Secondary Evidence: Yamauchi Y, Wada K, Goshima F, Daikoku T, Ohtsuka K, Nishiyama Y. Herpes simplex virus type 2 UL14 gene product has heat shock protein (HSP)-like functions. J Cell Sci. 2002 Jun 15;115(Pt 12):2517-27. PMID: 12045222
Yamauchi Y, Wada K, Goshima F, Takakuwa H, Daikoku T, Yamada M, Nishiyama Y. The UL14 protein of herpes simplex virus type 2 translocates the minor capsid protein VP26 and the DNA cleavage and packaging UL33 protein into the nucleus of coexpressing cells. J Gen Virol. 2001 Feb;82(Pt 2):321-30. PMID: 11161269
Cunningham C, Davison AJ, MacLean AR, Taus NS, Baines JD. Herpes simplex virus type 1 gene UL14:phenotype of a null mutant and identification of the encoded protein. J Virol. 2000 Jan;74(1):33-41. PMID: 10590088
de Wind N, Domen J, Berns A. Herpesviruses encode an unusual protein-serine/threonine kinase which is nonessential for growth in cultured cells. J Virol. 1992 Sep;66(9):5200-9. PMID: 1323689
UL14:Expression pattern:UL14 is located in a gene cluster also containing genes UL13,UL12,and UL11 which share a common polyadenylation signal downstream of UL11.UL14 has been classified as a late gene;a 3.5kb transcript could be detected at 6 hours but not 2 hours post infection in the porcine kidney cell line SK6 after infection at high MOI (de Wind et.al.,1994).UL14 of HSV-1 is first detected 9 hours post infection,and is classified as a late protein due to the absence of UL14 protein with phosphonoacetic acid treatment (Cunningham et al.,2000).In HSV-1,UL14 is expressed as a leaky-late (g1) gene.
Description:Little is known about PRV UL14. HSV-1 UL14 is a minor component of the virion tegument,predominantly localized to the nucleus during infection, potentially phosphorylated,and is needed for optimal growth of the virus in culture (Cunningham et.al., 2000).A UL14 null mutant has delayed growth kinetics,lower viral yield,a cell-cell spread defect,and is attenuated for replication in the mouse brain after intracranial inoculation.Ultrastructural studies have indicated UL14 mutants are defective in egress from the infected cell because unenveloped capsids accumulate in the perinuclear region of the infected cell.In addition,the UL14 protein of HSV-2 has heat shock protein-like activities,and translocates VP26 (minor capsid protein) and UL33 (a cleavage and packaging protein) into the nucleus of coexpressing cells (Yamauchi et al.,2001,Yamauchi et al.,2002). UL14¹s precise role in egress and infection remains to be determined.UL14 homologs are found in the Alphaherpesvirinae.Positional homologs exist in Betaherpesvirinae and Gammaherpesvirinae,albeit they share little sequence conservation.NCBI: AAA47480.1
Blast Summary:PSI-Blast Search This gene shares similarity with several other genes from members of the alphaherpesvirus subfamily. The best match is between residues 3-156, of this gene, and residues 4-159 of Gene 48 from Equine herpesvirus 4 (9629775), which are 50% similar using gapped BLAST.No matches were found outside the alphaherpesvirus subfamily.
COGS Summary:COGS Search No hits to the COGs database.
Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 3-156 are 68% similar to a protein domain (PD008302 which is seen in UL14_PRVN3.
Paralogs:Local Blast Search PRV043 does not have significant similarity with any other gene in this genome.
Pfam Summary:Pfam Search No significant hits to the Pfam 7.3 database.
Top PDB Hits: No hits to the PDB database.
Gene Protein Sequence:
MLASDRRERRVRLEEAFQRESVFKARTVELLRGRADKKNPEFVRAFMAAK QARRDVERHLRLAARVESVEQKARALQARVEAQAAVRGVLDRHRRFTRAD FAEALDAAEDALAAGEDRLDDAAALDEDWAGGGAPDEDEGEEADEALLTQ WLLEEAEEA$