WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= 'E06G09_N09_13.ab1' (387 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 3 Sequences : less than 3 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 896 179 |=========================================================== 6310 717 110 |==================================== 3980 607 152 |================================================== 2510 455 122 |======================================== 1580 333 61 |==================== 1000 272 51 |================= 631 221 44 |============== 398 177 35 |=========== 251 142 18 |====== 158 124 14 |==== 100 110 8 |== 63.1 102 5 |= 39.8 97 21 |======= 25.1 76 1 |: 15.8 75 5 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 70 <<<<<<<<<<<<<<<<< 10.0 70 9 |=== 6.31 61 2 |: 3.98 59 4 |= 2.51 55 1 |: 1.58 54 0 | 1.00 54 4 |= 0.63 50 2 |: 0.40 48 2 |: 0.25 46 1 |: 0.16 45 1 |: 0.10 44 6 |== 0.063 38 6 |== 0.040 32 2 |: 0.025 30 3 |= 0.016 27 1 |: 0.010 26 8 |== Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|114950|sp|P24076|BGIA_MOMCHGLU S.GRISEUS PROTEASE ... +3 137 2.3e-08 1 gi|603890|emb|CAA87073.1|(Z46949) pathogenesis-relate... +3 128 2.0e-07 1 gi|1084325|pir||JC2508trypsin inhibitor BGIT - balsam... +3 126 3.3e-07 1 gi|124984|sp|P19873|ITH5_CUCMAINHIBITOR OF TRYPSIN AN... +3 122 8.8e-07 1 gi|999878|pdb|1TIN| Trypsin Inhibitor V (Nmr, Minim... +3 122 8.8e-07 1 gi|1431715|pdb|1MIT| Recombinant Cucurbita Maxima T... +3 122 8.8e-07 1 gi|3928100|gb|AAC79626.1|(AC005770) putative protease... +3 122 8.8e-07 1 gi|688425|dbj|BAA05472.1|(D26455) tumor-related prote... +3 108 2.7e-05 1 gi|124192|sp|P20076|IER1_LYCESETHYLENE-RESPONSIVE PRO... +3 101 0.00015 1 gi|218290|dbj|BAA02823.1|(D13662) genetic tumor-relat... +3 100 0.00019 1 gi|547733|sp|Q03199|IPIB_TOBACPROTEINASE INHIBITOR I-... +3 99 0.00024 1 gi|124120|sp|P16231|ICI1_LYCPEWOUND-INDUCED PROTEINAS... +3 99 0.00024 1 gi|170516|gb|AAA34198.1|(M59427) proteinase inhibitor... +3 99 0.00024 1 gi|547743|sp|Q02214|ITR1_NICSYTRYPSIN INHIBITOR I PRE... +3 98 0.00031 1 gi|547732|sp|Q03198|IPIA_TOBACPROTEINASE INHIBITOR I-... +3 97 0.00039 1 gi|1127128|pdb|1HYM|BChain B, Hydrolyzed Trypsin Inhi... +3 96 0.00050 1 gi|6730431|pdb|1DWM|AChain A, Solution Structure Of L... +3 96 0.00050 1 gi|10178197|dbj|BAB11621.1|(AB016875) gene_id:K9D7.8~... +3 96 0.00050 1 gi|68798|pir||TIPO1Achymotrypsin inhibitor I chain A ... +3 85 0.0073 1 gi|124126|sp|P01052|ICIA_SOLTUCHYMOTRYPSIN INHIBITOR ... +3 85 0.0073 1 gi|169491|gb|AAA69780.1|(L06137) proteinase inhibitor... +3 85 0.0073 1 gi|124130|sp|P08454|ICID_SOLTUWOUND-INDUCED PROTEINAS... +3 84 0.0093 1 gi|169542|gb|AAA72133.1|(L06985) proteinase inhibitor... +3 84 0.0093 1 gi|225840|prf||1314299Aproteinase inhibitor I [Solanu... +3 84 0.0093 1 gi|2129998|pir||S66278serine proteinase inhibitor - p... +3 84 0.0093 1 gi|3928101|gb|AAC79627.1|(AC005770) putative protease... +3 84 0.0093 1 gi|266330|sp|Q00783|ICI1_SOLTUPROTEINASE INHIBITOR I ... +3 82 0.015 1 gi|100458|pir||S25159proteinase inhibitor I - potato ... +3 80 0.025 1 gi|461598|sp|P80211|ATSI_AMACATRYPSIN/SUBTILISIN INHI... +3 80 0.025 1 gi|6453287|emb|CAB61327.1|(AJ132473) trypsin inhibito... +3 80 0.025 1 gi|2129494|pir||S66650proteinase inhibitor BWI-1 - co... +3 79 0.031 1 gi|1836152|gb|AAB46906.1|BTI-2=trypsin inhibitor isof... +3 79 0.031 1 