383	0.2842	1089.45	1	5000.0%	1	R.ILMVGLDAAGK.T
	TK280802_E16_cyto_2D_step02.5156.5156.3	1.165	0.0468	3502.51	53	950.0%	1	R.NWYIQATCATSGDGLYEGLDWLSNQLRNQK.-
	TK280802_E16_cyto_2D_step02.3528.3528.1	2.3029	0.3038	1091.93	1	6110.0%	2	R.DAVLLVFANK.Q
UTALI_MOUSE99.6%19357.8%25412698316.1(P26039) Talin
	TK280802_E16_cyto_2D_step04.2287.2287.1	1.1805	0.1074	730.84	3	4170.0%	1	R.KLLSAAK.I
	TK280802_E16_cyto_2D_step10.2425.2425.2	1.7243	0.2351	1013.46	1	7140.0%	1	K.KLEQLKPR.A
	TK280802_E16_cyto_2D_step05.2148.2148.1	1.2937	0.0056	717.22	90	5000.0%	1	R.ALHYGR.E
	TK280802_E16_cyto_2D_step07.4827.4827.2	0.9083	0.0192	3055.45	8	1540.0%	1	R.DPVQLNLLYVQARDDILNGSHPVSFDK.A
	TK280802_E16_cyto_2D_step01.3374.3374.1	1.3938	0.0891	1459.01	37	3080.0%	1	R.ILAQATSDLVNAIK.A
	TK280802_E16_cyto_2D_step07.0465.0465.1	0.4267	0.0098	433.67	2	2500.0%	2	K.AWR.K
	TK280802_E16_cyto_2D_step08.3072.3072.2	3.5245	0.5083	1338.64	1	7500.0%	2	K.VSHVLAALQAGNR.G
	TK280802_E16_cyto_2D_step06.4868.4868.3	1.0908	0.0773	4136.49	54	810.0%	1	K.AVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVK.A
	TK280802_E16_cyto_2D_step01.3937.3937.1	1.1954	0.208	1524.23	1	3850.0%	1	K.TLAESALQLLYTAK.E
	TK280802_E16_cyto_2D_step01.0823.0823.2	1.4311	0.3025	1142.75	9	3330.0%	1	R.ALEATTEHIR.Q
	TK280802_E16_cyto_2D_step02.4350.4350.2	1.2899	0.2894	3054.65	2	2240.0%	1	K.GTEWVDPEDPTVIAENELLGAAAAIEAAAK.K
	TK280802_E16_cyto_2D_step05.4934.4934.1	0.6071	0.0576	1243.83	66	1670.0%	1	K.FLPSELRDEH.-
	TK280802_E16_cyto_2D_step09.3033.3033.2	1.0941	0.0020	1404.06	56	2310.0%	1	K.GISMSSSKLLLAAK.A
UQ91VW399.6%2435.5%93104775.1(Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3
*	TK280802_E16_cyto_2D_step10.4195.4195.3	4.5842	0.6214	3829.96	1	2730.0%	2	K.ATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLK.L
UQ9CSN899.6%4108.7%369422218.5(Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment)
	TK280802_E16_cyto_2D_step12.2599.2599.2	1.758	0.3628	1796.76	2	3930.0%	3	K.LITQTFNHHNQLAQK.A
	TK280802_E16_cyto_2D_step03.3832.3832.3	1.7634	0.2611	1828.88	6	2190.0%	1	K.GKLKPNLGNGADLPNYR.W
UQ9R0C499.6%6182.8%18212020094.3(Q9R0C4) Intermediate filament protein nestin
*	TK280802_E16_cyto_2D_step11.3248.3248.3	1.2662	0.0592	2732.16	94	1520.0%	1	R.AVEDEQMTVNPPEKVDPELPKPLR.N
*	TK280802_E16_cyto_2D_step10.3097.3097.2	2.5103	0.5182	1699.04	1	4690.0%	4	K.APLVGSPVHLGPSQPLK.F
*	TK280802_E16_cyto_2D_step14.1648.1648.2	0.9623	0.1032	1241.49	23	4440.0%	1	K.LEQETQQPLR.A
UIF41_HUMAN99.6%2520728.1%406461545.5(P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I)
	TK280802_E16_cyto_2D_step05.2254.2254.1	1.3156	0.1074	763.81	79	6000.0%	1	R.RYLSPK.Y
	TK280802_E16_cyto_2D_step11.4311.4311.3	1.7031	0.1738	4170.2	1	1600.0%	1	R.SRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLR.G
	TK280802_E16_cyto_2D_step04.3653.3653.2	2.8498	0.5931	2146.49	1	4440.0%	9	R.GIDVQQVSLVINYDLPTNR.E
	TK280802_E16_cyto_2D_step01.3146.3146.1	1.1959	0.1602	1115.23	113	3890.0%	1	R.VLITTDLLAR.G
	TK280802_E16_cyto_2D_step01.0186.0186.1	1.3552	0.1493	1141.9	1	5500.0%	1	K.ATQALVLAPTR.E
	TK280802_E16_cyto_2D_step08.4363.4363.2	2.0271	0.3305	1907.22	1	4690.0%	11	K.TATFAISILQQIELDLK.A
	TK280802_E16_cyto_2D_step01.2046.2046.1	1.0799	0.1956	1584.68	16	2310.0%	1	R.DFTVSAMHGDMDQK.E
UA2HS_MOUSE99.6%177331.6%345373266.5(P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin)
*	TK280802_E16_cyto_2D_step06.2346.2346.2	1.3258	0.0845	1971.19	3	3750.0%	2	R.VMHTQCHSTPDSAEDVR.K
*	TK280802_E16_cyto_2D_step06.2118.2118.1	0.7881	0.2786	776.7	1	6000.0%	1	K.QHGFCK.A
*	TK280802_E16_cyto_2D_step06.3735.3735.3	1.1824	0.2374	4032.61	3	1250.0%	1	K.LFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPR.G
*	TK280802_E16_cyto_2D_step06.4415.4415.3	3.0207	0.5311	2547.42	1	2610.0%	3	R.AQNVPLPVSTLVEFVIAATDCTAK.E
*	TK280802_E16_cyto_2D_step06.5124.5124.2	0.9709	0.0827	2141.43	3	2250.0%	3	R.HAFSPVASVESASGETLHSPK.V
UAPA4_MOUSE99.6%337.3%395450295.6(P06728) Apolipoprotein A-IV precursor (Apo-AIV)
	TK280802_E16_cyto_2D_step06.0596.0596.1	0.7517	0.0	646.65	3	3750.0%	1	K.EEIKK.E
*	TK280802_E16_cyto_2D_step08.1976.1976.1	1.1228	0.2236	678.81	6	6000.0%	1	K.GHLTPR.A
*	TK280802_E16_cyto_2D_step02.4095.4095.2	2.8569	0.5892	2024.73	1	6180.0%	1	K.LVPFVVQLSGHLAKETER.V
ULDHA_MOUSE99.6%2916332.0%331363677.7(P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M)
*	TK280802_E16_cyto_2D_step08.3681.3681.2	2.0068	0.2983	1850.25	1	4670.0%	1	K.LKGEMMDLQHGSLFLK.T
*	TK280802_E16_cyto_2D_step13.2473.2473.2	1.6984	0.3178	1184.13	3	5000.0%	3	R.RVHPISTMIK.G
	TK280802_E16_cyto_2D_step01.0322.0322.1	1.8023	0.0353	736.49	1	8000.0%	9	R.NVNIFK.F
*	TK280802_E16_cyto_2D_step07.2964.2964.1	1.1058	0.0639	1025.83	17	3750.0%	2	R.VHPISTMIK.G
	TK280802_E16_cyto_2D_step04.4233.4233.2	3.3881	0.5908	2115.09	1	5260.0%	4	K.GYTSWAIGLSVADLAESIMK.N
	TK280802_E16_cyto_2D_step01.2376.2376.1	1.6444	0.2361	1120.26	2	4440.0%	1	K.SADTLWGIQK.E
*	TK280802_E16_cyto_2D_step01.3302.3302.1	2.3692	0.3146	1057.93	1	6880.0%	1	K.DQLIVNLLK.E
*	TK280802_E16_cyto_2D_step15.4275.4275.3	3.7118	0.4593	3615.52	1	2210.0%	7	R.LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK.S
UQ9QYB199.6%119.5%253287295.6(Q9QYB1) Intracellular chloride channel protein
	TK280802_E16_cyto_2D_step13.3217.3217.2	3.4944	0.5986	2624.45	1	4570.0%	1	R.KPADLQNLAPGTHPPFITFNSEVK.T
UMY9B_HUMAN99.6%665.7%21582435558.7(Q13459) Myosin IXb (Unconventional myosin-9b)
*	TK280802_E16_cyto_2D_step08.5133.5133.3	1.1677	0.0754	3241.72	5	1380.0%	1	K.VSEETEKTLPSGSPRPGQLERPTSLALDSR.V
*	TK280802_E16_cyto_2D_step01.1140.1140.1	0.8793	0.0164	1185.99	72	2220.0%	1	R.KSFSQMISEK.Q
*	TK280802_E16_cyto_2D_step14.3779.3779.2	0.8083	0.0986	2974.11	40	1400.0%	1	R.GLLPRQQADFDDLCNLPELTEGNLLK.N
*	TK280802_E16_cyto_2D_step08.4568.4568.2	0.8938	0.0825	2761.3	1	1520.0%	1	K.ESGGEEWVLDANDSPVHRVLLWPR.R
	TK280802_E16_cyto_2D_step14.2697.2697.2	0.6779	0.1745	2480.95	2	870.0%	1	K.GYASGVERTILGACPVLEAFGNAK.T
*	TK280802_E16_cyto_2D_step01.2724.2724.1	2.73	0.1813	1157.07	2	6880.0%	1	K.YLDEFLLNK.I
UILK1_HUMAN99.6%244.4%452514198.1(Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK)
	TK280802_E16_cyto_2D_step13.3105.3105.2	1.5494	0.33	2142.08	1	2890.0%	2	K.VALEGLRPTIPPGISPHVCK.L
UQ99KQ299.6%166220.1%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment)
	TK280802_E16_cyto_2D_step08.3456.3456.2	2.989	0.5797	2203.45	1	3680.0%	4	R.LVSNHSLHETSSVFVDSLTK.V
	TK280802_E16_cyto_2D_step07.3540.3540.3	1.3948	0.0965	2508.21	46	1700.0%	1	K.AGNNMLLVGVHGPRTPCEEILVK.H
	TK280802_E16_cyto_2D_step11.3039.3039.2	1.8206	0.0010	1827.4	1	5000.0%	2	R.RAPSVANIGSHCDLSLK.I
	TK280802_E16_cyto_2D_step13.3241.3241.2	2.3589	0.3849	2306.75	2	3180.0%	2	K.GQHVPGSPFQFTVGPLGEGGAHK.V
	TK280802_E16_cyto_2D_step05.3126.3126.2	1.7163	0.3834	1437.44	2	3460.0%	6	K.AGNNMLLVGVHGPR.T
*	TK280802_E16_cyto_2D_step14.2155.2155.2	1.2854	0.0128	2303.4	18	2110.0%	1	K.GEYTLVVKWGDEHIPGSPYR.I
UPSB3_MOUSE99.6%106817.6%205229656.5(Q9R1P1) Proteasome subunit beta type 3 (EC 3.4.25.1) (Proteasome theta chain) (Proteasome chain 13) (Proteasome component C10-II)
*	TK280802_E16_cyto_2D_step05.3645.3645.2	1.8341	0.2969	1556.89	2	4640.0%	8	R.DAVSGMGVIVHVIEK.D
	TK280802_E16_cyto_2D_step15.4669.4669.3	1.8272	0.0193	2486.45	22	2000.0%	2	K.EGRQIKPYTLMSMVANLLYEK.R
UFSC1_HUMAN99.6%135522.0%492543997.2(Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55)
	TK280802_E16_cyto_2D_step12.3031.3031.2	2.0247	0.2978	1243.49	1	5560.0%	7	K.LINRPIIVFR.G
	TK280802_E16_cyto_2D_step02.4522.4522.3	1.6414	0.0145	3832.75	18	1360.0%	1	K.DSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNK.V
	TK280802_E16_cyto_2D_step06.2736.2736.3	1.3645	0.0045	2056.24	53	2210.0%	1	R.EVPGPDCRFLIVAHDDGR.W
	TK280802_E16_cyto_2D_step13.2457.2457.2	0.8993	0.0042	2282.64	9	1670.0%	1	R.THTGKYWTLTATGGVQSTASSK.N
	TK280802_E16_cyto_2D_step05.3865.3865.3	1.6342	0.1218	2678.94	1	2500.0%	1	K.VGKDELFALEQSCAQVVLQAANER.N
UPRSX_HUMAN99.6%81612.6%389441737.5(Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44)
	TK280802_E16_cyto_2D_step01.3714.3714.1	1.2587	0.0302	1442.08	11	3460.0%	1	K.ALQSVGQIVGEVLK.Q
	TK280802_E16_cyto_2D_step08.0424.0424.1	0.5253	0.0299	417.04	2	5000.0%	1	K.ELR.E
	TK280802_E16_cyto_2D_step11.2950.2950.2	2.2465	0.4219	1436.13	1	5450.0%	2	R.KIHIDLPNEQAR.L
	TK280802_E16_cyto_2D_step08.2332.2332.1	1.2505	0.283	838.83	17	4290.0%	3	K.IHAGPITK.H
	TK280802_E16_cyto_2D_step01.2599.2599.1	1.1103	0.1431	1367.47	3	4090.0%	1	R.AVASQLDCNFLK.V
UQ8R01699.6%208418.7%455525116.5(Q8R016) Similar to bleomycin hydrolase
*	TK280802_E16_cyto_2D_step09.3477.3477.3	1.7127	0.1919	2108.67	62	2340.0%	1	K.VERCYFFLNAFVDTAQK.K
*	TK280802_E16_cyto_2D_step14.2431.2431.3	3.9433	0.5612	2731.44	1	3020.0%	4	R.ATVQGAQHVFQHVVPQEGKPVTNQK.S
*	TK280802_E16_cyto_2D_step01.3268.3268.1	0.881	0.0144	1277.22	58	2500.0%	1	K.IGPITPLQFYK.E
*	TK280802_E16_cyto_2D_step06.3987.3987.2	1.5688	0.3266	2174.05	1	3160.0%	5	R.LAFGESLMTHAMTFTAVSEK.D
*	TK280802_E16_cyto_2D_step09.2896.2896.2	1.7117	0.2919	1514.57	3	5000.0%	4	K.ICFVNDPRPQHK.Y
UPUR2_MOUSE99.6%9179.2%10101073376.8(Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)]
*	TK280802_E16_cyto_2D_step12.2546.2546.1	2.5204	0.4286	1285.82	1	5910.0%	3	K.SSSHIVLVISNK.A
*	TK280802_E16_cyto_2D_step06.2619.2619.1	1.1413	0.0598	654.87	3	6250.0%	2	K.IHWAK.E
	TK280802_E16_cyto_2D_step03.0706.0706.1	0.4903	0.0345	1245.03	5	1540.0%	1	K.ASGLAAGKGVIVAK.S
*	TK280802_E16_cyto_2D_step01.3954.3954.2	1.4933	0.2358	2556.31	3	2080.0%	1	K.GVEITGFPEAQALGLQVFHAGTALK.D
	TK280802_E16_cyto_2D_step05.2363.2363.1	1.1915	0.051	798.05	5	4170.0%	1	K.KIQPLAK.A
*	TK280802_E16_cyto_2D_step04.3789.3789.3	0.953	0.0577	3257.65	4	1640.0%	1	K.NTILQRAVDGMQQEGAPYTGILYAGIMLTK.D
UQ9NPL899.6%1825824.6%285321938.2(Q9NPL8) C3orf1 hypothetical protein
	TK280802_E16_cyto_2D_step12.5019.5019.3	2.8483	0.0517	3010.36	2	1920.0%	16	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
	TK280802_E16_cyto_2D_step12.2710.2710.2	1.0112	0.0185	1703.1	8	3210.0%	1	K.IESSLQEDEPENDAK.K
	TK280802_E16_cyto_2D_step13.4242.4242.2	0.8908	0.0077	2917.6	20	1520.0%	1	K.QQYIEQSQAEIYHNRFDAVQSAHR.A
URL24_HUMAN99.6%123426.8%1571777911.3(P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30)
	TK280802_E16_cyto_2D_step05.2071.2071.1	1.2223	0.078	684.06	1	8000.0%	4	K.IVKPVK.V
	TK280802_E16_cyto_2D_step11.2065.2065.2	1.2802	0.067	1028.42	8	6430.0%	2	K.RNQKPEVR.K
	TK280802_E16_cyto_2D_step01.2864.2864.1	2.0583	0.3478	967.41	1	7140.0%	1	K.VFQFLNAK.C
	TK280802_E16_cyto_2D_step06.2050.2050.1	1.1799	0.0141	801.7	27	4170.0%	2	K.IYPGHGR.R
	TK280802_E16_cyto_2D_step01.3003.3003.1	2.8334	0.3634	1264.84	1	5830.0%	3	R.AITGASLADIMAK.R
UMPK2_MOUSE99.6%118.7%401444367.0(Q63932) Dual specificity mitogen-activated protein kinase kinase 2 (EC 2.7.1.-) (MAP kinase kinase 2) (MAPKK 2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK2)
	TK280802_E16_cyto_2D_step13.3266.3266.3	4.3749	0.2328	3618.2	1	2210.0%	1	R.RKPVLPALTINPTIAEGPSPTSEGASEANLVDLQK.K
UELV1_MOUSE99.6%353.4%326360699.2(P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG)
	TK280802_E16_cyto_2D_step13.1697.1697.1	2.409	0.4875	1235.76	1	5500.0%	2	R.FGGPVHHQAQR.F
UQ921R299.6%138120.7%1401614210.7(Q921R2) Similar to ribosomal protein S13
	TK280802_E16_cyto_2D_step10.3277.3277.2	3.1586	0.4935	1384.9	1	7500.0%	8	K.KGLTPSQIGVILR.D
	TK280802_E16_cyto_2D_step08.1759.1759.1	1.0381	0.0967	641.22	11	5000.0%	4	R.MHAPGK.G
	TK280802_E16_cyto_2D_step01.0123.0123.1	1.107	0.2155	1091.91	7	4440.0%	1	K.GLSQSALPYR.R
UQ9D1P499.6%51114.5%331373517.9(Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene)
	TK280802_E16_cyto_2D_step12.2221.2221.2	1.0825	0.0076	1907.46	21	2500.0%	1	R.TTDFSDFLSIVGCTKGR.H
	TK280802_E16_cyto_2D_step09.3154.3154.2	3.1606	0.4737	1848.89	1	5670.0%	3	K.FQEHIIQAPKPVEAIK.R
	TK280802_E16_cyto_2D_step11.2502.2502.2	1.5966	0.2361	1716.03	1	5000.0%	1	R.HNSEKPPEPVKPEVK.T
UIF32_MOUSE99.5%3311.1%325364615.6(Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1)
	TK280802_E16_cyto_2D_step04.1816.1816.1	0.6631	0.021	1088.66	32	1880.0%	1	R.QINDIQLSR.D
	TK280802_E16_cyto_2D_step13.2485.2485.2	1.5225	0.2268	1324.34	4	5500.0%	1	-.MKPILLQGHER.S
	TK280802_E16_cyto_2D_step12.2803.2803.2	3.1955	0.4154	1680.77	1	5670.0%	1	K.GHFGPINSVAFHPDGK.S
UADHA_MOUSE99.5%63178146.3%374396408.1(P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2)
*	TK280802_E16_cyto_2D_step03.4608.4608.2	1.1763	0.132	2847.54	19	1550.0%	1	K.VTPGSTCAVFGLGGVGLSVIIGCKAAGAAR.I
	TK280802_E16_cyto_2D_step01.2515.2515.1	1.3848	0.1284	895.21	5	5710.0%	1	K.LVADFMAK.K
*	TK280802_E16_cyto_2D_step01.0199.0199.1	1.252	0.0354	832.96	7	6670.0%	1	R.SDLLMPR.G
	TK280802_E16_cyto_2D_step01.2650.2650.1	1.4412	0.1727	799.36	5	5710.0%	2	K.GAIFGGFK.S
*	TK280802_E16_cyto_2D_step06.4261.4261.2	1.1433	0.0529	2352.26	2	1960.0%	1	K.VTPGSTCAVFGLGGVGLSVIIGCK.A
	TK280802_E16_cyto_2D_step01.0320.0320.1	1.7947	0.1434	887.82	2	6430.0%	8	R.IIAVDINK.D
*	TK280802_E16_cyto_2D_step04.1924.1924.1	0.9754	0.0137	1134.47	11	2500.0%	1	K.HPESNFCSR.S
*	TK280802_E16_cyto_2D_step01.5205.5205.2	1.458	0.3211	2505.73	1	2140.0%	1	K.AAVLWELHKPFTIEDIEVAPPK.A
*	TK280802_E16_cyto_2D_step09.5061.5061.2	2.7829	0.3396	1897.99	1	6000.0%	41	K.KFPLDPLITHVLPFEK.I
*	TK280802_E16_cyto_2D_step01.3822.3822.3	2.9564	0.537	4088.5	1	1690.0%	1	R.SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK.V
*	TK280802_E16_cyto_2D_step06.3831.3831.2	1.6995	0.2567	2686.5	2	2390.0%	5	K.QIHNFISTSTFSQYTVVDDIAVAK.I
UQ99PC399.4%394.1%3924659810.0(Q99PC3) CGI-74-like SR-rich protein
	TK280802_E16_cyto_2D_step10.2907.2907.2	2.076	0.4046	1869.07	1	4670.0%	3	K.SHLLNCCPHDVLSGTR.M
URS30_HUMAN99.4%3528.8%59664812.1(Q05472) 40S ribosomal protein S30 (Q05472) 40S ribosomal protein S30
	TK280802_E16_cyto_2D_step01.2848.2848.1	1.9192	0.3831	1109.06	1	7220.0%	2	R.FVNVVPTFGK.K
	TK280802_E16_cyto_2D_step06.1981.1981.1	1.3948	0.3171	739.78	1	5830.0%	1	K.VHGSLAR.A
UFSC1_MOUSE99.4%112.0%492542746.7(Q61553) Fascin (Singed-like protein)
	TK280802_E16_cyto_2D_step01.3115.3115.1	2.1201	0.4159	1149.17	1	6110.0%	1	K.YLTAEAFGFK.V
UO3549999.4%113712.7%773839544.4(O35499) Nuclear autoantigenic sperm protein
	TK280802_E16_cyto_2D_step08.4295.4295.3	2.9721	0.5507	3987.76	1	1890.0%	5	K.LGEVSVESENYIQAVEEFQACLSLQEQYLEAHDR.L
	TK280802_E16_cyto_2D_step08.3741.3741.3	1.3983	0.0827	3154.04	3	1480.0%	1	R.LLAETHYQLGLAYGYNSQYDEAVAQFGK.S
	TK280802_E16_cyto_2D_step02.4335.4335.2	2.959	0.5313	2792.46	1	3910.0%	1	K.SLQENEEEEIGNLELAWDMLDLAK.I
	TK280802_E16_cyto_2D_step06.1647.1647.1	0.2969	0.0225	436.86	8	3330.0%	1	K.STAC.-
	TK280802_E16_cyto_2D_step06.2934.2934.1	1.6211	0.1881	858.93	1	4290.0%	3	K.KLLGLGQK.H
UFBL1_MOUSE99.4%4162.4%705780575.2(Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90)
*	TK280802_E16_cyto_2D_step10.3470.3470.2	2.6565	0.5135	1907.48	1	4690.0%	4	R.DPVHTVSHTVISLPTFR.E
UO8817999.4%10344.9%550605155.4(O88179) Guanine nucleotide regulatory protein (Fragment)
	TK280802_E16_cyto_2D_step08.3241.3241.1	2.103	0.2622	950.82	11	6430.0%	4	K.HLIVLINK.M
	TK280802_E16_cyto_2D_step06.2379.2379.1	1.1414	0.0965	789.85	133	5000.0%	3	K.KVGFNPK.K
	TK280802_E16_cyto_2D_step10.3167.3167.2	2.9723	0.5142	1415.06	1	7270.0%	3	R.TFDAQIVIIEHK.S
UQ9CSH099.4%4105.1%588633916.9(Q9CSH0) 2810036L13Rik protein (Fragment)
	TK280802_E16_cyto_2D_step11.3324.3324.2	2.1998	0.455	1706.5	1	5670.0%	3	R.HDGYGSHGPLLPLPSR.Y
	TK280802_E16_cyto_2D_step06.2443.2443.2	1.4781	0.0614	1425.21	2	5380.0%	1	R.SMPLSTEGGGSHHK.V
UPMG1_MOUSE99.4%114528.1%253287017.2(Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1)
	TK280802_E16_cyto_2D_step03.4603.4603.2	1.2621	0.2193	3026.7	5	1350.0%	2	K.HLEGLSEEAIMELNLPTGIPIVYELDK.N
	TK280802_E16_cyto_2D_step06.2747.2747.1	1.2269	0.0796	1150.75	2	5000.0%	1	R.VLIAAHGNSLR.G
	TK280802_E16_cyto_2D_step02.3576.3576.2	1.6693	0.3247	1783.79	1	3930.0%	2	R.DAGYEFDICFTSVQK.R
	TK280802_E16_cyto_2D_step11.3487.3487.2	2.0265	0.4994	2117.39	1	4120.0%	6	K.NLKPIKPMQFLGDEETVR.K
UQ9CXT499.4%71915.5%200231614.4(Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence
*	TK280802_E16_cyto_2D_step05.1973.1973.1	0.9817	0.0818	688.64	6	6000.0%	1	K.QQKGVK.E
	TK280802_E16_cyto_2D_step01.2272.2272.1	2.1389	0.2089	1017.71	2	6250.0%	1	K.DLSTIEPLK.K
	TK280802_E16_cyto_2D_step05.2340.2340.1	2.4236	0.3798	884.76	1	8570.0%	4	K.HLNLSGNK.I
	TK280802_E16_cyto_2D_step01.0067.0067.1	1.3745	0.2294	991.82	5	5710.0%	1	K.ELVLDNCK.S
UQ9UEV999.4%885.8%26022781905.7(Q9UEV9) Actin-binding protein homolog ABP-278
	TK280802_E16_cyto_2D_step13.3138.3138.2	2.2589	0.5372	2309.44	1	3860.0%	1	R.GQHVTGSPFQFTVGPLGEGGAHK.V
	TK280802_E16_cyto_2D_step08.3368.3368.2	0.9045	0.023	2194.61	2	2140.0%	1	K.AHGPGLEGGLVGKPAEFTIDTK.G
	TK280802_E16_cyto_2D_step08.5101.5101.2	1.1459	0.1058	2552.29	65	1520.0%	1	K.NGNHVANSPVSIMVVQSEIGDARR.A
	TK280802_E16_cyto_2D_step12.4266.4266.3	1.4928	0.1847	4594.08	7	1150.0%	1	R.EAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPK.A
	TK280802_E16_cyto_2D_step11.2744.2744.3	1.3082	0.0129	2229.66	52	1910.0%	1	K.IEYNDQNDGSCDVKYWPK.E
	TK280802_E16_cyto_2D_step13.1856.1856.2	1.0795	0.177	1049.76	1	5560.0%	1	K.LKPGAPLKPK.L
	TK280802_E16_cyto_2D_step01.3174.3174.1	1.0014	0.0135	1503.76	7	3210.0%	1	K.SPFTVGVAAPLDLSK.I
UQ91VC399.4%243.6%411468406.7(Q91VC3) Unknown (Protein for MGC:6715) (Hypothetical 46.8 kDa protein)
	TK280802_E16_cyto_2D_step08.2627.2627.2	2.9389	0.4864	1599.51	1	5000.0%	2	R.KLDYGQHVVAGTPGR.V
UDPY2_MOUSE99.4%155318.4%572621716.4(O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein)
	TK280802_E16_cyto_2D_step01.2636.2636.1	0.9789	0.1736	1296.32	4	3180.0%	1	R.MVIPGGIDVHTR.F
*	TK280802_E16_cyto_2D_step05.4255.4255.2	1.9772	0.4088	2185.2	1	4410.0%	4	K.DRFQLTDSQIYEVLSVIR.D
*	TK280802_E16_cyto_2D_step02.3654.3654.2	1.5829	0.3637	1918.44	1	2940.0%	1	R.ISVGSDADLVIWDPDSVK.T
*	TK280802_E16_cyto_2D_step07.3350.3350.2	1.5827	0.2225	2052.38	1	4000.0%	5	K.SCCDYSLHVDITEWHK.G
	TK280802_E16_cyto_2D_step02.4320.4320.2	1.6417	0.1657	3140.24	1	2240.0%	3	K.AALAGGTTMIIDHVVPEPGTSLLAAFDQWR.E
	TK280802_E16_cyto_2D_step01.2100.2100.1	1.8553	0.3966	1087.37	1	4500.0%	1	R.GSPLVVISQGK.I
UO3573799.4%102022.7%449491996.3(O35737) Heterogeneous nuclear ribonucleoprotein H
	TK280802_E16_cyto_2D_step07.1996.1996.2	1.1721	0.0446	1016.73	1	5710.0%	3	R.THYDPPRK.L
	TK280802_E16_cyto_2D_step01.2716.2716.1	1.6216	0.1232	814.21	1	8000.0%	1	R.YIEIFK.S
	TK280802_E16_cyto_2D_step06.2642.2642.2	1.7397	0.2964	2098.98	1	3330.0%	2	R.YGDGGSTFQSTTGHCVHMR.G
	TK280802_E16_cyto_2D_step03.4164.4164.2	1.3237	0.2782	2908.88	4	2000.0%	1	K.EEIVQFFSGLEIVPNGITLPVDFQGR.S
	TK280802_E16_cyto_2D_step02.3548.3548.2	2.695	0.5247	1844.08	1	5310.0%	2	R.STGEAFVQFASQEIAEK.A
	TK280802_E16_cyto_2D_step06.5088.5088.3	1.5281	0.152	2882.21	1	2100.0%	1	K.ANMQHRYVELFLNSTAGASGGAYEHR.Y
UFUMH_MOUSE99.4%465.3%507543719.0(P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3)
*	TK280802_E16_cyto_2D_step08.1673.1673.2	0.5536	0.0996	1703.24	54	1330.0%	1	K.VLLPGLQKLHDALSAK.S
*	TK280802_E16_cyto_2D_step13.1238.1238.2	1.234	0.2516	1287.87	1	5000.0%	1	K.KPVHPNDHVNK.S
URL26_HUMAN99.4%81621.4%1451725810.6(Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26
	TK280802_E16_cyto_2D_step06.2523.2523.2	1.7045	0.0345	1419.92	5	4230.0%	3	K.ANGTTVHVGIHPSK.V
	TK280802_E16_cyto_2D_step10.2927.2927.1	1.5279	0.2144	1083.7	6	5000.0%	1	K.KYVIYIER.V
	TK280802_E16_cyto_2D_step13.1906.1906.2	2.1022	0.2649	1080.45	1	6880.0%	1	R.HFNAPSHIR.R
UQ91X9499.4%51110.5%257292839.3(Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD)
	TK280802_E16_cyto_2D_step13.1714.1714.1	2.1059	0.419	1046.89	1	5620.0%	1	K.KYHNVGLSK.C
	TK280802_E16_cyto_2D_step01.0171.0171.1	1.6395	0.236	1168.97	1	6670.0%	3	K.FGEVVDCTLK.L
	TK280802_E16_cyto_2D_step01.3341.3341.1	1.1399	0.1026	1020.97	2	6430.0%	1	R.GFCFITFK.E
UQ9JHU999.4%4412.4%557609326.4(Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1)
*	TK280802_E16_cyto_2D_step13.2472.2472.2	2.7224	0.5234	2321.5	1	4520.0%	1	K.MERPGPGIKPGEVVATSPLPCK.K
	TK280802_E16_cyto_2D_step08.2080.2080.2	1.385	0.0237	1182.71	91	4440.0%	1	K.YVPYVGDSKR.A
*	TK280802_E16_cyto_2D_step11.3403.3403.3	1.4683	0.219	2990.87	28	1350.0%	1	K.TMSIVSYNHLGNNDGQNLSAPLQFRSK.E
*	TK280802_E16_cyto_2D_step13.2402.2402.1	0.7948	0.2299	1111.76	2	3890.0%	1	R.EGGVLRVQPR.A
UQ9CQ6099.4%71917.1%257272545.8(Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene)
*	TK280802_E16_cyto_2D_step04.4248.4248.2	1.1257	0.2245	2345.48	1	2500.0%	1	R.VTLTLPVLNAAQSIIFVATGEGK.A
	TK280802_E16_cyto_2D_step05.2511.2511.2	1.2752	0.3084	1605.75	7	3210.0%	3	K.IVAPISDSPKPPPQR.V
*	TK280802_E16_cyto_2D_step05.2338.2338.1	1.0593	0.0418	700.91	10	6000.0%	3	R.THLLSK.L
UQ8VDM499.4%5115.0%9081002035.2(Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2)
	TK280802_E16_cyto_2D_step08.0375.0375.3	1.4845	0.0534	2438.1	20	2140.0%	1	R.LAQGLTHLGKGTLTLCPYHSDR.Q
	TK280802_E16_cyto_2D_step07.3232.3232.2	2.3742	0.5312	1843.15	1	5710.0%	3	K.VQQLLHICSEHFDSK.E
	TK280802_E16_cyto_2D_step13.2169.2169.2	1.6923	0.2307	1019.23	1	6430.0%	1	K.FLRPHYGK.L
UCNBP_MOUSE99.4%72912.4%170187427.7(P53996) Cellular nucleic acid binding protein (CNBP)
	TK280802_E16_cyto_2D_step08.2364.2364.2	2.5233	0.5276	1850.83	1	4640.0%	2	R.EQCCYNCGKPGHLAR.D
	TK280802_E16_cyto_2D_step05.2141.2141.1	1.1797	0.0937	713.92	4	5000.0%	5	R.SGHWAR.E
