WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A10E04_CONSENSUS (387 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 15 Sequences : less than 15 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 3523 899 |=========================================================== 6310 2624 881 |========================================================== 3980 1743 377 |========================= 2510 1366 381 |========================= 1580 985 261 |================= 1000 724 188 |============ 631 536 122 |======== 398 414 113 |======= 251 301 53 |=== 158 248 40 |== 100 208 34 |== 63.1 174 31 |== 39.8 143 14 |: 25.1 129 9 |: 15.8 120 16 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 104 <<<<<<<<<<<<<<<<< 10.0 104 18 |= 6.31 86 15 |= 3.98 71 8 |: 2.51 63 7 |: 1.58 56 5 |: 1.00 51 4 |: 0.63 47 3 |: 0.40 44 0 | 0.25 44 4 |: 0.16 40 0 | 0.10 40 1 |: 0.063 39 1 |: 0.040 38 3 |: 0.025 35 0 | 0.016 35 5 |: 0.010 30 3 |: 0.0063 27 3 |: 0.0040 24 1 |: 0.0025 23 6 |: 0.0016 17 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|2467088|emb|CAA05084.1|(AJ001911) putative Ckc2 [A... +1 197 9.9e-15 1 gi|2281631|gb|AAC49769.1|(AF003096) AP2 domain contai... +1 193 2.6e-14 1 gi|7487565|pir||T00432hypothetical protein T30B22.18 ... +1 132 1.0e-12 2 gi|7489226|pir||T07784AP2 domain protein homolog - po... +1 167 3.2e-11 1 gi|10798644|emb|CAC12822.1|(AJ299252) AP2 domain-cont... +1 138 2.0e-08 1 gi|6176534|gb|AAF05606.1|AF190770_1(AF190770) EREBP-l... +1 102 2.0e-08 2 gi|1168862|sp|P42736|CDI3_ARATHCADMIUM-INDUCED PROTEI... +1 137 2.2e-08 1 gi|12325282|gb|AAG52589.1|AC016529_20(AC016529) putat... +1 140 2.3e-08 1 gi|6689918|gb|AAF23899.1|AF193803_1(AF193803) transcr... +1 101 5.8e-07 2 gi|2281649|gb|AAC49778.1|(AF003105) AP2 domain contai... +1 124 2.4e-06 1 gi|6056399|gb|AAF02863.1|AC009324_12(AC009324) AP2 do... +1 124 3.0e-06 1 gi|9279571|dbj|BAB01029.1|(AB022220) transcription fa... +1 118 1.5e-05 1 gi|3264767|gb|AAC24587.1|(AF071893) AP2 domain contai... +1 106 0.00018 1 gi|7485319|pir||T04787hypothetical protein F10M10.180... +1 103 0.00035 1 gi|1707016|gb|AAC69127.1|(U78721) putative AP2 domain... +1 101 0.00036 1 gi|2281637|gb|AAC49772.1|(AF003099) AP2 domain contai... +1 95 0.00067 1 gi|3617742|gb|AAC36019.1|(AC005687) RAP2.6 [Arabidops... +1 95 0.0012 1 gi|7489208|pir||T01986Tsi1 protein - common tobacco >... +1 96 0.0018 1 gi|10177219|dbj|BAB10294.1|(AB026650) contains simila... +1 94 0.0022 1 gi|7531181|sp|O04682|PTI6_LYCESPATHOGENESIS-RELATED G... +1 95 0.0023 1 gi|8980313|emb|CAB96899.1|(AJ251249) AP2-domain DNA-b... +1 93 0.0024 1 gi|7484952|pir||T00409ethylene-responsive transcripti... +1 94 0.0024 1 gi|3702318|gb|AAC62875.1|(AC005397) putative AP2 doma... +1 96 0.0024 1 gi|7486964|pir||T02896hypothetical protein T13J8.60 -... +1 95 0.0039 1 gi|11358680|pir||T49870probable transcription factor ... +1 93 0.0042 1 gi|9758388|dbj|BAB08875.1|(AB022212) AP2 domain trans... +1 92 0.0049 1 gi|6478845|dbj|BAA87068.1|(AB035270) ethylene-respons... +1 87 0.0053 1 gi|9665142|gb|AAF97326.1|AC023628_7(AC023628) Similar... +1 87 0.0092 1 gi|2062174|gb|AAB63648.1|(AC001645) transcription fac... +1 89 0.0094 1 gi|11358305|pir||T48580hypothetical protein T31B5.150... +1 88 0.0096 1 gi|9279711|dbj|BAB01268.1|(AB023046) transcription fa... +1 89 0.011 1 gi|9758474|dbj|BAB09003.1|(AB012239) transcription fa... +1 87 0.011 1 gi|9369375|gb|AAF87124.1|AC006434_20(AC006434) F10A5.... +1 87 0.012 1 gi|7488058|pir||T01919probable Ap2 domain protein - A... +1 89 0.014 1 gi|7486739|pir||T05607hypothetical protein F9D16.220 ... +1 90 0.014 1 gi|3282693|gb|AAC39489.1|(AF040959) AP2 domain family... +1 87 0.028 1 gi|8346773|emb|CAB93939.1|(AJ238739) AP2-domain DNA-b... +1 87 0.034 1 gi|10177206|dbj|BAB10308.1|(AB025637) contains simila... +1 87 0.036 1 gi|9758475|dbj|BAB09004.1|(AB012239) contains similar... +1 86 0.042 1 gi|5091503|dbj|BAA78738.1|(AB023482) EST AU055776(S20... +1 86 0.065 1 gi|4699791|pdb|2GCC| Solution Structure Of The Gcc-... +1 72 0.16 1 gi|4204307|gb|AAD10688.1|(AC003027) lcl|prt_seq No de... +1 84 0.17 1 gi|4699734|pdb|1GCC|AChain A, Solution Nmr Structure ... +1 71 0.20 1 gi|6552733|gb|AAF16532.1|AC013482_6(AC013482) T26F17.... +1 83 0.22 1 gi|11358884|pir||T51834transcription factor DREB2B, d... +1 83 0.37 1 gi|106688|pir||S24709Ig alpha chain - human >gi|28566... +2 67 0.44 1 gi|5281024|emb|CAB45963.1|(Z97343) EREBP-2 protein [A... +1 81 0.45 1 gi|11281604|pir||T47955hypothetical protein F15G16.20... +1 82 0.48 1 gi|7531108|sp|O80338|ERF2_ARATHETHYLENE RESPONSIVE EL... +1 81 0.50 1 gi|7531107|sp|O80337|ERFI_ARATHETHYLENE RESPONSIVE EL... +1 81 0.56 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 2 Hits gi|106688 | ______________ __________________________________________________ Query sequence: | | | | 129 0 50 100 Locus_ID Frame 1 Hits gi|2467088 | __________________________________________ gi|2281631 | __________________________________________ gi|7487565 | ______ _____________________ gi|7489226 | __________________________________________ gi|10798644 | _________________________________ gi|6176534 | ___________ _____________ gi|1168862 | ___________________________________ gi|12325282 | __________________________________________ gi|6689918 | ___________ _____________ gi|2281649 | _______________________________________ gi|6056399 | __________________________________________ gi|9279571 | _______________________________________ gi|3264767 | _____________ gi|7485319 | _______________________ gi|1707016 | _______________________ gi|2281637 | _____________ gi|3617742 | _____________ gi|7489208 | _______________________ gi|10177219 | _____________ gi|7531181 | _______________________ gi|8980313 | _________________________________ gi|7484952 | ___________________________________ gi|3702318 | ___________________ gi|7486964 | ___________________________ gi|11358680 | ______________ gi|9758388 | ______________ gi|6478845 | ___________________ gi|9665142 | _________________________ gi|2062174 | ___________________________ gi|11358305 | _____________ gi|9279711 | ___________________________ gi|9758474 | ________________________________ gi|9369375 | _______________________ gi|7488058 | ___________________ gi|7486739 | ______________________ gi|3282693 | ____________________________ gi|8346773 | _______________________ gi|10177206 | _________________ gi|9758475 | ________________________________________ gi|5091503 | ________________________________ gi|4699791 | _____________ gi|4204307 | ______________________ gi|4699734 | ___________ gi|6552733 | ___________________________ gi|11358884 | _______________________ gi|5281024 | _____________________ gi|11281604 | ___________________ gi|7531108 | _____________________ gi|7531107 | _____________________ __________________________________________________ Query sequence: | | | | 129 0 50 100
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 54 database sequences were not reported due to the limiting value of parameter V = 50. >gi|2467088|emb|CAA05084.1| (AJ001911) putative Ckc2 [Arabidopsis thaliana] Length = 246 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 246 0 50 100 150 200 Plus Strand HSPs: Score = 197 (69.3 bits), Expect = 9.9e-15, P = 9.9e-15 Identities = 50/107 (46%), Positives = 64/107 (59%), Frame = +1 Query: 67 MCGGAIISDF---IGVKRGRNLXAXELWSELDPFS--DLLGFDTTTTT--TNQPPLPDKK 225 MCGGAIISD+ + +GR L A ELWSELD + D GF +T+ TNQ + +++ Sbjct: 1 MCGGAIISDYAPLVTKAKGRKLTAEELWSELDASAADDFWGFYSTSKLHPTNQVNVKEEE 60 Query: 226 VVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 V KK+++ K R N Y GI PWG WA EI DP GVR+WL Sbjct: 61 AV-----KKEQATEPGKRR---KRKNVYRGIRKRPWGKWAAEIRDPRKGVRVWL 106 >gi|2281631|gb|AAC49769.1| (AF003096) AP2 domain containing protein RAP2.3 [Arabidopsis thaliana] >gi|11994632|dbj|BAB02769.1| (AB022217) AP2 domain transcription factor RAP2.3 [Arabidopsis thaliana] Length = 248 Frame 1 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | | 248 0 50 100 150 200 Plus Strand HSPs: Score = 193 (67.9 bits), Expect = 2.6e-14, P = 2.6e-14 Identities = 50/107 (46%), Positives = 63/107 (58%), Frame = +1 Query: 67 MCGGAIISDF---IGVKRGRNLXAXELWSELDPFS--DLLGFDTTTTT--TNQPPLPDKK 225 MCGGAIISD+ + +GR L A ELWSELD + D GF +T+ TNQ + ++ Sbjct: 1 MCGGAIISDYAPLVTKAKGRKLTAEELWSELDASAADDFWGFYSTSKLHPTNQVNVKEEA 60 Query: 226 VVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 V KK+++ K R N Y GI PWG WA EI DP GVR+WL Sbjct: 61 V------KKEQATEPGKRR---KRKNVYRGIRKRPWGKWAAEIRDPRKGVRVWL 105 >gi|7487565|pir||T00432 hypothetical protein T30B22.18 - Arabidopsis thaliana >gi|2529675|gb|AAC62858.1| (AC002535) putative AP2 domain transcription factor [Arabidopsis thaliana] Length = 171 Frame 1 hits (HSPs): ____ _______________ __________________________________________________ Database sequence: | | | | | 171 0 50 100 150 Plus Strand HSPs: Score = 132 (46.5 bits), Expect = 1.0e-12, Sum P(2) = 1.0e-12 Identities = 28/53 (52%), Positives = 33/53 (62%), Frame = +1 Query: 229 VSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 VSS +K+K SVS ++ G R N Y GI PWG WA EI DP GVR+WL Sbjct: 25 VSSRKKRKPVSVSEER-DGKRERKNLYRGIRQRPWGKWAAEIRDPSKGVRVWL 76 Score = 59 (20.8 bits), Expect = 1.0e-12, Sum P(2) = 1.0e-12 Identities = 12/14 (85%), Positives = 12/14 (85%), Frame = +1 Query: 67 MCGGAIISDFIGVK 108 MCGGAIISDFI K Sbjct: 1 MCGGAIISDFIWSK 14 >gi|7489226|pir||T07784 AP2 domain protein homolog - potato >gi|1688233|gb|AAC29516.1| (U77655) DNA binding protein homolog [Solanum tuberosum] Length = 298 Frame 1 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | | | 298 0 50 100 150 200 250 Plus Strand HSPs: Score = 167 (58.8 bits), Expect = 3.2e-11, P = 3.2e-11 Identities = 41/107 (38%), Positives = 50/107 (46%), Frame = +1 Query: 67 MCGGAIISDFIGVKRGRNLXAXELWSELDPFSDLLGFDTTTTTTNQPPLPDKKVVSSCEK 246 MCGGAI+ D I R R L + +LW F F +T N PP P + +S + Sbjct: 1 MCGGAILYDII--PRDRRLSSTDLWPSSADFWQTSSFSKPISTQNVPPKPKRAQLSRGSE 58 Query: 247 KKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 + KK R N Y GI