gi|124122|sp|P01053|ICI2_HORVUSUBTILISIN-CHYMOTRYPSIN... +3 78 0.040 1 gi|443451|pdb|3CI2| Chymotrypsin Inhibitor 2 (Serin... +3 78 0.040 1 gi|494714|pdb|1YPA|IChain I, Chymotrypsin Inhibitor 2... +3 78 0.040 1 gi|494715|pdb|1YPB|IChain I, Chymotrypsin Inhibitor 2... +3 78 0.040 1 gi|494716|pdb|1YPC|IChain I, Chymotrypsin Inhibitor 2... +3 78 0.040 1 gi|2118425|pir||S61830subtilisin/chymotrypsin inhibit... +3 77 0.050 1 gi|224447|prf||1105220Ainhibitor,subtilisin [Vicia faba] +3 76 0.064 1 gi|493947|pdb|1COA|IChain I, Chymotrypsin Inhibitor 2... +3 76 0.064 1 gi|124123|sp|P08626|ICI3_HORVUSUBTILISIN-CHYMOTRYPSIN... +3 75 0.081 1 gi|100574|pir||S18818chymotrypsin inhibitor 2 - barle... +3 75 0.081 1 gi|544883|gb|AAB29664.1|ATI=trypsin inhibitor [Amaran... +3 75 0.081 1 gi|640139|pdb|2CI2|IChain I, Chymotrypsin Inhibitor 2... +3 75 0.081 1 gi|1836151|gb|AAB46905.1|BTI-1=7.634 kda trypsin inhi... +3 73 0.13 1 gi|1083950|pir||JC2380subtilisin inhibitor CLSI-I - C... +3 71 0.20 1 gi|124119|sp|P05118|ICI1_LYCESWOUND-INDUCED PROTEINAS... +3 76 0.28 1 gi|1361981|pir||S55592trypsin inhibitor - winter squa... +3 69 0.31 1 gi|7438245|pir||T06181subtilisin-chymotrypsin inhibit... +3 68 0.39 1 gi|2118424|pir||S06251proteinase inhibitor I precurso... +3 74 0.41 1
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 20 database sequences were not reported due to the limiting value of parameter V = 50. >gi|114950|sp|P24076|BGIA_MOMCH GLU S.GRISEUS PROTEASE INHIBITOR (BGIA) >gi|81581|pir||A41174 endopeptidase inhibitor - balsam pear >gi|234607|gb|AAB19651.1| BGIA=acidic amino acid-specific endopeptidase inhibitor [Momordica charantia L.=bitter gourd, Peptide, 68 aa] Length = 68 Frame 3 hits (HSPs): _______________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 68 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 6..29 BLOCKS BL00285B: Potato inhibitor I family prot 39..54 DOMO DM00902: POTATOINHIBITORIFAMILY 1..67 Entrez acetylation site 1 Entrez active site: REACTIVE BOND (BY SIMILARIT 44..45 PFAM potato_inhibit: Potato inhibitor I famil 6..68 PRINTS POTATOINHBTR1: Potato inhibitor motif I 8..21 PRINTS POTATOINHBTR2: Potato inhibitor motif II 33..44 PRINTS POTATOINHBTR3: Potato inhibitor motif II 45..55 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 6..67 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 9..20 __________________ Plus Strand HSPs: Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08 Identities = 29/42 (69%), Positives = 31/42 (73%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP V A V GS VTADFRCDRVRVWVT+ GIV + P IG Sbjct: 27 ENPRVRAVIVRVGSPVTADFRCDRVRVWVTERGIVARPPAIG 68 >gi|603890|emb|CAA87073.1| (Z46949) pathogenesis-related protein PR-6 type [Sambucus nigra] Length = 79 Frame 3 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | | 79 0 20 40 60 Plus Strand HSPs: Score = 128 (45.1 bits), Expect = 2.0e-07, P = 2.0e-07 Identities = 27/42 (64%), Positives = 31/42 (73%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP V A V +GSIVT D RCDRVRVWV ++GIV + P IG Sbjct: 38 ENPSVTAVIVPEGSIVTTDERCDRVRVWVDENGIVTRVPVIG 79 >gi|1084325|pir||JC2508 trypsin inhibitor BGIT - balsam pear >gi|1096161|prf||2111250B trypsin inhibitor BGIT [Momordica charantia] Length = 68 Frame 3 hits (HSPs): _______________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 68 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 