UP9731599.4%10828.8%193205838.6(P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein)
	TK280802_E16_cyto_2D_step12.0444.0444.2	1.8689	0.4142	1844.43	1	4060.0%	9	K.HEEAPGHRPTTNPNASK.F
UQ9CQM999.4%125624.9%337377785.6(Q9CQM9) Thioredoxin-like 2
	TK280802_E16_cyto_2D_step01.4062.4062.1	1.9312	0.2982	1581.05	1	5000.0%	2	K.YEISSVPTFLFFK.N
	TK280802_E16_cyto_2D_step05.3853.3853.2	0.9001	0.028	2070.37	2	2810.0%	1	K.HNIQFSSFDIFSDEEVR.Q
*	TK280802_E16_cyto_2D_step10.2629.2629.1	0.8549	0.089	1079.68	5	3750.0%	1	K.EHPHVSFVK.L
*	TK280802_E16_cyto_2D_step15.3270.3270.3	1.5107	0.0779	2874.99	4	1880.0%	1	-.MAAGAAEAGEAAVAVVEVGSAQQFEELLR.L
*	TK280802_E16_cyto_2D_step09.2649.2649.2	1.3877	0.2603	1710.77	6	4000.0%	7	R.HVSSGAFPPSTNEHLK.E
UROA2_MOUSE99.4%3876615.2%341359938.6(O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1)
	TK280802_E16_cyto_2D_step09.2496.2496.2	1.4834	0.1868	1413.43	1	5450.0%	5	K.YHTINGHNAEVR.K
	TK280802_E16_cyto_2D_step08.4796.4796.2	0.8095	0.1189	2828.68	77	1150.0%	1	R.GFGFVTFSSMAEVDAAMAARPHSIDGR.V
	TK280802_E16_cyto_2D_step13.3110.3110.2	1.0293	0.0293	1992.62	52	2810.0%	1	K.IVLQKYHTINGHNAEVR.K
	TK280802_E16_cyto_2D_step01.1126.1126.1	1.5031	4.0E-4	734.05	12	6670.0%	3	K.LFVGGIK.E
	TK280802_E16_cyto_2D_step08.3129.3129.1	2.241	0.2925	863.89	8	6430.0%	27	K.KLFVGGIK.E
UROA1_MOUSE99.4%3978917.2%319340659.2(P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed)
	TK280802_E16_cyto_2D_step01.1126.1126.1	1.5031	4.0E-4	734.05	12	6670.0%	3	K.IFVGGIK.E
	TK280802_E16_cyto_2D_step03.3375.3375.2	1.3389	0.1054	1967.18	1	5330.0%	1	R.SHFEQWGTLTDCVVMR.D
	TK280802_E16_cyto_2D_step08.3129.3129.1	2.241	0.2925	863.89	8	6430.0%	27	K.KIFVGGIK.E
	TK280802_E16_cyto_2D_step09.2262.2262.3	1.0663	0.0961	1853.06	42	1670.0%	1	R.NQGGYGGSSSSSSYGSGRR.F
	TK280802_E16_cyto_2D_step04.2007.2007.2	1.5435	0.076	1489.43	5	4090.0%	7	K.YHTVNGHNCEVR.K
UQ9CX8699.4%3374123.0%305305309.3(Q9CX86) 3010025E17Rik protein
*	TK280802_E16_cyto_2D_step14.3780.3780.2	0.9374	0.1768	2893.1	44	1150.0%	1	K.GDVAEGDLIEHFSQFGAVEKAEIIADK.Q
	TK280802_E16_cyto_2D_step09.3538.3538.2	1.9848	0.5169	2322.21	1	3500.0%	1	R.GHFEAFGTLTDCVVVVNPQTK.R
	TK280802_E16_cyto_2D_step01.1126.1126.1	1.5031	4.0E-4	734.05	12	6670.0%	3	K.LFVGGLK.G
*	TK280802_E16_cyto_2D_step09.2223.2223.2	1.1125	0.1259	1336.89	1	3850.0%	1	K.EDIHAGGGGARAAR.G
	TK280802_E16_cyto_2D_step08.3129.3129.1	2.241	0.2925	863.89	8	6430.0%	27	K.KLFVGGLK.G
UQ9JKX699.3%2218.8%218239845.5(Q9JKX6) Nudix hydrolase
*	TK280802_E16_cyto_2D_step02.4766.4766.3	1.0805	0.0024	4677.22	3	1120.0%	1	R.TLHHECVILVKQFRPPMGSYCLEFPAGFIEDGESPEAAALR.E
*	TK280802_E16_cyto_2D_step12.2338.2338.1	2.2589	0.3848	1351.25	2	5500.0%	1	R.TLHHECVILVK.Q
URS4_HUMAN99.3%4425829.4%2622946710.2(P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10)
	TK280802_E16_cyto_2D_step13.2241.2241.2	2.0246	0.2258	1508.67	4	4580.0%	2	R.ERHPGSFDVVHVK.D
	TK280802_E16_cyto_2D_step11.2787.2787.1	1.9601	0.3417	1217.99	2	5000.0%	6	K.GIPHLVTHDAR.T
	TK280802_E16_cyto_2D_step01.2975.2975.1	1.4967	0.1649	991.48	2	6250.0%	1	R.LSNIFVIGK.G
	TK280802_E16_cyto_2D_step01.4198.4198.1	1.4829	0.1639	1275.93	2	4440.0%	2	R.ECLPLIIFLR.N
	TK280802_E16_cyto_2D_step07.3323.3323.2	1.4805	0.1602	1170.38	3	5560.0%	8	K.GNKPWISLPR.G
	TK280802_E16_cyto_2D_step05.1869.1869.3	1.5677	0.0168	1833.3	100	2030.0%	1	K.LTGVFAPRPSTGPHKLR.E
	TK280802_E16_cyto_2D_step05.2551.2551.1	1.6327	0.3064	793.26	1	5830.0%	2	R.KIFVGTK.G
	TK280802_E16_cyto_2D_step11.2848.2848.2	1.5175	0.1597	1224.59	1	5000.0%	2	R.HPGSFDVVHVK.D
UTEBP_MOUSE99.3%3515.6%160187214.5(Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23)
	TK280802_E16_cyto_2D_step01.3849.3849.1	0.8624	0.0121	1535.81	70	2730.0%	1	K.LNWLSVDFNNWK.D
	TK280802_E16_cyto_2D_step01.2776.2776.1	1.7273	0.3899	1447.7	1	5830.0%	2	K.LTFSCLGGSDNFK.H
UMBNL_MOUSE99.3%449.1%341369768.6(Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein)
	TK280802_E16_cyto_2D_step14.2319.2319.1	0.7591	0.1411	1103.26	54	1880.0%	1	K.YLHPPPHLK.T
	TK280802_E16_cyto_2D_step13.2253.2253.2	1.1944	0.0703	1310.61	4	5000.0%	1	K.YFHPPAHLQAK.I
	TK280802_E16_cyto_2D_step10.2703.2703.2	0.785	0.0317	1355.09	1	4000.0%	1	R.GNCNRGENDCR.F
UHS74_MOUSE99.3%6104.2%841941335.2(Q61316) Heat shock 70-related protein APG-2
	TK280802_E16_cyto_2D_step06.2298.2298.1	1.9648	0.3907	871.83	1	7140.0%	2	K.NHAAPFSK.V
	TK280802_E16_cyto_2D_step01.3027.3027.1	1.631	0.0705	1537.85	1	4620.0%	1	R.GCALQCAILSPAFK.V
*	TK280802_E16_cyto_2D_step15.1442.1442.1	0.3664	0.0289	882.6	1	2140.0%	1	K.TDQPPQAK.K
	TK280802_E16_cyto_2D_step13.1349.1349.1	0.5501	0.0060	674.55	1	5000.0%	2	K.RFHGR.A
UQ9EQR099.3%14304.4%25042724266.6(Q9EQR0) Fatty acid synthase
*	TK280802_E16_cyto_2D_step04.3085.3085.1	1.4094	0.1881	850.92	2	4290.0%	4	K.ALHLVGLK.R
*	TK280802_E16_cyto_2D_step09.2966.2966.3	1.4265	0.1417	2177.48	120	2000.0%	1	R.EEEPEAVLPGAQPTLISAISK.T
*	TK280802_E16_cyto_2D_step07.3531.3531.3	1.2564	0.0088	2550.45	51	1310.0%	1	K.LDPGSPELQQVLKHDLVMNVYR.D
*	TK280802_E16_cyto_2D_step06.2053.2053.1	0.945	0.098	694.84	15	5000.0%	2	R.HPQALK.D
*	TK280802_E16_cyto_2D_step04.2182.2182.3	1.141	0.0899	1472.67	110	2050.0%	1	R.RQQEQLVPTLEK.F
*	TK280802_E16_cyto_2D_step01.3795.3795.1	1.7743	0.3834	1413.3	2	4550.0%	1	K.DNLEFFLTNLGK.V
*	TK280802_E16_cyto_2D_step06.2395.2395.2	1.4016	0.0799	1024.9	2	7140.0%	1	K.VIREPRPR.S
*	TK280802_E16_cyto_2D_step06.2716.2716.2	2.0066	0.2559	1271.45	1	6110.0%	2	R.HFQLEQDKPK.E
*	TK280802_E16_cyto_2D_step01.1203.1203.1	0.9695	0.2084	1027.95	6	3890.0%	1	R.QAPLLIGSTK.S
UUBA1_MOUSE99.3%687.5%10581178095.7(Q02053) Ubiquitin-activating enzyme E1 1
*	TK280802_E16_cyto_2D_step01.4308.4308.2	2.3025	0.4927	2617.99	1	3860.0%	1	R.IYDDDFFQNLDGVANALDNIDAR.M
*	TK280802_E16_cyto_2D_step08.4077.4077.2	0.7279	0.0032	2468.98	14	2000.0%	1	R.QMNPYIQVTSHQNRVGPDTER.I
*	TK280802_E16_cyto_2D_step03.3578.3578.2	1.2999	0.2033	2541.27	1	2620.0%	1	K.AVTLHDQGTTQWADLSSQFYLR.E
	TK280802_E16_cyto_2D_step07.2601.2601.1	1.5167	0.1484	623.51	2	7500.0%	2	K.KISFK.S
	TK280802_E16_cyto_2D_step01.2071.2071.1	1.7837	0.1363	814.49	1	7860.0%	1	K.NIILGGVK.A
UEF1G_MOUSE99.3%138515.8%437500616.7(Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma)
*	TK280802_E16_cyto_2D_step01.3220.3220.1	1.2746	0.0177	1123.12	1	5000.0%	1	R.ILGLLDTHLK.T
	TK280802_E16_cyto_2D_step14.4449.4449.2	1.3991	0.2094	1711.62	1	4290.0%	9	R.VLSAPPHFHFGQTNR.T
	TK280802_E16_cyto_2D_step02.4719.4719.2	0.9207	0.0105	2702.53	149	1460.0%	1	R.KNAFASVILFGTNNSSSISGVWVFR.G
	TK280802_E16_cyto_2D_step10.2882.2882.2	2.1134	0.3855	1125.85	1	7220.0%	1	K.AKDPFAHLPK.S
	TK280802_E16_cyto_2D_step01.3008.3008.1	1.3448	0.1325	1086.17	4	5620.0%	1	K.STFVLDEFK.R
UQ9Z1A199.2%61416.1%397430205.1(Q9Z1A1) TFG protein (Trk-fused gene)
	TK280802_E16_cyto_2D_step02.5282.5282.3	1.6421	0.184	2731.81	3	2260.0%	2	R.IPIHNEDITYDELVLMMQRVFR.G
	TK280802_E16_cyto_2D_step14.4083.4083.2	1.1384	0.199	2894.96	24	1670.0%	1	K.YKDEDGDLITIFDSSDLSFAIQCSR.I
*	TK280802_E16_cyto_2D_step10.2665.2665.2	2.9674	0.4731	1863.88	1	5940.0%	3	R.NRPPFGQGYAQPGPGYR.-
UPCB1_HUMAN99.2%102624.4%356375267.1(Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3)
*	TK280802_E16_cyto_2D_step04.3710.3710.2	2.3864	0.2803	1962.41	3	4060.0%	2	K.QICLVMLETLSQSPQGR.V
*	TK280802_E16_cyto_2D_step01.2483.2483.1	2.1626	0.217	1444.98	1	5000.0%	2	R.LVVPATQCGSLIGK.G
*	TK280802_E16_cyto_2D_step09.4317.4317.3	2.9407	0.3505	3382.6	1	2170.0%	3	K.AFAMIIDKLEEDINSSMTNSTAASRPPVTLR.L
*	TK280802_E16_cyto_2D_step08.3285.3285.2	1.9529	0.4165	2608.56	1	3540.0%	3	R.QQSHFAMMHGGTGFAGIDSSSPEVK.G
URS20_HUMAN99.2%41010.9%119133739.9(P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20
	TK280802_E16_cyto_2D_step09.3261.3261.2	2.2222	0.2773	1509.15	1	5420.0%	3	K.RLIDLHSPSEIVK.Q
	TK280802_E16_cyto_2D_step01.2728.2728.1	2.3693	0.3708	1352.88	1	5910.0%	1	R.LIDLHSPSEIVK.Q
UCLI1_MOUSE99.1%233773.7%241270135.2(Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP)
	TK280802_E16_cyto_2D_step05.2890.2890.2	1.7819	0.2664	1098.07	1	6880.0%	4	K.LHIVQVVCK.K
UDYNA_MOUSE99.1%576.9%12811417276.0(O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued)
	TK280802_E16_cyto_2D_step10.5095.5095.3	0.7896	0.0543	4357.54	99	510.0%	1	R.GAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYK.K
	TK280802_E16_cyto_2D_step13.3564.3564.2	1.3444	0.1383	2089.17	4	3330.0%	1	R.LRAFLQGGQEATDIALLLR.D
	TK280802_E16_cyto_2D_step09.3054.3054.2	1.5894	0.3499	1703.83	3	3460.0%	2	R.LVLTQEQLHQLHSR.L
*	TK280802_E16_cyto_2D_step09.2941.2941.2	2.7386	0.4638	1735.38	1	5710.0%	1	K.LNQLSTHTHVVDITR.S
URL1X_MOUSE99.1%131259.1%1762073210.7(P11249) 60S ribosomal protein L18a
	TK280802_E16_cyto_2D_step05.2515.2515.2	1.8079	0.0349	1046.28	11	5710.0%	2	K.CHTPPLYR.M
	TK280802_E16_cyto_2D_step03.2532.2532.1	0.9503	0.1491	930.78	9	3570.0%	11	R.AHSIQIMK.V
UEZRI_MOUSE99.1%216511.1%585692156.1(P26040) Ezrin (p81) (Cytovillin) (Villin 2)
	TK280802_E16_cyto_2D_step01.3444.3444.1	1.1491	0.0943	1106.33	1	4380.0%	1	K.IGFPWSEIR.N
	TK280802_E16_cyto_2D_step11.2958.2958.1	2.3294	0.0965	1089.87	1	7500.0%	2	K.KFVIKPIDK.K
	TK280802_E16_cyto_2D_step10.2602.2602.2	2.8956	0.4228	1177.02	1	7500.0%	3	R.IQVWHAEHR.G
	TK280802_E16_cyto_2D_step13.1836.1836.2	1.4645	0.3097	1651.18	1	5000.0%	1	K.RTHNDIIHNENMR.Q
	TK280802_E16_cyto_2D_step05.3454.3454.1	0.724	0.0889	743.7	9	4000.0%	1	K.FGDYNK.E
	TK280802_E16_cyto_2D_step05.2583.2583.2	1.0376	0.1348	1496.99	1	4090.0%	2	R.THNDIIHNENMR.Q
	TK280802_E16_cyto_2D_step08.2735.2735.2	1.639	0.3153	1474.75	1	5450.0%	6	R.RKPDTIEVQQMK.A
	TK280802_E16_cyto_2D_step01.3498.3498.1	1.9081	0.074	896.62	41	6670.0%	2	K.LFFLQVK.D
UQ9D3R699.1%226.4%409461318.0(Q9D3R6) 4933439B08Rik protein
*	TK280802_E16_cyto_2D_step07.2048.2048.2	0.7976	0.0304	1515.97	64	1920.0%	1	K.TTFFNISASTIVSK.W
	TK280802_E16_cyto_2D_step01.2694.2694.1	2.1713	0.3619	1175.14	1	5450.0%	1	K.GLLLYGPPGTGK.T
UTERA_MOUSE99.1%3535515.8%806893085.3(Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
	TK280802_E16_cyto_2D_step01.2694.2694.1	2.1713	0.3619	1175.14	1	5450.0%	1	R.GILLYGPPGTGK.T
	TK280802_E16_cyto_2D_step01.2759.2759.1	2.3433	0.2066	1095.09	2	6880.0%	1	R.LEILQIHTK.N
	TK280802_E16_cyto_2D_step05.4877.4877.1	1.3699	0.3669	1192.24	2	4380.0%	3	R.RDHFEEAMR.F
	TK280802_E16_cyto_2D_step01.3480.3480.1	1.6798	0.2939	1559.02	2	4580.0%	1	R.LDQLIYIPLPDEK.S
	TK280802_E16_cyto_2D_step06.2848.2848.1	1.7262	0.1951	715.04	6	6000.0%	18	R.HPALFK.A
	TK280802_E16_cyto_2D_step08.2368.2368.2	1.4918	0.0752	839.02	2	6430.0%	1	K.AIGVKPPR.G
	TK280802_E16_cyto_2D_step11.3858.3858.2	1.153	0.1394	2521.05	27	1360.0%	2	K.NVFIIGATNRPDIIDPAILRPGR.L
	TK280802_E16_cyto_2D_step01.4210.4210.1	2.0282	0.204	1434.3	1	4580.0%	2	R.IVSQLLTLMDGLK.Q
	TK280802_E16_cyto_2D_step14.3633.3633.3	1.177	0.1073	1887.25	7	2340.0%	1	R.LGDVISIQPCPDVKYGK.R
	TK280802_E16_cyto_2D_step01.4294.4294.2	1.4219	0.0957	1925.22	1	3440.0%	1	R.QAAPCVLFFDELDSIAK.A
USYG_MOUSE99.1%223.6%729818786.7(Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS)
	TK280802_E16_cyto_2D_step01.4003.4003.1	0.8882	0.012	1461.11	47	2920.0%	1	R.TFFSFPAVVAPFK.C
	TK280802_E16_cyto_2D_step09.2893.2893.2	2.7095	0.4645	1451.25	1	5420.0%	1	K.VPLVAEKPLKEPK.T
UENPL_MOUSE99.1%187013.1%802924764.8(P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96)
	TK280802_E16_cyto_2D_step01.2739.2739.1	1.0588	0.1429	1513.85	3	3460.0%	1	K.NLLHVTDTGVGMTR.E
	TK280802_E16_cyto_2D_step06.5132.5132.2	0.862	0.0402	1927.28	255	1560.0%	1	K.EFGTNIKLGVIEDHSNR.T
	TK280802_E16_cyto_2D_step15.1706.1706.3	0.9471	0.0514	2899.0	44	1480.0%	1	K.VEKTVWDWELMNDIKPIWQRPSK.E
*	TK280802_E16_cyto_2D_step05.3258.3258.2	2.5735	0.483	2252.15	1	5000.0%	2	R.FQSSHHSTDITSLDQYVER.M
	TK280802_E16_cyto_2D_step06.2240.2240.1	0.9182	0.0946	862.81	30	5830.0%	1	K.RFQNVAK.E
	TK280802_E16_cyto_2D_step01.2922.2922.1	1.1836	0.2813	1189.52	136	3500.0%	1	K.SILFVPTSAPR.G
	TK280802_E16_cyto_2D_step07.2497.2497.1	1.165	0.0496	637.34	4	6250.0%	5	R.HPLIR.D
	TK280802_E16_cyto_2D_step01.0396.0396.1	2.0546	0.2516	996.27	1	6250.0%	6	R.SGYLLPDTK.A
UQ9D6U599.1%41613.9%173197596.2(Q9D6U5) 2310057C03Rik protein
	TK280802_E16_cyto_2D_step08.4309.4309.2	1.7989	0.3913	2742.66	1	3040.0%	4	R.SVEGWILFVTGVHEEATEEDIHDK.F
UQ9CYG699.1%2224.8%222249486.0(Q9CYG6) 5730478E03Rik protein
	TK280802_E16_cyto_2D_step04.5030.5030.3	1.2804	0.1586	4246.6	78	880.0%	1	R.LLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMR.K
	TK280802_E16_cyto_2D_step03.3539.3539.2	2.5524	0.4812	1830.7	1	5310.0%	1	R.ATAAFILANEHNVALFK.H
UQ99J3599.1%61212.8%375410266.5(Q99J35) Hypothetical 41.0 kDa protein
	TK280802_E16_cyto_2D_step08.2149.2149.3	1.2803	0.0706	1772.7	127	1960.0%	1	K.FAPVCSICENPIIPR.D
*	TK280802_E16_cyto_2D_step15.3495.3495.3	2.8277	0.4525	2656.83	1	3230.0%	1	K.SLISDLEQLHLPPPPPPPPPQAPSK.G
	TK280802_E16_cyto_2D_step01.0536.0536.1	1.1425	0.0675	888.37	20	5000.0%	1	R.ELAVEAMK.R
UIMB2_HUMAN99.1%71910.7%8901013105.0(Q92973) Importin beta-2 subunit (Karyopherin beta-2 subunit) (Transportin) (M9 region interaction protein) (MIP)
*	TK280802_E16_cyto_2D_step02.3512.3512.3	1.3121	0.2423	4096.16	3	1110.0%	1	K.ESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKK.A
*	TK280802_E16_cyto_2D_step05.3697.3697.2	2.2511	0.4826	1290.61	1	5830.0%	4	R.ATVGILITTIASK.G
*	TK280802_E16_cyto_2D_step12.3067.3067.3	1.7346	0.2575	3734.91	1	1750.0%	1	-.MEYEWKPDEQGLQQILQLLKESQSPDTTIQR.T
*	TK280802_E16_cyto_2D_step08.3279.3279.2	1.1549	0.1265	1605.56	56	4230.0%	1	R.SHAVACVNQFIISR.T
UBAG3_MOUSE99.1%449.5%577618287.5(Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis)
*	TK280802_E16_cyto_2D_step08.3480.3480.3	1.5327	0.0048	2960.57	1	2500.0%	1	R.SGTPVHCPSPIRVHTVVDRPQPMTHR.E
*	TK280802_E16_cyto_2D_step08.2500.2500.2	2.6449	0.467	2300.77	1	3610.0%	1	K.THYPAQQGEYQPQQPVYHK.I
*	TK280802_E16_cyto_2D_step06.2112.2112.1	0.947	0.1075	544.77	18	5000.0%	1	K.GPENK.D
*	TK280802_E16_cyto_2D_step01.0406.0406.1	0.9443	0.0583	612.55	5	6250.0%	1	R.LLPIR.E
UMYO6_MOUSE99.0%7272.5%12651464098.8(Q64331) Myosin VI
*	TK280802_E16_cyto_2D_step11.2750.2750.2	2.2799	0.4808	1851.08	1	5000.0%	5	R.LPQPSDQHFTSVVHQK.H
*	TK280802_E16_cyto_2D_step07.2035.2035.2	0.8233	0.0234	928.93	66	3120.0%	1	R.RGPAVQATK.A
*	TK280802_E16_cyto_2D_step04.1561.1561.1	0.7189	0.0038	748.0	1	4000.0%	1	K.LEMEPK.R
UPEBP_MOUSE99.0%3512.8%187208605.4(P70296) Phosphatidylethanolamine-binding protein (PEBP)
	TK280802_E16_cyto_2D_step12.4466.4466.1	0.9154	0.2547	1441.16	1	4000.0%	2	R.EWHHFLVVNMK.G
*	TK280802_E16_cyto_2D_step01.2452.2452.1	1.5529	0.4456	1367.05	1	6250.0%	1	R.VDYAGVTVDELGK.V
ULA_MOUSE98.9%466.5%415477569.8(P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog)
	TK280802_E16_cyto_2D_step06.2427.2427.1	1.305	0.3183	945.92	2	5000.0%	2	K.GSHVFTAAR.R
	TK280802_E16_cyto_2D_step01.2942.2942.1	1.6746	0.1571	819.92	2	6670.0%	1	K.EGIILFK.E
	TK280802_E16_cyto_2D_step05.1989.1989.2	1.0641	0.0593	1089.19	69	4000.0%	1	K.GNRPGYAGAPK.G
UENOB_HUMAN98.9%246.9%433468567.7(P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3)
*	TK280802_E16_cyto_2D_step01.5137.5137.2	2.8555	0.4499	3025.24	1	2410.0%	2	R.HIADLAGNPDLILPVPAFNVINGGSHAGNK.L
UQ9CXZ298.9%62613.5%163174037.1(Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence
	TK280802_E16_cyto_2D_step01.2054.2054.1	1.3689	0.0831	891.71	5	5000.0%	5	K.AAVSGLWGK.V
	TK280802_E16_cyto_2D_step01.0054.0054.1	1.4408	0.1477	1286.92	4	3750.0%	1	K.VNADEVGGEALGR.L
UK1CI_HUMAN98.9%7491.3%622619875.2(P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9)
*	TK280802_E16_cyto_2D_step07.2036.2036.1	1.1279	0.1806	813.15	13	3570.0%	7	K.KGPAAIQK.N
UQ8VCI598.9%4167.0%299327334.3(Q8VCI5) Peroxisomal farnesylated protein
*	TK280802_E16_cyto_2D_step10.2318.2318.2	1.7931	0.2739	2088.44	1	3000.0%	4	K.AKPSPEHAPTISAPDASGPQK.R
UO8870198.8%359.6%375426794.7(O88701) Nucleosome assembly protein 1-like protein 4
*	TK280802_E16_cyto_2D_step14.3692.3692.2	0.9991	0.0548	2867.79	27	1670.0%	2	R.EFITGDVEPTDAESAWHSENEEEDK.L
	TK280802_E16_cyto_2D_step01.3084.3084.1	2.3247	0.3491	1329.91	1	5500.0%	1	K.YAALYQPLFDK.R
USERA_MOUSE98.8%6815.5%485514496.9(Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment)
	TK280802_E16_cyto_2D_step09.3276.3276.3	1.4759	0.0297	1798.67	124	2500.0%	1	R.VVNCARGGIVDEGALLR.A
*	TK280802_E16_cyto_2D_step11.3395.3395.2	2.7403	0.409	1087.53	1	9380.0%	2	R.RGQPLLVFR.A
	TK280802_E16_cyto_2D_step13.2620.2620.3	1.5026	0.1163	3300.9	7	1450.0%	1	R.GGIVDEGALLRALQSGQCAGAALDVFTEEPPR.D
	TK280802_E16_cyto_2D_step04.2410.2410.3	1.0882	0.0315	2049.49	75	1530.0%	1	R.ALVDHENVISCPHLGASTK.E
	TK280802_E16_cyto_2D_step01.3148.3148.1	1.518	0.3556	900.44	8	5000.0%	1	K.TLGILGLGR.I
URNT1_MOUSE98.7%466.2%11131226576.7(Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog)
	TK280802_E16_cyto_2D_step11.5027.5027.3	1.2186	0.061	3785.25	3	1210.0%	1	K.AGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTK.L
	TK280802_E16_cyto_2D_step14.4540.4540.2	1.1614	0.0085	2408.93	11	2250.0%	1	R.FMTTAMYDAREAIIPGSVYDR.S
	TK280802_E16_cyto_2D_step11.2763.2763.2	2.4365	0.4706	1494.54	1	5380.0%	2	R.GNTSGSHIVNHLVR.A
UQ9JK3198.6%779.3%13061384884.8(Q9JK31) ATFa-associated factor
*	TK280802_E16_cyto_2D_step14.2988.2988.3	1.2811	0.1784	2834.68	9	1350.0%	1	K.NPVSLPPLPNPTKPNIPSVPSPSSIQR.N
*	TK280802_E16_cyto_2D_step07.3280.3280.1	0.7694	0.1334	1028.14	86	2220.0%	1	K.MEGSFGSPSK.Q
	TK280802_E16_cyto_2D_step13.2168.2168.2	2.324	0.4667	1815.39	1	4690.0%	1	R.LPPEAASTSLPQKPHLK.L
*	TK280802_E16_cyto_2D_step06.3610.3610.3	1.1957	0.1873	2910.34	49	1150.0%	1	R.LPVPRAPANHQVVYTTLPAPTTQAPLR.G
*	TK280802_E16_cyto_2D_step01.1296.1296.3	1.1856	0.0075	2075.29	1	2920.0%	1	R.FGPFCDPQSTDVISSSQNS.-
*	TK280802_E16_cyto_2D_step08.3481.3481.3	1.6267	0.0473	2507.25	14	1900.0%	1	K.EDTVVDNTDSMETDEIIPILEK.L
UQ8QZT198.6%5722.6%424448168.5(Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial
*	TK280802_E16_cyto_2D_step08.4000.4000.3	1.1008	0.071	3335.32	8	1340.0%	1	K.EDIAMWEVNEAFSVVVLANIKMLEIDPQK.V
*	TK280802_E16_cyto_2D_step13.2644.2644.2	2.3016	0.4673	1932.51	1	4740.0%	1	K.VNIHGGAVSLGHPIGMSGAR.I
*	TK280802_E16_cyto_2D_step10.2371.2371.3	1.1731	0.2605	2662.8	88	1000.0%	2	R.QATLGAGLPISTPCTTVNKVCASGMK.A
*	TK280802_E16_cyto_2D_step12.3742.3742.2	1.0408	0.0753	2228.59	102	1750.0%	1	K.FASEITPITISVKGKPDVVVK.E
URL7_MOUSE98.6%81615.6%2703142010.9(P14148) 60S ribosomal protein L7
	TK280802_E16_cyto_2D_step05.2686.2686.2	1.7318	0.1276	1082.96	5	5000.0%	1	K.KVPAVPETLK.K
	TK280802_E16_cyto_2D_step05.2480.2480.1	1.7836	0.3105	1013.78	1	5560.0%	2	K.KVATVPGTLK.K
	TK280802_E16_cyto_2D_step07.1905.1905.1	1.4997	0.0727	696.9	2	6670.0%	3	K.KVPAGPK.T
	TK280802_E16_cyto_2D_step06.2647.2647.1	1.5198	0.0156	607.56	6	7500.0%	1	K.KFALK.T
	TK280802_E16_cyto_2D_step01.3660.3660.1	1.4576	0.119	1267.73	1	5560.0%	1	K.EANNFLWPFK.L
UEF1D_MOUSE98.6%82817.1%281312935.0(P57776) Elongation factor 1-delta (EF-1-delta)
*	TK280802_E16_cyto_2D_step10.3974.3974.2	1.8545	0.0478	1846.94	2	3330.0%	1	K.FEEHVQSVDIAAFDKI.-
*	TK280802_E16_cyto_2D_step01.3238.3238.1	2.0209	0.3366	1288.16	1	4550.0%	1	R.GVVQDLQQAISK.L
*	TK280802_E16_cyto_2D_step07.2305.2305.1	1.7132	0.1408	758.58	1	6670.0%	5	K.KPTLVAK.S
	TK280802_E16_cyto_2D_step04.2072.2072.2	2.0384	0.4362	1426.74	1	5830.0%	1	R.ATAPQTQHVSPMR.Q
UQ9DAB498.6%113.6%391428906.7(Q9DAB4) 1700015E05Rik protein
	TK280802_E16_cyto_2D_step01.2779.2779.1	1.7656	0.3352	1530.03	2	4620.0%	1	K.NLEPEWAAAATEVK.E
URL27_HUMAN98.4%394.4%1351566710.6(P08526) 60S ribosomal protein L27
*	TK280802_E16_cyto_2D_step06.2202.2202.1	1.5424	0.396	708.01	1	8000.0%	3	K.FMKPGK.V
UNUCL_MOUSE98.4%686.8%706765924.8(P09405) Nucleolin (Protein C23)
*	TK280802_E16_cyto_2D_step06.2894.2894.2	1.5105	0.1442	1672.55	51	2860.0%	2	K.GIAYIEFKSEADAEK.N
*	TK280802_E16_cyto_2D_step13.0744.0744.2	1.0942	0.0451	1103.91	3	4440.0%	1	K.VPQNPHGKPK.G
*	TK280802_E16_cyto_2D_step01.3573.3573.1	1.4807	0.1813	1026.01	2	5620.0%	1	K.FAISELFAK.N
	TK280802_E16_cyto_2D_step07.4008.4008.2	2.207	0.5255	1596.06	1	4620.0%	1	K.GYAFIEFASFEDAK.E
UMCM2_MOUSE98.4%797.1%9041020475.8(P97310) DNA replication licensing factor MCM2
	TK280802_E16_cyto_2D_step13.1988.1988.3	1.3772	0.0474	2559.61	346	1590.0%	1	K.DQQIGEKIFASIAPSIYGHEDIK.R
	TK280802_E16_cyto_2D_step01.1948.1948.1	0.5463	0.0026	1274.66	42	1820.0%	1	K.VAVGELTDEDVK.M
	TK280802_E16_cyto_2D_step13.1832.1832.1	1.3492	0.234	992.04	10	5000.0%	2	R.ITNHIHVR.I
	TK280802_E16_cyto_2D_step08.3435.3435.1	0.7717	0.0122	1135.73	234	2500.0%	1	R.QLHLNQLIR.T
	TK280802_E16_cyto_2D_step12.2113.2113.1	0.9875	0.139	1380.73	40	1820.0%	1	R.THVDSHGHNVFK.E
UQ9CY2698.3%5252.3%298333665.5(Q9CY26) 2700085E05Rik protein
	TK280802_E16_cyto_2D_step08.3467.3467.1	1.6036	0.35	863.03	1	5830.0%	5	R.ALHFVFK.V
UGBB1_HUMAN98.3%112.1%340373776.0(P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1)
	TK280802_E16_cyto_2D_step07.2740.2740.1	1.6026	0.3365	805.85	1	6670.0%	1	K.VHAIPLR.S
UADK_MOUSE98.3%10503.9%279311037.4(P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment)
	TK280802_E16_cyto_2D_step04.2748.2748.2	1.4265	0.2603	1160.08	6	5000.0%	5	R.AGHYAASVIIR.R
UQ9D3T698.2%118.4%179201886.4(Q9D3T6) 4933436C10Rik protein
	TK280802_E16_cyto_2D_step13.2105.2105.2	2.2817	0.4603	1852.13	1	5360.0%	1	K.VLQCHKPVHAEYLEK.L
UQ6116698.2%3516.4%268300165.2(Q61166) APC-binding protein EB1 homolog
	TK280802_E16_cyto_2D_step12.3874.3874.3	1.6901	0.0328	2983.08	41	1700.0%	1	K.IEQLCSGAAYCQFMDMLFPGSIALKK.V