PWG WA EI DP VR+WL Sbjct: 59 QMKKR----------QRKNLYRGIRQRPWGKWAAEIRDPRKRVRVWL 95 >gi|10798644|emb|CAC12822.1| (AJ299252) AP2 domain-containing transcription factor [Nicotiana tabacum] Length = 226 Frame 1 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | | 226 0 50 100 150 200 Plus Strand HSPs: Score = 138 (48.6 bits), Expect = 2.0e-08, P = 2.0e-08 Identities = 35/89 (39%), Positives = 44/89 (49%), Frame = +1 Query: 133 ELWSELDPFSDLLG-FDTTTTTT---NQPPLPDKKVVSSCEKKKKKSVSAQKXSGG-XXR 297 + WS S + G D+ + T N+P D ++ EK SV +K S G R Sbjct: 3 DFWSSSSSSSSIAGKSDSVQSLTHSYNKPQKSDSGKLNQLEKGTI-SVKVEKESSGPRAR 61 Query: 298 NNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 N Y GI PWG WA EI DP GVR+WL Sbjct: 62 KNKYRGIRQRPWGKWAAEIRDPQKGVRVWL 91 >gi|6176534|gb|AAF05606.1|AF190770_1 (AF190770) EREBP-like protein [Oryza sativa] Length = 362 Frame 1 hits (HSPs): ____ _____ __________________________________________________ Database sequence: | | | | 362 0 150 300 Plus Strand HSPs: Score = 102 (35.9 bits), Expect = 2.0e-08, Sum P(2) = 2.0e-08 Identities = 18/31 (58%), Positives = 20/31 (64%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 R N + GI PWG WA EI DP GVR+WL Sbjct: 111 RKNQFRGIRQRPWGKWAAEIRDPRKGVRVWL 141 Score = 63 (22.2 bits), Expect = 2.0e-08, Sum P(2) = 2.0e-08 Identities = 14/27 (51%), Positives = 17/27 (62%), Frame = +1 Query: 67 MCGGAIISDFIGVKRGRNLXAXELWSE 147 MCGGAI+SD I R + A +LW E Sbjct: 1 MCGGAILSDLIPPPR--RVTAGDLWLE 25 >gi|1168862|sp|P42736|CDI3_ARATH CADMIUM-INDUCED PROTEIN AS30 >gi|629508|pir||S49031 cadmium-induced protein - Arabidopsis thaliana >gi|541773|emb|CAA85734.1| (Z37504) cadmium-induced protein [Arabidopsis thaliana] Length = 204 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 204 0 50 100 150 200 Plus Strand HSPs: Score = 137 (48.2 bits), Expect = 2.2e-08, P = 2.2e-08 Identities = 35/89 (39%), Positives = 43/89 (48%), Frame = +1 Query: 121 LXAXELWSELDPFSDLLGFDTTTTTTNQPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRN 300 L A ELWSELD S F +T+ P V KK++ + ++ R Sbjct: 12 LTAEELWSELDA-SAADDFWGNYSTSKLHPTNQVNVKEEAVKKEQATEPGKRRK----RK 66 Query: 301 NXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 N Y GI PWG WA EI DP GVR+WL Sbjct: 67 NVYRGIRKRPWGKWAAEIRDPRKGVRVWL 95 >gi|12325282|gb|AAG52589.1|AC016529_20 (AC016529) putative AP2 domain transcription factor; 71325-70452 [Arabidopsis thaliana] Length = 262 Frame 1 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | | | 262 0 50 100 150 200 250 Plus Strand HSPs: Score = 140 (49.3 bits), Expect = 2.3e-08, P = 2.3e-08 Identities = 38/107 (35%), Positives = 48/107 (44%), Frame = +1 Query: 67 MCGGAIISDFIGVKRGRNLXAXELWSELDPFS-DLLGFDTTTTTTNQPPLPDKKVVSSCE 243 MCGGA+ISD+I ++ W F + FD D+ V S Sbjct: 1 MCGGAVISDYIAPEKIARSSGKSSWRSNGVFDCSIYDFDGNFDELES----DEPFVFSST 56 Query: 244 KKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 K S SA G +++ Y GI PWG WA EI DP GVR+WL Sbjct: 57 HKHHASGSAS--DGKKKQSSRYKGIRRRPWGRWAAEIRDPIKGVRVWL 102 >gi|6689918|gb|AAF23899.1|AF193803_1 (AF193803) transcription factor EREBP1 [Oryza sativa] Length = 365 Frame 1 hits (HSPs): ____ _____ __________________________________________________ Database sequence: | | | | 365 0 150 300 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 5.8e-07, Sum P(2) = 5.8e-07 Identities = 18/31 (58%), Positives = 20/31 (64%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 R N + GI PWG WA EI DP GVR+WL Sbjct: 116 RKNQFRGIRHRPWGKWAAEIRDPRKGVRVWL 146 Score = 50 (17.6 bits), Expect = 5.8e-07, Sum P(2) = 5.8e-07 Identities = 13/28 (46%), Positives = 13/28 (46%), Frame = +1 Query: 67 MCGGAIISDFIGVKRG-RNLXAXELWSE 147 MCGGAII G G R LW E Sbjct: 1 MCGGAIIHHLKGHPEGSRRATEGLLWPE 28 >gi|2281649|gb|AAC49778.1| (AF003105) AP2 domain containing protein RAP2.12 [Arabidopsis thaliana] Length = 317 Frame 1 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | | | | 317 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 124 (43.7 bits), Expect = 2.4e-06, P = 2.4e-06 Identities = 33/100 (33%), Positives = 45/100 (45%), Frame = +1 Query: 88 SDFIGVKRGRNLXAXELWSELDPFSDLLGFDTTTTTTNQPPLPDKKVVSSCEKKKKKSVS 267 +DF G K ++ + + D F+D+ F T+T +P + S KK Sbjct: 13 ADFQGFKDDSSIDCDDDFDVGDVFADVKPF--VFTSTPKPAVSAAAEGSVFGKKVTGLDG 70 Query: 268 AQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 + S R N Y GI PWG WA EI DP G R+WL Sbjct: 71 DAEKSANRKRKNQYRGIRQRPWGKWAAEIRDPREGARIWL 110 >gi|6056399|gb|AAF02863.1|AC009324_12 (AC009324) AP2 domain containing protein RAP2.12 [Arabidopsis thaliana] Length = 358 Frame 1 hits (HSPs): ____ ______________ __________________________________________________ Database sequence: | | | | 358 0 150 300 Plus Strand HSPs: Score = 124 (43.7 bits), Expect = 3.0e-06, P = 3.0e-06 Identities = 33/100 (33%), Positives = 45/100 (45%), Frame = +1 Query: 88 SDFIGVKRGRNLXAXELWSELDPFSDLLGFDTTTTTTNQPPLPDKKVVSSCEKKKKKSVS 267 +DF G K ++ + + D F+D+ F T+T +P + S KK Sbjct: 54 ADFQGFKDDSSIDCDDDFDVGDVFADVKPF--VFTSTPKPAVSAAAEGSVFGKKVTGLDG 111 Query: 268 AQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 + S R N Y GI PWG WA EI DP G R+WL Sbjct: 112 DAEKSANRKRKNQYRGIRQRPWGKWAAEIRDPREGARIWL 151 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93 Identities = 15/28 (53%), Positives = 19/28 (67%), Frame = +1 Query: 67 MCGGAIISDFIGVKRGRNLXAXELWSEL 150 MCGGAIISDFI R R + + +W +L Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDL 28 >gi|9279571|dbj|BAB01029.1| (AB022220) transcription factor EREBP-like protein [Arabidopsis thaliana] Length = 375 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | 375 0 150 300 Plus Strand HSPs: Score = 118 (41.5 bits), Expect = 1.5e-05, P = 1.5e-05 Identities = 35/100 (35%), Positives = 43/100 (43%), Frame = +1 Query: 88 SDFIGVKRGRNLXAXELWSELDPFSDLLGFDTTTTTTNQPPLPDKKVVSSCEKKKKKSVS 267 +DF G K A + + D F ++ F T TT V S+ KK +S Sbjct: 54 ADFQGFKDD---SAFDCEDDDDVFVNVKPFVFTATTKPVASAFVSTVGSAYAKKTVESAE 110 Query: 268 AQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 + S R N Y GI PWG WA EI DP G R WL Sbjct: 111 QAEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWL 150 >gi|3264767|gb|AAC24587.1| (AF071893) AP2 domain containing protein [Prunus armeniaca] Length = 280 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | | 280 0 50 100 150 200 250 Plus Strand HSPs: Score = 106 (37.3 bits), Expect = 0.00018, P = 0.00018 Identities = 19/31 (61%), Positives = 20/31 (64%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 R N Y GI PWG WA EI DP GVR+WL Sbjct: 8 RKNQYRGIRQRPWGKWAAEIRDPRKGVRVWL 38 >gi|7485319|pir||T04787 hypothetical protein F10M10.180 - Arabidopsis thaliana >gi|4455186|emb|CAB36718.1| (AL035521) putative protein [Arabidopsis thaliana] >gi|7270391|emb|CAB80158.1| (AL161585) putative protein [Arabidopsis thaliana] Length = 268 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | 268 0 50 100 150 200 250 Plus Strand HSPs: Score = 103 (36.3 bits), Expect = 0.00035, P = 0.00035 Identities = 21/63 (33%), Positives = 34/63 (53%), Frame = +1 Query: 217 DKKVVSSCEKKKKKSVSAQKXSGGXX------RNNXYXGIXPWPWG*WAPEIXDPHXGVR 378 ++++ SS ++++ S A+K GG + N Y G+ PWG +A EI DP R Sbjct: 100 EEEITSSSNRRRESSPVAKKAEGGGKIRKRKNKKNGYRGVRQRPWGKFAAEIRDPKRATR 159 Query: 379 LWL 387 +WL Sbjct: 160 VWL 162 >gi|1707016|gb|AAC69127.1| (U78721) putative AP2 domain transcription factor [Arabidopsis thaliana] Length = 218 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | 218 0 50 100 150 200 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 0.00036, P = 0.00036 Identities = 22/59 (37%), Positives = 32/59 (54%), Frame = +1 Query: 211 LPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 L + + SS + + S++ Q+ S RN Y G+ PWG WA EI DP+ R+WL Sbjct: 41 LTGQPIPSSIDDQSS-SLTLQEKSNSRQRN--YRGVRQRPWGKWAAEIRDPNKAARVWL 96 >gi|2281637|gb|AAC49772.1| (AF003099) AP2 domain containing protein RAP2.6 [Arabidopsis thaliana] Length = 164 Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | 164 0 50 100 150 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.00067, P = 0.00067 Identities = 16/31 (51%), Positives = 18/31 (58%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 R Y G+ PWG WA EI DPH R+WL Sbjct: 29 RPKKYRGVRQRPWGKWAAEIRDPHKATRVWL 59 >gi|3617742|gb|AAC36019.1| (AC005687) RAP2.6 [Arabidopsis thaliana] Length = 192 Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | 192 0 50 100 150 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.0012, P = 0.0012 Identities = 16/31 (51%), Positives = 18/31 (58%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 R Y G+ PWG WA EI DPH R+WL Sbjct: 57 RPKKYRGVRQRPWGKWAAEIRDPHKATRVWL 87 >gi|7489208|pir||T01986 Tsi1 protein - common tobacco >gi|3065895|gb|AAC14323.1| (AF058827) TSI1 [Nicotiana tabacum] Length = 251 Frame 1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | || 251 0 50 100 150 200 250 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.0018, P = 0.0018 Identities = 22/59 (37%), Positives = 30/59 (50%), Frame = +1 Query: 211 LPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 +P ++ CEKK++ VS R + G+ PWG WA EI DP G R+WL Sbjct: 81 MPSPNLI--CEKKRRL-VSPDTD---VTRRKKFRGVRQRPWGRWAAEIRDPTRGKRVWL 133 >gi|10177219|dbj|BAB10294.1| (AB026650) contains similarity to AP2 domain transcription factor~gene_id:MPF21.9 [Arabidopsis thaliana] Length = 220 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 220 0 50 100 150 200 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 0.0022, P = 0.0022 Identities = 15/31 (48%), Positives = 18/31 (58%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 + Y G+ PWG WA EI DPH R+WL Sbjct: 73 KKRRYRGVRQRPWGKWAAEIRDPHRAARVWL 103 >gi|7531181|sp|O04682|PTI6_LYCES PATHOGENESIS-RELATED GENES TRANSCRIPTIONAL ACTIVATOR PTI6 >gi|7489079|pir||T07728 transcription factor Pti6 - tomato >gi|2213785|gb|AAC49741.1| (U89257) Pti6 [Lycopersicon esculentum] Length = 248 Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | 248 0 50 100 150 200 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.0023, P = 0.0023 Identities = 21/59 (35%), Positives = 29/59 (49%), Frame = +1 Query: 211 LPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 +P K + +K++SVS R + G+ PWG WA EI DP G R+WL Sbjct: 72 MPSTKSIGD---RKRRSVSPDSD---VTRRKKFRGVRQRPWGRWAAEIRDPTRGKRVWL 124 >gi|8980313|emb|CAB96899.1| (AJ251249) AP2-domain DNA-binding protein [Catharanthus roseus] >gi|8980315|emb|CAB96900.1| (AJ251250) AP2-domain DNA-binding protein [Catharanthus roseus] Length = 203 Frame 1 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | || 203 0 50 100 150 200 Plus Strand HSPs: Score = 93 (32.7 bits), Expect = 0.0024, P = 0.0024 Identities = 26/90 (28%), Positives = 39/90 (43%), Frame = +1 Query: 133 ELWSELDPFSDLLGFDTTTTTTNQPPLPDK----KVVSSCEKKKKKSVSAQKXSGGXXRN 300 E W E+ F+D L + + P + + SC++ + +GG Sbjct: 38 ENWEEI--FADFLNWSGSEIQKRGSPSSESCQSNSMAESCQEDSVVGTPPEAAAGGGCSK 95 Query: 301 --NXYXGIXPWPWG*WAPEIXDPHX-GVRLWL 387 N Y G+ PWG +A EI DP G R+WL Sbjct: 96 DWNRYKGVRRRPWGKFAAEIRDPKKKGSRIWL 127 >gi|7484952|pir||T00409 ethylene-responsive transcription factor homolog T13E15.15 - Arabidopsis thaliana >gi|2344900|gb|AAC31840.1| (AC002388) putative ethylene response element-binding protein (EREBP) [Arabidopsis thaliana] Length = 226 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 226 0 50 100 150 200 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 0.0024, P = 0.0024 Identities = 27/96 (28%), Positives = 40/96 (41%), Frame = +1 Query: 118 NLXAXELWSEL----DPFSDLLGFDTTTTTTNQPPLPD-KKVVSSCEKKKKKSVSAQKXS 282 N+ + WS+L D D+ ++T + P V S E+ K + A Sbjct: 24 NVILNDNWSDLPLSVDDSQDMAIYNTLRDAVSSGWTPSVPPVTSPAEENKPPATKASGSH 83 Query: 283 GGXXRNNXYXGIXPWPWG*WAPEIXDPHX-GVRLWL 387 + Y G+ PWG +A EI DP G R+WL Sbjct: 84 APRQKGMQYRGVRRRPWGKFAAEIRDPKKNGARVWL 119 >gi|3702318|gb|AAC62875.1| (AC005397) putative AP2 domain transcription factor [Arabidopsis thaliana] Length = 294 Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | | | 294 0 50 100 150 200 250 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.0024, P = 0.0024 Identities = 22/50 (44%), Positives = 27/50 (54%), Frame = +1 Query: 244 KKKKKSVSAQKXSGGXXRNNX--YXGIXPWPWG*WAPEIXDPHXGVRLWL 387 K KKKS +A +GG + Y G+ PWG +A EI DP RLWL Sbjct: 76 KAKKKSPAAAAENGGDLVKSVVKYRGVRQRPWGKFAAEIRDPSSRTRLWL 125 >gi|7486964|pir||T02896 hypothetical protein T13J8.60 - Arabidopsis thaliana >gi|4455354|emb|CAB36764.1| (AL035524) putative protein [Arabidopsis thaliana] >gi|7269649|emb|CAB79597.1| (AL161572) putative protein [Arabidopsis thaliana] Length = 334 Frame 1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 334 0 150 300 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.0039, P = 0.0039 Identities = 23/69 (33%), Positives = 32/69 (46%), Frame = +1 Query: 181 TTTTTTNQPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXD 360 ++T + P D+K ++ +K SVS Q Y G+ PWG WA EI D Sbjct: 82 SSTGDVSASPTKDRKRINVDSTVQKPSVSGQN-------QKKYRGVRQRPWGKWAAEIRD 134 Query: 361 PHXGVRLWL 387 P R+WL Sbjct: 135 PEQRRRIWL 143 >gi|11358680|pir||T49870 probable transcription factor - Arabidopsis thaliana >gi|7576169|emb|CAB87920.1| (AL163912) putative transcription factor [Arabidopsis thaliana] Length = 263 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | 263 0 50 100 150 200 250 Plus Strand HSPs: Score = 93 (32.7 bits), Expect = 0.0042, P = 0.0042 Identities = 16/34 (47%), Positives = 18/34 (52%), Frame = +1 Query: 286 GXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 G R Y G+ PWG WA EI DP R+WL Sbjct: 85 GLLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWL 118 >gi|9758388|dbj|BAB08875.1| (AB022212) AP2 domain transcription factor-like [Arabidopsis thaliana] Length = 248 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 248 0 50 100 150 200 Plus Strand HSPs: Score = 92 (32.4 bits), Expect = 0.0049, P = 0.0049 Identities = 16/34 (47%), Positives = 18/34 (52%), Frame = +1 Query: 286 GXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 G R Y G+ PWG WA EI DP R+WL Sbjct: 83 GDLRRRHYRGVRQRPWGKWAAEIRDPKKAARVWL 116 >gi|6478845|dbj|BAA87068.1| (AB035270) ethylene-responsive element binding protein1 homolog [Matricaria chamomilla] Length = 158 Frame 1 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | 158 0 50 100 150 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.0054, P = 0.0053 Identities = 19/49 (38%), Positives = 26/49 (53%), Frame = +1 Query: 244 KKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDP-HXGVRLWL 387 K + ++ S Q S G + Y G+ PWG +A EI DP G R+WL Sbjct: 17 KSEPETSSFQPKSLGSQKGKHYRGVRRRPWGKYAAEIRDPAKNGARVWL 65 >gi|9665142|gb|AAF97326.1|AC023628_7 (AC023628) Similar to transcription factor TINY [Arabidopsis thaliana] Length = 187 Frame 1 hits (HSPs): __________________ __________________________________________________ Database sequence: | | | | | 187 0 50 100 150 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.0092, P = 0.0092 Identities = 16/63 (25%), Positives = 28/63 (44%), Frame = +1 Query: 199 NQPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVR 378 + PP+ + + ++ K ++ S R+ Y G+ WG W EI +P R Sbjct: 4 SSPPVTNNEPTATASAVKSCGGGGKETSSSTTRHPVYHGVRKRRWGKWVSEIREPRKKSR 63 Query: 379 LWL 387 +WL