9..20 __________________ Plus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.3e-07, P = 3.3e-07 Identities = 26/42 (61%), Positives = 29/42 (69%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP V A + GS T DFRCDRVRVWVT+ GIV + P IG Sbjct: 27 ENPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVARPPTIG 68 >gi|124984|sp|P19873|ITH5_CUCMA INHIBITOR OF TRYPSIN AND HAGEMAN FACTOR (CMTI-V) >gi|99624|pir||S12897 serine proteinase inhibitor - winter squash >gi|227289|prf||1701295A trypsin inhibitor [Cucurbita maxima] Length = 68 Frame 3 hits (HSPs): _______________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 68 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 6..29 BLOCKS BL00285B: Potato inhibitor I family prot 39..54 DOMO DM00902: POTATOINHIBITORIFAMILY 1..67 Entrez acetylation site 1 Entrez active site: REACTIVE BOND (BY SIMILARIT 44..45 PFAM potato_inhibit: Potato inhibitor I famil 6..68 PRINTS POTATOINHBTR1: Potato inhibitor motif I 8..21 PRINTS POTATOINHBTR2: Potato inhibitor motif II 33..44 PRINTS POTATOINHBTR3: Potato inhibitor motif II 45..55 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 6..67 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 9..20 __________________ Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 23/42 (54%), Positives = 30/42 (71%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 +NP V A + +G+ VT DFRC+RVR+WV K G+V PRIG Sbjct: 27 QNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSPPRIG 68 >gi|999878|pdb|1TIN| Trypsin Inhibitor V (Nmr, Minimized Average Structure) Length = 69 Frame 3 hits (HSPs): _______________________________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 23/42 (54%), Positives = 30/42 (71%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 +NP V A + +G+ VT DFRC+RVR+WV K G+V PRIG Sbjct: 28 QNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSPPRIG 69 >gi|1431715|pdb|1MIT| Recombinant Cucurbita Maxima Trypsin Inhibitor V (Rcmti-V) (Nmr, Minimized Average Structure) Length = 69 Frame 3 hits (HSPs): _______________________________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 23/42 (54%), Positives = 30/42 (71%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 +NP V A + +G+ VT DFRC+RVR+WV K G+V PRIG Sbjct: 28 QNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSPPRIG 69 >gi|3928100|gb|AAC79626.1| (AC005770) putative protease inhibitor [Arabidopsis thaliana] Length = 73 Frame 3 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | | 73 0 20 40 60 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.8e-07, P = 8.8e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP V+A +L GS VTADFRCDRVRV+V + IV + P+ G Sbjct: 32 ENPTVNAAVILDGSPVTADFRCDRVRVFVDGNRIVVKTPKSG 73 >gi|688425|dbj|BAA05472.1| (D26455) tumor-related protein [Nicotiana glauca X Nicotiana langsdorffii] Length = 64 Frame 3 hits (HSPs): __________________________________ __________________________________________________ Database sequence: | | | | | 64 0 20 40 60 Plus Strand HSPs: Score = 108 (38.0 bits), Expect = 2.7e-05, P = 2.7e-05 Identities = 23/43 (53%), Positives = 30/43 (69%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP L + +VL GS VT DFRC+RVR++V +V Q PR+G Sbjct: 22 ENPKLTNVPSVLNGSPVTKDFRCNRVRLFVNVLDVVVQIPRVG 64 >gi|124192|sp|P20076|IER1_LYCES ETHYLENE-RESPONSIVE PROTEINASE INHIBITOR I PRECURSOR >gi|82085|pir||A32067 ethylene-responsive proproteinase inhibitor I precursor - tomato >gi|623594|gb|AAA60745.1| (J04099) proteinase inhibitor I [Lycopersicon esculentum] Length = 119 Frame 3 hits (HSPs): ___________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 119 0 50 100 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 56..79 BLOCKS BL00285B: Potato inhibitor I family prot 90..105 DOMO DM02780: POTATOINHIBITORIFAMILY 1..47 DOMO DM00902: POTATOINHIBITORIFAMILY 49..118 Entrez active site: REACTIVE BOND (BY SIMILARIT 95..96 PFAM potato_inhibit: Potato inhibitor I famil 56..119 PRINTS POTATOINHBTR1: Potato inhibitor motif I 58..71 PRINTS POTATOINHBTR2: Potato inhibitor motif II 84..95 PRINTS POTATOINHBTR3: Potato inhibitor motif II 96..106 PRODOM PD054937: IER1_LYCES 1..54 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 56..118 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 59..70 __________________ Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 0.00015, P = 0.00015 Identities = 21/43 (48%), Positives = 28/43 (65%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP L + T+L GS T D RC+RVR++V IV Q P++G Sbjct: 77 ENPKLTNVETLLNGSAFTEDLRCNRVRLFVNLLDIVVQTPKVG 119 >gi|218290|dbj|BAA02823.1| (D13662) genetic tumor-related proteinase inhibitor I precursor [Nicotiana glauca X Nicotiana langsdorffii] Length = 94 Frame 3 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | | 94 0 20 40 60 80 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.00019, P = 0.00019 Identities = 23/43 (53%), Positives = 28/43 (65%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 EN L + +VL GS VT D RCDRVR++V IV Q PR+G Sbjct: 52 ENSKLTNVPSVLNGSPVTQDLRCDRVRLFVNLLDIVVQIPRVG 94 >gi|547733|sp|Q03199|IPIB_TOBAC PROTEINASE INHIBITOR I-B PRECURSOR (PI-IB) (INHIBITOR OF MICROBIAL SERINE PROTEINASES MAJOR ISOFORM) >gi|1076637|pir||A47487 serine proteinase inhibitor TIMPa precursor - common tobacco >gi|19913|emb|CAA78269.1| (Z12623) Pre-pro-proteinase inhibitor I [Nicotiana tabacum] >gi|398177|emb|CAA47461.1| (X67076) inhibitor of microbial serine proteinases (major isoform) [Nicotiana tabacum] Length = 107 Frame 3 hits (HSPs): _____________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 44..67 BLOCKS BL00285B: Potato inhibitor I family prot 78..93 Entrez active site: REACTIVE BOND (BY SIMILARIT 83..84 PFAM potato_inhibit: Potato inhibitor I famil 44..107 PRINTS POTATOINHBTR1: Potato inhibitor motif I 46..59 PRINTS POTATOINHBTR2: Potato inhibitor motif II 72..83 PRINTS POTATOINHBTR3: Potato inhibitor motif II 84..94 PRODOM PD027510: IPIA(1) IPIB(1) 1..42 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 44..106 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 47..58 __________________ Plus Strand HSPs: Score = 99 (34.8 bits), Expect = 0.00024, P = 0.00024 Identities = 21/43 (48%), Positives = 28/43 (65%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP L + TVL G+ VT D RC+RVR++V V Q P++G Sbjct: 65 ENPKLTNVQTVLNGTPVTEDLRCNRVRLFVNVLDFVVQTPQVG 107 >gi|124120|sp|P16231|ICI1_LYCPE WOUND-INDUCED PROTEINASE INHIBITOR I PRECURSOR >gi|100268|pir||A34359 trypsin inhibitor I precursor - Peruvian tomato >gi|170477|gb|AAA34180.1| (J05094) proteinase inhibitor I precursor [Lycopersicon peruvianum] Length = 111 Frame 3 hits (HSPs): ____________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 111 0 