*	TK280802_E16_cyto_2D_step13.1812.1812.2	2.2927	0.3335	1880.82	1	3530.0%	2	K.KPLGSSTAAPQRPIATQR.T
UQ91YZ898.1%338.3%615678539.5(Q91YZ8) Hypothetical 67.9 kDa protein
*	TK280802_E16_cyto_2D_step09.2480.2480.3	1.1426	0.0061	2488.15	10	1500.0%	1	R.HLAPTGVPTAVPNLAPRAAVAAAAPR.A
	TK280802_E16_cyto_2D_step11.3108.3108.2	2.3627	0.4473	1704.12	1	5670.0%	1	R.SKVDEAVAVLQAHHAK.K
	TK280802_E16_cyto_2D_step14.1896.1896.1	0.6877	0.1601	778.86	1	2500.0%	1	K.VGTVAAATS.-
URL2B_HUMAN98.1%51717.9%1561769510.4(P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a
	TK280802_E16_cyto_2D_step01.2228.2228.1	2.0984	0.136	1408.22	2	4580.0%	1	R.LAPDYDALDVANK.I
	TK280802_E16_cyto_2D_step10.3563.3563.2	2.0791	0.2903	1750.89	1	4640.0%	4	K.KIEDNNTLVFIVDVK.A
UQ96A9098.0%1112112.0%217235738.5(Q96A90) G6b-C protein precursor
*	TK280802_E16_cyto_2D_step12.4529.4529.3	2.0776	0.1737	3011.91	1	2800.0%	11	R.FDHSLDLLCPPHIAPLVKTEPQRPVK.E
UTCPQ_MOUSE97.9%449.7%548595565.6(P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta)
	TK280802_E16_cyto_2D_step01.2920.2920.1	1.1506	0.095	1129.32	1	5000.0%	1	K.LATNAAVTVLR.V
	TK280802_E16_cyto_2D_step04.4820.4820.1	0.6612	0.0597	1195.17	65	2000.0%	1	K.KETEGDVTSVK.D
*	TK280802_E16_cyto_2D_step10.3175.3175.2	2.9039	0.4157	1757.96	1	6430.0%	1	K.KAHEILPELVCCSAK.N
	TK280802_E16_cyto_2D_step14.0006.0006.2	1.2595	0.0992	1782.73	14	3000.0%	1	K.GTVLIKTAEELMNFSK.G
UMCM7_MOUSE97.9%122418.5%719812116.4(Q61881) DNA replication licensing factor MCM7 (CDC47 homolog)
*	TK280802_E16_cyto_2D_step11.2895.2895.2	2.7341	0.4032	1297.83	1	7000.0%	3	K.YGTQLVHLAHR.E
	TK280802_E16_cyto_2D_step13.2078.2078.2	1.6699	0.3205	1590.95	1	5830.0%	1	R.LAQHITYVHQHSR.Q
	TK280802_E16_cyto_2D_step15.2398.2398.3	1.0123	0.0424	2813.52	132	1000.0%	1	R.TAIHEVMEQQTISIAKAGILTTLNAR.C
*	TK280802_E16_cyto_2D_step04.4245.4245.3	0.9577	0.0348	3015.15	354	800.0%	1	R.GFTPAQFQAALDEYEELNVWQVNTSR.T
*	TK280802_E16_cyto_2D_step02.0498.0498.1	0.6019	0.0846	1480.33	52	1360.0%	1	R.NPQNQYPSELMR.R
*	TK280802_E16_cyto_2D_step07.5124.5124.3	1.1128	0.0508	3317.0	83	1250.0%	1	R.SITVVLEGENTRIAQPGDHVSVTGIFLPVLR.T
*	TK280802_E16_cyto_2D_step07.4143.4143.2	1.0514	0.1073	1808.17	9	3080.0%	1	K.FLQEFYYENELGKK.Q
UCATA_MOUSE97.8%357.0%526596347.9(P24270) Catalase (EC 1.11.1.6)
*	TK280802_E16_cyto_2D_step10.2525.2525.2	1.608	0.3094	1702.62	1	4000.0%	2	K.NAIHTYTQAGSHMAAK.G
	TK280802_E16_cyto_2D_step07.2173.2173.3	1.2147	0.0776	2518.26	493	1620.0%	1	K.FYTEDGNWDLVGNNTPIFFIR.D
U143B_MOUSE97.7%2517733.5%245279554.8(Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1)
	TK280802_E16_cyto_2D_step01.2554.2554.1	1.6365	0.1416	909.96	4	5710.0%	3	R.NLLSVAYK.N
	TK280802_E16_cyto_2D_step09.4609.4609.2	1.74	0.1475	2320.33	1	2890.0%	10	R.LGLALNFSVFYYEILNSPEK.A
	TK280802_E16_cyto_2D_step09.2486.2486.2	1.2691	0.0887	1236.14	40	4440.0%	1	K.KEMQPTHPIR.L
	TK280802_E16_cyto_2D_step08.3912.3912.2	0.8482	0.1183	2162.44	82	1670.0%	1	K.QTTVSNSQQAYQEAFEISK.K
*	TK280802_E16_cyto_2D_step01.2546.2546.1	2.1768	0.2615	1351.06	1	5450.0%	1	K.YLILNATQAESK.V
	TK280802_E16_cyto_2D_step01.0002.0002.1	2.1823	0.1153	903.76	2	7140.0%	1	R.VISSIEQK.T
	TK280802_E16_cyto_2D_step01.1275.1275.1	1.5422	0.1883	671.8	8	7500.0%	8	K.VFYLK.M
UPSB6_MOUSE97.3%61823.5%238254255.1(Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y)
*	TK280802_E16_cyto_2D_step12.2691.2691.2	1.4379	0.2783	1571.19	1	4550.0%	4	K.LTPIHDHIFCCR.S
	TK280802_E16_cyto_2D_step04.4177.4177.3	1.672	0.2448	4059.38	1	1320.0%	1	R.SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK.E
	TK280802_E16_cyto_2D_step04.2248.2248.1	0.936	0.012	759.91	12	6250.0%	1	K.EMCYR.Y
U143Z_MOUSE97.2%489.8%245277714.8(P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit)
*	TK280802_E16_cyto_2D_step01.2274.2274.1	1.8222	0.2357	1332.89	2	5000.0%	2	K.FLIPNASQPESK.V
	TK280802_E16_cyto_2D_step01.3988.3988.1	1.9769	0.3092	1420.83	1	7270.0%	2	R.DICNDVLSLLEK.F
UROK_MOUSE97.2%2226614.0%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein)
	TK280802_E16_cyto_2D_step10.2546.2546.1	0.9233	0.0156	869.08	42	2500.0%	1	R.GPPPPPPGR.G
	TK280802_E16_cyto_2D_step01.3698.3698.1	1.8518	0.3139	1343.23	1	5910.0%	2	K.IILDLISESPIK.G
	TK280802_E16_cyto_2D_step06.2831.2831.2	1.3855	0.3882	1198.31	1	5000.0%	16	R.NLPLPPPPPPR.G
	TK280802_E16_cyto_2D_step10.4383.4383.3	1.3974	0.1667	3477.24	17	1250.0%	1	R.TDYNASVSVPDSSGPERILSISADIETIGEILK.K
UT2EA_MOUSE97.2%393.6%440495934.9(Q9D0D5) Transcription initiation factor IIE, alpha subunit (TFIIE-alpha) (General transcription factor IIE 56 kDa subunit)
*	TK280802_E16_cyto_2D_step11.2395.2395.2	2.1269	0.5389	1390.38	1	5330.0%	3	R.AATAAGAAGLAGGHHR.E
UCDNC_MOUSE97.1%4164.9%348373324.3(P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2)
	TK280802_E16_cyto_2D_step14.2928.2928.2	2.3039	0.3377	1782.53	1	4380.0%	4	R.LQLGPRPPPVAVAVIPR.S
UQ922B697.0%579.6%594664877.0(Q922B6) Unknown (Protein for MGC:7807)
	TK280802_E16_cyto_2D_step02.4919.4919.2	0.8252	0.205	3022.24	26	1520.0%	1	K.LCCQLCCSVFKDPVITTCGHTFCR.R
	TK280802_E16_cyto_2D_step11.0393.0393.3	1.11	0.1285	4178.76	41	740.0%	1	R.STFSLPEEEEEPEPLVFAEQPSVKLCCQLCCSVFK.D
	TK280802_E16_cyto_2D_step01.2962.2962.1	1.5062	0.0805	957.34	7	5000.0%	2	K.MNLEAHLK.E
	TK280802_E16_cyto_2D_step12.3074.3074.2	1.0049	0.0681	1721.36	27	3080.0%	1	K.DPVITTCGHTFCRR.C
URL23_HUMAN96.7%124811.4%1401486510.5(P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17)
	TK280802_E16_cyto_2D_step11.2538.2538.1	0.9497	0.1054	829.03	4	4170.0%	2	K.KGKPELR.K
	TK280802_E16_cyto_2D_step13.2089.2089.2	1.2762	0.1728	1020.39	3	5000.0%	2	K.KVHPAVVIR.Q
	TK280802_E16_cyto_2D_step07.2713.2713.1	1.1349	0.2143	893.06	12	4290.0%	6	K.VHPAVVIR.Q
UQ9CQ9996.7%2239.1%115116514.5(Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene)
	TK280802_E16_cyto_2D_step01.0159.0159.2	1.0749	0.1433	2775.9	2	2030.0%	1	K.LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK.K
*	TK280802_E16_cyto_2D_step01.2906.2906.1	2.1152	0.291	1243.92	2	5910.0%	1	K.NIEDVIAQGVGK.L
UR37A_HUMAN96.7%158517.6%911014410.4(P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a
	TK280802_E16_cyto_2D_step08.2581.2581.2	1.3498	0.1825	1056.81	9	5000.0%	2	K.KIEISQHAK.Y
	TK280802_E16_cyto_2D_step05.2408.2408.2	0.9794	0.0030	924.06	1	5000.0%	1	K.IEISQHAK.Y
	TK280802_E16_cyto_2D_step05.2306.2306.1	1.6912	0.2098	703.11	8	5000.0%	8	K.KVGIVGK.Y
UQ9CRI096.4%41025.9%139160025.7(Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment)
	TK280802_E16_cyto_2D_step13.2281.2281.3	1.2133	0.0334	2634.31	36	1820.0%	1	R.GFGFVTYSCVEEVDAAMCARPHK.V
	TK280802_E16_cyto_2D_step01.1301.1301.1	1.6421	0.1245	1383.35	1	4170.0%	3	R.EDSVKPGAHLTVK.K
UTCPB_MOUSE96.4%81212.3%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta)
	TK280802_E16_cyto_2D_step01.3704.3704.1	1.4964	0.2383	1557.11	1	4620.0%	2	R.SLHDALCVLAQTVK.D
	TK280802_E16_cyto_2D_step06.2114.2114.1	1.4704	0.0025	883.74	10	5000.0%	1	K.KIGVNQPK.R
	TK280802_E16_cyto_2D_step07.2839.2839.2	1.3036	0.2447	1538.65	3	3930.0%	1	R.AAHSEGHITAGLDMK.E
	TK280802_E16_cyto_2D_step01.4275.4275.1	1.0698	0.1152	1504.91	1	3210.0%	1	R.LSSFIGAIAIGDLVK.S
	TK280802_E16_cyto_2D_step13.1545.1545.1	1.1885	0.0659	750.44	15	5000.0%	2	K.LLTHHK.D
	TK280802_E16_cyto_2D_step11.1831.1831.2	1.0042	0.1366	1018.96	17	3570.0%	1	K.RVPDHHPC.-
UADHX_MOUSE96.3%3319.0%373395027.5(P28474) Alcohol dehydrogenase class III (EC 1.1.1.1) (Alcohol dehydrogenase 2) (Glutathione-dependent formaldehyde dehydrogenase) (EC 1.2.1.1) (FDH) (FALDH) (Alcohol dehydrogenase-B2) (ADH-B2)
	TK280802_E16_cyto_2D_step01.3228.3228.2	2.5291	0.4049	2308.02	1	4290.0%	1	K.AAVAWEAGKPLSIEEIEVAPPK.A
*	TK280802_E16_cyto_2D_step11.4980.4980.3	1.3413	0.0789	4584.59	9	990.0%	1	K.ILATAVCHTDAYTLSGRDPEGCFPVILGHEGAGIVESVGEGVTK.L
	TK280802_E16_cyto_2D_step15.3670.3670.2	0.7853	0.0458	2896.52	40	1540.0%	1	K.AAVAWEAGKPLSIEEIEVAPPKAHEVR.I
UQ9CSP796.2%246.7%268287435.3(Q9CSP7) 2700017M01Rik protein (Fragment)
	TK280802_E16_cyto_2D_step14.1955.1955.2	2.1037	0.4795	1696.05	1	3820.0%	2	R.LPSRPPLPGSGGSQSGAK.M
UH11_MOUSE96.1%119.0%2122165410.9(P43275) Histone H1.1 (H1 VAR.3) (H1A)
*	TK280802_E16_cyto_2D_step12.3434.3434.2	2.4152	0.4143	1885.88	2	3890.0%	1	K.KPAGPSVSELIVQAVSSSK.E
UQ9CVL396.1%114.2%263282868.2(Q9CVL3) 1810024J13Rik protein (Fragment)
*	TK280802_E16_cyto_2D_step10.2986.2986.2	2.6716	0.3763	1318.1	1	7000.0%	1	K.KPIPEEHLILK.T
UTS24_MOUSE96.0%10404.5%19442160856.4(P53995) Protein TSG24 (Meiotic check point regulator)
	TK280802_E16_cyto_2D_step11.3328.3328.2	1.3427	0.2206	2744.84	6	1960.0%	1	R.HTAEVLLAEIGRPPGPEMEYCTDR.E
*	TK280802_E16_cyto_2D_step13.2272.2272.2	2.1215	0.4717	1624.14	1	4000.0%	1	R.AHSPALGVHSFSGAQR.F
	TK280802_E16_cyto_2D_step01.1060.1060.1	0.4704	0.0735	549.7	7	5000.0%	1	R.SILSK.D
*	TK280802_E16_cyto_2D_step04.3484.3484.2	1.3011	0.0293	1620.9	2	4230.0%	6	K.RGLFINSEFLPVVK.C
	TK280802_E16_cyto_2D_step07.5138.5138.3	0.7927	0.1938	3054.87	124	560.0%	1	K.EGDTINVDVTCPGATLALAMIYLKTNNR.S
UQ9CV4596.0%3511.6%225255225.3(Q9CV45) 2310038O07Rik protein (Fragment)
	TK280802_E16_cyto_2D_step13.2921.2921.2	2.3917	0.4137	1939.49	1	4710.0%	1	R.VALVTFNSAAHNKPSLIR.D
	TK280802_E16_cyto_2D_step01.1146.1146.1	1.0121	0.0316	937.23	52	4290.0%	2	R.EVEMGPFK.H
UQ8R0L695.9%2217.0%206235215.7(Q8R0L6) Similar to coronin, actin binding protein, 2A (Fragment)
*	TK280802_E16_cyto_2D_step08.3657.3657.3	1.2068	0.1279	3048.88	30	1500.0%	1	K.WTAEHHLGEKSCLTNGFDVFECSPPK.T
*	TK280802_E16_cyto_2D_step04.3140.3140.1	1.6015	0.2936	971.04	3	5620.0%	1	-.QKGIGIMPK.R
UERF_MOUSE95.9%7919.4%551590507.3(P70459) ETS-domain transcription factor ERF
*	TK280802_E16_cyto_2D_step10.3009.3009.2	1.5113	0.0179	1553.58	3	4000.0%	2	R.GDVGPGESGGPLTPRR.V
*	TK280802_E16_cyto_2D_step14.2167.2167.2	2.0202	0.3759	2340.78	1	3410.0%	1	R.APPAPPKPEPGEAPGVAQCMPLK.L
*	TK280802_E16_cyto_2D_step13.2498.2498.2	2.0259	0.3201	1366.32	1	5420.0%	1	R.ARPPGPPELGAFR.G
	TK280802_E16_cyto_2D_step06.2308.2308.1	1.1315	0.1372	609.89	38	5000.0%	1	R.GPPLAR.L
	TK280802_E16_cyto_2D_step06.4793.4793.2	0.8254	0.0575	3180.48	54	830.0%	1	K.CPLPPMAPETPPVPSSASSSSSSSSSPFKFK.L
	TK280802_E16_cyto_2D_step13.3104.3104.2	2.5345	0.3947	2064.62	2	3530.0%	1	R.AFLHYPGLVVPQPQRPDK.C
UQ9UM0695.9%574.1%11811290537.2(Q9UM06) ABP125
	TK280802_E16_cyto_2D_step08.1908.1908.1	0.6906	0.0257	614.55	2	3750.0%	1	K.QQLPK.G
	TK280802_E16_cyto_2D_step11.2013.2013.3	0.7995	0.0509	1687.61	187	960.0%	1	K.TQPPEDISCIAWNR.Q
	TK280802_E16_cyto_2D_step05.3367.3367.2	0.8093	0.1667	1960.52	36	2060.0%	1	R.TGPQNGWNDPPALNRVPK.K
	TK280802_E16_cyto_2D_step10.2894.2894.2	2.7572	0.3672	1211.12	1	7270.0%	2	R.RPVGASFSFGGK.L
UU5S1_MOUSE95.6%576.7%9711093615.0(O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa)
	TK280802_E16_cyto_2D_step07.2948.2948.2	1.2992	0.0326	1257.63	8	5000.0%	1	K.STPVTVVLPDTK.G
	TK280802_E16_cyto_2D_step15.4149.4149.3	2.2501	0.1803	3048.78	13	1730.0%	2	R.SFVEFILEPLYKILAQVVGDVDTSLPR.T
	TK280802_E16_cyto_2D_step13.2797.2797.2	2.7795	0.3606	1895.91	2	3750.0%	1	K.SIVIRPLEPQPAPHLAR.E
*	TK280802_E16_cyto_2D_step04.2255.2255.1	0.7842	0.0791	945.84	26	3750.0%	1	K.KAPSSSSQR.S
UQ8VC9495.5%118.4%167190249.8(Q8VC94) Hypothetical 19.0 kDa protein
	TK280802_E16_cyto_2D_step01.2794.2794.1	1.5088	0.3318	1546.93	1	5000.0%	1	K.VLEQLTGQTPVFSK.A
URL18_MOUSE95.5%62612.3%1872151311.8(P35980) 60S ribosomal protein L18
	TK280802_E16_cyto_2D_step07.2736.2736.2	2.2891	0.415	1142.87	2	6110.0%	5	R.TNRPPLSLSR.M
*	TK280802_E16_cyto_2D_step01.3307.3307.1	1.8469	0.1772	1476.9	1	6250.0%	1	K.ILTFDQLALESPK.G
UVAA1_MOUSE95.4%6106.5%617682685.9(P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1)
	TK280802_E16_cyto_2D_step13.0802.0802.1	0.8754	0.0441	1310.73	2	2270.0%	2	R.VGHSELVGEIIR.L
*	TK280802_E16_cyto_2D_step01.0618.0618.1	1.2265	0.0103	1120.71	11	3750.0%	1	R.EHMGEILYK.L
*	TK280802_E16_cyto_2D_step08.2841.2841.1	1.0197	0.0209	908.72	19	5000.0%	1	K.WEFIPSK.N
	TK280802_E16_cyto_2D_step08.2760.2760.2	2.0605	0.4749	1317.51	1	7270.0%	2	K.LPANHPLLTGQR.V
URL19_HUMAN95.3%134712.8%1962346611.5(P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19
	TK280802_E16_cyto_2D_step10.2667.2667.2	1.9247	0.3426	1022.27	2	6430.0%	2	R.ILMEHIHK.L
	TK280802_E16_cyto_2D_step05.2179.2179.1	1.3529	0.3839	643.51	1	6000.0%	5	R.HMGIGK.R
	TK280802_E16_cyto_2D_step13.2569.2569.1	1.0375	0.0559	1193.08	6	3750.0%	1	R.HMYHSLYLK.V
	TK280802_E16_cyto_2D_step13.1718.1718.1	0.9384	0.0325	856.94	3	6430.0%	1	K.GRHMGIGK.R
UO7014095.3%249.3%247283187.8(O70140) Calcyclin binding protein (Fragment)
	TK280802_E16_cyto_2D_step12.3306.3306.2	1.7371	0.3237	2684.81	2	2270.0%	2	K.IYITLTGVHQVPTENVQVHFTER.S
UQ9CZX895.2%599.9%2122294010.8(Q9CZX8) Ribosomal protein S19
	TK280802_E16_cyto_2D_step05.3262.3262.2	1.7926	0.3608	1128.52	1	5560.0%	2	R.RVLQALEGLK.M
	TK280802_E16_cyto_2D_step01.2683.2683.1	2.1737	0.1666	972.97	1	6880.0%	2	R.VLQALEGLK.M
	TK280802_E16_cyto_2D_step07.2824.2824.2	1.2719	0.1049	1312.49	3	5000.0%	1	K.LKVPEWVDTVK.L
UDHCA_MOUSE95.2%5533.3%276305977.8(P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1)
*	TK280802_E16_cyto_2D_step14.4303.4303.2	1.0339	0.1779	3174.96	2	1730.0%	1	K.VNDDTPFHIQAEVTMETNFFGTRDVCK.E
*	TK280802_E16_cyto_2D_step10.3561.3561.3	1.3506	0.0941	3495.45	5	1480.0%	1	K.ATKSPEEGAETPVYLALLPPDAEGPHGQFVQDK.K
*	TK280802_E16_cyto_2D_step08.5188.5188.3	1.0616	0.0321	2670.56	41	1820.0%	1	K.VNDDTPFHIQAEVTMETNFFGTR.D
*	TK280802_E16_cyto_2D_step01.4083.4083.1	1.5646	0.2956	1389.77	2	3850.0%	1	-.SSSRPVALVTGANK.G
*	TK280802_E16_cyto_2D_step09.2910.2910.2	1.219	0.1426	1932.3	1	3530.0%	1	K.KGVHAEEGWPNSAYGVTK.I
UTBA4_HUMAN95.0%108214.3%448499245.1(P05215) Tubulin alpha-4 chain (Alpha-tubulin 4) (P05215) Tubulin alpha-4 chain (Alpha-tubulin 4)
	TK280802_E16_cyto_2D_step12.2783.2783.2	0.9523	0.0015	3011.42	62	1000.0%	1	R.EDMAALEKDYEEVGIDSYEDEDEGEE.-
	TK280802_E16_cyto_2D_step09.3968.3968.3	2.4239	0.2897	4305.32	1	1350.0%	9	R.ECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDK.T
UQ9CXU394.9%1116.0%8190585.8(Q9CXU3) 3110003A17Rik protein
	TK280802_E16_cyto_2D_step01.4296.4296.1	1.8149	0.2883	1438.57	1	5000.0%	1	R.CANLFEALVGTLK.A
USERC_MOUSE94.9%8225.9%370404738.0(Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP)
*	TK280802_E16_cyto_2D_step13.2390.2390.1	1.8787	0.2684	1241.82	4	4500.0%	2	K.KFGTVNIVHPK.L
	TK280802_E16_cyto_2D_step06.3360.3360.1	1.773	0.1874	1278.8	2	6000.0%	4	K.LPHSVLLEIQK.Q
UQ9DBY694.9%71310.3%407446548.5(Q9DBY6) 1200009K13Rik protein
	TK280802_E16_cyto_2D_step05.2360.2360.1	0.9571	0.1522	1186.78	4	3640.0%	1	R.GGSGSHNWGTVK.D
	TK280802_E16_cyto_2D_step13.2126.2126.1	1.8	0.2717	828.88	1	6670.0%	1	K.KGFVLHK.S
	TK280802_E16_cyto_2D_step13.1778.1778.1	1.4005	0.2386	1343.44	21	3750.0%	1	K.RGGSGSHNWGTVK.D
	TK280802_E16_cyto_2D_step01.1902.1902.1	0.7819	0.0471	1322.11	4	2080.0%	1	K.NPLPPSVGVADKK.E
	TK280802_E16_cyto_2D_step06.4976.4976.1	1.0366	0.0219	1177.08	53	3750.0%	3	R.RFEKPLEEK.G
URS2_MOUSE94.9%91331.4%2933121710.2(P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein)
	TK280802_E16_cyto_2D_step13.1553.1553.1	1.8005	0.2827	1138.69	1	6670.0%	2	K.IGKPHTVPCK.V
	TK280802_E16_cyto_2D_step06.1741.1741.3	1.1379	0.0125	1845.61	136	1330.0%	1	K.KLLMMAGIDDCYTSAR.G
	TK280802_E16_cyto_2D_step05.4297.4297.2	0.9612	0.1208	2154.98	1	1670.0%	1	K.ESEIIDFFLGASLKDEVLK.I
	TK280802_E16_cyto_2D_step12.2038.2038.2	1.2367	0.1735	1794.66	49	1670.0%	1	-.MADDAGAAGGPGGPGGPGLGGR.G
	TK280802_E16_cyto_2D_step01.1782.1782.1	0.6612	0.0788	1425.97	14	1920.0%	1	K.EVATAIRGAIILAK.L
	TK280802_E16_cyto_2D_step01.3235.3235.1	1.2479	0.1949	1388.97	11	3500.0%	2	K.TYSYLTPDLWK.E
URL13_MOUSE94.9%81020.5%2102417411.5(P47963) 60S ribosomal protein L13 (A52)
	TK280802_E16_cyto_2D_step01.3103.3103.1	1.3527	0.0662	759.84	2	8000.0%	1	K.LILFPR.K
	TK280802_E16_cyto_2D_step15.1222.1222.1	0.3716	0.1764	750.72	3	1670.0%	1	R.VAGIHKK.V
*	TK280802_E16_cyto_2D_step13.2560.2560.2	1.887	0.3407	1324.26	1	6500.0%	1	R.NGMILKPHFHK.D
	TK280802_E16_cyto_2D_step07.0760.0760.1	0.9052	0.0586	628.18	31	4000.0%	2	R.KPSAPK.K
*	TK280802_E16_cyto_2D_step01.2798.2798.1	1.7104	0.2887	1399.13	2	3750.0%	1	K.LATQLTGPVMPIR.N
	TK280802_E16_cyto_2D_step05.1907.1907.1	1.0426	0.0543	624.52	3	7000.0%	1	R.VAGIHK.K
UUBCI_HUMAN94.9%6148.2%158180078.7(P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18)
	TK280802_E16_cyto_2D_step11.3304.3304.2	1.7545	0.248	1444.58	1	5420.0%	3	R.KDHPFGFVAVPTK.N
	TK280802_E16_cyto_2D_step01.2755.2755.1	0.7886	0.0044	1318.19	65	2730.0%	2	K.DHPFGFVAVPTK.N
UPGK2_MOUSE94.8%111.4%416447807.1(P09041) Phosphoglycerate kinase, testis specific (EC 2.7.2.3)
	TK280802_E16_cyto_2D_step01.2795.2795.1	2.1492	0.2395	735.13	3	8000.0%	1	K.DVIFLK.D
UKAC_MOUSE94.7%2410.4%106117785.4(P01837) Ig kappa chain C region
	TK280802_E16_cyto_2D_step05.1983.1983.2	2.054	0.5171	1350.18	1	7000.0%	2	R.HNSYTCEATHK.T
UQ9Y2V194.6%227.4%448535834.9(Q9Y2V1) Hypothetical protein
	TK280802_E16_cyto_2D_step06.2515.2515.1	2.0395	0.258	1015.78	1	6250.0%	1	R.EIDAALQKK.R
*	TK280802_E16_cyto_2D_step09.4024.4024.3	1.5635	0.0506	2891.32	63	1850.0%	1	R.QEMGEEEEENETFGLSKEYEELIK.L
UYB1_MOUSE94.5%123615.8%322357309.9(P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB)
	TK280802_E16_cyto_2D_step07.1779.1779.1	0.568	0.0129	593.75	5	3330.0%	1	R.RPYR.R
	TK280802_E16_cyto_2D_step08.2640.2640.3	2.4223	0.2514	3228.31	2	1980.0%	2	R.RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.Q
	TK280802_E16_cyto_2D_step07.2379.2379.1	0.9002	0.0375	747.97	6	5000.0%	2	R.RPYRR.R
	TK280802_E16_cyto_2D_step13.0475.0475.1	0.8655	0.0751	1422.45	2	2730.0%	1	R.RRPENPKPQDGK.E
	TK280802_E16_cyto_2D_step08.0402.0402.2	0.8986	0.0103	1266.95	4	3500.0%	1	R.RPENPKPQDGK.E
	TK280802_E16_cyto_2D_step08.0394.0394.1	0.8055	0.1487	592.7	4	5000.0%	5	R.RYPR.R
UQ8R0B294.5%115.5%236263696.8(Q8R0B2) Hypothetical 26.4 kDa protein (Fragment)
	TK280802_E16_cyto_2D_step13.2365.2365.2	2.0456	0.5258	1497.28	1	5000.0%	1	K.LFHTAPNVPHYAK.N
UHNT1_MOUSE94.4%73735.2%125136466.9(P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)
	TK280802_E16_cyto_2D_step09.5113.5113.2	1.1952	0.1461	2294.45	19	2110.0%	6	R.CLAFHDISPQAPTHFLVIPK.K
*	TK280802_E16_cyto_2D_step13.3256.3256.2	1.9477	0.4431	2546.96	1	3260.0%	1	R.MVVNEGADGGQSVYHIHLHVLGGR.Q
USTN1_MOUSE94.3%4617.6%148171436.0(P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein)
*	TK280802_E16_cyto_2D_step01.2655.2655.1	1.8016	0.2655	1315.09	3	4550.0%	1	K.ESVPDFPLSPPK.K
	TK280802_E16_cyto_2D_step10.3502.3502.2	1.6343	0.1257	1546.97	1	5000.0%	2	K.RASGQAFELILSPR.S
UNED4_MOUSE94.3%443.8%9571099685.6(P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment)
	TK280802_E16_cyto_2D_step06.2117.2117.1	1.143	0.1553	905.72	11	5000.0%	1	R.AHTCFNR.L
	TK280802_E16_cyto_2D_step01.2700.2700.1	0.877	0.012	1323.82	19	3890.0%	1	R.TYYVNHESRR.T
	TK280802_E16_cyto_2D_step08.2353.2353.1	0.654	0.0692	706.45	50	4000.0%	1	K.IPAHLR.G
	TK280802_E16_cyto_2D_step01.4131.4131.1	1.8512	0.2604	1551.12	2	4580.0%	1	K.EGFFELIPQDLIK.I
UABD4_HUMAN94.1%5175.1%606685976.6(O14678) ATP-binding cassette, sub-family D, member 4 (Peroxisomal membrane protein 69) (PMP69) (Peroxisomal membrane protein 1-like) (PXMP1-L) (P70R)
	TK280802_E16_cyto_2D_step08.4348.4348.2	2.7805	0.0849	1405.72	1	6250.0%	4	R.FLELAGLSNLVAR.T
	TK280802_E16_cyto_2D_step08.3795.3795.2	0.615	0.0567	2053.6	90	1470.0%	1	R.VNAEPAAFYRAGHVEHMR.T
UCAP1_MOUSE94.0%6186.5%474515757.5(P40124) Adenylyl cyclase-associated protein 1 (CAP 1)
	TK280802_E16_cyto_2D_step09.3933.3933.2	0.9017	0.0946	1928.26	6	2650.0%	1	R.SALFAQINQGESITHALK.H
	TK280802_E16_cyto_2D_step09.2133.2133.1	0.639	0.0225	489.75	1	7500.0%	1	K.KWR.V
	TK280802_E16_cyto_2D_step07.2153.2153.1	1.0011	0.0223	1124.41	117	2780.0%	4	K.HAEMVHTGLK.L
UHMG2_MOUSE93.8%2220.1%209240317.3(P30681) High mobility group protein 2 (HMG-2)
*	TK280802_E16_cyto_2D_step08.3039.3039.2	2.1153	0.4103	1581.63	1	4640.0%	1	K.IKIEHPGLSIGDTAK.K
*	TK280802_E16_cyto_2D_step04.3614.3614.3	1.4543	0.2001	3398.54	41	1540.0%	1	K.KNEPEDEEEEEEEEEEEDDEEEEEDEE.-
UQ924D293.6%554.4%15611699007.9(Q924D2) Myosin light chain kinase (Fragment)
	TK280802_E16_cyto_2D_step06.1890.1890.1	0.631	0.0095	597.83	9	5000.0%	1	R.QVKPK.T
	TK280802_E16_cyto_2D_step01.3011.3011.1	1.0607	0.0436	1598.84	102	2330.0%	1	K.SSLPPVLGTESDATVK.K
*	TK280802_E16_cyto_2D_step05.2464.2464.2	2.2118	0.4007	1304.23	1	5450.0%	1	K.RPESQGSAPVFK.E
*	TK280802_E16_cyto_2D_step06.5212.5212.1	0.7989	0.1189	1485.62	5	2920.0%	1	K.EKLQDVHVAEGEK.L
*	TK280802_E16_cyto_2D_step01.4889.4889.2	0.6928	0.0326	2603.18	4	1590.0%	1	R.ALSKDSGHFELLQNEDVFTLVLK.N
UGTP1_MOUSE93.4%5259.6%209234067.8(P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi)
	TK280802_E16_cyto_2D_step13.3456.3456.2	2.0658	0.2671	2138.63	2	3420.0%	5	K.ALPGHLKPFETLLSQNQGGK.A
URBB7_MOUSE93.2%6269.4%425477905.0(Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7)
	TK280802_E16_cyto_2D_step11.3895.3895.2	2.7313	0.297	2776.1	1	3700.0%	1	K.DYALHWLVLGTHTSDEQNHLVVAR.V
	TK280802_E16_cyto_2D_step08.2469.2469.2	1.8345	0.3393	1791.68	2	3330.0%	5	K.HPAKPDPSGECNPDLR.L
UGTFI_MOUSE93.1%445.5%9981123806.4(Q9ESZ8) General transcription factor II-I (GTFII-I) (TFII-I) (Bruton tyrosine kinase-associated protein-135) (BTK-associated protein-135) (BAP-135)
	TK280802_E16_cyto_2D_step07.2460.2460.2	1.0815	0.0328	1410.86	108	3180.0%	1	K.APSYLEISSMRR.I