Sbjct: 64 IWL 66 >gi|2062174|gb|AAB63648.1| (AC001645) transcription factor (TINY) isolog [Arabidopsis thaliana] Length = 236 Frame 1 hits (HSPs): _______________ __________________________________________________ Database sequence: | | | | | | 236 0 50 100 150 200 Plus Strand HSPs: Score = 89 (31.3 bits), Expect = 0.0095, P = 0.0094 Identities = 22/69 (31%), Positives = 35/69 (50%), Frame = +1 Query: 181 TTTTTTN--QPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEI 354 TTTT+T+ + P + ++ K+++ S SA S ++ Y G+ WG W EI Sbjct: 21 TTTTSTHLSEEEAPPRN--NNTRKRRRDSSSASSSSS--MQHPVYRGVRMRSWGKWVSEI 76 Query: 355 XDPHXGVRLWL 387 P R+WL Sbjct: 77 RQPRKKTRIWL 87 >gi|11358305|pir||T48580 hypothetical protein T31B5.150 - Arabidopsis thaliana >gi|7529288|emb|CAB86640.1| (AL163491) putative protein [Arabidopsis thaliana] Length = 212 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 212 0 50 100 150 200 Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 0.0097, P = 0.0096 Identities = 15/31 (48%), Positives = 17/31 (54%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 R Y G+ PWG WA EI DP R+WL Sbjct: 35 RRRHYRGVRQRPWGKWAAEIRDPKKAARVWL 65 >gi|9279711|dbj|BAB01268.1| (AB023046) transcription factor TINY-like protein [Arabidopsis thaliana] Length = 254 Frame 1 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | || 254 0 50 100 150 200 250 Plus Strand HSPs: Score = 89 (31.3 bits), Expect = 0.011, P = 0.011 Identities = 22/69 (31%), Positives = 35/69 (50%), Frame = +1 Query: 181 TTTTTTN--QPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEI 354 TTTT+T+ + P + ++ K+++ S SA S ++ Y G+ WG W EI Sbjct: 39 TTTTSTHLSEEEAPPRN--NNTRKRRRDSSSASSSSS--MQHPVYRGVRMRSWGKWVSEI 94 Query: 355 XDPHXGVRLWL 387 P R+WL Sbjct: 95 RQPRKKTRIWL 105 >gi|9758474|dbj|BAB09003.1| (AB012239) transcription factor-like protein [Arabidopsis thaliana] Length = 201 Frame 1 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | || 201 0 50 100 150 200 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.011, P = 0.011 Identities = 24/82 (29%), Positives = 37/82 (45%), Frame = +1 Query: 145 ELDPFSDLLGFDTTTTTTNQPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXP 324 +L+P S +L D+ Q S+ + ++VS +K + Y G+ Sbjct: 53 KLEPSSPVLDPDSYVQEILQMEAESSSSSSTTTSPEVETVSNRKKTKRFEETRHYRGVRR 112 Query: 325 WPWG*WAPEIXDP-HXGVRLWL 387 PWG +A EI DP G R+WL Sbjct: 113 RPWGKFAAEIRDPAKKGSRIWL 134 >gi|9369375|gb|AAF87124.1|AC006434_20 (AC006434) F10A5.29 [Arabidopsis thaliana] Length = 206 Frame 1 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | | 206 0 50 100 150 200 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.012, P = 0.012 Identities = 22/64 (34%), Positives = 30/64 (46%), Frame = +1 Query: 217 DKKVVSSCEKKKKKSVSAQKXSG-----GXXRNNX--YXGIXPWPWG*WAPEIXDPHXGV 375 + KV+ KK+++V A G G N Y G+ WG W EI +P+ G Sbjct: 5 EPKVMMVGANKKQRTVQASSRKGCMRGKGGPDNASCTYKGVRQRTWGKWVAEIREPNRGA 64 Query: 376 RLWL 387 RLWL Sbjct: 65 RLWL 68 >gi|7488058|pir||T01919 probable Ap2 domain protein - Arabidopsis thaliana >gi|3600050|gb|AAC35537.1| (AF080120) contains similarity to AP2 domain containing proteins [Arabidopsis thaliana] >gi|4850293|emb|CAB43049.1| (AL049876) putative Ap2 domain protein [Arabidopsis thaliana] >gi|7267813|emb|CAB81215.1| (AL161531) putative Ap2 domain protein [Arabidopsis thaliana] Length = 287 Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | | 287 0 50 100 150 200 250 Plus Strand HSPs: Score = 89 (31.3 bits), Expect = 0.014, P = 0.014 Identities = 19/49 (38%), Positives = 26/49 (53%), Frame = +1 Query: 241 EKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 +K+KK+ V+ R + G+ PWG WA EI DP VR+WL Sbjct: 67 KKRKKRVVTVPVVVTTATRK--FRGVRQRPWGKWAAEIRDPSRRVRVWL 113 >gi|7486739|pir||T05607 hypothetical protein F9D16.220 - Arabidopsis thaliana >gi|4454044|emb|CAA23041.1| (AL035394) putative Ap2 domain protein [Arabidopsis thaliana] >gi|7269224|emb|CAB81293.1| (AL161560) putative Ap2 domain protein [Arabidopsis thaliana] Length = 343 Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 343 0 150 300 Plus Strand HSPs: Score = 90 (31.7 bits), Expect = 0.014, P = 0.014 Identities = 23/56 (41%), Positives = 28/56 (50%), Frame = +1 Query: 220 KKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 K+ V S E VSA + G + + G+ PWG WA EI DP VRLWL Sbjct: 97 KRAVKS-ESTVSPVVSATTTTTGEKK---FRGVRQRPWGKWAAEIRDPLKRVRLWL 148 >gi|3282693|gb|AAC39489.1| (AF040959) AP2 domain family transcription factor homolog [Arabidopsis thaliana] >gi|4587996|gb|AAD25937.1|AF085279_10 (AF085279) ABI4 [Arabidopsis thaliana] >gi|6598941|gb|AAF18736.1|AC018721_11 (AC018721) AP2 domain transcription factor (ABI4:abscisic acid-insensitive 4 ) [Arabidopsis thaliana] Length = 328 Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 328 0 150 300 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.028, P = 0.028 Identities = 22/70 (31%), Positives = 29/70 (41%), Frame = +1 Query: 178 DTTTTTTNQPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNX-YXGIXPWPWG*WAPEI 354 D T T+ P D SS ++K +K GG + Y G+ WG W