	TK280802_E16_cyto_2D_step10.3429.3429.3	1.3036	0.0187	2087.35	40	1840.0%	1	K.ITINPGCVVVDGMPPGVSFK.A
	TK280802_E16_cyto_2D_step01.1228.1228.1	0.8726	0.1102	821.91	33	4170.0%	1	R.KYAQAIK.A
	TK280802_E16_cyto_2D_step11.2811.2811.2	2.0942	0.4084	1865.74	1	5000.0%	1	K.RPELLTHSTTEVTQPR.T
UQ9D89293.0%51113.1%198219465.9(Q9D892) 2010016I08Rik protein
	TK280802_E16_cyto_2D_step14.1808.1808.1	0.8236	0.0263	1076.85	27	3330.0%	1	K.KIVFVTGNAK.K
	TK280802_E16_cyto_2D_step01.0287.0287.1	0.9153	0.0121	948.81	22	3120.0%	1	K.IVFVTGNAK.K
	TK280802_E16_cyto_2D_step09.3986.3986.2	1.1144	0.0566	1798.61	3	4000.0%	3	K.LKPEGLHQLLAGFEDK.S
UPUR9_MOUSE92.8%7118.1%592641576.8(Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)]
	TK280802_E16_cyto_2D_step09.3782.3782.2	0.8117	0.0079	2166.02	3	2940.0%	1	K.AFTHTAQYDEAISDYFRK.Q
*	TK280802_E16_cyto_2D_step09.5156.5156.2	1.054	0.1673	2596.9	25	1430.0%	1	R.HLALKAFTHTAQYDEAISDYFR.K
*	TK280802_E16_cyto_2D_step01.2407.2407.1	0.9164	0.0474	1147.25	3	3640.0%	1	R.GAVDIPAAASFK.H
	TK280802_E16_cyto_2D_step13.2748.2748.2	0.7874	0.027	1358.19	291	2500.0%	2	K.TLHPAVHAGILAR.N
UQ9EST592.7%228.1%272310794.0(Q9EST5) Proliferation related acidic leucine rich protein PAL31 (Similar to acidic protein rich in leucines)
	TK280802_E16_cyto_2D_step01.2272.2272.1	2.1389	0.2089	1017.71	2	6250.0%	1	K.DISTLEPLK.R
*	TK280802_E16_cyto_2D_step10.0026.0026.1	0.8602	0.0371	1496.66	83	2500.0%	1	R.ELVLDNCKAMDGK.I
UQ8TDG492.7%71911.4%11011241756.5(Q8TDG4) DNA helicase HEL308
*	TK280802_E16_cyto_2D_step11.3850.3850.3	1.5476	0.0422	3155.65	1	1900.0%	1	R.IDSLGLVVVDELHMIGEGSRGATLEMTLAK.I
*	TK280802_E16_cyto_2D_step02.4648.4648.3	1.2545	0.1388	4050.82	1	1460.0%	1	K.DVLMILPYVAIVQEKISGLSSFGIELGFFVEEYAGSK.G
*	TK280802_E16_cyto_2D_step03.4970.4970.2	1.2952	0.2098	2405.3	5	2140.0%	4	K.SLYIATIEKGHSLVNSLIETGR.I
*	TK280802_E16_cyto_2D_step02.2711.2711.3	1.0823	0.2238	4404.19	10	640.0%	1	K.FNMPRGYIQNLLTGTASFSSCVLHFCEELEEFWVYR.A
UFAS_MOUSE92.7%557.2%838912137.7(P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment)
	TK280802_E16_cyto_2D_step08.1998.1998.1	0.5709	0.0066	416.9	1	5000.0%	1	K.AGIR.D
	TK280802_E16_cyto_2D_step07.2753.2753.2	1.6629	0.1201	1263.38	6	4000.0%	1	K.VSVHIIEGDHR.T
	TK280802_E16_cyto_2D_step01.4420.4420.2	1.3232	0.4695	2452.1	1	2270.0%	1	R.TLLEGSGLESIINIIHSSLAEPR.V
	TK280802_E16_cyto_2D_step09.2701.2701.2	1.674	0.0353	1496.24	16	3750.0%	1	K.LQASVRCLAQHGR.F
	TK280802_E16_cyto_2D_step01.3316.3316.1	1.7769	0.25	996.52	1	6250.0%	1	K.VLEALLPLK.S
UO9534792.5%110.8%11971357808.6(O95347) Chromosome-associated protein-E
*	TK280802_E16_cyto_2D_step01.2715.2715.1	2.2528	0.0303	1155.06	7	6250.0%	1	K.YEVLENKMK.N
UQ99LG292.3%4102.0%8871004565.0(Q99LG2) Similar to karyopherin beta 2b, transportin
	TK280802_E16_cyto_2D_step07.3527.3527.2	0.9491	0.0789	1427.55	58	2730.0%	1	R.ALVMLLEVRIDR.L
	TK280802_E16_cyto_2D_step06.2772.2772.1	1.6405	0.2383	715.77	1	7000.0%	3	K.ILHGFK.D
UMCM3_MOUSE92.2%101417.5%812915465.6(P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3)
*	TK280802_E16_cyto_2D_step08.2414.2414.2	1.2618	0.0081	1054.34	3	5620.0%	1	R.ELENGSHIR.G
	TK280802_E16_cyto_2D_step07.2784.2784.2	1.6327	0.3475	1425.08	1	5420.0%	1	R.SLAPSIHGHDYVK.K
	TK280802_E16_cyto_2D_step12.1861.1861.1	1.3277	0.2643	859.11	3	5000.0%	2	K.KYIHVAK.I
*	TK280802_E16_cyto_2D_step08.2177.2177.2	0.895	0.1186	1684.9	55	2080.0%	1	R.EISDHVLRMHQYR.A
	TK280802_E16_cyto_2D_step12.3545.3545.3	1.1933	0.1238	3780.57	4	1370.0%	1	K.TPMENIGLQDSLLSRFDLLFIMLDQMDPEQDR.E
*	TK280802_E16_cyto_2D_step07.2577.2577.1	1.1552	0.1951	1007.74	55	3750.0%	2	K.HDSLLHGTK.K
*	TK280802_E16_cyto_2D_step10.2979.2979.3	0.7831	0.0135	4239.87	9	790.0%	1	R.APGEQDGDALPLGSSVDILATDDPDFTQDDQQDTRIYEK.H
*	TK280802_E16_cyto_2D_step12.2585.2585.3	1.2128	0.0749	2477.92	81	1840.0%	1	R.DYLDFLDDEEDQGIYQNKVR.E
USYD_MOUSE92.2%8504.4%501571176.5(Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS)
	TK280802_E16_cyto_2D_step08.3864.3864.2	1.632	0.3854	1402.86	1	4090.0%	7	R.VTMLFLGLHNVR.Q
	TK280802_E16_cyto_2D_step09.2672.2672.1	1.2882	0.1705	1132.71	2	4440.0%	1	R.ALHHGIDLEK.I
UQ9CQX891.7%1112.7%1021110110.0(Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene)
*	TK280802_E16_cyto_2D_step13.2454.2454.2	2.5126	0.3461	1429.8	1	5830.0%	1	R.VVQVVKPHAPLIK.F
URL29_MOUSE91.7%82217.0%1591745611.8(P47915) 60S ribosomal protein L29
*	TK280802_E16_cyto_2D_step05.3102.3102.1	1.0083	0.0551	714.79	202	2860.0%	1	K.AGAKAPAK.A
*	TK280802_E16_cyto_2D_step06.2967.2967.1	1.4615	0.1996	899.0	8	5000.0%	4	R.LAFIAHPK.L
*	TK280802_E16_cyto_2D_step13.2010.2010.1	1.5619	0.1005	1194.99	4	4500.0%	2	K.ALVKPQAIKPK.M
U143E_HUMAN91.5%71513.7%255291744.7(P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E)
	TK280802_E16_cyto_2D_step01.0016.0016.1	1.2841	0.1081	917.57	1	7140.0%	1	R.IISSIEQK.E
	TK280802_E16_cyto_2D_step08.0424.0424.1	0.5253	0.0299	417.04	2	5000.0%	1	K.MIR.E
	TK280802_E16_cyto_2D_step01.3724.3724.1	2.0491	0.175	1479.0	2	5450.0%	2	K.LICCDILDVLDK.H
	TK280802_E16_cyto_2D_step01.1382.1382.1	1.5376	0.2677	1237.93	1	5000.0%	3	K.HLIPAANTGESK.V
UQ9D0Y491.3%4639.0%123140454.8(Q9D0Y4) 4831443O22Rik protein
	TK280802_E16_cyto_2D_step01.2648.2648.1	1.132	0.15	956.29	1	5620.0%	1	K.ITAVPTLLK.Y
	TK280802_E16_cyto_2D_step12.3010.3010.2	1.6686	0.4231	2547.47	1	3420.0%	2	K.HVTEDCVFIYCQVGDKPYWK.D
	TK280802_E16_cyto_2D_step11.2703.2703.3	1.2721	0.0196	2246.86	114	1810.0%	1	K.DTEGKSWCPDCVEAEPVIR.E
UODO1_MOUSE91.3%246.9%130151779.0(Q60597) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) (Fragment)
	TK280802_E16_cyto_2D_step08.3289.3289.1	1.6514	0.0719	1042.76	13	5620.0%	2	R.KPLIVFTPK.S
U143S_MOUSE91.2%228.9%248277134.8(O70456) 14-3-3 protein sigma (Stratifin)
*	TK280802_E16_cyto_2D_step08.2936.2936.2	0.9889	0.1508	1623.31	24	2690.0%	1	R.YEDMAAFMKSAVEK.G
	TK280802_E16_cyto_2D_step01.0002.0002.1	2.1823	0.1153	903.76	2	7140.0%	1	R.VLSSIEQK.S
URL31_HUMAN91.1%111016.4%1251446310.5(P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31
	TK280802_E16_cyto_2D_step07.2691.2691.1	1.7836	0.1057	759.84	1	7500.0%	10	R.IHGVGFK.K
	TK280802_E16_cyto_2D_step13.2210.2210.1	1.1276	0.3185	914.43	81	5000.0%	1	K.RIHGVGFK.K
USPH2_MOUSE91.0%224.9%617656186.6(Q9JIA7) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2)
	TK280802_E16_cyto_2D_step10.2343.2343.2	0.8329	0.0189	1221.61	12	2780.0%	1	R.LRPKPEARPR.D
*	TK280802_E16_cyto_2D_step13.2605.2605.2	2.0052	0.4446	2036.29	1	4210.0%	1	K.SELVLAPAPAPAATHSPLHR.S
UQ8R50991.0%481.5%528567549.2(Q8R509) Polypirimidine tract binding protein
	TK280802_E16_cyto_2D_step05.2438.2438.2	2.0081	0.449	966.26	1	7860.0%	2	K.HQSVQLPR.E
UPSD4_MOUSE90.9%9653.7%376407044.8(O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein)
	TK280802_E16_cyto_2D_step05.2646.2646.1	1.6621	0.0824	753.7	4	5830.0%	8	R.VAHLALK.H
	TK280802_E16_cyto_2D_step06.2097.2097.1	1.0937	0.1092	822.8	34	5000.0%	1	K.LHTVQPK.G
UQ9EPK690.9%7493.2%465524035.2(Q9EPK6) Sil1 protein precursor
*	TK280802_E16_cyto_2D_step07.3678.3678.2	1.9437	0.1239	1620.4	1	5000.0%	7	K.LLVILATNQPLPAKK.K
UAP19_MOUSE90.7%41020.7%111121629.1(P56212) cAMP-regulated phosphoprotein 19 (ARPP-19)
	TK280802_E16_cyto_2D_step13.2614.2614.2	1.8382	0.3985	1673.98	1	4640.0%	1	R.YPHLGQKPGGSDFLR.K
	TK280802_E16_cyto_2D_step07.2265.2265.1	1.531	0.2734	830.04	1	5710.0%	3	R.KPSLVASK.L
UQ91W8390.5%3315.2%309334295.2(Q91W83) Putative TAT protein (Transactivating regulatory protein)
	TK280802_E16_cyto_2D_step12.3025.3025.2	2.6012	0.2577	1275.25	1	7000.0%	1	R.ILRPGGCLFLK.E
	TK280802_E16_cyto_2D_step14.4217.4217.3	1.2709	0.124	3097.89	21	1480.0%	1	R.CANCPYLGMPAFKPGEQVLLSNSNLQDA.-
	TK280802_E16_cyto_2D_step05.2111.2111.1	1.4198	0.3385	883.81	2	5710.0%	1	K.RPDPASLK.A
UTDBP_MOUSE90.5%112.9%414445486.7(Q921F2) TAR DNA-binding protein-43 (TDP-43)
	TK280802_E16_cyto_2D_step01.3803.3803.1	1.9222	0.2323	1344.21	2	5000.0%	1	K.TSDLIVLGLPWK.T
UR23A_MOUSE90.4%5252.5%363397704.6(P54726) UV excision repair protein RAD23 homolog A (MHR23A)
	TK280802_E16_cyto_2D_step04.3210.3210.1	1.3363	0.2712	1038.98	5	4380.0%	5	K.NFVVVMVTK.A
UQ9JII690.3%224.9%324364567.4(Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase)
	TK280802_E16_cyto_2D_step09.3520.3520.2	1.1562	0.2886	1940.81	3	3000.0%	1	K.LWNTKHHPEDVEPALR.K
	TK280802_E16_cyto_2D_step06.4869.4869.1	1.6274	0.2393	1302.69	1	4000.0%	1	K.HHPEDVEPALR.K
UDRG1_MOUSE90.3%3314.4%367405128.9(P32233) Developmentally regulated GTP-binding protein 1 (DRG 1) (Nedd3 protein)
	TK280802_E16_cyto_2D_step09.2694.2694.2	1.144	0.0922	1946.76	14	2500.0%	1	R.ELITPKGGGGGGPGEGFDVAK.T
	TK280802_E16_cyto_2D_step13.2428.2428.1	1.7773	0.2336	1060.82	4	5560.0%	1	K.ATAHHLGLLK.A
	TK280802_E16_cyto_2D_step01.2928.2928.2	0.9258	0.0239	2521.28	61	1670.0%	1	R.IYTKPKGQLPDYTSPVVLPYSR.T
UQ8TB8490.1%117.0%172204908.8(Q8TB84) Hypothetical protein
*	TK280802_E16_cyto_2D_step01.2663.2663.1	1.5318	0.2806	1379.35	1	4090.0%	1	R.LVGLPVHLLFLR.F
USPSY_MOUSE90.0%3310.7%366413135.1(P97355) Spermine synthase (EC 2.5.1.22) (Spermidine aminopropyltransferase) (SPMSY)
	TK280802_E16_cyto_2D_step10.3258.3258.3	1.3464	0.0392	3129.11	1	1900.0%	1	R.LVEYDIDEVVYDEDSPYQNIKILHSK.Q
	TK280802_E16_cyto_2D_step12.2303.2303.2	2.6017	0.1992	852.71	1	8330.0%	1	K.RLPPIVR.G
	TK280802_E16_cyto_2D_step04.1934.1934.1	0.9865	0.1205	711.97	3	5000.0%	1	K.EDYTGK.D
UPSA7_MOUSE89.8%4420.6%248278558.5(Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1)
	TK280802_E16_cyto_2D_step01.2527.2527.1	0.9138	0.0747	1101.27	239	3330.0%	1	K.DIVVLGVEKK.S
	TK280802_E16_cyto_2D_step01.3497.3497.2	1.0961	0.0922	2453.46	11	2140.0%	1	R.AITVFSPDGHLFQVEYAQEAVK.K
	TK280802_E16_cyto_2D_step15.3026.3026.2	0.8463	0.0832	2030.32	30	2220.0%	1	K.ALLEVVQSGGKNIELAVMR.R
	TK280802_E16_cyto_2D_step01.2771.2771.1	1.6042	0.2387	972.94	1	6250.0%	1	K.DIVVLGVEK.K
URADI_MOUSE89.7%593.6%583684526.1(P26043) Radixin
	TK280802_E16_cyto_2D_step07.2652.2652.2	1.4072	0.0874	1414.31	14	3640.0%	1	K.EIHKPGYLANDR.L
	TK280802_E16_cyto_2D_step07.2533.2533.2	1.0451	0.0243	1251.48	1	6250.0%	2	R.IQNWHEEHR.G
UALDR_MOUSE89.3%72114.3%315356017.2(P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase)
	TK280802_E16_cyto_2D_step07.2516.2516.1	2.1357	0.0585	883.75	3	7140.0%	4	R.ILNKPGLK.Y
	TK280802_E16_cyto_2D_step06.2971.2971.2	1.3916	0.2574	2218.74	5	2650.0%	2	K.YKPAVNQIECHPYLTQEK.L
	TK280802_E16_cyto_2D_step15.3286.3286.2	0.727	0.0407	2225.15	378	1390.0%	1	K.VFDFEVSSEDMATLLSYNR.N
UALD1_MOUSE89.3%51712.4%315358577.3(P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7)
	TK280802_E16_cyto_2D_step07.2516.2516.1	2.1357	0.0585	883.75	3	7140.0%	4	R.LLNKPGLK.H
*	TK280802_E16_cyto_2D_step08.4151.4151.3	0.938	0.1107	3586.11	40	1000.0%	1	K.SVTPSRIQENLQVFDFQLSEEDMAAILSFNR.N
UNDKA_MOUSE89.2%2213.2%152172087.4(P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1)
	TK280802_E16_cyto_2D_step01.2495.2495.1	1.551	0.256	1345.37	1	4090.0%	1	R.TFIAIKPDGVQR.G
	TK280802_E16_cyto_2D_step01.2791.2791.1	1.5705	0.0648	829.16	16	5710.0%	1	R.GLVGEIIK.R
UQ9Z33289.2%392.2%553593357.9(Q9Z332) Keratin 6 alpha
	TK280802_E16_cyto_2D_step01.3691.3691.1	1.6695	0.1862	1306.23	1	5450.0%	3	R.SLDLDSIIAEVK.A
UQ922K289.1%91515.1%641749236.8(Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment)
	TK280802_E16_cyto_2D_step08.3613.3613.2	1.0205	0.0253	1766.82	243	2310.0%	1	K.QHTFRVNLFTDFDK.Y
	TK280802_E16_cyto_2D_step08.1831.1831.2	0.9689	0.0111	1190.14	324	2780.0%	1	K.QPFKDLGNLR.Y
	TK280802_E16_cyto_2D_step11.3479.3479.2	2.3791	0.3558	1705.29	1	5380.0%	1	R.GFHCESSAHWPIFK.W
	TK280802_E16_cyto_2D_step13.2957.2957.3	1.4888	0.1352	3061.2	2	1850.0%	1	K.DRPQEADGIDSVIVVDNVPQVGPDRLEK.L
	TK280802_E16_cyto_2D_step08.2569.2569.1	1.3831	0.1216	712.9	2	6250.0%	3	K.LHWQK.N
	TK280802_E16_cyto_2D_step01.1280.1280.1	0.6687	0.0423	851.14	103	3330.0%	1	K.LKNVIHK.I
	TK280802_E16_cyto_2D_step12.3134.3134.2	1.0221	0.1829	2161.42	4	2220.0%	1	K.FAVLHGEAPRISVSFYHVK.S
UQ9DCG989.0%229.6%125141415.3(Q9DCG9) 0610038D11Rik protein
	TK280802_E16_cyto_2D_step13.2724.2724.2	1.9401	0.5368	1390.73	1	6360.0%	1	K.LLTHNLLSSHVR.G
UKPY1_HUMAN88.9%7379.4%530578067.8(P14618) Pyruvate kinase, M1 isozyme (EC 2.7.1.40) (Pyruvate kinase muscle isozyme) (Cytosolic thyroid hormone-binding protein) (CTHBP) (THBP1)
	TK280802_E16_cyto_2D_step09.4154.4154.2	1.4684	0.2433	1879.05	1	3440.0%	6	R.AGKPVICATQMLESMIK.K
	TK280802_E16_cyto_2D_step14.2191.2191.3	0.9258	0.1993	3382.07	2	780.0%	1	R.LAPITSDPTEATAVGAVEASFKCCSGAIIVLTK.S
URAC1_HUMAN88.8%61415.1%192214508.5(P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25)
	TK280802_E16_cyto_2D_step08.3341.3341.2	2.5538	0.2927	1633.32	1	5360.0%	2	K.KLTPITYPQGLAMAK.E
	TK280802_E16_cyto_2D_step13.2621.2621.2	2.054	0.2222	1589.33	2	4620.0%	3	R.HHCPNTPIILVGTK.L
URL2A_MOUSE88.7%61020.4%1471645811.1(P14115) 60S ribosomal protein L27a (L29)
	TK280802_E16_cyto_2D_step07.2103.2103.1	1.1833	0.1163	684.6	79	5000.0%	2	K.QPVIVK.A
	TK280802_E16_cyto_2D_step05.2651.2651.1	0.8545	0.0597	968.5	16	3570.0%	1	K.YHPGYFGK.V
	TK280802_E16_cyto_2D_step01.2878.2878.1	1.5685	0.242	1142.08	1	6000.0%	2	K.TGVAPIIDVVR.S
	TK280802_E16_cyto_2D_step13.1593.1593.1	1.1932	0.0375	697.58	1	7500.0%	1	R.HYHLK.R
UQ6115788.6%1115.4%6572004.8(Q61157) YSK4 (Fragment)
*	TK280802_E16_cyto_2D_step01.2063.2063.1	1.669	0.2296	1216.72	3	3890.0%	1	R.KLQEEVDLLK.A
UQ9Z1F988.0%5711.3%638705695.2(Q9Z1F9) ARX
	TK280802_E16_cyto_2D_step03.4112.4112.2	0.9012	0.0978	2801.69	6	1880.0%	1	K.NLVLTGFSHIDLIDLDTIDVSNLNR.Q
	TK280802_E16_cyto_2D_step05.2343.2343.2	1.7587	0.1897	1863.32	1	3930.0%	1	K.GVTECYECHPKPTQR.T
	TK280802_E16_cyto_2D_step11.2882.2882.2	0.8155	0.0027	1993.82	215	2330.0%	2	K.KGVTECYECHPKPTQR.T
*	TK280802_E16_cyto_2D_step13.3044.3044.3	2.3944	0.3186	3443.98	1	2080.0%	1	K.RKPPVPLDWAEVQSQGEANADQQNEPQLGLK.D
URL44_HUMAN87.3%51712.4%1051231010.6(P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a)
	TK280802_E16_cyto_2D_step11.2114.2114.1	0.5629	9.0E-4	711.69	10	3750.0%	1	R.RTFCK.K
	TK280802_E16_cyto_2D_step01.0972.0972.1	1.9043	0.1242	903.9	1	7140.0%	4	K.HFELGGDK.K
UDCUP_MOUSE87.2%246.0%367405986.7(P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD)
*	TK280802_E16_cyto_2D_step12.4093.4093.2	1.9195	0.3793	2365.44	1	4050.0%	2	R.LRDPAAAASELGYVFQAITLTR.Q
UUBIQ_HUMAN86.6%183247.9%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin
	TK280802_E16_cyto_2D_step01.0716.0716.1	2.0636	0.0917	650.84	3	8000.0%	18	R.LIFAGK.Q
UQ9H9J386.3%51131.6%155172029.6(Q9H9J3) Hypothetical protein FLJ12700
*	TK280802_E16_cyto_2D_step01.4501.4501.1	0.9717	0.082	1253.22	14	3750.0%	3	K.GRSPATGAALTPR.F
*	TK280802_E16_cyto_2D_step15.2090.2090.3	1.0983	0.1433	2475.94	115	800.0%	1	-.MEEAAAAPISPWTMAATIQAMER.K
*	TK280802_E16_cyto_2D_step15.2357.2357.3	1.1012	0.0028	2709.34	9	1850.0%	1	R.SPATGAALTPRFQMFLWTPVQMQK.L
URL6_MOUSE85.8%164219.5%2873261210.8(P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107)
	TK280802_E16_cyto_2D_step01.0766.0766.1	1.3242	0.0566	607.4	26	7500.0%	3	R.VVFLK.Q
*	TK280802_E16_cyto_2D_step05.4279.4279.2	2.0209	0.3175	1530.36	4	4640.0%	4	R.SSITPGTVLIILTGR.H
*	TK280802_E16_cyto_2D_step08.2190.2190.1	1.1104	0.0748	609.43	2	5000.0%	3	K.KVHPK.G
	TK280802_E16_cyto_2D_step01.0116.0116.1	1.2509	0.3543	867.8	1	6430.0%	1	K.FVIATSTK.V
*	TK280802_E16_cyto_2D_step01.2740.2740.1	1.6673	0.1649	999.04	2	5620.0%	1	K.AVDLQILPK.I
	TK280802_E16_cyto_2D_step05.1929.1929.1	1.0021	0.096	656.32	1	6000.0%	1	K.LLSHGK.K
	TK280802_E16_cyto_2D_step13.1706.1706.2	1.7673	0.2833	1002.14	1	7140.0%	2	K.KPFSQHVR.R
UEFTU_HUMAN85.7%225.3%452495427.6(P49411) Elongation factor Tu, mitochondrial precursor (P43)
*	TK280802_E16_cyto_2D_step13.2014.2014.2	1.9694	0.3915	1811.78	1	4690.0%	1	R.DKPHVNVGTIGHVDHGK.T
*	TK280802_E16_cyto_2D_step12.1273.1273.1	0.7996	0.0799	774.63	1	4170.0%	1	R.DPELGLK.S
UQ9D09685.7%2216.4%177193188.2(Q9D096) 2610034N03Rik protein
	TK280802_E16_cyto_2D_step01.2846.2846.1	1.5062	0.2659	1517.8	1	3930.0%	1	K.GLGSTVQEIDLTGVK.L
*	TK280802_E16_cyto_2D_step01.3675.3675.1	1.0008	0.1927	1583.95	20	2690.0%	1	R.ILGIPVIITEQYPK.G
UMPRI_MOUSE85.2%15514.9%24832738145.7(Q07113) Cation-independent mannose-6-phosphate receptor precursor (CI Man-6-P receptor) (CI-MPR) (Insulin-like growth factor II receptor) (300 kDa mannose 6-phosphate receptor) (MPR 300) (MPR300)
*	TK280802_E16_cyto_2D_step03.3322.3322.3	1.4838	0.0635	2446.48	150	1790.0%	1	K.LEVIDETVIVTYSKGYPCGGNK.T
	TK280802_E16_cyto_2D_step15.2545.2545.2	0.9253	0.0167	1755.33	133	2140.0%	3	K.LVSFHDDSDEDLLHI.-
*	TK280802_E16_cyto_2D_step09.2210.2210.2	0.8914	0.0327	1523.97	1	3080.0%	1	R.NGSSIIDLSPLIHR.T
*	TK280802_E16_cyto_2D_step10.2131.2131.3	0.9738	0.0073	2641.36	2	1430.0%	1	K.LTYYDGMIQLSYRNGTPYNNEK.H
*	TK280802_E16_cyto_2D_step06.2583.2583.1	1.4328	0.3447	855.59	1	5830.0%	1	R.IHLVCGR.G
*	TK280802_E16_cyto_2D_step06.4003.4003.3	1.5989	0.0656	2674.68	6	2020.0%	1	K.EEETDENETEWLMEEIQVPAPR.L
*	TK280802_E16_cyto_2D_step08.3413.3413.2	0.7278	0.0305	1236.73	54	2270.0%	1	K.VPVDGPPIDIGR.V
*	TK280802_E16_cyto_2D_step05.1857.1857.1	1.2874	0.1911	715.01	2	4170.0%	6	R.KPTAPAK.L
UQ9H8U484.9%444.9%669742668.5(Q9H8U4) Hypothetical protein FLJ13220
*	TK280802_E16_cyto_2D_step04.2639.2639.2	0.8135	0.181	1196.95	3	3330.0%	1	R.ATGAALLVAPGPR.S
*	TK280802_E16_cyto_2D_step06.2432.2432.2	2.1144	0.3489	1324.85	1	6820.0%	1	R.NFSIVAHVDHGK.S
*	TK280802_E16_cyto_2D_step05.2271.2271.2	1.1695	0.0866	945.12	106	3570.0%	1	R.LYSSAEFK.E
UCO3_MOUSE84.9%442.7%16631864826.8(P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin]
*	TK280802_E16_cyto_2D_step14.1856.1856.2	0.6577	0.031	1637.23	139	1250.0%	1	R.AVLFNYREQEELK.V
*	TK280802_E16_cyto_2D_step08.2828.2828.1	1.0578	0.0241	1093.85	20	4290.0%	1	K.LCHSEMCR.C
	TK280802_E16_cyto_2D_step01.0323.0323.1	1.3044	0.0107	904.64	30	5710.0%	1	K.GVFVLNKK.N
*	TK280802_E16_cyto_2D_step11.3496.3496.2	1.9354	0.4133	1753.74	1	3330.0%	1	K.TVVILIETPDGIPVKR.D
UQ9UFU884.8%11836.1%917994396.9(Q9UFU8) Hypothetical protein (Fragment)
*	TK280802_E16_cyto_2D_step09.5200.5200.2	1.2734	0.2507	3140.88	2	1610.0%	1	R.IHFGGLIEEDDVILLAAALRIQNMVSSGR.R
*	TK280802_E16_cyto_2D_step07.1915.1915.2	0.7372	0.0044	1200.06	143	2000.0%	1	K.DIELSPEAQAK.I
*	TK280802_E16_cyto_2D_step08.4267.4267.2	2.1308	0.1279	1539.45	7	4330.0%	9	K.MHGGGPSVTAGVPLKK.E
UCAD2_MOUSE84.8%576.1%906997614.8(P15116) Neural-cadherin precursor (N-cadherin) (Cadherin-2)
*	TK280802_E16_cyto_2D_step12.2383.2383.1	1.4582	0.2933	1209.12	1	5500.0%	1	R.QLAKHSGALQR.Q
*	TK280802_E16_cyto_2D_step12.4573.4573.3	2.0132	0.0068	2997.43	4	1810.0%	1	R.IAGGRGTLLPLLAALLQASVEASGEIALCK.T
	TK280802_E16_cyto_2D_step06.3008.3008.3	1.3469	0.0722	1643.35	12	1920.0%	1	R.QAKQLLIDPEDDVR.D
UK22E_HUMAN84.4%81218.6%645658658.0(P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e)
*	TK280802_E16_cyto_2D_step02.5112.5112.3	1.1458	0.0414	4653.09	2	1050.0%	1	K.SISISVAGGGGGFGAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F
*	TK280802_E16_cyto_2D_step12.4133.4133.2	2.0146	0.0509	2654.39	6	1830.0%	1	R.SLVGLGGTKSISISVAGGGGGFGAAGGFGGR.G
*	TK280802_E16_cyto_2D_step03.3579.3579.2	1.3346	0.38	3050.5	1	2120.0%	1	K.VLYDAEISQIHQSVTDTNVILSMDNSR.N
*	TK280802_E16_cyto_2D_step08.2657.2657.2	2.0374	0.3603	1323.02	1	6330.0%	2	R.HGGGGGGFGGGGFGSR.S
*	TK280802_E16_cyto_2D_step09.2608.2608.3	1.7259	0.228	2434.22	1	2500.0%	1	R.STSSFSCLSRHGGGGGGFGGGGFGSR.S
UQ9NVM684.4%141963.3%304346878.5(Q9NVM6) Hypothetical protein FLJ10634
*	TK280802_E16_cyto_2D_step09.3513.3513.1	1.4601	0.1609	1110.02	5	4440.0%	14	K.GGYSKDVLLR.L
UALFA_MOUSE84.4%61012.1%363392258.1(P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase)
	TK280802_E16_cyto_2D_step09.3906.3906.2	1.0432	0.0218	2089.16	39	2350.0%	1	R.VNPCIGGVILFHETLYQK.A
	TK280802_E16_cyto_2D_step14.2129.2129.2	0.5543	0.0595	1644.82	77	1920.0%	1	K.RLQSIGTENTEENR.R
*	TK280802_E16_cyto_2D_step06.2664.2664.2	2.1036	0.3542	1379.4	1	5450.0%	2	-.PHPYPALTPEQK.K
UNPA1_HUMAN84.2%112.4%590627508.4(Q99742) Neuronal PAS domain protein 1 (Neuronal PAS1) (Member of PAS protein 5) (MOP5)
*	TK280802_E16_cyto_2D_step01.3735.3735.1	2.0894	0.0513	1481.06	4	4230.0%	1	K.LLPLPGAISIQLDK.A
UZYX_MOUSE84.1%4413.3%564607906.9(Q62523) Zyxin
*	TK280802_E16_cyto_2D_step12.4086.4086.3	1.5011	0.0202	4338.26	1	1320.0%	1	K.AYHPQCFTCVVCACPLEGTSFIVDQANQPHSVPDYHK.Q
*	TK280802_E16_cyto_2D_step14.3895.3895.2	0.9253	0.2161	2691.09	4	1820.0%	1	K.EKPLVQEKQHPQPPPAQNQNQVR.S
	TK280802_E16_cyto_2D_step05.2376.2376.1	0.8344	0.0153	676.96	29	5000.0%	1	K.NFHMK.C
	TK280802_E16_cyto_2D_step06.2628.2628.2	1.9279	0.4411	1054.91	1	7220.0%	1	K.FAPVVAPKPK.V
UQ91V4183.8%41025.6%215238976.2(Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512)
*	TK280802_E16_cyto_2D_step03.4612.4612.2	0.8831	0.1058	2718.71	5	1520.0%	1	-.MATAPYNYSYIFKYIIIGDMGVGK.S
	TK280802_E16_cyto_2D_step13.2466.2466.3	2.7073	0.3366	3281.66	1	2080.0%	3	K.KIYQNIQDGSLDLNAAESGVQHKPSAPQGGR.L
UQ9EQC882.8%359.4%491523024.9(Q9EQC8) Papillary renal cell carcinoma-associated protein
*	TK280802_E16_cyto_2D_step06.3204.3204.2	1.3744	0.3203	2240.8	2	2500.0%	2	K.TKPASLAPVLGTTTTTPSPSAIK.A
	TK280802_E16_cyto_2D_step15.4526.4526.3	1.2474	0.0316	2669.39	105	1480.0%	1	R.EEINFVEIKGDDQLSGAQQWMTK.S
UQ8WYI382.8%243.1%2232614410.1(Q8WYI3) MSTP023
	TK280802_E16_cyto_2D_step07.2695.2695.1	1.532	0.2235	913.99	3	7500.0%	2	K.QYALYKK.M
UQ91X8182.8%392.8%318364877.8(Q91X81) Unknown (Protein for MGC:18702)
	TK280802_E16_cyto_2D_step05.4254.4254.1	1.421	0.0883	986.8	73	3750.0%	3	R.YSSEQNGAK.I
UO0879482.8%8127.2%9661094046.2(O08794) Alpha glucosidase II, alpha subunit
	TK280802_E16_cyto_2D_step08.2747.2747.2	2.0467	0.3447	1147.39	1	6110.0%	2	R.SIRPGLSPYR.A
	TK280802_E16_cyto_2D_step10.3098.3098.2	1.1134	0.0483	1235.97	38	4000.0%	1	R.KLVAIVDPHIK.V
	TK280802_E16_cyto_2D_step04.2174.2174.1	0.7942	0.0010	748.9	15	3750.0%	2	R.RPRYR.V
*	TK280802_E16_cyto_2D_step04.3046.3046.2	0.8916	0.0065	1684.18	1	3750.0%	1	R.VVIMGAGKPAAVVLQTK.G
	TK280802_E16_cyto_2D_step05.2676.2676.3	1.6409	0.096	1855.77	1	2830.0%	1	K.VLLVLELQGLQKNMTR.I
	TK280802_E16_cyto_2D_step11.2012.2012.2	0.8355	0.2562	1250.08	18	2000.0%	1	R.LKVTEGGEPYR.L
UCBX1_HUMAN82.8%249.2%185214184.9(P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25) (P23197) Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Modifier 1 protein) (M31) (Heterochromatin protein p25)
	TK280802_E16_cyto_2D_step10.3090.3090.2	2.04	0.3508	2110.89	1	4690.0%	2	K.KVEEVLEEEEEEYVVEK.V
URS24_HUMAN82.5%6269.8%1331542310.8(P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19)
	TK280802_E16_cyto_2D_step06.2024.2024.1	1.5272	0.2275	704.71	1	5830.0%	5	R.THFGGGK.T
	TK280802_E16_cyto_2D_step01.0388.0388.1	1.3063	0.1308	746.78	5	6000.0%	1	R.HGLYEK.K
UO0042982.0%61212.4%736818916.8(O00429) Dynamin-like protein
	TK280802_E16_cyto_2D_step14.3201.3201.3	0.942	0.011	4038.6	64	470.0%	1	-.MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGK.S
	TK280802_E16_cyto_2D_step10.2691.2691.2	1.1382	0.1253	1395.54	3	4170.0%	3	K.SKPIPIMPASPQK.G
	TK280802_E16_cyto_2D_step13.2674.2674.2	0.8111	0.0493	1636.21	296	1920.0%	1	K.LHDAIVEVVTCLLR.K
	TK280802_E16_cyto_2D_step07.3451.3451.3	0.8757	0.1131	3271.8	24	1000.0%	1	R.CVELVHEEMQRIIQHCSNYSTQELLR.F
UDYHC_MOUSE81.6%19234.3%46445320306.4(Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain)
	TK280802_E16_cyto_2D_step06.0596.0596.1	0.7517	0.0	646.65	3	3750.0%	1	R.EELKK.V
	TK280802_E16_cyto_2D_step04.2314.2314.1	1.2481	0.0602	808.09	2	6000.0%	2	K.QVELYR.N
	TK280802_E16_cyto_2D_step07.2184.2184.1	0.6871	6.0E-4	516.94	5	5000.0%	1	K.EDPR.S
*	TK280802_E16_cyto_2D_step08.4111.4111.3	1.2569	0.0876	2901.21	3	1730.0%	1	K.LQGATCSNNKLSLSNAISTVLPLTQLR.W
*	TK280802_E16_cyto_2D_step09.4010.4010.2	0.9678	0.0107	1860.4	2	2670.0%	1	R.ILVDDTIITTLENLKR.E
	TK280802_E16_cyto_2D_step08.5008.5008.2	0.6994	0.0334	2598.46	400	1140.0%	1	R.FGNPLLVQDVESYDPVLNPVLNR.E
	TK280802_E16_cyto_2D_step12.1889.1889.1	1.6956	0.1993	1009.02	1	6430.0%	1	K.KQHLVEVR.S
*	TK280802_E16_cyto_2D_step01.1571.1571.1	0.9902	0.0051	873.92	120	4170.0%	1	K.NFPARLR.Q
	TK280802_E16_cyto_2D_step06.2319.2319.1	1.1426	0.1441	852.01	1	5710.0%	1	K.ALGHQLGR.F
	TK280802_E16_cyto_2D_step09.3769.3769.2	1.6096	0.4065	2529.02	1	3180.0%	2	K.TKPVTGNLRPEEALQALTIYEGK.F
*	TK280802_E16_cyto_2D_step12.1689.1689.1	1.1457	0.0134	945.89	41	5000.0%	1	K.LPQPPTHR.E
	TK280802_E16_cyto_2D_step07.2417.2417.2	0.8701	0.0894	1227.16	4	3330.0%	1	R.VEPLRNELQK.L
	TK280802_E16_cyto_2D_step07.3815.3815.3	1.3894	0.0314	2891.51	20	1500.0%	1	K.TKPVTGNLRPEEALQALTIYEGKFGR.L
	TK280802_E16_cyto_2D_step08.2535.2535.2	1.2749	0.2642	1459.61	315	2500.0%	1	R.QDLADVVQVCEGK.K
	TK280802_E16_cyto_2D_step07.2597.2597.1	0.7871	0.0042	636.7	27	3750.0%	1	R.EKCAK.A
	TK280802_E16_cyto_2D_step07.3631.3631.1	0.6832	0.1075	696.3	31	3000.0%	1	R.LIPSLR.T
	TK280802_E16_cyto_2D_step08.4248.4248.3	1.2834	0.0102	3018.9	5	1940.0%	1	R.SMANPPAAVKLALESICLLLGESTTDWK.Q
UQ9D6U481.4%245.1%257286995.0(Q9D6U4) 2310057D15Rik protein
*	TK280802_E16_cyto_2D_step06.3190.3190.2	1.345	0.0059	1533.12	16	3750.0%	2	K.VYIYSSRSVEAQK.L
UQ6086481.2%335.5%543625826.8(Q60864) MSTI1
	TK280802_E16_cyto_2D_step01.3520.3520.1	0.9596	0.0817	1101.21	6	3330.0%	1	K.LMDVGLIAIR.-
	TK280802_E16_cyto_2D_step01.2930.2930.1	1.9932	0.1565	1490.01	1	4580.0%	1	R.LAYINPDLALEEK.N
	TK280802_E16_cyto_2D_step01.1392.1392.1	0.8281	0.0093	892.89	39	5000.0%	1	K.KCQQAEK.I
UQ9Z24381.2%114318.8%457506485.2(Q9Z243) NNX3
	TK280802_E16_cyto_2D_step01.5090.5090.1	1.0269	0.0319	1139.45	6	4440.0%	6	K.QAVGLVEHRK.E
*	TK280802_E16_cyto_2D_step11.4296.4296.2	1.1065	0.0208	2620.96	46	1740.0%	1	K.EFLSPSLAPYSAIAHHALPTIPER.K
*	TK280802_E16_cyto_2D_step13.3144.3144.2	1.8526	0.271	2444.5	1	3100.0%	2	R.QEELLGELESKPDTVIANGEDR.V
*	TK280802_E16_cyto_2D_step09.2362.2362.2	1.0399	0.0629	1299.74	2	3640.0%	1	K.MSDAAGDFVDIR.E
*	TK280802_E16_cyto_2D_step11.5103.5103.3	1.2956	0.1274	4449.97	5	1280.0%	1	K.KPLPSGVSEAFSGTVIEKEFLSPSLAPYSAIAHHALPTIPER.K
UEZH2_MOUSE81.1%4102.3%746853366.8(Q61188) Enhancer of zeste homolog 2 (ENX-1)
	TK280802_E16_cyto_2D_step06.3830.3830.1	0.2762	0.017	445.34	10	1670.0%	1	K.TPPK.R
	TK280802_E16_cyto_2D_step07.3551.3551.2	2.2136	0.0569	1401.34	3	5000.0%	3	K.KDETSSSSEANSR.C
UTRAL_MOUSE81.1%242.0%706802096.7(Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1)
	TK280802_E16_cyto_2D_step01.2803.2803.1	1.8342	0.1896	1515.98	1	3850.0%	2	R.GVVDSEDIPLNLSR.E
UACDV_MOUSE80.9%8504.3%656708768.7(P50544) Acyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor (EC 1.3.99.-) (VLCAD) (MVLCAD)
*	TK280802_E16_cyto_2D_step04.3921.3921.2	1.6492	0.3076	2704.73	3	2500.0%	7	R.EATQAVLDKPETLSSDASTREKPAR.A
	TK280802_E16_cyto_2D_step08.0424.0424.1	0.5253	0.0299	417.04	2	5000.0%	1	K.QLR.R
UPRS8_HUMAN80.3%243.0%406456267.5(P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG)
	TK280802_E16_cyto_2D_step08.2804.2804.2	1.6044	0.1819	1428.51	6	4550.0%	2	R.AVAHHTDCTFIR.V
UQ9WTM580.1%6187.8%463511135.6(Q9WTM5) DNA helicase
	TK280802_E16_cyto_2D_step05.2755.2755.2	1.2976	0.103	1160.42	23	5000.0%	1	K.VQAGDVITIDK.A
	TK280802_E16_cyto_2D_step08.3304.3304.2	1.4954	0.2796	1949.3	1	3750.0%	4	K.EVVHTVSLHEIDVINSR.T
	TK280802_E16_cyto_2D_step13.1588.1588.1	0.9342	0.106	890.64	73	4290.0%	1	R.IGAHSHIR.G
UQ9CWI480.1%3313.1%312349088.2(Q9CWI4) Esterase 10
	TK280802_E16_cyto_2D_step09.3249.3249.1	1.2121	0.199	858.85	3	6670.0%	1	K.KIPVVFR.L
*	TK280802_E16_cyto_2D_step13.4144.4144.2	1.8275	0.4606	2561.7	1	3000.0%	1	R.LQEGYDHSYYFIATFIADHIR.H
*	TK280802_E16_cyto_2D_step05.3495.3495.1	1.3247	0.0121	1400.67	7	3750.0%	1	K.KAFSGYLGPDESK.W
UCSE1_MOUSE79.8%91111.5%9711104555.8(Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein)
	TK280802_E16_cyto_2D_step13.2130.2130.1	1.5577	0.0269	1048.74	6	5000.0%	2	K.IHLAQSLHK.L
	TK280802_E16_cyto_2D_step08.5159.5159.3	0.8609	0.0786	3410.51	6	1120.0%	1	K.FFEGPVTGIFSGYVNSMLQEYAKNPSVNWK.H
	TK280802_E16_cyto_2D_step04.2967.2967.3	1.0455	0.1203	1761.05	139	1500.0%	1	K.YGALALQEIFDGIQPK.M
	TK280802_E16_cyto_2D_step05.2768.2768.1	1.1511	0.1817	803.64	5	5830.0%	1	R.TAHSLFK.R
	TK280802_E16_cyto_2D_step02.4232.4232.2	0.9523	0.0673	3074.65	64	1400.0%	1	K.LLAVSKNPSKPHFNHYMFEAICLSIR.I
	TK280802_E16_cyto_2D_step14.1813.1813.3	1.1334	0.2153	1615.71	213	1610.0%	1	K.HKDAAIYLVTSLASK.A
	TK280802_E16_cyto_2D_step12.1397.1397.1	0.6771	0.0654	942.35	25	2500.0%	1	R.TGNIPALVR.L
UPESC_MOUSE79.8%228.7%584677966.8(Q9EQ61) Pescadillo homolog 1
*	TK280802_E16_cyto_2D_step01.2443.2443.1	2.0369	0.0234	1567.8	2	3750.0%	1	K.DIKFLLHEPIVNK.F
*	TK280802_E16_cyto_2D_step02.5291.5291.3	1.3953	0.1615	4412.18	9	1150.0%	1	K.VFLSIKGIYYQAEVLGQPIVWIAPYAFSHDHPTDVDYR.V
UQ9D0Z679.6%114.2%355387608.3(Q9D0Z6) 1110037P11Rik protein
*	TK280802_E16_cyto_2D_step10.2975.2975.2	1.9666	0.3474	1498.68	2	4290.0%	1	R.QVEAAADPADAKGPR.T
UQ9P2E679.5%223.4%853970498.0(Q9P2E6) Hypothetical protein KIAA1401 (Fragment)
	TK280802_E16_cyto_2D_step04.2526.2526.3	1.2497	0.0595	1760.36	268	2120.0%	1	R.EDVLWFKPVELRTK.W
*	TK280802_E16_cyto_2D_step12.2585.2585.2	1.8482	0.4158	1652.28	1	5360.0%	1	K.DGPPHQVLVVPLHSR.I
UPYR1_HUMAN79.4%794.3%22252429146.4(P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)]
*	TK280802_E16_cyto_2D_step07.3540.3540.2	1.2892	0.0792	1672.47	4	4230.0%	2	K.DQMSHLFNVAHTLR.M
*	TK280802_E16_cyto_2D_step06.3943.3943.2	0.6508	0.0198	1485.86	76	1920.0%	1	K.QIALAVLSTELAVR.K
*	TK280802_E16_cyto_2D_step10.4871.4871.3	1.3675	0.1172	2869.67	2	2120.0%	1	R.VLSEPNPRPVFGICLGHQLLALAIGAK.T
*	TK280802_E16_cyto_2D_step07.2856.2856.1	0.9721	0.0786	908.62	270	3570.0%	1	K.EHPVVISK.F
*	TK280802_E16_cyto_2D_step15.3123.3123.2	1.0177	0.2549	2428.19	1	2370.0%	1	K.TIMVNYNPETVSTDYDMCDR.L
*	TK280802_E16_cyto_2D_step12.2229.2229.2	1.2832	0.0628	1259.04	2	4580.0%	1	K.EATAGNPGGQTVR.E
UQ9R0H579.0%5179.7%524573837.0(Q9R0H5) Type II cytokeratin (Keratin protein K6irs)
	TK280802_E16_cyto_2D_step01.1366.1366.1	1.2605	0.0388	1476.64	16	4090.0%	4	R.FLEQQNQVLQTK.W
*	TK280802_E16_cyto_2D_step11.5124.5124.3	1.5212	0.281	4524.19	2	1250.0%	1	K.CLFEAEMAQIQSHISDMSVILSMDNNRNLDLDSIIDEVR.A
UK2C1_MOUSE79.0%61815.0%627650928.8(P04104) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (67 kDa cytokeratin)
*	TK280802_E16_cyto_2D_step09.3342.3342.3	0.9917	0.07	3245.88	9	1210.0%	1	R.MSGECTPNVSVSVSTSHTSMSGSSSRGGGSGGGR.Y
*	TK280802_E16_cyto_2D_step12.2694.2694.3	1.1407	0.0559	3745.83	4	850.0%	1	R.GGFGGGSYGGGGFGGGSFGGGGFGGSGFGGGSGGGGGFGSGGGFGGGR.F
*	TK280802_E16_cyto_2D_step01.1366.1366.1	1.2605	0.0388	1476.64	16	4090.0%	4	R.FLEQQNKVLQTK.W
UQ9Z1Y478.3%5715.8%480509347.3(Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6)
*	TK280802_E16_cyto_2D_step10.3161.3161.2	2.0632	0.3807	1850.29	12	2780.0%	2	R.GASQASGPLPGPHFPLTGR.G
*	TK280802_E16_cyto_2D_step05.2527.2527.2	1.2458	0.2941	1382.16	5	4170.0%	1	R.GPTWVGSHGTPQR.L
*	TK280802_E16_cyto_2D_step14.2091.2091.2	1.8124	0.4518	1780.89	1	4410.0%	1	R.GALGPPTAHGATLQPHPR.V
*	TK280802_E16_cyto_2D_step15.3494.3494.2	1.1073	0.1594	2675.34	5	1600.0%	1	R.GIIRPGSLDAEIDSLTSMLADLDGGR.S
UQ8R2Q778.2%225.6%869990467.5(Q8R2Q7) Similar to hypothetical protein FLJ20318
*	TK280802_E16_cyto_2D_step10.3210.3210.3	1.1714	0.032	3404.72	68	950.0%	1	K.QYWRSLQASMPGVQVLGNQIMPGLLNMEIK.F
*	TK280802_E16_cyto_2D_step13.3050.3050.2	2.0358	0.3307	2241.1	1	3330.0%	1	K.DHLIAPNDNDFGKYSFLFK.D
UKI67_HUMAN77.6%284122.9%32563587479.4(P46013) Antigen KI-67
*	TK280802_E16_cyto_2D_step07.4908.4908.1	1.0181	0.0735	1344.95	23	2730.0%	20	K.QESGSEIHVEVK.A
*	TK280802_E16_cyto_2D_step08.4395.4395.2	1.1633	0.0619	1995.02	244	1560.0%	1	K.ELFQTPDHTEESTTDDK.T
*	TK280802_E16_cyto_2D_step01.1808.1808.1	1.6281	0.0805	1353.85	2	4170.0%	2	K.SSPELEDTATSSK.R
*	TK280802_E16_cyto_2D_step10.2745.2745.1	1.324	0.2011	940.51	14	4290.0%	1	R.QPKTPLEK.R
*	TK280802_E16_cyto_2D_step13.2280.2280.3	1.2284	0.0153	2804.65	7	1540.0%	1	K.EDSTADDSKDSVAQGTTNVHSSEHAGR.N
*	TK280802_E16_cyto_2D_step06.2888.2888.1	0.9752	0.1725	759.39	30	3330.0%	2	K.VPGDEDK.G
*	TK280802_E16_cyto_2D_step01.4466.4466.1	0.9077	0.0155	1346.35	97	1820.0%	1	K.VDMKEEPLAVSK.L
UQ9CZD277.6%114.6%260296233.9(Q9CZD2) 2810018A15Rik protein
	TK280802_E16_cyto_2D_step01.2854.2854.1	1.9406	0.1366	1330.95	1	5000.0%	1	K.DLSTVEALQNLK.N
UPRS7_MOUSE77.4%578.5%433486485.9(P46471) 26S protease regulatory subunit 7 (MSS1 protein)
	TK280802_E16_cyto_2D_step01.3016.3016.1	1.1695	0.2325	1142.94	3	3640.0%	1	K.GVLLFGPPGTGK.T
	TK280802_E16_cyto_2D_step04.2420.2420.1	1.0159	0.265	645.62	2	5000.0%	2	R.THIFK.I
	TK280802_E16_cyto_2D_step01.2707.2707.1	1.3953	0.1493	1115.14	1	5560.0%	1	R.FVNLGIEPPK.G
	TK280802_E16_cyto_2D_step08.3383.3383.2	1.7372	0.4157	1207.64	1	5000.0%	1	K.YQIHIPLPPK.I
UQ9CVA377.1%117.5%161183749.1(Q9CVA3) 2210415M20Rik protein (Fragment)
	TK280802_E16_cyto_2D_step13.2184.2184.2	2.0133	0.3297	1312.72	1	5000.0%	1	K.IVVHLHPAPSNK.E
UQ9CXW777.1%115.8%1391660510.8(Q9CXW7) 3010033P07Rik protein
	TK280802_E16_cyto_2D_step01.3018.3018.1	1.8278	0.1652	935.26	1	6430.0%	1	K.LDYILGLK.I
UQ9DAU776.7%1119.0%174180325.3(Q9DAU7) 1600023A02Rik protein (WAP domain protein HE4)
*	TK280802_E16_cyto_2D_step11.2671.2671.3	2.599	0.3669	3321.49	1	1720.0%	1	K.LSETGTTTQSAGLDHTTKPPGGQVSTKPPAVTR.E
USPCO_MOUSE76.6%9115.6%23632744216.0(Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain)
	TK280802_E16_cyto_2D_step06.3487.3487.3	1.2862	0.0525	2231.75	67	1580.0%	1	R.VAVVNQIARQLMHNGHPSEK.E
	TK280802_E16_cyto_2D_step11.4015.4015.2	1.6104	0.123	2487.06	1	3810.0%	2	K.SNAHYNLQNAFNLAEQHLGLTK.L
	TK280802_E16_cyto_2D_step08.2022.2022.3	1.5281	0.1355	1506.43	37	2730.0%	1	R.EVDDLEQWIAER.E
	TK280802_E16_cyto_2D_step08.2189.2189.1	0.7968	0.0085	531.51	3	5000.0%	1	K.HVFK.L
	TK280802_E16_cyto_2D_step04.3018.3018.3	0.8343	0.0037	2784.05	119	940.0%	1	K.HLLGVEDLLQKHALVEADIAIQAER.V
	TK280802_E16_cyto_2D_step12.1686.1686.1	0.9418	0.2614	1181.49	17	1880.0%	1	R.KHEWEAHNK.K
*	TK280802_E16_cyto_2D_step10.2433.2433.3	1.712	0.0475	3013.54	2	1960.0%	1	K.SALPAQSAATLPARTLETPAAQMEGFLNR.K
	TK280802_E16_cyto_2D_step09.1959.1959.2	0.9018	0.0387	1292.93	1	3500.0%	1	K.NREAASELLMR.L
UQ99JY976.4%117.2%418473575.9(Q99JY9) Hypothetical 47.4 kDa protein
	TK280802_E16_cyto_2D_step01.3656.3656.2	1.9106	0.3562	3061.14	1	2410.0%	1	R.TLTGTVIDSGDGVTHVIPVAEGYVIGSCIK.H
UQ9CWK176.3%61423.6%259294445.7(Q9CWK1) 2410026J11Rik protein
	TK280802_E16_cyto_2D_step11.2903.2903.3	1.4559	0.0166	2526.27	7	2380.0%	1	K.VQYKSNCKPSTFAYPAPLEVPK.E
	TK280802_E16_cyto_2D_step07.2383.2383.3	0.963	0.1844	1771.83	162	1070.0%	2	K.KEPEPNFQLLDNPAR.V
	TK280802_E16_cyto_2D_step03.3796.3796.2	1.4772	0.0099	2440.65	4	2830.0%	3	K.FGAILAQGILDAGGHNVTISLQSR.T
UPYRG_MOUSE75.7%81612.4%591667116.6(P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase)
*	TK280802_E16_cyto_2D_step07.2715.2715.1	1.4525	0.2836	899.09	1	6670.0%	2	R.LPHYLQK.G
*	TK280802_E16_cyto_2D_step14.3201.3201.2	0.7697	0.1855	2692.74	38	830.0%	1	K.TSHPVVIDMPEHNPGQMGGTMRLGK.R
*	TK280802_E16_cyto_2D_step05.3189.3189.1	1.1538	0.0236	948.3	2	5710.0%	3	R.FEVNPVLK.K
	TK280802_E16_cyto_2D_step07.2764.2764.2	1.3296	0.148	1304.89	2	5450.0%	1	K.ALEHSALAINHK.L
	TK280802_E16_cyto_2D_step11.2170.2170.3	0.9954	0.0829	2096.53	75	1120.0%	1	K.LCSAHGVLVPGGFGVRGTEGK.I
UQ9H41075.6%72712.9%356400677.0(Q9H410) DJ469A13.2 (Novel protein)
*	TK280802_E16_cyto_2D_step03.3839.3839.2	1.7224	0.1965	2576.81	5	2140.0%	5	K.QLQAFMDESTQCFQKVSVQLGK.R
*	TK280802_E16_cyto_2D_step13.1198.1198.1	0.4527	0.4029	615.95	2	2000.0%	1	K.GPVMSK.T
*	TK280802_E16_cyto_2D_step02.3986.3986.2	0.9871	0.0435	2624.77	6	1740.0%	1	K.GPVMSKTHDHQLESSLSPVEVFAK.T
UQ9CPT475.4%226.6%166179826.8(Q9CPT4) DNA segment, Chr 17, Wayne state University 104, expressed (Stromal cell-derived growth factor SF20/IL25)
*	TK280802_E16_cyto_2D_step13.1765.1765.2	2.137	0.3108	1172.12	1	6000.0%	1	K.TAVSHRPGAFK.A
URO60_MOUSE74.8%3311.0%538601247.9(O08848) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP)
	TK280802_E16_cyto_2D_step11.3116.3116.2	2.0579	0.3147	1681.58	1	4670.0%	1	R.LSHLKPSSEGLAIVTK.Y
*	TK280802_E16_cyto_2D_step12.4386.4386.3	0.891	0.0754	3950.79	1	1210.0%	1	K.LIVCGMTSNGFTIADPDDRGMLDMCGFDTAALDVIR.N
*	TK280802_E16_cyto_2D_step01.2404.2404.1	0.9264	0.0379	822.05	24	5000.0%	1	R.NFTLDVI.-
UCOA1_HUMAN74.8%221806.1%23462650386.5(Q13085) Acetyl-CoA carboxylase 1 (EC 6.4.1.2) (ACC-alpha) [Includes: Biotin carboxylase (EC 6.3.4.14)]
*	TK280802_E16_cyto_2D_step07.3510.3510.3	1.3075	0.3396	2755.11	18	1770.0%	1	R.IPVQAVWAGWGHASENPKLPELLLK.N
*	TK280802_E16_cyto_2D_step12.2671.2671.3	1.4987	0.1254	2903.1	13	1900.0%	1	R.SLVQANPEVAMDSIIHMTQHISPTQR.A
*	TK280802_E16_cyto_2D_step13.1612.1612.3	1.7983	0.0689	1994.62	49	2650.0%	1	K.IHSANPELTDGQIQAMLR.R
*	TK280802_E16_cyto_2D_step14.2496.2496.3	0.9391	0.0133	2018.09	397	1110.0%	1	K.NGIAFMGPPNQAMWALGDK.I
*	TK280802_E16_cyto_2D_step01.2844.2844.1	1.0887	0.046	1267.59	21	3890.0%	1	K.CVFALREENK.S
*	TK280802_E16_cyto_2D_step05.3034.3034.2	1.1379	0.2218	1256.47	124	2500.0%	1	R.AIIRHSDLVTK.E
*	TK280802_E16_cyto_2D_step15.1167.1167.3	1.4035	0.1811	1678.1	77	1540.0%	2	R.IIEFVPTKTPYDPR.W
*	TK280802_E16_cyto_2D_step05.4194.4194.2	1.601	0.1649	1505.22	20	3640.0%	13	K.RILNVPQELYEK.G
*	TK280802_E16_cyto_2D_step11.2822.2822.1	1.0426	0.1106	1019.15	1	5000.0%	1	R.WSYEMFR.N
UUNRI_MOUSE74.7%225.1%351385135.1(Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein)
	TK280802_E16_cyto_2D_step13.2236.2236.1	1.4489	0.2603	1179.74	2	4440.0%	1	K.GHFGPIHCVR.F
	TK280802_E16_cyto_2D_step01.2120.2120.1	1.1663	0.1412	932.13	1	7140.0%	1	R.LWQTVVGK.T
UQ99LS374.5%116.2%225250966.1(Q99LS3) Similar to phosphoserine phosphatase
*	TK280802_E16_cyto_2D_step13.2584.2584.2	1.8201	0.3448	1554.28	2	5380.0%	1	R.LLAEHPPHLTPGIR.E
UQ96JP874.5%110.8%28093003265.1(Q96JP8) Fibrillin3
*	TK280802_E16_cyto_2D_step13.2920.2920.3	2.799	0.2916	2447.24	2	2950.0%	1	R.AGACFSVLFGGRCAGDLAGHYTR.R
UQ9H1L674.5%227.6%510572805.7(Q9H1L6) BA209J19.1.1 (GW112 protein)
*	TK280802_E16_cyto_2D_step06.4071.4071.3	2.7854	0.2849	2867.07	1	2320.0%	1	R.SGSSSSRSLGSGGSVSQLFSNFTGSVDDR.G
*	TK280802_E16_cyto_2D_step12.1854.1854.1	0.6808	0.1841	1170.38	38	1670.0%	1	K.EGKLDIVMHK.M
UQ8TEA774.5%335.5%8931006806.5(Q8TEA7) Hypothetical protein FLJ23725
	TK280802_E16_cyto_2D_step01.3991.3991.1	1.5355	0.2028	1387.1	3	3640.0%	1	K.ELPETVIDLLNK.C
	TK280802_E16_cyto_2D_step01.3813.3813.1	0.8401	0.0844	1598.81	1	3460.0%	1	K.TDLSRESIPLNDLK.S
	TK280802_E16_cyto_2D_step15.4323.4323.3	1.6859	0.0773	2573.78	5	2390.0%	1	R.ISAEDLIDLCELTVTGHFKTPSK.K
UMK01_MOUSE74.0%338.9%358412767.0(P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1)
	TK280802_E16_cyto_2D_step05.1689.1689.2	0.6774	0.0388	977.62	98	2500.0%	1	R.GQVFDVGPR.Y
	TK280802_E16_cyto_2D_step12.2245.2245.1	1.5153	0.2152	1210.08	2	5000.0%	1	K.YIHSANVLHR.D
	TK280802_E16_cyto_2D_step11.2823.2823.2	1.7357	0.3986	1695.69	1	5000.0%	1	K.KISPFEHQTYCQR.T
UGUAA_HUMAN73.8%81612.6%693767156.9(P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase)
*	TK280802_E16_cyto_2D_step10.3139.3139.2	1.1545	0.0033	1163.63	9	3500.0%	2	R.HPFPGPGLAIR.V
*	TK280802_E16_cyto_2D_step06.2675.2675.1	1.7984	0.1515	786.99	1	6670.0%	3	K.KLGIQVK.V
*	TK280802_E16_cyto_2D_step10.2176.2176.3	1.0222	0.0232	1894.25	53	1470.0%	1	-.MALCNGDSKLENAGGDLK.D
*	TK280802_E16_cyto_2D_step07.4703.4703.3	1.4592	0.086	4597.01	34	950.0%	1	K.IANEVIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIK.T
*	TK280802_E16_cyto_2D_step13.2118.2118.1	1.1814	0.2377	992.92	2	5000.0%	1	K.KPHTLLQR.V
UQ6148073.7%353.9%558641547.6(Q61480) TRAF5
	TK280802_E16_cyto_2D_step03.4078.4078.2	1.4485	0.071	1484.63	5	4170.0%	2	R.AALQDHMLLVLEK.N
	TK280802_E16_cyto_2D_step10.2105.2105.1	0.7965	0.0129	1116.9	25	1880.0%	1	K.KNHIVETFK.A
UQ9WUC273.2%101614.2%11301271997.7(Q9WUC2) SH2-containing inositol phosphatase
	TK280802_E16_cyto_2D_step08.4207.4207.3	1.3546	0.026	3859.57	21	1440.0%	1	K.VEALLQEDLLLTKPEMFENPLYGSVSSFPKLVPR.K
	TK280802_E16_cyto_2D_step14.3537.3537.2	0.7033	0.0045	2950.06	48	1400.0%	1	K.TRDDSADYIPHDIYVIGTQEDPLGEK.E
	TK280802_E16_cyto_2D_step05.2567.2567.2	1.2756	0.0376	1111.96	9	5620.0%	1	R.AYALCVLFR.N
*	TK280802_E16_cyto_2D_step07.0050.0050.2	0.6216	0.1667	3160.13	61	740.0%	1	R.QWEPSGRVPACGVSSLNEMINPNYIANR.G
	TK280802_E16_cyto_2D_step01.0447.0447.1	1.2269	0.0366	993.8	4	6430.0%	3	K.KLMSLLCK.E
	TK280802_E16_cyto_2D_step12.4960.4960.2	1.189	0.2015	2905.32	29	1670.0%	1	R.LETTEAQHPIYTPLTHHGEMTGHFR.G
	TK280802_E16_cyto_2D_step13.2097.2097.3	1.1585	0.0227	2560.27	73	1840.0%	1	K.VFLHFEEEEITFAPTYRFER.L
	TK280802_E16_cyto_2D_step01.3539.3539.1	0.86	0.0682	1325.5	3	3890.0%	1	R.RNQNYMNILR.F
UPL10_MOUSE73.1%447.7%660731417.2(P16381) Putative ATP-dependent RNA helicase PL10
	TK280802_E16_cyto_2D_step12.2475.2475.3	1.1145	0.1897	2404.37	1	1880.0%	1	R.VRPCVVYGGADIGQQIRDLER.G
	TK280802_E16_cyto_2D_step01.4227.4227.1	1.4885	0.2201	1294.33	1	5450.0%	1	R.SFLLDLLNATGK.D
	TK280802_E16_cyto_2D_step09.3550.3550.2	1.3309	0.1098	1487.31	4	3750.0%	1	R.KQYPISLVLAPTR.E
	TK280802_E16_cyto_2D_step05.2028.2028.1	1.0279	0.0672	699.58	2	7500.0%	1	R.KFSYR.S
UCD45_HUMAN72.8%7911.1%13041472546.2(P08575) Leukocyte common antigen precursor (EC 3.1.3.48) (L-CA) (CD45 antigen) (T200)
	TK280802_E16_cyto_2D_step01.2578.2578.1	1.5005	0.2085	1516.09	2	3850.0%	1	K.QDANCVNPLGAPEK.L
	TK280802_E16_cyto_2D_step14.1088.1088.3	0.9746	0.06	1510.91	26	2500.0%	1	R.TQHIGNQEENKSK.N
*	TK280802_E16_cyto_2D_step15.3330.3330.3	1.5206	0.1353	4053.07	1	1460.0%	1	-.MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAK.M
	TK280802_E16_cyto_2D_step13.3192.3192.3	1.2075	0.1416	3556.4	97	890.0%	1	R.DGSQQTGIFCALLNLLESAETEEVVDIFQVVK.A
	TK280802_E16_cyto_2D_step05.3522.3522.3	1.1899	0.2645	2080.65	24	1620.0%	2	K.IIKTDFGSPGEPQIIFCR.S
	TK280802_E16_cyto_2D_step06.4207.4207.3	1.0012	0.0275	3025.38	6	1580.0%	1	K.EQAEGSEPTSGTEGPEHSVNGPASPALNQGS.-
UAAKB_MOUSE72.5%115.9%269301776.2(Q9R078) 5'-AMP-activated protein kinase, beta-1 subunit (AMPK beta-1 chain) (AMPKb)
	TK280802_E16_cyto_2D_step14.3843.3843.2	1.9051	0.3288	1765.4	2	4330.0%	1	K.APPILPPHLLQVILNK.D
URS12_MOUSE72.5%116.1%131143947.2(P09388) 40S ribosomal protein S12
	TK280802_E16_cyto_2D_step01.2904.2904.1	1.4327	0.2843	1043.64	1	6430.0%	1	K.DVIEEYFK.C
UZ213_HUMAN72.5%4610.2%547597647.9(O14771) Zinc finger protein 213 (Putative transcription factor CR53) (Fragment)
*	TK280802_E16_cyto_2D_step04.1898.1898.1	1.4336	0.2713	890.11	1	6670.0%	2	R.KWDLLGR.S
*	TK280802_E16_cyto_2D_step08.2481.2481.2	1.3751	0.1996	1659.95	38	2860.0%	1	R.DLAAEKPHSCGQCGK.R
*	TK280802_E16_cyto_2D_step09.4309.4309.3	1.4111	0.144	3530.0	17	1440.0%	1	R.LKPTNPEPQARGMAAPLEAQDQAPGEGEGLLIVK.V
UKCRB_MOUSE71.8%9278.7%381427135.7(Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK)
	TK280802_E16_cyto_2D_step01.0764.0764.1	1.2514	0.0578	985.79	7	5000.0%	1	R.GIWHNDNK.T