EI Sbjct: 15 DNNQTLTHNNPQSDSTTDSSTSSAQRK----RKGKGGPDNSKFRYRGVRQRSWGKWVAEI 70 Query: 355 XDPHXGVRLWL 387 +P R WL Sbjct: 71 REPRKRTRKWL 81 >gi|8346773|emb|CAB93939.1| (AJ238739) AP2-domain DNA-binding protein [Catharanthus roseus] Length = 376 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 376 0 150 300 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.035, P = 0.034 Identities = 21/58 (36%), Positives = 28/58 (48%), Frame = +1 Query: 214 PDKKVVSSCEKKKKKSVSAQKXSGGXXRNN-XYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 P +KV + KK K GG ++ Y G+ WG W EI +P+ G RLWL Sbjct: 54 PARKVPAKGSKK-----GCMKGKGGPENSHCKYRGVRQRTWGKWVAEIREPNRGSRLWL 107 >gi|10177206|dbj|BAB10308.1| (AB025637) contains similarity to transcription factor~gene_id:MVP7.8 [Arabidopsis thaliana] Length = 391 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 391 0 150 300 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.037, P = 0.036 Identities = 18/43 (41%), Positives = 20/43 (46%), Frame = +1 Query: 259 SVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 S SG R Y G+ PWG WA EI DP R+WL Sbjct: 170 SSETSSFSGDQPRRR-YRGVRQRPWGKWAAEIRDPFKAARVWL 211 >gi|9758475|dbj|BAB09004.1| (AB012239) contains similarity to ethylene responsive element binding factor~gene_id:K11J9.13 [Arabidopsis thaliana] Length = 241 Frame 1 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | | 241 0 50 100 150 200 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 0.042, P = 0.042 Identities = 31/102 (30%), Positives = 48/102 (47%), Frame = +1 Query: 82 IISDFIGVKRGR-NLXAXELW---SELDPFSDLLGFDTTTTTTNQ--PPLPDKKVVSSCE 243 +++DF+ ++ +L +L SE P + +T NQ PPLP+ V + Sbjct: 17 LLTDFVSMETDHPSLFTNQLHNFHSETGPRTITNQSPKPNSTLNQRKPPLPNLSVSRTVS 76 Query: 244 KKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHX-GVRLWL 387 K +K Y G+ PWG +A EI DP+ G R+WL Sbjct: 77 TKTEKE----------EEERHYRGVRRRPWGKYAAEIRDPNKKGCRIWL 115 >gi|5091503|dbj|BAA78738.1| (AB023482) EST AU055776(S20048) corresponds to a region of the predicted gene.; Similar to Arabidopsis thaliana AP2 domain containing protein RAP2.10 mRNA, partial cds.(AF003103) [Oryza sativa] Length = 315 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | | | 315 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 0.068, P = 0.065 Identities = 21/80 (26%), Positives = 30/80 (37%), Frame = +1 Query: 148 LDPFSDLLGFDTTTTTTNQPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPW 327 L P + D T PP P + ++ +V A G Y G+ Sbjct: 123 LAPLRNSARMDRREATVFLPPPPPPQPTQPQQQPAAAAVRAPVGGRGGGGGRQYRGVRMR 182 Query: 328 PWG*WAPEIXDPHXGVRLWL 387 WG W EI +P+ R+WL Sbjct: 183 KWGKWVAEIREPNKRSRIWL 202 >gi|4699791|pdb|2GCC| Solution Structure Of The Gcc-Box Binding Domain, Nmr, Minimized Mean Structure >gi|4699799|pdb|3GCC| Solution Structure Of The Gcc-Box Binding Domain, Nmr, 46 Structures Length = 70 Frame 1 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | 70 0 20 40 60 Plus Strand HSPs: Score = 72 (25.3 bits), Expect = 0.17, P = 0.16 Identities = 14/32 (43%), Positives = 18/32 (56%), Frame = +1 Query: 295 RNNXYXGIXPWPWG*WAPEIXDP-HXGVRLWL 387 + Y G+ PWG +A EI DP G R+WL Sbjct: 2 KGKHYRGVRQRPWGKFAAEIRDPAKNGARVWL 33 >gi|4204307|gb|AAD10688.1| (AC003027) lcl|prt_seq No definition line found [Arabidopsis thaliana] >gi|11414990|dbj|BAB18561.1| (AB047649) ERF domain protein 10 [Arabidopsis thaliana] Length = 245 Frame 1 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | | | 245 0 50 100 150 200 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 0.18, P = 0.17 Identities = 22/58 (37%), Positives = 29/58 (50%), Frame = +1 Query: 223 KVVSSCEKKKKKSVS---AQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 K VS KK+K+V+ A G + Y G+ PWG +A EI DP R+WL Sbjct: 22 KEVSDKGVKKRKNVTKALAVNDGGEKSKEVRYRGVRRRPWGRYAAEIRDPVKKKRVWL 79 >gi|4699734|pdb|1GCC|A Chain A, Solution Nmr Structure Of The Complex Of Gcc-Box Binding Domain Of Aterf1 And Gcc-Box Dna, Minimized Average Structure Length = 63 Frame 1 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | 63 0 20 40 60 Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 0.22, P = 0.20 Identities = 14/28 (50%), Positives = 17/28 (60%), Frame = +1 Query: 307 YXGIXPWPWG*WAPEIXDP-HXGVRLWL 387 Y G+ PWG +A EI DP G R+WL Sbjct: 3 YRGVRQRPWGKFAAEIRDPAKNGARVWL 30 >gi|6552733|gb|AAF16532.1|AC013482_6 (AC013482) T26F17.14 [Arabidopsis thaliana] Length = 230 Frame 1 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | | 230 0 50 100 150 200 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 0.25, P = 0.22 Identities = 20/68 (29%), Positives = 27/68 (39%), Frame = +1 Query: 184 TTTTTNQPPLPDKKVVSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDP 363 T++T + PL SS S S K + Y G+ WG W EI P Sbjct: 10 TSSTKKEMPLSSSPSSSSSSSSSSSSSSC-KNKNKKSKIKKYKGVRMRSWGSWVSEIRAP 68 Query: 364 HXGVRLWL 387 + R+WL Sbjct: 69 NQKTRIWL 76 >gi|11358884|pir||T51834 transcription factor DREB2B, drought-induced [validated] - Arabidopsis thaliana >gi|3738232|dbj|BAA33795.1| (AB007791) DREB2B [Arabidopsis thaliana] >gi|4126708|dbj|BAA36706.1| (AB016571) DREB2B [Arabidopsis thaliana] >gi|6016692|gb|AAF01519.1|AC009991_15 (AC009991) DREB2B transcription factor [Arabidopsis thaliana] Length = 330 Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 330 0 150 300 Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 0.46, P = 0.37 Identities = 20/58 (34%), Positives = 27/58 (46%), Frame = +1 Query: 214 PDKKVVSSCEKKKKKSVSAQKXSGGXXRNN-XYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 P +KV + KK K GG ++ + G+ WG W EI +P G RLWL Sbjct: 51 PKRKVPAKGSKK-----GCMKGKGGPDNSHCSFRGVRQRIWGKWVAEIREPKIGTRLWL 104 >gi|106688|pir||S24709 Ig alpha chain - human >gi|28566|emb|CAA78683.1| (Z14960) codes for truncated alpha heavy Ig mRNA of alpha heavy chain disease patient AYO [Homo sapiens] Length = 77 Frame 2 hits (HSPs): _____________________ Annotated Domains: ____________________ __________________________________________________ Database sequence: | | | | | 77 0 20 40 60 __________________ Annotated Domains: DOMO DM04904: 41..70 __________________ Plus Strand HSPs: Score = 67 (23.6 bits), Expect = 0.59, P = 0.44 Identities = 12/32 (37%), Positives = 18/32 (56%), Frame = +2 Query: 140 GPSLTLSLTSLASIPPPPPPTNXPFQTKKWCH 235 GP T +++S+ S PP P P+ P + CH Sbjct: 36 GPETTGTVSSVPSTPPTPSPSTPPTPSPSCCH 67 >gi|5281024|emb|CAB45963.1| (Z97343) EREBP-2 protein [Arabidopsis thaliana] >gi|7268502|emb|CAB78753.1| (AL161546) EREBP-2 protein [Arabidopsis thaliana] Length = 225 Frame 1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | | 225 0 50 100 150 200 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 0.60, P = 0.45 Identities = 20/53 (37%), Positives = 27/53 (50%), Frame = +1 Query: 229 VSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDP-HXGVRLWL 387 V S KK+K+ S + + Y G+ PWG +A EI DP G R+WL Sbjct: 80 VDSVPVKKEKT-SPVSAAVTAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWL 132 >gi|11281604|pir||T47955 hypothetical protein F15G16.20 - Arabidopsis thaliana >gi|6850854|emb|CAB71093.1| (AL132959) putative protein [Arabidopsis thaliana] Length = 315 Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | | | 315 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 0.65, P = 0.48 Identities = 16/47 (34%), Positives = 24/47 (51%), Frame = +1 Query: 247 KKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDPHXGVRLWL 387 K+++SV + + Y G+ PWG +A EI DP R+WL Sbjct: 85 KEEESVVVEDDVSTSVKPKKYRGVRQRPWGKFAAEIRDPSSRTRIWL 131 >gi|7531108|sp|O80338|ERF2_ARATH ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 2 (ATERF2) >gi|3434969|dbj|BAA32419.1| (AB008104) ethylene responsive element binding factor 2 [Arabidopsis thaliana] >gi|8809604|dbj|BAA97155.1| (AB018117) ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis thaliana] Length = 243 Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | 243 0 50 100 150 200 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 0.69, P = 0.50 Identities = 18/52 (34%), Positives = 29/52 (55%), Frame = +1 Query: 232 SSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDP-HXGVRLWL 387 ++ E+K KK++ + + + Y G+ PWG +A EI DP G R+WL Sbjct: 95 TAMEEKPKKAIPVTETA---VKAKHYRGVRQRPWGKFAAEIRDPAKNGARVWL 144 >gi|7531107|sp|O80337|ERFI_ARATH ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1 (ATERF1) >gi|3434967|dbj|BAA32418.1| (AB008103) ethylene responsive element binding factor 1 [Arabidopsis thaliana] Length = 266 Frame 1 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | | 266 0 50 100 150 200 250 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 0.81, P = 0.56 Identities = 20/53 (37%), Positives = 27/53 (50%), Frame = +1 Query: 229 VSSCEKKKKKSVSAQKXSGGXXRNNXYXGIXPWPWG*WAPEIXDP-HXGVRLWL 387 V S KK+K+ S + + Y G+ PWG +A EI DP G R+WL Sbjct: 121 VDSVPVKKEKT-SPVSAAVTAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWL 173 WARNING: HSPs involving 54 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.92 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.331 0.143 0.528 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.342 0.146 0.487 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.332 0.147 0.515 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.331 0.147 0.471 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.343 0.151 0.536 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.340 0.143 0.548 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 128 117 10. 71 3 12 22 0.094 33 29 0.10 35 +2 0 128 121 10. 71 3 12 22 0.098 33 29 0.11 35 +1 0 129 119 10. 71 3 12 22 0.096 33 29 0.11 35 -1 0 129 120 10. 71 3 12 22 0.097 33 29 0.11 35 -2 0 128 120 10. 71 3 12 22 0.097 33 29 0.11 35 -3 0 128 119 10. 71 3 12 22 0.096 33 29 0.11 35 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 104 No. of states in DFA: 586 (58 KB) Total size of DFA: 169 KB (192 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 141.44u 1.11s 142.55t Elapsed: 00:00:24 Total cpu time: 141.47u 1.16s 142.63t Elapsed: 00:00:24 Start: Mon Oct 1 22:48:05 2001 End: Mon Oct 1 22:48:29 2001 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000