	TK280802_E16_cyto_2D_step06.2206.2206.1	1.168	0.1303	625.1	10	5000.0%	3	R.AGVHIK.L
*	TK280802_E16_cyto_2D_step04.3833.3833.2	1.5181	0.2622	1673.42	1	5000.0%	1	K.TFLVWINEEDHLR.V
*	TK280802_E16_cyto_2D_step09.2622.2622.1	1.2954	0.0662	666.89	1	6000.0%	4	K.LPHLGK.H
UAAC4_MOUSE71.8%6812.2%9121049775.4(P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein)
	TK280802_E16_cyto_2D_step01.4013.4013.1	0.6425	0.0212	1518.19	26	1790.0%	1	K.LVSIGAEEIVDGNAK.M
	TK280802_E16_cyto_2D_step09.2820.2820.2	2.3094	0.1891	1301.17	1	6110.0%	1	R.HRPELIEYDK.L
*	TK280802_E16_cyto_2D_step12.4273.4273.2	1.264	0.0019	3036.81	25	1430.0%	2	R.MAPYQGPDAAPGALDYKSFSTALYGESDL.-
	TK280802_E16_cyto_2D_step13.4154.4154.3	1.0678	0.0069	4564.96	32	920.0%	1	K.RAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFK.S
	TK280802_E16_cyto_2D_step10.3613.3613.2	1.2828	0.1931	2093.59	9	2650.0%	1	K.LMLLLEVISGERLPKPER.G
UIDHC_MOUSE71.8%337.7%414466606.9(O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP)
*	TK280802_E16_cyto_2D_step09.3449.3449.2	1.1058	0.0722	1934.88	7	3120.0%	1	K.NIPRLVTGWVKPIIIGR.H
	TK280802_E16_cyto_2D_step06.2190.2190.1	1.5291	0.0399	808.98	33	6000.0%	1	K.RVEEFK.L
	TK280802_E16_cyto_2D_step01.2931.2931.1	1.5784	0.1852	977.07	1	6880.0%	1	R.NILGGTVFR.E
UFAFX_MOUSE71.5%7114.4%25592905436.0(P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.1.2.15) (Ubiquitin thiolesterase FAF-X) (Ubiquitin-specific processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin carboxyl-terminal hydrolase FAM) (Fat facets homolog)
*	TK280802_E16_cyto_2D_step01.3195.3195.2	1.291	0.1538	2275.98	10	2370.0%	2	K.ASYDTLCVLDGDKDSINCAR.Q
	TK280802_E16_cyto_2D_step12.3198.3198.1	1.9631	0.1032	1221.68	2	5000.0%	2	K.KLPPVLAIQLK.R
*	TK280802_E16_cyto_2D_step15.3690.3690.2	0.8553	0.1804	2940.26	49	1460.0%	1	K.VISSVSYYTHRHGSSEDEEWLTAER.M
*	TK280802_E16_cyto_2D_step12.5016.5016.3	1.138	0.0011	3872.17	6	1410.0%	1	R.HDLINQLQHNHALVTLVAENLATYMESMRMYGR.D
	TK280802_E16_cyto_2D_step09.3384.3384.3	1.303	0.0019	2728.49	213	1520.0%	1	K.CMVALFSSCPVAYQILQGNGDLKR.K
UQ8VGP371.4%10828.6%304340018.8(Q8VGP3) Olfactory receptor MOR227-1
	TK280802_E16_cyto_2D_step12.5060.5060.2	1.7033	0.1191	2983.25	4	1800.0%	9	K.LVAVFYTVITPMLNPIIYTLRNAEVK.N
UQ8WZ4271.4%88984.3%3435038161116.3(Q8WZ42) Titin
	TK280802_E16_cyto_2D_step11.4152.4152.2	1.2695	0.1358	2791.99	10	1880.0%	1	K.ELVSGGSCYITKEALESSLELYLVK.T
	TK280802_E16_cyto_2D_step01.4043.4043.1	1.3678	0.0068	1111.11	11	5000.0%	1	R.YEILTEGRK.R
	TK280802_E16_cyto_2D_step09.1798.1798.1	0.6133	0.0253	836.01	11	2140.0%	1	K.KVPAPVPK.K
	TK280802_E16_cyto_2D_step01.3743.3743.1	0.9216	0.0993	1568.0	19	2500.0%	1	K.AENSIGTASSKTVFR.I
	TK280802_E16_cyto_2D_step13.3325.3325.3	1.1108	0.0453	3901.21	3	1540.0%	1	R.VSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFR.D
	TK280802_E16_cyto_2D_step10.2199.2199.2	1.5037	0.0014	824.57	6	5830.0%	1	K.KPVPEKK.V
	TK280802_E16_cyto_2D_step05.2075.2075.1	1.0339	0.0698	685.98	2	6000.0%	1	K.KVLVPK.K
	TK280802_E16_cyto_2D_step12.1143.1143.1	0.5205	0.0016	675.15	3	2000.0%	2	R.VGQTIR.I
	TK280802_E16_cyto_2D_step10.4829.4829.2	0.7716	0.1832	2735.08	45	1090.0%	1	R.ELAESVIAKDILHPPEVELDVTCR.D
	TK280802_E16_cyto_2D_step04.2621.2621.1	0.7742	0.0030	896.07	15	5000.0%	1	K.YTITSRR.G
	TK280802_E16_cyto_2D_step15.2718.2718.2	0.7455	0.0035	2827.51	46	1040.0%	1	K.DSMTVCWNRPDSDGGSEIIGYIVEK.R
	TK280802_E16_cyto_2D_step10.2127.2127.3	1.252	0.0554	1884.47	78	1500.0%	1	K.IDVPFKGRPQATVNWR.K
	TK280802_E16_cyto_2D_step06.3680.3680.2	0.8782	0.038	2123.73	5	2370.0%	1	K.YILTIENGVGEPKSSTVSVK.V
	TK280802_E16_cyto_2D_step03.3736.3736.2	0.8492	0.0268	1958.16	20	2650.0%	1	K.TLEATISGLTAGEEYVFR.V
	TK280802_E16_cyto_2D_step13.2705.2705.3	0.9035	0.0217	1782.49	29	2170.0%	1	K.VAGTPELSVEWYKDGK.L
	TK280802_E16_cyto_2D_step05.4445.4445.2	0.8838	0.0276	1941.87	1	3330.0%	1	K.IESTSSLRGGTAAFQATLK.G
	TK280802_E16_cyto_2D_step01.0667.0667.1	0.9564	0.0618	758.89	51	5000.0%	1	K.EKHSTR.W
	TK280802_E16_cyto_2D_step08.3628.3628.3	1.302	0.0068	2615.45	1	2080.0%	1	K.EPATITEEAVSIDVTQGDPATLQVK.F
	TK280802_E16_cyto_2D_step09.2433.2433.3	1.3673	0.0685	1859.28	2	2680.0%	1	R.DWLVKPIRDQHVKPK.G
	TK280802_E16_cyto_2D_step05.2516.2516.3	1.2817	0.0089	1844.12	1	3750.0%	1	R.LIKANLLANNEYYFR.V
	TK280802_E16_cyto_2D_step04.2383.2383.2	0.82	0.0813	1220.57	119	2000.0%	1	R.AVPVPTVSWHK.D
	TK280802_E16_cyto_2D_step07.2727.2727.3	1.4908	0.0367	2094.66	139	1970.0%	1	K.DAAYPPGPPSNPHVTDTTKK.S
	TK280802_E16_cyto_2D_step06.3559.3559.1	1.1119	0.0295	1195.91	8	3500.0%	1	K.DGKIVVEKPGR.I
	TK280802_E16_cyto_2D_step11.3463.3463.3	1.3603	4.0E-4	1863.39	14	2680.0%	1	R.FEVTGLMEDTQYQFR.V
	TK280802_E16_cyto_2D_step06.3422.3422.2	0.8776	0.0875	1702.29	30	2000.0%	1	K.GDSGQYTCQATNDVGK.D
	TK280802_E16_cyto_2D_step05.4833.4833.2	0.7542	0.0031	2829.8	9	870.0%	1	R.HEVSAEEEWSYSEEEEGVSISVYR.E
	TK280802_E16_cyto_2D_step02.2988.2988.1	1.092	0.0887	909.0	14	5000.0%	1	K.KPELPPVK.V
	TK280802_E16_cyto_2D_step04.3660.3660.3	1.0615	0.0208	3246.23	177	930.0%	1	K.FLHDGQEYTLLLIEAFPEDAAVYTCEAK.N
	TK280802_E16_cyto_2D_step10.4030.4030.2	0.745	0.0408	1718.52	63	2670.0%	1	K.KLSDTSTLIGDAVELR.A
	TK280802_E16_cyto_2D_step10.4110.4110.3	1.2134	0.0442	3438.22	14	1530.0%	1	K.FGCGPPVEIGPILAVDPLGPPTSPERLTYTER.T
	TK280802_E16_cyto_2D_step11.3870.3870.2	1.2667	0.0269	2613.88	16	1740.0%	1	K.LVEGGSVVFGCQVGGNPKPHVYWK.K
	TK280802_E16_cyto_2D_step05.2228.2228.1	1.3064	0.1206	871.76	5	5000.0%	1	K.ESPYFTK.E
	TK280802_E16_cyto_2D_step01.2150.2150.1	0.7277	0.043	945.7	37	3120.0%	1	R.VVIDNVGTK.S
	TK280802_E16_cyto_2D_step04.3636.3636.2	1.1755	0.0307	1826.64	1	3570.0%	1	K.VSWFKDEADVLEDDR.T
	TK280802_E16_cyto_2D_step10.2101.2101.3	1.4216	0.2451	1970.73	1	2190.0%	1	K.FESVSADQMTLSWFPPK.D
*	TK280802_E16_cyto_2D_step13.4173.4173.3	0.8158	0.1831	3650.08	1	1060.0%	1	R.VPIPTMPIRAVPPEEIPPVVAPPIPLLLPTPEEK.K
	TK280802_E16_cyto_2D_step14.3443.3443.2	0.6063	0.0724	3014.73	36	960.0%	2	K.ADSVILSWDVPEDNGGGEITCYSIEKR.E
	TK280802_E16_cyto_2D_step01.4898.4898.2	0.8636	0.1578	3139.68	23	1110.0%	1	K.SLVCLEIFSFNSADVGEYECVVANEVGK.C
	TK280802_E16_cyto_2D_step14.1585.1585.2	0.9198	0.1589	1452.63	21	2270.0%	1	R.HIMCMYLVTSAK.S
	TK280802_E16_cyto_2D_step12.4581.4581.2	1.9359	0.1721	2983.46	1	2600.0%	1	K.TPFFFRVLAENEIGIGEPCETTEPVK.A
	TK280802_E16_cyto_2D_step10.4650.4650.2	1.1913	0.1724	1797.19	2	3330.0%	1	R.SVSMQDEGKTHSITFK.D
	TK280802_E16_cyto_2D_step06.2494.2494.3	1.7405	0.0526	1791.74	146	2170.0%	1	K.TGGSPITGYHLEFKER.N
	TK280802_E16_cyto_2D_step07.5279.5279.2	0.9052	0.0603	1895.15	159	2190.0%	1	K.AAVDGRLFFVSEPQSIR.V
	TK280802_E16_cyto_2D_step04.3313.3313.2	0.7271	0.0088	2560.91	4	1900.0%	1	K.EYDVMLLAEVAGTPPFEITWFK.D
	TK280802_E16_cyto_2D_step10.2829.2829.2	1.0294	0.054	1511.54	94	2920.0%	1	K.WFKDGQELTLGSK.Y
	TK280802_E16_cyto_2D_step05.2121.2121.1	0.8292	0.0717	896.87	40	4290.0%	1	K.VPVPVQKK.E
	TK280802_E16_cyto_2D_step05.2004.2004.1	1.0455	0.0485	685.74	42	5000.0%	1	K.KVPVIK.K
	TK280802_E16_cyto_2D_step02.4843.4843.3	1.0641	0.0034	4535.67	5	1220.0%	1	R.AVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEK.L
	TK280802_E16_cyto_2D_step05.3251.3251.3	0.9981	0.028	2549.99	34	1250.0%	1	R.EIRPGGNYKMTLVENTATLTVLK.V
	TK280802_E16_cyto_2D_step05.3625.3625.2	1.1137	0.3018	1762.89	18	2500.0%	1	R.LILTEGKNPPFFDIR.L
	TK280802_E16_cyto_2D_step11.2175.2175.3	1.0977	0.0362	1844.68	74	1250.0%	1	K.EPRSNGGSPIQGYIIEK.R
	TK280802_E16_cyto_2D_step05.1497.1497.1	0.9326	0.0262	748.74	2	4170.0%	1	K.VPVPIPK.K
	TK280802_E16_cyto_2D_step12.1381.1381.3	0.798	0.0586	2229.76	21	880.0%	1	R.IMAVNKYGVGEPLESEPVVAK.N
	TK280802_E16_cyto_2D_step06.3788.3788.3	0.7776	0.0651	2389.8	382	1000.0%	1	R.DENVPPIVEFGPEYFDGLIIK.S
	TK280802_E16_cyto_2D_step02.3712.3712.3	1.0416	0.0226	2818.89	36	1250.0%	1	K.ITLMDVTRNSVSLSWEKPEHDGGSR.I
	TK280802_E16_cyto_2D_step01.3516.3516.1	0.7177	0.0261	1232.09	170	2000.0%	1	R.LSQTEPVTLIK.D
	TK280802_E16_cyto_2D_step01.3710.3710.1	0.8563	0.0284	1401.02	146	2500.0%	1	K.VHLECQVDEDR.K
	TK280802_E16_cyto_2D_step09.2745.2745.3	1.0735	0.0883	2666.48	9	1790.0%	1	K.EGETATFVCELSHEKMHVVWFK.N
	TK280802_E16_cyto_2D_step12.2151.2151.3	1.543	0.0443	2132.62	12	2500.0%	1	R.NAAHEDGGIYSLTVENPAGSK.T
	TK280802_E16_cyto_2D_step06.2868.2868.1	0.5811	0.046	845.19	5	2500.0%	1	T.EPPKFVK.K
	TK280802_E16_cyto_2D_step04.4877.4877.3	0.9396	0.1506	3604.43	96	550.0%	1	R.NRSSVTLYVNAPEPPQVLQELQPVTVQSGKPAR.F
	TK280802_E16_cyto_2D_step09.4733.4733.2	1.5901	0.0808	1914.55	10	3120.0%	2	R.ARTEIISTDNHTLLTVK.D
	TK280802_E16_cyto_2D_step05.2475.2475.1	1.5637	0.1805	872.8	1	5830.0%	1	K.EPPRFVK.K
	TK280802_E16_cyto_2D_step01.3821.3821.3	1.0826	0.0609	4162.31	55	1000.0%	1	K.QLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICK.A
	TK280802_E16_cyto_2D_step01.5283.5283.2	0.8812	0.1147	3112.67	33	1350.0%	1	K.MVISEEKMFFASHTEEEVSVTVPEVQK.E
	TK280802_E16_cyto_2D_step10.2682.2682.3	1.1335	0.0445	2228.22	241	1530.0%	1	K.VGETAPGFVYSEYEKEYEK.E
	TK280802_E16_cyto_2D_step11.2967.2967.2	1.4768	0.1127	1829.83	3	3120.0%	1	K.KPAYDGGSKITGYIVEK.K
	TK280802_E16_cyto_2D_step01.1864.1864.1	1.1389	0.0605	1521.45	1	4170.0%	1	R.FVKTLEEEVTVVK.G
	TK280802_E16_cyto_2D_step11.3747.3747.2	0.892	0.0611	1830.67	107	2350.0%	1	K.AGEPVHIPADVTGLPMPK.I
	TK280802_E16_cyto_2D_step01.1580.1580.1	0.8655	0.0372	849.97	25	5000.0%	1	K.WYRNGR.E
	TK280802_E16_cyto_2D_step12.2482.2482.3	1.4501	0.0317	2929.5	7	1700.0%	1	K.TSVILSWTKPDFDGGSVITEYVVERK.G
	TK280802_E16_cyto_2D_step10.3822.3822.2	0.6659	0.0245	2735.84	46	1360.0%	1	K.EFEELVSFIQQRLSQTEPVTLIK.D
	TK280802_E16_cyto_2D_step05.3317.3317.3	1.2072	0.0052	1900.86	17	2810.0%	2	R.LEADVSGRPPPTMEWSK.D
	TK280802_E16_cyto_2D_step05.2935.2935.1	0.9654	0.0633	767.01	8	3330.0%	1	K.EVAPPVR.V
	TK280802_E16_cyto_2D_step04.5058.5058.2	0.8976	0.0413	2790.24	4	1880.0%	1	K.SWMKANHVNVPECAFTVTDLVEGGK.Y
	TK280802_E16_cyto_2D_step10.2144.2144.3	1.0961	0.0081	1310.26	224	1750.0%	1	K.NTVHLSWKPPK.N
	TK280802_E16_cyto_2D_step03.4694.4694.3	1.0193	0.0471	4425.53	57	510.0%	1	R.VSAVNAAGEGPPGETQPVTVAEPQEPPAVELDVSVKGGIQIMAGK.T
	TK280802_E16_cyto_2D_step08.4363.4363.3	1.4707	0.0122	2860.32	4	1940.0%	1	K.ATNGSGQATSTAELLVKAETAPPNFVQR.L
	TK280802_E16_cyto_2D_step05.2040.2040.3	1.5823	0.031	1845.25	4	2340.0%	1	K.NSVGKSNCTVSVHVSDR.I
	TK280802_E16_cyto_2D_step04.4654.4654.2	0.6251	0.0717	3030.0	172	770.0%	1	K.VDADIYGKPIPTIQWIKGDQELSNTAR.L
	TK280802_E16_cyto_2D_step10.2281.2281.3	1.3575	0.0493	1869.67	2	3000.0%	1	K.FVFDGDDHSLIILFTK.L
	TK280802_E16_cyto_2D_step02.5175.5175.2	1.0421	0.0468	3158.02	2	1720.0%	2	K.VDDLIALGGQTVTLQAAVRGSEPISVTWMK.G
UK6A1_MOUSE70.9%112.2%724815958.1(P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1)
*	TK280802_E16_cyto_2D_step11.3099.3099.2	1.8473	0.3265	1745.71	1	4330.0%	1	R.TTQAPLHSVVQQLHGK.N
USIA1_MOUSE70.7%337.7%403464078.8(Q64685) CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase (EC 2.4.99.1) (Beta-galactoside alpha-2,6-sialyltransferase) (Alpha 2,6-ST) (Sialyltransferase 1) (ST6Gal I)
*	TK280802_E16_cyto_2D_step06.2600.2600.1	1.2531	0.0873	1012.73	16	5000.0%	1	-.MIHTNLKR.K
*	TK280802_E16_cyto_2D_step08.2596.2596.2	0.6502	0.0149	1162.3	6	1670.0%	1	K.EGVQILSYPR.V
*	TK280802_E16_cyto_2D_step06.2455.2455.1	1.5132	0.201	1424.6	3	3330.0%	1	K.KGSDYEALTLQAK.V
UQ91Y3770.0%241.6%623695665.6(Q91Y37) Cytosolic aminopeptidase P
*	TK280802_E16_cyto_2D_step13.1946.1946.1	1.8149	0.1269	1046.78	3	5560.0%	2	R.SAGHHLVPVK.E
UH2B1_MOUSE70.0%51710.4%1251380510.3(P10853) Histone H2B F (H2B 291A)
	TK280802_E16_cyto_2D_step08.2352.2352.1	0.9473	0.0018	822.82	12	5000.0%	1	K.RSTITSR.E
	TK280802_E16_cyto_2D_step05.1847.1847.1	1.3171	0.2033	746.79	1	6000.0%	4	R.LAHYNK.R
UCASB_MOUSE69.8%116.1%231253376.2(P10598) Beta casein precursor
*	TK280802_E16_cyto_2D_step01.2812.2812.1	1.6632	0.1659	1531.79	2	5000.0%	1	K.VFILACLVALALAR.E
UQ96JJ469.8%334.0%11661292666.6(Q96JJ4) Hypothetical protein KIAA1833 (Fragment)
*	TK280802_E16_cyto_2D_step13.2837.2837.2	1.7668	0.365	2329.26	4	2630.0%	1	K.SLYLETLHALEDLLTSLLQR.N
*	TK280802_E16_cyto_2D_step12.2405.2405.1	0.9667	0.0384	1436.54	11	2730.0%	1	K.AELVAQMMEFIR.A
*	TK280802_E16_cyto_2D_step05.3125.3125.2	0.8866	0.0013	1673.32	2	2860.0%	1	R.AICSSTQAGSFHFTR.K
UO9599669.7%8283.4%23032439468.8(O95996) APCL protein
*	TK280802_E16_cyto_2D_step12.5021.5021.3	1.1925	0.0374	4594.99	31	850.0%	1	R.TRGDGALQSLCLTTPTEEAVYCFYGNDSDEEPPAAAPTPTHR.R
*	TK280802_E16_cyto_2D_step01.1607.1607.1	1.2964	0.0366	1215.83	8	4500.0%	5	R.YASLPHISVAR.R
*	TK280802_E16_cyto_2D_step05.4063.4063.2	0.951	0.03	2394.2	1	2080.0%	1	K.RPPVTQAAGALPGPGASPVPKTPAR.T
*	TK280802_E16_cyto_2D_step11.5079.5079.3	1.6061	0.0346	4494.29	86	1000.0%	1	R.GDGALQSLCLTTPTEEAVYCFYGNDSDEEPPAAAPTPTHRR.T
UMUC5_HUMAN69.7%221.5%10561130437.6(P98088) Tracheobronchial mucin (TBM) (Major airway glycoprotein) (Fragment)
*	TK280802_E16_cyto_2D_step05.2711.2711.1	1.4698	0.2105	899.85	4	5000.0%	1	R.GADPQASPR.G
	TK280802_E16_cyto_2D_step05.2035.2035.1	0.9882	0.0487	900.7	7	4170.0%	1	R.RPEEITR.L
UCDC2_MOUSE69.2%71122.2%297341078.4(P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1)
	TK280802_E16_cyto_2D_step03.4207.4207.2	1.076	0.3566	2215.92	1	2630.0%	1	R.YSTPVDIWSIGTIFAELATK.K
	TK280802_E16_cyto_2D_step13.2292.2292.1	1.7789	0.1298	1211.9	1	6000.0%	2	K.WKPGSLASHVK.N
	TK280802_E16_cyto_2D_step10.3589.3589.2	1.1314	0.1009	1804.85	12	3570.0%	2	K.KPLFHGDSEIDQLFR.I
	TK280802_E16_cyto_2D_step04.3445.3445.2	1.0114	0.096	1566.18	11	3640.0%	1	R.VYTHEVVTLWYR.S
*	TK280802_E16_cyto_2D_step01.2346.2346.1	0.804	0.0019	848.91	63	3570.0%	1	R.ISGKMALK.H
UGTM1_MOUSE69.1%113.2%217258398.0(P10649) Glutathione S-transferase Mu 1 (EC 2.5.1.18) (GST class-mu 1) (Glutathione S-transferase GT8.7) (pmGT10) (GST 1-1)
*	TK280802_E16_cyto_2D_step06.2359.2359.1	1.4249	0.2471	873.53	1	7500.0%	1	K.MAHWSNK.-
UQ9NQH768.0%467.7%507570346.8(Q9NQH7) Hypothetical protein
	TK280802_E16_cyto_2D_step01.2970.2970.1	1.594	0.1705	817.56	5	6670.0%	2	K.AILFVPR.R
	TK280802_E16_cyto_2D_step12.2451.2451.2	1.0235	0.0281	1509.42	14	3330.0%	1	K.QLPSHKAILFVPR.R
	TK280802_E16_cyto_2D_step07.2816.2816.3	1.2257	0.0329	2975.98	35	1800.0%	1	R.DCLALCFPGTSLENIYSMMLTLIGQK.L
UQ9BVA768.0%6126.6%575589477.5(Q9BVA7) Hypothetical protein
*	TK280802_E16_cyto_2D_step11.3170.3170.3	1.4656	0.023	2355.46	124	1590.0%	3	K.LIDAETTAAAWPNVAAVSITGRK.R
*	TK280802_E16_cyto_2D_step07.4182.4182.3	1.0754	0.0022	2226.16	36	1550.0%	1	K.LIDAETTAAAWPNVAAVSITGR.K
*	TK280802_E16_cyto_2D_step06.2454.2454.1	1.5237	0.1832	987.69	1	5710.0%	1	K.RMALVLER.V
*	TK280802_E16_cyto_2D_step06.2246.2246.1	1.2808	0.0568	759.33	5	4170.0%	1	K.QVNVVAK.A
UQ8VCF468.0%224.4%4765708810.8(Q8VCF4) Similar to hypothetical protein FLJ13213
	TK280802_E16_cyto_2D_step13.0380.0380.1	0.7508	0.0482	670.41	4	3330.0%	1	R.GAPPGNR.S
*	TK280802_E16_cyto_2D_step13.2065.2065.2	2.0094	0.3015	1641.66	1	4620.0%	1	R.TVILHDRPEVAHPR.H
UHS9B_HUMAN67.9%111.0%723831335.0(P08238) Heat shock protein HSP 90-beta (HSP 84) (HSP 90)
*	TK280802_E16_cyto_2D_step01.3155.3155.1	1.7513	0.1401	830.36	2	6670.0%	1	R.ALLFIPR.R
UCOPB_MOUSE67.8%91511.8%9531070666.0(Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP)
	TK280802_E16_cyto_2D_step08.2162.2162.3	1.3752	0.1928	1297.19	69	2500.0%	1	K.VCHANPSERAR.F
	TK280802_E16_cyto_2D_step09.3534.3534.2	1.7653	0.3409	2091.74	1	3610.0%	1	K.LVEKPSPLTLAPHDFANIK.A
*	TK280802_E16_cyto_2D_step06.3891.3891.3	0.9376	0.1506	4423.46	3	1280.0%	1	R.TLHSCSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVR.E
	TK280802_E16_cyto_2D_step07.1889.1889.1	0.5415	0.0047	431.67	2	3330.0%	3	K.ANVK.V
	TK280802_E16_cyto_2D_step07.2399.2399.1	0.5628	0.1562	1124.82	136	1670.0%	1	K.LPGLLMTIIR.F
	TK280802_E16_cyto_2D_step07.2081.2081.2	0.7617	0.014	2050.62	83	1470.0%	1	K.EDQFQLSLLAAMGNTQRK.E
*	TK280802_E16_cyto_2D_step05.1594.1594.2	0.6848	0.017	1091.88	163	2220.0%	1	R.QSLSQMLSAK.L
URS16_MOUSE67.8%4622.9%1441622510.2(P14131) 40S ribosomal protein S16
	TK280802_E16_cyto_2D_step06.2951.2951.2	1.2445	0.2855	1244.72	5	4090.0%	2	K.GGGHVAQIYAIR.Q
	TK280802_E16_cyto_2D_step01.2806.2806.1	1.1305	0.0469	1188.38	4	4000.0%	1	K.GPLQSVQVFGR.K
	TK280802_E16_cyto_2D_step01.3621.3621.1	1.4239	0.2422	1095.27	2	4440.0%	1	K.LLEPVLLLGK.E
UQ9Y60267.5%7378.6%267302649.4(Q9Y602) Cysteine sulfinic acid decarboxylase-related protein 1
*	TK280802_E16_cyto_2D_step04.3169.3169.1	1.465	0.2132	884.45	3	5830.0%	6	R.GRLVWPR.L
*	TK280802_E16_cyto_2D_step09.4397.4397.2	0.9223	0.0269	1992.71	35	2000.0%	1	R.FWDLAPTVSEWSRLMR.E
UO5498867.4%573.7%12331414855.1(O54988) Serine/threonine protein kinase
	TK280802_E16_cyto_2D_step09.3653.3653.2	1.7488	0.4257	2455.05	2	2750.0%	2	R.WTTSQLLQHPFVTVDSNKPVR.E
	TK280802_E16_cyto_2D_step01.3808.3808.1	1.0609	0.0827	1306.18	10	3890.0%	1	R.YNQRLIEELK.N
	TK280802_E16_cyto_2D_step12.1990.1990.1	0.9266	0.3331	916.25	7	3750.0%	1	K.ETNVLAAAK.V
	TK280802_E16_cyto_2D_step03.2246.2246.1	0.58	0.037	803.29	5	3000.0%	1	K.QYEHVK.R
UQ9D3U467.4%466.5%565625648.3(Q9D3U4) 4933434H11Rik protein
	TK280802_E16_cyto_2D_step01.3706.3706.1	1.9621	0.0842	917.12	7	5710.0%	2	R.GFGFVLFK.D
*	TK280802_E16_cyto_2D_step10.0010.0010.2	0.8234	0.0704	2404.52	1	2000.0%	1	K.MFIGGLSQEMSKQVLLEYLSK.F
*	TK280802_E16_cyto_2D_step01.1122.1122.1	0.7902	0.0422	1036.8	19	4290.0%	1	K.DNETEQFR.E
UQ9DC4567.4%351.5%814935875.3(Q9DC45) 1200003J11Rik protein
*	TK280802_E16_cyto_2D_step06.1997.1997.1	0.9529	0.0073	648.66	37	6250.0%	1	K.KDQEK.T
	TK280802_E16_cyto_2D_step07.2501.2501.1	1.9569	0.0079	890.04	2	5830.0%	2	K.EKEELLK.L
UQ9D5T867.4%486.5%400468566.8(Q9D5T8) 4921522E24Rik protein
*	TK280802_E16_cyto_2D_step12.2806.2806.2	1.2822	0.128	2246.34	33	2780.0%	2	K.SFQQQLCDAIAIIKGMYQK.Y
*	TK280802_E16_cyto_2D_step07.2501.2501.1	1.9569	0.0079	890.04	2	5830.0%	2	K.EKEEIIK.N
UDDX5_HUMAN67.1%113.3%614691488.9(P17844) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5)
*	TK280802_E16_cyto_2D_step11.4154.4154.2	1.7477	0.5312	2362.82	1	3420.0%	1	K.TLSYLLPAIVHINHQPFLER.G
UH10_MOUSE67.1%83813.5%1932073010.9(P10922) Histone H1' (H1.0) (H1(0))
*	TK280802_E16_cyto_2D_step06.1747.1747.1	0.937	0.0518	640.74	5	5000.0%	1	K.KAAKPK.K
*	TK280802_E16_cyto_2D_step05.1623.1623.1	1.0481	0.0552	714.95	9	4170.0%	6	K.KPAATPK.K
	TK280802_E16_cyto_2D_step12.2063.2063.1	0.9499	0.0549	1441.61	2	3750.0%	1	K.YSDMIVAAIQAEK.N
UROG_MOUSE67.1%353.9%3884223410.0(O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)
	TK280802_E16_cyto_2D_step14.1245.1245.1	0.736	0.0129	874.01	39	2140.0%	2	R.RGPPPPPR.S
	TK280802_E16_cyto_2D_step05.2077.2077.1	1.0398	0.0904	854.9	2	4170.0%	1	R.REPLPSR.R
UQ91W4867.0%465.7%511572306.2(Q91W48) Archain 1
	TK280802_E16_cyto_2D_step09.2517.2517.2	1.8699	0.3095	1464.91	1	5830.0%	1	K.KGVQLQTHPNVDK.K
	TK280802_E16_cyto_2D_step05.1788.1788.3	1.0278	0.0647	1465.51	87	1670.0%	2	K.GVQLQTHPNVDKK.L
	TK280802_E16_cyto_2D_step05.4058.4058.2	1.103	0.063	1801.45	113	2500.0%	1	R.NTLEWCLPVIDAKNK.S
UATY2_MOUSE66.8%151493.9%12001323788.0(Q9EPE9) Probable cation-transporting ATPase 2 (EC 3.6.3.-) (CATP)
	TK280802_E16_cyto_2D_step07.5210.5210.1	1.2255	1.0E-4	1343.96	114	2500.0%	2	R.CTLVTTLQMFK.I
*	TK280802_E16_cyto_2D_step12.4135.4135.3	0.9829	0.0223	4357.37	9	1210.0%	1	K.TLSRERPLPNIFNLYTILTVMLQFSVHFLSLVYLYR.E
UO6029066.8%576.7%11111251107.4(O60290) Hypothetical protein KIAA0543 (Fragment)
*	TK280802_E16_cyto_2D_step08.3552.3552.3	1.2132	0.0323	2604.33	56	1410.0%	1	R.MNYELLASLGPAAAKPDLISKLER.R
*	TK280802_E16_cyto_2D_step15.4071.4071.3	0.8758	0.0019	4357.8	9	950.0%	1	K.QMEVKESYITLAPLYSETADGYFETIVSALDELDIPFR.K
*	TK280802_E16_cyto_2D_step05.1720.1720.1	0.6909	0.0012	847.75	4	3000.0%	1	K.RTYRPR.S
*	TK280802_E16_cyto_2D_step05.2379.2379.1	1.7845	0.1204	755.01	2	8000.0%	2	R.KLLKPR.S
UIRS2_MOUSE66.8%464.4%13211365278.7(P81122) Insulin receptor substrate-2 (IRS-2) (4PS)
*	TK280802_E16_cyto_2D_step09.4210.4210.2	0.8436	0.0025	2907.17	4	1730.0%	1	R.LSLMDQVSGVEAFLQVSQPPDPHRGAK.V
	TK280802_E16_cyto_2D_step05.2379.2379.1	1.7845	0.1204	755.01	2	8000.0%	2	K.QILQPR.L
*	TK280802_E16_cyto_2D_step08.3389.3389.3	1.3511	0.0704	2694.63	10	1980.0%	1	R.RHSSETFSSTTTVTPVSPSFAHNSK.R
UDLP2_HUMAN66.4%71910.3%10191137847.0(Q9P1A6) Disks large-associated protein 2 (DAP-2) (SAP90/PSD-95-associated protein 2) (SAPAP2) (PSD-95/SAP90 binding protein 2) (Fragment)
*	TK280802_E16_cyto_2D_step10.3530.3530.3	1.1496	0.0184	2837.43	1	2000.0%	1	R.TQVDTSTLPPPDPWLEPAIDTVETGR.M
*	TK280802_E16_cyto_2D_step11.4343.4343.3	0.8174	0.1256	4028.24	8	880.0%	1	R.SSVHSECVMMPVVLGDHVSSSTFPRMHYSSHYDTR.D
	TK280802_E16_cyto_2D_step04.1931.1931.1	1.3628	0.2172	655.9	2	6000.0%	4	K.KPPKGK.F
*	TK280802_E16_cyto_2D_step02.4086.4086.3	1.8732	0.0913	4051.75	11	1420.0%	1	K.SIGQRPLGEHQTQTYLQAASDVPVGHSLDPAANYNSPK.F
UKTHY_HUMAN66.2%113.3%212239028.6(P23919) Thymidylate kinase (EC 2.7.4.9) (dTMP kinase)
*	TK280802_E16_cyto_2D_step01.3074.3074.1	1.926	0.0207	879.37	5	7500.0%	1	K.DTTLNWK.M
U3BP5_MOUSE65.9%391.9%427474085.3(Q9Z131) SH3 domain-binding protein 5 (SH3 domain-binding protein that preferentially associates with BTK)
*	TK280802_E16_cyto_2D_step09.2521.2521.2	2.2319	0.1463	890.4	4	6430.0%	3	R.RSNAMGPR.G
UTCPD_MOUSE65.8%227.8%539580668.0(P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45)
*	TK280802_E16_cyto_2D_step01.3361.3361.1	1.4737	0.194	1552.88	4	3670.0%	1	R.ALIAGGGAPEIELALR.L
	TK280802_E16_cyto_2D_step03.3920.3920.2	0.8506	0.0053	2624.73	25	1600.0%	1	K.AQDIEAGDGTTSVVIIAGSLLDSCTK.L
UPDA4_MOUSE65.8%9175.5%638719735.3(P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72)
	TK280802_E16_cyto_2D_step07.2547.2547.1	1.2394	0.0499	697.18	8	7000.0%	1	K.LKPVIK.S
	TK280802_E16_cyto_2D_step09.2758.2758.2	1.7728	0.1556	980.18	2	6880.0%	3	K.RSPPIPLAK.V
	TK280802_E16_cyto_2D_step01.0968.0968.1	1.1558	0.0133	717.06	21	7000.0%	2	K.EILTLK.Q
*	TK280802_E16_cyto_2D_step13.2305.2305.2	1.3956	0.3506	1000.22	1	5620.0%	1	K.HALPLVGHR.K
*	TK280802_E16_cyto_2D_step06.1941.1941.1	1.2214	0.11	599.57	8	6250.0%	1	K.KNPIK.F
UQ9NXE865.7%222.8%4254964810.2(Q9NXE8) Hypothetical protein FLJ20291
*	TK280802_E16_cyto_2D_step06.0395.0395.1	0.6736	0.0023	848.22	13	3330.0%	1	R.RETGQTR.S
*	TK280802_E16_cyto_2D_step06.2162.2162.1	1.9051	0.0081	599.65	5	7500.0%	1	K.LHNSK.V
UQ9CZ8565.7%86423.7%114127155.0(Q9CZ85) 2810038F24Rik protein
*	TK280802_E16_cyto_2D_step12.4010.4010.2	1.7731	0.0387	3010.29	41	1350.0%	8	R.AQYTLMAQAVDRDTNKPLGPPSEFIDK.D
UQ96RT165.6%240.6%14121582375.5(Q96RT1) Densin-180-like protein
*	TK280802_E16_cyto_2D_step01.0210.0210.1	1.552	0.1583	1003.06	2	6250.0%	2	K.DVPPDSLMK.M
UQ99J1065.6%3311.2%420438238.1(Q99J10) Hypothetical 43.8 kDa protein
*	TK280802_E16_cyto_2D_step08.3815.3815.2	1.7284	0.3622	1680.56	1	3930.0%	1	K.DSTVLAHVLRELAPR.L
	TK280802_E16_cyto_2D_step05.3605.3605.1	1.08	0.2122	903.76	2	5000.0%	1	R.RALEEGAR.L
*	TK280802_E16_cyto_2D_step07.3216.3216.3	1.082	0.0192	2754.06	6	1300.0%	1	R.WELPLTIVAYEDLFGGWTMDAVAR.S
UGLYC_MOUSE65.5%223.3%478525856.9(P50431) Serine hydroxymethyltransferase, cytosolic (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT)
	TK280802_E16_cyto_2D_step13.2040.2040.1	1.4118	0.2354	879.96	1	6670.0%	1	K.VAHFIHR.G
*	TK280802_E16_cyto_2D_step09.1959.1959.3	1.4387	0.1231	1938.89	32	1670.0%	1	R.GLLEEDFQKVAHFIHR.G
UQ9Y5A865.5%392.8%427507109.2(Q9Y5A8) NY-REN-6 antigen (Fragment)
*	TK280802_E16_cyto_2D_step10.3110.3110.2	1.7049	0.0249	1575.07	2	5450.0%	3	R.RTLLEHWMMINK.L
UQ9NUV865.5%557.9%865988614.9(Q9NUV8) Hypothetical protein FLJ11111
*	TK280802_E16_cyto_2D_step14.2961.2961.1	0.5791	0.0622	963.25	42	2140.0%	1	R.EQLTETDK.D
*	TK280802_E16_cyto_2D_step12.4991.4991.2	1.4843	0.1452	1990.94	7	2500.0%	1	R.AEDIIKEIIDENFAELK.K
*	TK280802_E16_cyto_2D_step08.2737.2737.3	1.1613	0.1165	2151.98	173	1470.0%	1	R.SYEVMGSMEETLCNIDDR.D
*	TK280802_E16_cyto_2D_step01.0778.0778.1	1.1184	0.0356	838.74	174	5000.0%	1	K.SSETGKVK.T
*	TK280802_E16_cyto_2D_step04.4052.4052.2	1.7029	0.3641	1893.77	1	4690.0%	1	K.HRAGEITSDGLSFLFLK.E
URS6_HUMAN65.1%396.8%2492868110.8(P10660) 40S ribosomal protein S6 (Phosphoprotein NP33) (P10660) 40S ribosomal protein S6 (Phosphoprotein NP33)
	TK280802_E16_cyto_2D_step06.4297.4297.2	2.0472	0.2875	1829.08	1	4380.0%	3	R.GCIVDANLSVLNLVIVK.K
UQ96S4265.0%225.8%347395807.1(Q96S42) Nodal-related protein
*	TK280802_E16_cyto_2D_step10.4129.4129.3	2.5358	0.4177	2340.04	1	2760.0%	1	K.TKPLSMLYVDNGRVLLDHHK.D
UQ9Y4W764.8%222.5%9761109036.5(Q9Y4W7) Poly(ADP-ribose) glycohydrolase
*	TK280802_E16_cyto_2D_step01.2940.2940.1	0.8185	0.0072	1362.96	64	3330.0%	1	K.GIKTAESESLDSK.E
*	TK280802_E16_cyto_2D_step01.3004.3004.1	1.7486	0.1247	1316.19	1	6000.0%	1	R.FLINPELIISR.L
ULHX4_MOUSE64.7%5119.0%367408127.7(P53776) LIM/homeobox protein Lhx4
	TK280802_E16_cyto_2D_step04.0508.0508.1	0.7389	0.0892	1512.28	9	2080.0%	1	R.EDQILSELGHTNR.I
	TK280802_E16_cyto_2D_step01.3023.3023.1	1.6402	0.1523	687.44	3	7500.0%	3	K.EDFFK.R
	TK280802_E16_cyto_2D_step14.1682.1682.2	0.5522	0.0271	1713.48	39	1070.0%	1	K.CTACQQGIPPTQVVR.K
UHBD_HUMAN64.7%398.9%146159248.0(P02042) Hemoglobin delta chain
*	TK280802_E16_cyto_2D_step01.2542.2542.1	1.3839	0.2368	1523.94	2	3750.0%	3	K.GTFSQLSELHCDK.L
URL28_MOUSE64.2%62611.8%1361560212.0(P41105) 60S ribosomal protein L28
	TK280802_E16_cyto_2D_step05.2129.2129.1	0.9908	0.1204	924.05	3	4290.0%	5	R.KPATSYVR.T
*	TK280802_E16_cyto_2D_step03.2235.2235.1	0.8131	0.184	886.42	93	2860.0%	1	R.SQKPVVVK.R
UANX6_MOUSE64.2%9137.6%672757555.5(P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II)
	TK280802_E16_cyto_2D_step01.3475.3475.1	1.2876	0.0914	1031.13	2	5620.0%	1	K.TLIEILATR.T
	TK280802_E16_cyto_2D_step06.2037.2037.1	0.8333	0.1512	603.27	1	6250.0%	1	K.SHFGR.D
	TK280802_E16_cyto_2D_step04.3010.3010.1	0.6825	0.0013	692.23	5	5000.0%	1	K.EDYHK.S
	TK280802_E16_cyto_2D_step01.3104.3104.1	1.6782	0.1444	1026.94	2	7140.0%	1	R.LVFDEYLK.T
	TK280802_E16_cyto_2D_step03.3290.3290.1	1.2631	0.0242	1178.17	1	5000.0%	1	K.DAFVAIVQSVK.N
	TK280802_E16_cyto_2D_step06.2462.2462.1	1.0944	0.233	773.65	17	6000.0%	2	R.SYPHLR.R
	TK280802_E16_cyto_2D_step01.0424.0424.1	1.2697	0.0455	774.67	1	6670.0%	2	K.LMLAVVK.C
UQ9DBI664.1%112.1%669694859.7(Q9DBI6) 1300007E16Rik protein
	TK280802_E16_cyto_2D_step13.2190.2190.2	1.7535	0.3553	1557.17	1	5000.0%	1	R.AIEALHGHELRPGR.A
UVIME_MOUSE64.0%4418.5%465535575.1(P20152) Vimentin
*	TK280802_E16_cyto_2D_step12.4279.4279.2	0.7911	0.0195	2924.19	381	930.0%	1	R.TYSLGSALRPSTSRSLYSSSPGGAYVTR.S
*	TK280802_E16_cyto_2D_step03.4672.4672.3	1.0333	0.0059	4038.65	89	880.0%	1	K.KLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALR.D
	TK280802_E16_cyto_2D_step01.1676.1676.1	0.9034	0.1485	1256.3	7	3890.0%	1	R.LGDLYEEEMR.E
	TK280802_E16_cyto_2D_step01.3247.3247.1	1.6232	0.149	1534.97	1	4580.0%	1	R.KVESLQEEIAFLK.K
UO3512663.6%224.8%11751237239.0(O35126) DRPLA
	TK280802_E16_cyto_2D_step03.3507.3507.2	1.0273	0.1797	2020.86	8	2350.0%	1	R.SINDDGSSDPRDIDQDNR.S
	TK280802_E16_cyto_2D_step15.3151.3151.3	2.5467	0.3685	3949.64	1	1820.0%	1	R.APVECPSLGPVPHRPPFEPGSAVATVPPYLGPDTPALR.T
URL39_HUMAN63.0%3920.0%50627512.6(P02404) 60S ribosomal protein L39
*	TK280802_E16_cyto_2D_step11.3174.3174.2	1.8305	0.296	1309.11	2	5560.0%	3	K.QNRPIPQWIR.M
UQ9D7R062.9%108219.1%215249505.6(Q9D7R0) 1500031J01Rik protein
	TK280802_E16_cyto_2D_step01.1600.1600.3	1.375	0.1635	2216.13	2	1810.0%	1	K.ELRTSLEEHQSALELIMSK.Y
	TK280802_E16_cyto_2D_step02.4150.4150.2	2.0235	0.138	2555.85	1	2620.0%	9	K.EQHSKELQAHVDQITEMAAVMR.K
UQ6198462.2%223.5%12031299709.6(Q61984) N-methyl-D-aspartate receptor subunit NR2C
*	TK280802_E16_cyto_2D_step12.2863.2863.2	1.8155	0.2913	2084.01	2	2860.0%	1	R.GSNTVVAAAILPGGLCGGRASR.G
*	TK280802_E16_cyto_2D_step01.1152.1152.3	1.2366	0.1046	1929.72	126	1710.0%	1	R.LGCAVASASRASGIAPLGLR.A
UCAPB_MOUSE62.2%4103.2%277313455.7(P47757) F-actin capping protein beta subunit (CapZ beta)
	TK280802_E16_cyto_2D_step06.2284.2284.2	2.0563	0.2741	1111.68	1	6880.0%	3	R.RLPPQQIEK.N
U143G_HUMAN62.2%95114.6%246281714.9(P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1)
	TK280802_E16_cyto_2D_step07.4292.4292.2	1.6138	0.3774	3014.8	2	2000.0%	1	R.LGLALNYSVFYYEIQNAPEQACHLAK.T
	TK280802_E16_cyto_2D_step10.2561.2561.2	1.3231	0.1244	1249.09	1	6110.0%	7	K.EHMQPTHPIR.L
UQ8WZ6462.1%151474.3%17041934217.3(Q8WZ64) PARX protein
	TK280802_E16_cyto_2D_step04.3466.3466.2	1.0124	0.0209	1821.77	2	3000.0%	1	K.AKIFTVLSGNSVWLCK.N
	TK280802_E16_cyto_2D_step07.5138.5138.2	0.6233	0.0852	2036.92	31	1180.0%	1	K.DTQVSQAGDLLIEVYVER.K
	TK280802_E16_cyto_2D_step09.2550.2550.2	1.2483	0.1058	1451.52	10	3750.0%	1	K.YGAFIRSLPGVNR.A
	TK280802_E16_cyto_2D_step12.2305.2305.3	2.1574	0.0686	2832.9	1	2300.0%	12	R.DFPTAEEPHLNLGSLNDSLFGSDNIK.I
UGALT_HUMAN62.0%5257.1%3683957310.2(O60755) Galanin receptor type 3 (GAL3-R) (GALR3)
*	TK280802_E16_cyto_2D_step12.3998.3998.2	1.5923	0.0628	3007.24	3	1800.0%	5	R.LASHCLAYANSCLNPLVYALASRHFR.A
UPSD1_HUMAN61.9%6810.4%9531058665.4(Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112)
*	TK280802_E16_cyto_2D_step06.3640.3640.3	0.9031	0.0683	3582.94	14	760.0%	1	R.QDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSK.N
*	TK280802_E16_cyto_2D_step13.2525.2525.2	0.9084	0.0039	1512.29	18	3750.0%	1	K.KPIDQRLEGIVNK.M
*	TK280802_E16_cyto_2D_step09.3889.3889.3	2.344	0.3121	2958.01	1	2400.0%	2	R.NSVCHTATVIANSFMHCGTTSDQFLR.D
*	TK280802_E16_cyto_2D_step09.2486.2486.3	1.4578	0.1045	1853.7	123	2190.0%	1	K.TILESNDVPGMLAYSLK.L
*	TK280802_E16_cyto_2D_step05.2427.2427.1	1.2263	0.0137	935.83	13	5000.0%	1	R.QFAALVASK.V
ULMA1_MOUSE61.9%884.3%30843381736.7(P19137) Laminin alpha-1 chain precursor (Laminin A chain)
*	TK280802_E16_cyto_2D_step01.2786.2786.1	1.4727	0.0776	975.23	4	5710.0%	1	K.YFNSVSEK.H
*	TK280802_E16_cyto_2D_step08.2929.2929.3	1.1099	0.025	1794.44	356	2000.0%	1	K.VTHFKGCMGEAFLNGK.S
	TK280802_E16_cyto_2D_step05.1816.1816.1	0.8542	0.0306	688.88	17	5000.0%	1	R.GPPTYR.A
*	TK280802_E16_cyto_2D_step15.4894.4894.2	1.0406	0.1242	2964.38	10	1400.0%	1	K.TQEPDNLLFYLGSSSSSDFLAVEMRR.G
*	TK280802_E16_cyto_2D_step04.4189.4189.2	0.9223	0.0259	1804.86	48	2670.0%	1	R.VQEEQNVTSELIAKGR.E
*	TK280802_E16_cyto_2D_step01.0190.0190.1	1.0813	0.03	1064.17	7	5000.0%	1	K.RFQKPQEK.L
*	TK280802_E16_cyto_2D_step08.3791.3791.2	1.6975	0.4409	2323.83	1	2890.0%	1	K.LDELKNLTSQFQESVDNITK.Q
*	TK280802_E16_cyto_2D_step14.2935.2935.3	1.0726	0.0881	3758.88	1	1060.0%	1	K.LTAFGGFLKYTVSYDIPVETVDSDLMSHADIIIK.G
UQ96MQ261.5%114.7%342389138.9(Q96MQ2) Hypothetical protein FLJ32053
*	TK280802_E16_cyto_2D_step13.2476.2476.2	1.6887	0.3994	1897.97	1	3000.0%	1	K.CGKAFSQFSMLIIHVR.I
UQ9EQ0061.3%397.8%230259425.1(Q9EQ00) cAMP-dependent protein kinase regulatory subunit
*	TK280802_E16_cyto_2D_step08.3644.3644.2	1.9068	0.2768	1944.07	4	3240.0%	3	K.FLALGCSSLGRTLNTAMK.N
UHCC1_MOUSE61.2%115.2%210235336.7(Q9D1J3) Nuclear protein Hcc-1
	TK280802_E16_cyto_2D_step01.3286.3286.1	1.4557	0.1824	1249.67	2	4500.0%	1	R.FNVPVSLESKK.A
URL32_HUMAN61.2%4413.4%1341572911.3(P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32
	TK280802_E16_cyto_2D_step13.2148.2148.2	1.627	0.2376	1094.37	63	3890.0%	1	-.AALRPLVKPK.I
	TK280802_E16_cyto_2D_step13.2141.2141.1	1.435	0.2185	985.98	1	5710.0%	1	R.KFLVHNVK.E
	TK280802_E16_cyto_2D_step05.2734.2734.1	1.1151	0.1499	856.78	1	6670.0%	1	K.FLVHNVK.E
UQ8TBY961.1%578.5%11541306455.0(Q8TBY9) Hypothetical protein
*	TK280802_E16_cyto_2D_step01.2766.2766.1	1.8501	0.0266	1170.14	1	5620.0%	1	R.YLVFINRDK.L
*	TK280802_E16_cyto_2D_step10.4939.4939.3	1.0086	0.0458	4664.82	3	1050.0%	1	R.VLLYVCAHTAIIYNVFRNNQYHLQGHANIISCLCVSEDR.R
*	TK280802_E16_cyto_2D_step10.2291.2291.2	0.9835	0.0768	1238.98	4	4440.0%	1	K.KIVMEETEEK.A
*	TK280802_E16_cyto_2D_step14.4819.4819.3	1.184	0.0274	4405.08	64	830.0%	2	K.GPDCLVIIWDSFTGIPVHTIFDSCPEGNGIMAMAMTHDAK.Y
ULAM1_HUMAN60.8%242.1%585662775.2(P20700) Lamin B1
*	TK280802_E16_cyto_2D_step11.2994.2994.2	2.0145	0.2722	1555.64	3	4090.0%	2	K.SMYEEEINETRR.K
UZ147_MOUSE60.7%354.9%634717728.3(Q61510) Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp)
*	TK280802_E16_cyto_2D_step08.3392.3392.2	0.9381	0.0364	1728.65	20	2000.0%	1	K.AAKLQGESTKPVYIPK.I
*	TK280802_E16_cyto_2D_step11.2471.2471.2	2.0101	0.2733	1535.81	2	5000.0%	2	K.TPVAPGPPSHFSPNK.L
UQ8R0K160.5%193256.0%749872806.8(Q8R0K1) Hypothetical 87.3 kDa protein (Fragment)
	TK280802_E16_cyto_2D_step08.0006.0006.2	1.1862	0.1731	2023.03	1	3120.0%	18	K.TFNEPGSEYFIFLLSTR.A
	TK280802_E16_cyto_2D_step09.3906.3906.3	1.3842	0.0044	3133.24	46	1480.0%	1	K.EDDSEGEESEEEEEGEEEGSESESRSVK.V
URA18_MOUSE60.5%357.5%509574127.2(Q9QXK2) Postreplication repair protein RAD18 (mRAD18Sc)
*	TK280802_E16_cyto_2D_step01.4031.4031.3	1.0989	0.047	2701.44	88	1630.0%	1	R.TDEPAETLPSMRTDEPAETLPLMR.A
*	TK280802_E16_cyto_2D_step01.2752.2752.1	1.8263	0.0209	1565.67	1	4620.0%	2	K.SAAEIVQEIESMEK.T
UQ96MZ860.4%111.9%618678798.7(Q96MZ8) Hypothetical protein FLJ31638
	TK280802_E16_cyto_2D_step07.2127.2127.1	1.6056	0.1306	1458.8	2	3180.0%	1	K.QLCPAIQKLMVR.S
ULAG3_HUMAN60.2%4109.7%525574378.0(P18627) Lymphocyte activation gene-3 protein precursor (LAG-3) (FDC protein) (CD223 antigen)
*	TK280802_E16_cyto_2D_step07.3359.3359.1	1.1504	0.0854	1221.64	1	4550.0%	3	R.YTVLSVGPGGLR.S
*	TK280802_E16_cyto_2D_step14.3775.3775.3	1.1527	0.1268	4360.46	16	920.0%	1	R.LGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFR.N
URL9_MOUSE60.2%41620.3%1922188110.0(P51410) 60S ribosomal protein L9
*	TK280802_E16_cyto_2D_step06.4327.4327.3	2.2268	0.3943	4104.28	1	1910.0%	4	R.TGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVK.N
UQ8VDW060.1%359.6%427490675.7(Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family
	TK280802_E16_cyto_2D_step01.3402.3402.1	1.5389	0.1477	1245.88	5	4440.0%	2	R.DFLLKPELLR.A
*	TK280802_E16_cyto_2D_step13.2992.2992.3	1.8322	0.2896	3516.62	14	1580.0%	1	-.MAEQDVENELLDYDEDEEPQAPQESTPAPPK.K
UQ9ULF260.1%7139.7%10231140778.2(Q9ULF2) Hypothetical protein KIAA1268 (Fragment)
*	TK280802_E16_cyto_2D_step08.3224.3224.3	1.0793	0.0255	2171.99	18	1580.0%	1	K.DTQGFYGTVSSPDSGVYEMK.I
*	TK280802_E16_cyto_2D_step01.3429.3429.2	0.9666	0.0768	2531.46	66	830.0%	1	K.AGPELQEELDTVGQGVAVSMGTVLK.T
*	TK280802_E16_cyto_2D_step08.4065.4065.2	0.7469	0.0655	1851.41	265	2060.0%	1	R.TVLAPGVVLIVQQGDLAR.L
*	TK280802_E16_cyto_2D_step07.3875.3875.3	1.2627	0.0934	2611.01	78	1740.0%	1	K.NIIHVIGGNDVKSSVSSVLQECEK.K
*	TK280802_E16_cyto_2D_step01.4326.4326.1	1.3213	0.0544	1255.16	16	3640.0%	3	R.ANGNLVSDKIPK.A
UQ9CT2760.1%3321.4%295330128.8(Q9CT27) 2610015J01Rik protein (Fragment)
*	TK280802_E16_cyto_2D_step08.2665.2665.3	1.6431	0.1895	2450.93	8	2260.0%	1	K.LKENDENCGPTTTVFVGNISEK.A
	TK280802_E16_cyto_2D_step04.3606.3606.3	1.1785	0.1625	2883.97	7	1900.0%	1	K.GAIEVLIREYSSELNAPSQESDSHPR.K
	TK280802_E16_cyto_2D_step12.3803.3803.2	1.7084	0.3236	1725.06	1	3930.0%	1	R.RFPVAPLIPYPLITK.E
UTGR2_MOUSE60.1%135518.8%592671226.3(Q62312) TGF-beta receptor type II precursor (EC 2.7.1.37) (TGFR-2) (TGF-beta type II receptor)
	TK280802_E16_cyto_2D_step15.2057.2057.2	0.7855	0.0158	1293.9	84	2000.0%	1	K.DYEPPFGSKVR.E
*	TK280802_E16_cyto_2D_step05.4514.4514.3	1.8043	0.116	2914.72	1	2500.0%	1	K.QNTSEQFETVAVKIFPYEEYSSWK.T
	TK280802_E16_cyto_2D_step09.4934.4934.1	0.8242	0.0208	1117.06	12	3120.0%	1	R.EHPCVESMK.D
	TK280802_E16_cyto_2D_step11.3792.3792.3	1.2517	0.0867	2886.56	1	2400.0%	1	K.QTDVYSMALVLWEMTSRCNAVGEVK.D
*	TK280802_E16_cyto_2D_step11.2296.2296.3	1.0873	0.0096	2386.74	12	2020.0%	1	K.HFNSDVMASDNGGAVKLPQLCK.F
*	TK280802_E16_cyto_2D_step12.2897.2897.2	1.2328	0.1391	2386.32	212	2110.0%	1	R.YMAPEVLESRMNLENVESFK.Q
UQ9NSE659.7%356.3%734794637.0(Q9NSE6) C21orf258 protein
*	TK280802_E16_cyto_2D_step12.4597.4597.2	1.7908	0.2852	2004.83	1	3160.0%	2	K.HLAGSASPSVVLITKPTTVK.E
*	TK280802_E16_cyto_2D_step09.3848.3848.3	1.0427	0.0028	2768.31	23	1600.0%	1	K.VVVCHVVGQAIQFLVSETPALGAGCR.L
UQ9DC9259.6%5910.1%318349907.0(Q9DC92) 0710008M05Rik protein (Non-canonical ubiquitin conjugating enzyme 1)
	TK280802_E16_cyto_2D_step07.2601.2601.1	1.5167	0.1484	623.51	2	7500.0%	2	R.QISFK.A
	TK280802_E16_cyto_2D_step12.4311.4311.2	1.8759	0.2042	2984.36	3	2120.0%	2	R.IVLPPEYPMKPPSIILLTANGRFEVGK.K
UQ96NK259.5%241.3%711814245.9(Q96NK2) Hypothetical protein FLJ30691 (Fragment)
*	TK280802_E16_cyto_2D_step01.1043.1043.1	1.8273	0.0251	903.21	9	5000.0%	2	R.AGRAGNLDK.I
UQ925I459.5%203265.7%843957367.4(Q925I4) Candidate taste receptor T1R2
*	TK280802_E16_cyto_2D_step15.3530.3530.2	1.5074	0.049	2679.77	1	2500.0%	1	R.LTYISNVSWYTPNNTVPISMCSK.S
*	TK280802_E16_cyto_2D_step14.2199.2199.2	0.9004	0.04	2238.95	2	2350.0%	1	K.CNEYNMKVLGYNLMQAMR.F
*	TK280802_E16_cyto_2D_step07.3031.3031.1	1.2725	0.0374	892.9	73	5000.0%	18	R.RFPAMLR.T
UMTM1_HUMAN59.5%224.1%603699328.2(Q13496) Myotubularin (EC 3.1.3.48)
*	TK280802_E16_cyto_2D_step09.2520.2520.3	1.6212	0.0404	2012.67	8	2780.0%	1	R.SLETDSSLILDVPLGVISR.I
*	TK280802_E16_cyto_2D_step01.0390.0390.1	1.8265	0.0373	736.68	6	8000.0%	1	R.ITFINK.C
UQ9D3P659.4%2211.4%228259197.5(Q9D3P6) DNA segment, human D0S6743E
	TK280802_E16_cyto_2D_step09.3242.3242.2	1.762	0.2993	1795.24	2	4000.0%	1	R.TPGRPTSSQSYEQNIK.Q
	TK280802_E16_cyto_2D_step06.1593.1593.2	0.6517	0.0182	1019.86	47	3330.0%	1	K.TASDQATTAR.I
UQ9H5R958.8%392.2%268306804.7(Q9H5R9) Hypothetical protein FLJ23129
*	TK280802_E16_cyto_2D_step06.2302.2302.1	0.7834	0.0076	698.87	12	4000.0%	3	R.QLPVLK.E
UQ9UPV858.7%6108.1%12631353427.4(Q9UPV8) Hypothetical protein KIAA1043 (Fragment)
*	TK280802_E16_cyto_2D_step01.0348.0348.1	1.7788	0.0947	1339.67	1	5000.0%	1	K.YPSSPYSAHISK.S
*	TK280802_E16_cyto_2D_step03.4598.4598.2	1.103	0.08	2823.92	22	1670.0%	1	R.ACASSETESEAGDIMDQQFEEMNNK.L
*	TK280802_E16_cyto_2D_step09.4016.4016.3	1.5386	0.2302	3291.22	2	1640.0%	2	R.TETTSLGSLPLPAGPPATAPARPLRLPSGNGYK.F
*	TK280802_E16_cyto_2D_step04.5026.5026.2	0.8288	0.1578	3088.48	37	1130.0%	2	K.SPRNMSPSSGHQSPAGSAPSPALSYSSAGSAR.S
UGDFF_MOUSE58.6%394.6%303332569.1(Q9Z0J7) Growth/differentiation factor 15 precursor (GDF-15)
*	TK280802_E16_cyto_2D_step10.4659.4659.1	1.81	0.0713	1574.85	8	3850.0%	3	R.RSGPESQLNADELR.G
UQ9NXW158.4%226.1%412468316.8(Q9NXW1) Hypothetical protein FLJ20030
*	TK280802_E16_cyto_2D_step01.3910.3910.1	0.7497	0.1029	1039.52	44	3120.0%	1	R.LAHGFSNHR.K
*	TK280802_E16_cyto_2D_step06.3271.3271.2	2.1723	0.1346	1914.38	1	5000.0%	1	R.TTSNTLHYIHIEQLDK.I
UQ9CZY558.3%71527.4%285306555.6(Q9CZY5) 2610312E17Rik protein
	TK280802_E16_cyto_2D_step15.2133.2133.2	1.0106	0.1346	2761.25	23	1040.0%	1	R.SDGSLLLGVSSLSGRCWVGSLWFFK.D
*	TK280802_E16_cyto_2D_step01.4727.4727.1	0.9724	0.0308	1097.32	6	3750.0%	1	R.CCVSPGTWK.G
	TK280802_E16_cyto_2D_step10.2167.2167.2	1.0066	0.1281	1535.25	3	2860.0%	3	R.AHAGQVTCVAASPHK.D
	TK280802_E16_cyto_2D_step11.3731.3731.2	1.5563	0.2406	3158.1	1	1960.0%	2	K.YEHDDIVSTVTVLSSGTQAVSGSKDCCIK.I
UQ9R0U558.3%225.9%306341046.9(Q9R0U5) Matrin3
	TK280802_E16_cyto_2D_step14.1612.1612.1	0.5739	0.0062	855.3	7	2140.0%	1	R.GPGPLQER.S
	TK280802_E16_cyto_2D_step05.2559.2559.2	1.6816	0.4147	1093.25	1	6670.0%	1	R.GPLPLSSQHR.G
UQ9CQU058.2%1122.9%170190495.3(Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene)
*	TK280802_E16_cyto_2D_step07.4191.4191.3	2.4959	0.404	4503.6	1	1580.0%	1	K.FAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPR.I
UMKK2_MOUSE58.2%4610.9%385439528.7(P49138) MAP kinase-activated protein kinase 2 (EC 2.7.1.-) (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAPK-2) (Fragment)
	TK280802_E16_cyto_2D_step07.2356.2356.2	1.263	0.2787	1137.14	1	6110.0%	1	K.VPQTPLHTSR.V
	TK280802_E16_cyto_2D_step04.2611.2611.3	0.9988	0.13	1715.2	1	1960.0%	1	R.GDQAFTEREASEIMK.S
	TK280802_E16_cyto_2D_step12.3547.3547.2	1.4021	0.0417	1925.19	1	3750.0%	2	K.SIGEAIQYLHSINIAHR.D
UTRFL_MOUSE58.0%354.2%707778668.6(P08071) Lactotransferrin precursor (Lactoferrin)
*	TK280802_E16_cyto_2D_step04.1878.1878.1	1.1721	0.1742	887.81	5	5000.0%	2	R.SCHTGIGR.S
*	TK280802_E16_cyto_2D_step05.4169.4169.3	1.7747	0.1266	2415.53	24	2140.0%	1	R.KPVTEAKNCHLAIAPNHAVVSR.T
UQ9JHK457.9%226.7%567649905.8(Q9JHK4) RAB geranylgeranyl transferase alpha subunit (Rab geranylgeranyl transferase, a subunit)
	TK280802_E16_cyto_2D_step13.1954.1954.1	1.3898	0.2449	817.88	1	5830.0%	1	R.VLHLAHK.D
*	TK280802_E16_cyto_2D_step08.3995.3995.3	1.3543	0.121	3612.09	103	1170.0%	1	R.TPDGRNRPSHVWLCDLPAASLNDHLPQHTFR.V
UQ8VHQ057.8%162562.9%385437876.4(Q8VHQ0) SPI3L2
*	TK280802_E16_cyto_2D_step14.4537.4537.2	1.6415	0.0925	1259.22	5	5000.0%	16	K.QGLFLSNVIHK.S
U143T_MOUSE57.5%51118.0%245277784.8(P35216) 14-3-3 protein tau (14-3-3 protein theta)
	TK280802_E16_cyto_2D_step01.0111.0111.1	1.3619	0.2927	1320.79	1	5450.0%	1	K.YLIANATNPESK.V
	TK280802_E16_cyto_2D_step04.4256.4256.2	1.3015	0.0055	2974.05	1	2400.0%	1	R.LGLALNFSVFYYEILNNPELACTLAK.T
	TK280802_E16_cyto_2D_step06.2882.2882.1	1.4614	0.0373	742.99	2	7000.0%	3	K.KLQLIK.D
USPCB_MOUSE57.3%554.8%21282452485.3(P15508) Spectrin beta chain, erythrocyte (Beta-I spectrin)
*	TK280802_E16_cyto_2D_step03.3363.3363.3	1.1857	0.159	2056.19	1	2660.0%	1	R.YFYTGTEILGLIDEKHR.E
*	TK280802_E16_cyto_2D_step06.5095.5095.3	1.5183	0.0976	3403.31	1	1850.0%	1	K.EFLEELEESRGVMEHLEHQAQGFPEEFR.D
*	TK280802_E16_cyto_2D_step06.3862.3862.3	1.0296	0.1024	3079.5	78	1400.0%	1	K.LFQDMLHSIDWMDEIKAHILSAEFGK.H
	TK280802_E16_cyto_2D_step01.3970.3970.1	1.7362	0.0896	1498.96	1	5910.0%	1	K.HRPDLIDFDKLK.D
*	TK280802_E16_cyto_2D_step09.5124.5124.2	0.9188	0.1505	2460.51	3	2110.0%	1	R.MWESRGNTLTQCLGFQEFQK.D
UQ6087357.3%3310.7%504576666.0(Q60873) P58
	TK280802_E16_cyto_2D_step01.0795.0795.1	1.4504	0.1769	993.86	3	5000.0%	1	R.GHLLLKQGK.L
	TK280802_E16_cyto_2D_step01.3386.3386.2	1.2048	0.0202	2574.73	36	1740.0%	1	K.KFDDGEDPLDAESQQGGGGNPFHR.S
	TK280802_E16_cyto_2D_step14.1368.1368.3	0.7243	0.1506	2233.3	167	880.0%	1	R.SQALDAFDGADYTAAITFLDK.I
UQ8WWL557.2%6269.9%445522179.0(Q8WWL5) TPIP alpha lipid phosphatase
	TK280802_E16_cyto_2D_step05.4606.4606.2	1.3092	0.1996	1701.95	1	4230.0%	1	R.FIIYSIRGDVCDLK.V
*	TK280802_E16_cyto_2D_step02.3935.3935.3	2.4678	0.4221	3832.73	1	1900.0%	5	K.VQFFSSNLPKYYDNCPFFFWFNTSFIQNNR.L
UQ9CXI257.2%6369.7%1761915211.2(Q9CXI2) 3300001A09Rik protein
*	TK280802_E16_cyto_2D_step08.5240.5240.2	1.7133	0.2918	1915.13	1	3750.0%	6	R.ALGCRLSLVLRPSGQQR.A
UKRAC_MOUSE57.1%355.0%480556225.8(P31750) RAC-alpha serine/threonine kinase (EC 2.7.1.-) (RAC-PK-alpha) (AKT1 kinase) (Protein kinase B) (PKB) (C-AKT) (Thymoma viral proto-oncogene)
	TK280802_E16_cyto_2D_step12.2379.2379.2	1.7571	0.2773	1932.94	1	5000.0%	1	K.KLSPPFKPQVTSETDTR.Y
	TK280802_E16_cyto_2D_step09.0900.0900.1	0.7792	0.0384	715.48	1	3330.0%	2	R.TLGPEAK.S
UQ8VEE457.0%226.3%623690377.9(Q8VEE4) Similar to replication protein A1 (70 kDa)
*	TK280802_E16_cyto_2D_step12.3089.3089.3	0.9911	0.107	3892.23	6	920.0%	1	K.AYGASKPFGKPAGTGLLQPSGGTQSKVVPIASLTPYQSK.W
*	TK280802_E16_cyto_2D_step13.2505.2505.2	2.0139	0.258	2506.07	1	3000.0%	1	K.AYGASKPFGKPAGTGLLQPSGGTQSK.V
UQ9NZ4556.9%3354.6%108121999.1(Q9NZ45) Uncharacterized hematopoietic stem/progenitor cells protein MDS029
*	TK280802_E16_cyto_2D_step02.3300.3300.2	1.3576	0.0325	2410.9	1	3180.0%	1	R.VEWIAAVTIAAGTAAIGYLAYKR.F
*	TK280802_E16_cyto_2D_step12.2355.2355.3	1.4635	0.0767	2796.21	121	1150.0%	1	K.FPFCDGAHTKHNEETGDNVGPLIIK.K
*	TK280802_E16_cyto_2D_step01.2704.2704.1	1.4647	0.1703	1313.2	3	4000.0%	1	R.NKAMINLHIQK.D
UQ9JKY056.9%227.0%299336018.0(Q9JKY0) FL10 (2610007F23RIK protein)
	TK280802_E16_cyto_2D_step15.1539.1539.1	0.9095	0.0612	1292.93	206	2220.0%	1	R.CYLRLSDNPR.A
	TK280802_E16_cyto_2D_step01.3859.3859.1	1.4557	0.166	1255.99	1	4500.0%	1	K.NLQEGQVTDPR.G
UQ8TEC456.8%4108.9%235265776.6(Q8TEC4) Hypothetical protein FLJ23656
*	TK280802_E16_cyto_2D_step08.3333.3333.2	0.8954	0.0837	1483.98	126	2920.0%	1	R.SSNEDSHIVKIEK.L
*	TK280802_E16_cyto_2D_step05.3006.3006.1	1.3484	0.105	898.93	48	3570.0%	3	R.KDDGVAHR.D
URL35_HUMAN56.7%247.4%1221442011.0(P42766) 60S ribosomal protein L35
*	TK280802_E16_cyto_2D_step09.2922.2922.2	1.6719	0.3569	1130.61	2	5620.0%	2	K.YKPLDLRPK.K
UQ8VE7156.7%240.8%662729468.5(Q8VE71) Hypothetical 72.9 kDa protein (Fragment)
	TK280802_E16_cyto_2D_step07.2601.2601.1	1.5167	0.1484	623.51	2	7500.0%	2	K.QLSFK.C
UQ91VS856.7%91110.0%10651212978.4(Q91VS8) Similar to KIAA0793 gene product
	TK280802_E16_cyto_2D_step07.2601.2601.1	1.5167	0.1484	623.51	2	7500.0%	2	R.KLSFK.R
	TK280802_E16_cyto_2D_step03.3186.3186.1	0.5183	3.0E-4	1010.99	79	2140.0%	1	R.KLEMYGIR.F
	TK280802_E16_cyto_2D_step01.1971.1971.1	0.8002	0.023	1339.03	22	3500.0%	1	K.EILATERTYLK.D
*	TK280802_E16_cyto_2D_step11.3590.3590.3	1.168	0.0265	2904.63	49	1610.0%	1	R.TSASLSSANVSFYPPPSSSLSPPGLPNLK.D
*	TK280802_E16_cyto_2D_step10.0286.0286.1	0.6891	0.0195	1487.22	8	2500.0%	1	K.YTFERWMDVIK.R
*	TK280802_E16_cyto_2D_step11.2735.2735.2	1.2213	0.1011	1221.52	6	4440.0%	1	R.TQKQLVDYVK.D
*	TK280802_E16_cyto_2D_step08.4117.4117.3	1.2548	0.0086	2736.63	28	1790.0%	1	K.EFELQKVCYLPLNTFLLKPVQR.L
	TK280802_E16_cyto_2D_step01.1984.1984.1	0.6849	0.0272	1262.34	1	2500.0%	1	K.AVFFSRGSSFR.Y
UQ91ZU856.6%775.3%26113016916.5(Q91ZU8) Bullous pemphigoid antigen 1-e
*	TK280802_E16_cyto_2D_step09.2049.2049.3	0.9614	0.0037	2180.48	120	970.0%	1	K.SLEDDLAQSQNLVSEFKQK.C
*	TK280802_E16_cyto_2D_step04.2902.2902.2	0.7842	0.1018	1551.64	1	2920.0%	1	R.ELKYELSAVQLEK.A
*	TK280802_E16_cyto_2D_step01.3140.3140.1	1.6229	0.111	1416.07	3	5000.0%	1	K.QQVDELTLANRK.A
	TK280802_E16_cyto_2D_step01.3122.3122.1	0.854	0.0162	1544.9	1	2920.0%	1	R.YTALVTLMTQYIK.F
	TK280802_E16_cyto_2D_step14.4839.4839.3	1.5699	0.2829	4584.7	2	1190.0%	1	K.CEEFFSQAADSPSVPALRSELSVVIQSLSQIYSMSSTYIEK.L
	TK280802_E16_cyto_2D_step05.3698.3698.3	1.2658	0.0275	2747.17	11	1850.0%	1	R.LEDFLEDSQESQIFSGSDISQLEK.E
	TK280802_E16_cyto_2D_step09.4977.4977.2	0.8873	0.0715	1940.81	150	1880.0%	1	K.ISEIQMTAPLKLSYTDK.L
UQ1517056.1%83028.0%1571830711.2(Q15170) Transcription factor S-II-related protein (PP21)
*	TK280802_E16_cyto_2D_step01.3351.3351.1	1.4545	0.1039	1255.2	1	5500.0%	5	R.WSTLPKSSPPR.S
*	TK280802_E16_cyto_2D_step07.2365.2365.1	0.9955	0.0394	943.96	78	3120.0%	1	R.RTPSAGLSR.K
	TK280802_E16_cyto_2D_step06.5179.5179.3	1.4439	0.1184	2732.01	13	2070.0%	2	R.GDIHGRNLSNEEMIQAADELEEMK.R
UQ9QXT055.6%246.0%182207675.1(Q9QXT0) Putative secreted protein ZSIG9 (5330432A10RIK protein) (Transmembrane protein 4)
*	TK280802_E16_cyto_2D_step11.0392.0392.2	1.9149	0.2591	1396.27	2	5000.0%	2	K.RTDLCDHALHR.S
UTLR7_HUMAN55.5%6262.5%10491209228.2(Q9NYK1) Toll-like receptor 7 precursor
*	TK280802_E16_cyto_2D_step06.2415.2415.1	1.3197	0.0011	756.58	1	8000.0%	5	R.LQIKPR.S
*	TK280802_E16_cyto_2D_step12.4687.4687.2	1.1644	0.1602	2254.82	16	2370.0%	1	K.DPAVTEWVLAELVAKLEDPR.E
UIF4H_MOUSE55.5%5252.4%248273417.2(Q9WUK2) Eukaryotic translation initiation factor 4H (eIF-4H) (Williams-Beuren syndrome chromosome region 1 protein homolog)
	TK280802_E16_cyto_2D_step06.2415.2415.1	1.3197	0.0011	756.58	1	8000.0%	5	R.LQLKPR.T
UQ9NZS255.0%41012.1%231265638.6(Q9NZS2) Lectin-like receptor F1 (Activating coreceptor NKp80)
	TK280802_E16_cyto_2D_step01.0822.0822.1	1.2423	0.144	1237.79	5	3500.0%	3	K.ENSCAAIKESK.I
	TK280802_E16_cyto_2D_step15.4015.4015.2	1.1774	0.0621	2035.43	22	2500.0%	1	K.SHLLIIHDQLEMAFIQK.N
UIRA2_HUMAN54.7%468.3%590652716.0(O43187) Interleukin-1 receptor-associated kinase-2 (EC 2.7.1.-) (IRAK-2)
*	TK280802_E16_cyto_2D_step06.3294.3294.3	1.869	0.0341	2764.12	17	1980.0%	2	K.RVDIFSCGIVLAEVLTGIPAMDNNR.S
*	TK280802_E16_cyto_2D_step07.4314.4314.1	1.5237	0.13	1212.37	1	5620.0%	1	K.EICQKYLEK.G
*	TK280802_E16_cyto_2D_step10.2485.2485.2	1.0483	0.2797	1636.96	13	2860.0%	1	R.LQGQGGSDPLPWPQR.V
UO3524354.6%445.1%15671648994.6(O35243) Antigen containing epitope to monoclonal antibody MMS-85/12 (Fragment)
*	TK280802_E16_cyto_2D_step09.3206.3206.2	0.9506	0.0678	2187.77	18	1580.0%	1	R.KNEECDGLMASTAGCDVSNK.D
*	TK280802_E16_cyto_2D_step13.1793.1793.3	1.0158	0.0549	2585.05	15	1190.0%	1	K.DEESDEEEEEEEEEEPLGATTR.S
*	TK280802_E16_cyto_2D_step01.2431.2431.1	1.4698	0.1489	1569.71	1	3460.0%	1	K.ETEGTVTCTETKGR.N
*	TK280802_E16_cyto_2D_step12.3525.3525.2	1.5349	0.1698	2613.46	3	2390.0%	1	R.HEENQQATHNPEGNGGHLATKQSK.C
UQ9CRM054.4%117.5%255278319.1(Q9CRM0) 4921528N06Rik protein (Fragment)
*	TK280802_E16_cyto_2D_step12.3273.3273.2	1.8121	0.2662	1962.16	1	3610.0%	1	R.CYGNTAAPAMSLQPAPASR.V
UNU4M_MOUSE54.1%113.9%459518829.4(P03911) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3)
*	TK280802_E16_cyto_2D_step12.4039.4039.2	1.6373	0.3716	1988.51	1	3530.0%	1	K.LGSYGMIRISIILDPLTK.Y
UQ9Y4D454.1%333.6%851947928.5(Q9Y4D4) Hypothetical protein KIAA0648 (Fragment)
*	TK280802_E16_cyto_2D_step01.2824.2824.1	1.6947	0.0909	1165.98	1	6110.0%	1	K.FNQVLGDDEK.L
*	TK280802_E16_cyto_2D_step02.3144.3144.1	0.9058	0.1137	870.6	2	4170.0%	1	R.ELLDLHK.Q
*	TK280802_E16_cyto_2D_step08.3559.3559.2	1.2915	0.2433	1490.08	43	3080.0%	1	K.RTVTAAGAENIQQK.T
UMDHM_MOUSE54.1%2210.9%338355968.6(P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37)
*	TK280802_E16_cyto_2D_step01.2972.2972.1	1.0821	0.0236	1557.87	24	3210.0%	1	-.MLSALARPAGAALRR.S
*	TK280802_E16_cyto_2D_step01.3587.3587.2	1.6715	0.3132	2396.6	1	3100.0%	1	R.LTLYDIAHTPGVAADLSHIETR.A
UQ9NQ1054.0%243.1%487557964.3(Q9NQ10) DJ412I7.1 (Similar to radial spokehead protein) (Fragment)
*	TK280802_E16_cyto_2D_step11.3379.3379.2	1.7134	0.0312	1917.44	2	3930.0%	2	K.YVYFVCNEPGRPWVK.L
UNER3_HUMAN53.9%1212210.7%428482527.2(Q9UQ49) Sialidase 3 (EC 3.2.1.18) (Membrane sialidase) (Ganglioside sialidase) (N-acetyl-alpha-neuraminidase 3)
*	TK280802_E16_cyto_2D_step06.3807.3807.2	0.7973	0.0315	2800.82	4	1960.0%	1	R.QLCEPPHGCQGSVVSFRPLEIPHR.C
*	TK280802_E16_cyto_2D_step05.4638.4638.2	1.7309	0.1243	2520.36	6	2380.0%	11	R.LEEEAGTPSESWLLYSHPTSRK.Q
UUBC7_HUMAN53.8%1114.3%154178628.5(P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC)
	TK280802_E16_cyto_2D_step01.4089.4089.2	2.0107	0.2497	2485.44	1	3570.0%	1	K.TDQVIQSLIALVNDPQPEHPLR.A
UMIF_MOUSE53.8%61814.0%114123737.3(P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor)
*	TK280802_E16_cyto_2D_step01.3043.3043.1	1.3277	0.1842	1048.06	2	5000.0%	1	K.LLCGLLSDR.L
*	TK280802_E16_cyto_2D_step04.2246.2246.1	1.4227	0.1837	839.91	2	5830.0%	4	R.LHISPDR.V
UO5497253.7%354.4%620680867.5(O54972) ETO/MTG8-related protein ETO-2
*	TK280802_E16_cyto_2D_step06.2958.2958.1	1.7882	5.0E-4	745.24	3	6000.0%	2	R.QLNKLK.R
*	TK280802_E16_cyto_2D_step07.4230.4230.3	1.7466	0.2035	2450.86	10	2120.0%	1	K.ASETCSGCNAARYCGSFCQHK.D
URL11_MOUSE53.5%4612.4%177201529.6(Q9CXW4) 60S ribosomal protein L11
	TK280802_E16_cyto_2D_step06.2263.2263.1	1.7809	0.0419	955.85	5	5710.0%	2	K.IAVHCTVR.G
*	TK280802_E16_cyto_2D_step11.0031.0031.1	0.9155	0.1721	1580.81	4	2310.0%	1	K.VLEQLTGQTQVFSK.A
UU520_HUMAN53.5%776.2%17011944786.7(O75643) U5 small nuclear ribonucleoprotein 200 kDa helicase (U5 snRNP-specific 200 kDa protein) (U5-200KD) (Fragment)
	TK280802_E16_cyto_2D_step07.2716.2716.2	0.899	0.0789	1645.93	20	2500.0%	1	K.FSVDVKEAETDSDSD.-
	TK280802_E16_cyto_2D_step08.3597.3597.1	0.842	0.1733	1367.86	25	2080.0%	1	R.GPVLEALVARAIR.N
	TK280802_E16_cyto_2D_step15.4714.4714.2	0.628	0.0965	2046.49	78	1180.0%	1	R.EIGKHINMDGTINVDDFK.I
	TK280802_E16_cyto_2D_step10.3095.3095.2	1.64	0.337	1142.87	1	6670.0%	1	K.KPVIVFVPSR.K
	TK280802_E16_cyto_2D_step09.3922.3922.3	1.3852	0.0983	2923.19	1	2100.0%	1	K.GYEEVHVPALKPKPFGSEEQLLPVEK.L
	TK280802_E16_cyto_2D_step04.4190.4190.2	1.622	0.1101	2294.69	2	2780.0%	1	K.YVHLFPKLELSVHLQPITR.S
	TK280802_E16_cyto_2D_step05.1996.1996.1	0.9162	0.023	587.03	7	6250.0%	1	K.LNNPK.F
URXRG_MOUSE53.4%226.5%463508937.6(P28705) Retinoic acid receptor RXR-gamma
	TK280802_E16_cyto_2D_step11.3219.3219.3	2.6206	0.2395	2165.21	1	3240.0%	1	K.RIPHFSDLTLEDQVILLR.A
	TK280802_E16_cyto_2D_step04.3405.3405.2	0.9342	0.1479	1413.74	21	2730.0%	1	R.EKVYATLEAYTK.Q
UQ9CXS453.3%393.2%252274829.7(Q9CXS4) 3110013H01Rik protein
*	TK280802_E16_cyto_2D_step13.1509.1509.1	1.0428	0.0275	1126.09	26	4290.0%	3	R.ERWETFQK.R
UQ9CR1653.3%468.4%370407437.4(Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D)
*	TK280802_E16_cyto_2D_step10.2573.2573.2	1.3747	0.2271	1332.05	2	4170.0%	2	K.GTGSTTGKPLHFK.G
	TK280802_E16_cyto_2D_step06.5131.5131.2	1.0487	0.0436	2036.03	10	2650.0%	1	K.AQGWQGLKEYDQALADLK.K
UO4330453.3%6263.4%756853036.8(O43304) Hypothetical protein KIAA0420 (Fragment)
*	TK280802_E16_cyto_2D_step04.3290.3290.2	0.814	0.093	1854.38	4	2500.0%	1	R.VYKYPFELVMAAYEK.R
*	TK280802_E16_cyto_2D_step06.3524.3524.2	2.1389	0.0516	1402.12	2	5500.0%	5	R.FLRAHDFHLDK.A
USMD3_HUMAN53.0%117.1%1261391610.3(P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3)
	TK280802_E16_cyto_2D_step01.3826.3826.1	1.5424	0.1109	1091.05	2	5000.0%	1	R.FLILPDMLK.N
UQ9BV0253.0%229.7%185212668.7(Q9BV02) Hypothetical protein (Fragment)
*	TK280802_E16_cyto_2D_step12.2331.2331.1	1.4105	0.204	1232.63	1	4000.0%	1	K.EHVGTDQFGNK.Y
*	TK280802_E16_cyto_2D_step15.1209.1209.1	0.5599	0.0185	747.39	18	3330.0%	1	R.IVEAANK.K
UDD15_MOUSE52.8%469.0%758866117.2(O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15)
	TK280802_E16_cyto_2D_step04.3770.3770.2	1.5996	0.4138	1736.15	1	3930.0%	1	K.ALVTGYFMQVAHLER.T
	TK280802_E16_cyto_2D_step03.3320.3320.2	0.7764	0.0286	2269.31	64	1110.0%	1	K.YMTDGMLLREAMNDPLLER.Y
	TK280802_E16_cyto_2D_step06.5193.5193.3	1.3701	0.0877	3894.95	6	1290.0%	2	K.MVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAK.K
UQ96QC252.8%8107.2%20902267305.5(Q96QC2) Hypothetical protein KIAA0170
	TK280802_E16_cyto_2D_step05.5143.5143.2	0.9495	0.0386	1802.98	49	2500.0%	1	R.DAEEDMPQRVVLLQR.S
	TK280802_E16_cyto_2D_step11.3598.3598.3	1.7818	0.2768	3380.81	4	1610.0%	1	K.TPETLVPTAPKLEPSTSTDQPVTPEPTSQATR.G
	TK280802_E16_cyto_2D_step12.3711.3711.2	1.6012	0.4176	2276.33	1	3750.0%	1	K.HLAPPPLLSPLLPSIKPTVRK.T
	TK280802_E16_cyto_2D_step12.2931.2931.2	1.1076	0.0186	1957.89	21	2500.0%	1	K.LLPERQTDVTGEEELTK.G
*	TK280802_E16_cyto_2D_step14.4047.4047.2	0.845	0.0323	2863.63	29	1350.0%	1	R.SQASTTVDINTQVEKEVPPGSAIIHIK.K
	TK280802_E16_cyto_2D_step13.3684.3684.2	1.1557	0.0238	2928.52	16	1790.0%	2	R.AAGNPGSLAAPIDHKPCSAPLEPKSQASR.N
	TK280802_E16_cyto_2D_step02.4810.4810.2	0.7729	0.0408	2601.27	121	1090.0%	1	K.SSPGIHLERSQASTTVDINTQVEK.E
UQ9CQC152.8%333.6%690834166.9(Q9CQC1) 1200013P10Rik protein (Crooked neck protein)
*	TK280802_E16_cyto_2D_step09.2126.2126.1	0.5954	0.0185	805.47	1	2500.0%	1	-.MAASTAAGK.Q
	TK280802_E16_cyto_2D_step11.2156.2156.1	0.7559	0.0467	642.4	4	3750.0%	1	K.QRIPK.V
*	TK280802_E16_cyto_2D_step01.3159.3159.1	1.5336	0.1096	1323.0	1	5000.0%	1	R.ISKQEAQELFK.N
URET3_MOUSE52.7%4626.5%136154605.4(P02695) Retinoic acid-binding protein I, cellular (CRABP-I)
	TK280802_E16_cyto_2D_step06.3132.3132.2	1.3599	0.0716	1074.71	34	4440.0%	1	K.ALGVNAMLRK.V
	TK280802_E16_cyto_2D_step09.2642.2642.2	1.4384	0.226	1450.97	4	4230.0%	2	K.VAVAAASKPHVEIR.Q
	TK280802_E16_cyto_2D_step14.4400.4400.1	0.8168	0.0489	1470.92	16	2270.0%	1	K.MRSSENFDELLK.A
UQ9P2F652.5%336.4%11941330158.0(Q9P2F6) Hypothetical protein KIAA1391 (Fragment)
*	TK280802_E16_cyto_2D_step01.1248.1248.1	1.1322	0.0828	802.85	29	6000.0%	1	K.YNNNFK.I
*	TK280802_E16_cyto_2D_step08.2548.2548.3	1.5415	0.1317	3008.81	7	1760.0%	1	K.GPLEPPPHASGVPEANSLQEEQKDLPLR.A
*	TK280802_E16_cyto_2D_step14.4221.4221.3	2.3145	0.4898	4753.6	1	1490.0%	1	K.LTDMWTASCVDEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQK.D
UQ9JLT452.4%240.9%528570598.5(Q9JLT4) Thioredoxin reductase 2, mitochondrial precursor (EC 1.6.4.5)
*	TK280802_E16_cyto_2D_step07.2199.2199.1	1.3255	0.0575	598.7	4	7500.0%	2	K.LHISK.R
UQ9CXP552.4%242.6%189206269.8(Q9CXP5) 3110043A19Rik protein
	TK280802_E16_cyto_2D_step07.2199.2199.1	1.3255	0.0575	598.7	4	7500.0%	2	R.LHLSK.S
UCYA8_MOUSE52.4%464.1%12491401556.9(P97490) Adenylate cyclase, type VIII (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Ca(2+)/calmodulin activated adenylyl cyclase)
	TK280802_E16_cyto_2D_step02.3975.3975.2	0.9182	0.0134	2611.0	2	2170.0%	1	R.RNSGATFTEGSWSPELPFDNIVGK.Q
	TK280802_E16_cyto_2D_step14.3149.3149.2	0.9759	0.1763	2431.49	1	1430.0%	1	K.TIGSTYMAVSGLSPEKQQCEDK.W
	TK280802_E16_cyto_2D_step07.2199.2199.1	1.3255	0.0575	598.7	4	7500.0%	2	R.IHISK.A
UO0031252.3%6361.4%424474026.8(O00312) MNK1
	TK280802_E16_cyto_2D_step07.3155.3155.1	1.3367	0.0478	834.79	2	7000.0%	6	K.FEDMYK.L
UMYHB_MOUSE52.3%552.9%19722270265.5(O08638) Myosin heavy chain, smooth muscle isoform (SMMHC)
	TK280802_E16_cyto_2D_step08.3775.3775.2	0.7985	0.0208	2093.47	19	2060.0%	1	K.EMEGLSQQYEEKAAAYDK.L
	TK280802_E16_cyto_2D_step05.1786.1786.1	0.8068	0.0082	619.2	19	3750.0%	1	K.QTLEK.E
	TK280802_E16_cyto_2D_step07.3995.3995.2	1.5349	0.0984	1861.37	1	3120.0%	1	K.LEGDLKDLELQADSAIK.G
	TK280802_E16_cyto_2D_step09.3284.3284.2	1.9248	0.2426	1545.99	1	5830.0%	1	K.SKHESMISELEVR.L
	TK280802_E16_cyto_2D_step06.0596.0596.1	0.7517	0.0	646.65	3	3750.0%	1	K.ELEQK.H
URBL2_HUMAN52.2%242.3%11391283577.4(Q08999) Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (PRB2) (P130) (RBR-2)
*	TK280802_E16_cyto_2D_step12.4009.4009.2	1.305	0.0204	3067.29	5	1600.0%	2	R.LTGANSDMEEEERGDLIQFYNNIYIK.Q
UQ9CYD652.1%72720.8%403445805.1(Q9CYD6) 5730525G14Rik protein
*	TK280802_E16_cyto_2D_step09.0014.0014.2	1.1208	0.0030	2404.81	15	1670.0%	1	K.GGLEEGQPVDLVLSCVDNFEAR.M
	TK280802_E16_cyto_2D_step11.3180.3180.3	1.0377	0.0038	2598.14	1	2070.0%	1	K.KTEDSASEVTVEDSGESLEDLMAR.M
	TK280802_E16_cyto_2D_step04.4077.4077.3	2.0622	0.085	4238.12	1	1550.0%	5	R.AAALPTQEAEPQEEAEVVHEDNEWGIELVSEVSEEELK.N
UQ9CQT651.7%62620.3%237267038.3(Q9CQT6) 1700019N19Rik protein
*	TK280802_E16_cyto_2D_step12.2523.2523.2	1.6487	0.2826	1478.7	2	5000.0%	5	-.MLKPAESKMESPK.T
*	TK280802_E16_cyto_2D_step02.3652.3652.3	1.164	0.1238	4043.99	55	1100.0%	1	K.EDQQGLNCSVANTPPLKPICSEDTVLWVLHEYAKK.Y
UXPB_HUMAN51.6%113.5%782892787.2(P19447) TFIIH basal transcription factor complex helicase XPB subunit (EC 3.6.1.-) (Basic transcription factor 2 89 kDa subunit) (BTF2-p89) (TFIIH 89 kDa subunit) (DNA-repair protein complementing XP-B cells) (Xeroderma pigmentosum group B complementing protein) (DNA excision repair protein ERCC-3)
*	TK280802_E16_cyto_2D_step02.4494.4494.2	1.565	0.4878	2795.08	1	2310.0%	1	K.VLAATDLDAEEEVVAGEFGSRSSQASR.R
UNUEM_HUMAN51.6%4422.5%377425109.8(Q16795) NADH-ubiquinone oxidoreductase 39 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-39KD) (CI-39KD)
*	TK280802_E16_cyto_2D_step07.0011.0011.3	1.6118	0.0411	2764.45	34	1730.0%	1	R.SSVSGIVATVFGATGFLGRYVVNHLGR.M
*	TK280802_E16_cyto_2D_step14.2563.2563.3	1.0573	0.066	3195.11	1	1400.0%	1	R.CDKYDIMHLRPMGDLGQLLFLEWDAR.D
*	TK280802_E16_cyto_2D_step13.2889.2889.2	0.929	0.1291	2229.8	4	2110.0%	1	K.VVRDAFPEAIIVKPSDIFGR.E
*	TK280802_E16_cyto_2D_step13.3022.3022.1	1.3417	0.2446	1393.67	1	4550.0%	1	K.FIHVSHLNANIK.S
UO3592951.3%114.0%297329099.1(O35929) Ras-like GTP-binding protein Rem
*	TK280802_E16_cyto_2D_step01.2896.2896.1	1.3345	0.3464	1284.44	1	4090.0%	1	R.QDNAAPETPSPR.R
ULSM5_HUMAN51.1%4166.7%9098064.5(Q9Y4Y9) U6 snRNA-associated Sm-like protein LSm5
*	TK280802_E16_cyto_2D_step05.2774.2774.1	1.771	0.0113	742.29	6	8000.0%	4	R.IHIVMK.S
UTIE2_HUMAN51.0%287304.2%11241258116.9(Q02763) Angiopoietin 1 receptor precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor TIE-2) (Tyrosine-protein kinase receptor TEK) (P140 TEK) (Tunica interna endothelial cell kinase) (CD202b antigen)
*	TK280802_E16_cyto_2D_step10.4557.4557.3	1.7707	0.0042	3033.43	50	1480.0%	27	K.MLLIAILGSAGMTCLTVLLAFLIILQLK.R
*	TK280802_E16_cyto_2D_step12.3798.3798.2	1.0886	0.0818	2244.16	42	1940.0%	1	K.VKNNPDPTIYPVLDWNDIK.F
UQ9H0R551.0%354.6%563641275.6(Q9H0R5) Hypothetical protein
	TK280802_E16_cyto_2D_step13.4048.4048.3	2.7113	0.0517	2981.2	6	2100.0%	2	K.QNQEASSDRCSALLQVIFSPLEEEVK.A
UQ91VH650.8%2215.5%297336927.2(Q91VH6) CGI-27 protein (C21orf19-like protein)
	TK280802_E16_cyto_2D_step11.4156.4156.3	1.2111	0.109	2977.32	29	1670.0%	1	K.LFSKYLADPSNLFVVSSDFCHWGQR.F
	TK280802_E16_cyto_2D_step11.2908.2908.2	1.5836	0.33	2282.92	1	3250.0%	1	R.AIIAPHAGYTYCGSCAAHAYK.Q
URANG_MOUSE50.7%2210.8%203235825.2(P34022) Ran-specific GTPase-activating protein (Ran binding protein 1) (RANBP1)
	TK280802_E16_cyto_2D_step15.1634.1634.2	0.7435	0.0076	1308.15	19	3000.0%	1	R.FLNAENAQKFK.T
	TK280802_E16_cyto_2D_step01.2524.2524.1	1.4981	0.1136	1336.98	1	5000.0%	1	R.FASENDLPEWK.E
UY218_HUMAN50.7%71310.9%761850397.4(Q93075) Putative deoxyribonuclease KIAA0218 (EC 3.1.21.-)
*	TK280802_E16_cyto_2D_step09.2461.2461.2	0.6387	0.1203	864.9	5	4170.0%	1	K.FVPPDYK.I
*	TK280802_E16_cyto_2D_step09.0411.0411.3	1.3935	0.1346	2541.94	19	2000.0%	1	K.IYSSSFPKEFQGCISDFCDPR.T
*	TK280802_E16_cyto_2D_step03.4066.4066.3	1.2317	0.0839	3438.96	5	1170.0%	1	R.MSDYSPNSTGSVQNTSRDMEASEEGWSQNSR.S
*	TK280802_E16_cyto_2D_step09.2665.2665.2	1.1911	0.0404	1969.47	14	2650.0%	1	R.EPCDVAPSSRPAQRSASR.S
*	TK280802_E16_cyto_2D_step01.1399.1399.1	1.2786	0.0291	732.24	22	7000.0%	3	R.RTVIDK.C
URS26_HUMAN50.7%83018.3%1151301511.0(P02383) 40S ribosomal protein S26 (P02383) 40S ribosomal protein S26
	TK280802_E16_cyto_2D_step07.2260.2260.1	1.3459	0.0133	808.32	2	5830.0%	5	R.GHVQPIR.C
	TK280802_E16_cyto_2D_step08.2779.2779.1	1.1522	0.0746	663.93	6	7500.0%	2	K.KFVIR.N
	TK280802_E16_cyto_2D_step01.0096.0096.1	1.1252	0.157	943.02	97	3750.0%	1	R.NIVEAAAVR.D
UO3560050.7%553.9%23102602076.2(O35600) ATP-binding cassette transporter
	TK280802_E16_cyto_2D_step09.3525.3525.2	0.8289	0.1583	2019.6	160	2060.0%	1	K.GWHALVSFLNVAHNAILR.A
	TK280802_E16_cyto_2D_step04.2140.2140.1	1.1074	0.0827	880.14	23	5830.0%	1	R.YWDSGPR.A
*	TK280802_E16_cyto_2D_step12.3541.3541.2	0.848	0.0351	2905.0	47	1460.0%	1	R.HHSMLQFQVPSSSLARIFQLLISHK.D
*	TK280802_E16_cyto_2D_step15.3513.3513.2	1.5723	0.3225	1785.92	3	3670.0%	1	K.NLVKVFEPSGRPAVDR.L
*	TK280802_E16_cyto_2D_step11.3068.3068.2	0.7805	0.1216	2828.74	8	1090.0%	1	R.LYCSGTPLFLKNCFGTGFYLTLVR.K
UQ9EQ2050.4%111.9%535579168.1(Q9EQ20) Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27)
	TK280802_E16_cyto_2D_step03.3124.3124.1	1.3595	0.2319	1032.07	1	5560.0%	1	K.EGASILLDGR.R
UQ8VCN450.3%5116.6%716833675.4(Q8VCN4) Hypothetical 83.4 kDa protein
*	TK280802_E16_cyto_2D_step08.4031.4031.3	2.6887	0.143	2675.94	2	2500.0%	3	K.LLLLQSQLEQLQEENFRLESSR.E
	TK280802_E16_cyto_2D_step06.1942.1942.1	0.704	0.0523	755.76	45	3330.0%	1	R.NAGHAER.T
*	TK280802_E16_cyto_2D_step14.2532.2532.2	0.8444	0.0223	2155.3	52	1760.0%	1	R.LNQQQLSELRAQVEELQK.A
UUD11_MOUSE50.2%3310.1%535601248.6(Q63886) UDP-glucuronosyltransferase 1-1 precursor, microsomal (EC 2.4.1.17) (UDPGT) (UGT1*1) (UGT1-01) (UGT1.1) (UGT1A1) (UGTBR1)
	TK280802_E16_cyto_2D_step15.4767.4767.2	0.9526	0.0778	2597.3	24	1590.0%	1	K.ENVTATLVELGRTAFNQDSFLLR.V
	TK280802_E16_cyto_2D_step14.3421.3421.2	0.6616	0.0351	2691.07	24	830.0%	1	R.METRGAGVTLNVLEMTADDLENALK.T
	TK280802_E16_cyto_2D_step01.2850.2850.1	1.4679	0.1277	809.13	4	6000.0%	1	R.MNFLQR.V
USNX8_HUMAN50.2%357.7%465525697.4(Q9Y5X2) Sorting nexin 8
*	TK280802_E16_cyto_2D_step07.4294.4294.2	1.2307	0.1216	2960.72	5	1670.0%	2	R.EPESVEQLESRIVEQENAIQTMELR.N
*	TK280802_E16_cyto_2D_step12.2343.2343.1	0.884	0.0175	1294.55	37	3000.0%	1	K.RQMMSATAQNR.E
UACLY_MOUSE50.1%9296.7%10911197287.4(Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme)
	TK280802_E16_cyto_2D_step11.3788.3788.2	0.9104	0.0713	1796.98	8	3000.0%	1	R.GQELIYAGMPITEVFK.E
	TK280802_E16_cyto_2D_step01.3609.3609.1	0.6347	0.0727	1568.16	9	1790.0%	1	R.TIAIIAEGIPEALTR.K
	TK280802_E16_cyto_2D_step06.2878.2878.1	1.8345	0.019	788.12	12	7000.0%	1	K.SWLKPR.L
	TK280802_E16_cyto_2D_step05.3415.3415.2	1.4499	0.0431	1875.28	1	3330.0%	5	K.GVTIIGPATVGGIKPGCFK.I
	TK280802_E16_cyto_2D_step15.1582.1582.3	1.1043	0.1215	1971.6	229	1250.0%	1	K.QHFPATPLLDYALEVEK.I
UQ96JX950.1%2215.9%201228927.9(Q96JX9) Hypothetical protein FLJ14906
*	TK280802_E16_cyto_2D_step12.2658.2658.1	1.7455	0.1838	1105.01	8	5000.0%	1	K.VNLLLVDYR.G
*	TK280802_E16_cyto_2D_step11.2176.2176.3	1.0066	0.152	2453.71	202	1250.0%	1	K.IFLFGRSLGGAVAIHLASENSHR.I
UQ8QZU650.1%395.3%264291856.7(Q8QZU6) Similar to unknown (Protein for IMAGE:3534875) (Fragment)
*	TK280802_E16_cyto_2D_step01.1956.1956.1	1.7439	0.052	1588.87	10	3850.0%	3	R.VVAPHQLHSEANER.L
ProteinsPeptide IDsCopies
Unfiltered191174152142553
Filtered5816651107191