50 100 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 48..71 BLOCKS BL00285B: Potato inhibitor I family prot 82..97 DOMO DM02780: POTATOINHIBITORIFAMILY 1..40 Entrez active site: REACTIVE BOND (BY SIMILARIT 87..88 PFAM potato_inhibit: Potato inhibitor I famil 48..111 PRINTS POTATOINHBTR1: Potato inhibitor motif I 50..63 PRINTS POTATOINHBTR2: Potato inhibitor motif II 76..87 PRINTS POTATOINHBTR3: Potato inhibitor motif II 88..98 PRODOM PD010350: ICI1(3) ICID(1) Q07459(1) 1..46 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 48..109 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 51..62 __________________ Plus Strand HSPs: Score = 99 (34.8 bits), Expect = 0.00024, P = 0.00024 Identities = 22/42 (52%), Positives = 28/42 (66%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 ENP + + +L GS VT DFRCDRVR++V G V Q PR+ Sbjct: 69 ENPSITNIPILLNGSPVTKDFRCDRVRLFVNILGDVVQIPRV 110 >gi|170516|gb|AAA34198.1| (M59427) proteinase inhibitor I [Lycopersicon peruvianum] Length = 111 Frame 3 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | 111 0 50 100 Plus Strand HSPs: Score = 99 (34.8 bits), Expect = 0.00024, P = 0.00024 Identities = 22/42 (52%), Positives = 28/42 (66%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 ENP + + +L GS VT DFRCDRVR++V G V Q PR+ Sbjct: 69 ENPSITNIPILLNGSPVTKDFRCDRVRLFVNILGDVVQIPRV 110 >gi|547743|sp|Q02214|ITR1_NICSY TRYPSIN INHIBITOR I PRECURSOR (NSTI-I) >gi|1076615|pir||A56555 trypsin inhibitor type I precursor - wood tobacco >gi|170223|gb|AAA34067.1| (M74102) pre-pro-proteinase inhibitor I [Nicotiana sylvestris] Length = 94 Frame 3 hits (HSPs): _______________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | 94 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 31..54 BLOCKS BL00285B: Potato inhibitor I family prot 65..80 DOMO DM02780: POTATOINHIBITORIFAMILY 1..29 DOMO DM00902: POTATOINHIBITORIFAMILY 31..93 Entrez active site: REACTIVE BOND (BY SIMILARIT 70..71 PFAM potato_inhibit: Potato inhibitor I famil 31..94 PRINTS POTATOINHBTR1: Potato inhibitor motif I 33..46 PRINTS POTATOINHBTR2: Potato inhibitor motif II 59..70 PRINTS POTATOINHBTR3: Potato inhibitor motif II 71..81 PRODOM PD027509: ITR1(1) Q40416(1) 1..29 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 31..93 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 34..45 __________________ Plus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.00031, P = 0.00031 Identities = 22/43 (51%), Positives = 28/43 (65%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 EN L + +VL GS VT DFRC+RVR++V V Q PR+G Sbjct: 52 ENSKLTNVPSVLNGSPVTKDFRCERVRLFVNVLDFVVQIPRVG 94 >gi|547732|sp|Q03198|IPIA_TOBAC PROTEINASE INHIBITOR I-A PRECURSOR (PI-IA) (INHIBITOR OF MICROBIAL SERINE PROTEINASES MINOR ISOFORM) >gi|1076638|pir||B47487 serine proteinase inhibitor TIMPb precursor - common tobacco >gi|19915|emb|CAA78265.1| (Z12619) Pre-pro-proteinase inhibitor I [Nicotiana tabacum] >gi|398179|emb|CAA47460.1| (X67075) inhibitor of microbial serine proteinases (minor isoform) [Nicotiana tabacum] Length = 107 Frame 3 hits (HSPs): _____________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 44..67 BLOCKS BL00285B: Potato inhibitor I family prot 78..93 DOMO DM02780: POTATOINHIBITORIFAMILY 1..36 DOMO DM00902: POTATOINHIBITORIFAMILY 38..106 Entrez active site: REACTIVE BOND (BY SIMILARIT 83..84 PFAM potato_inhibit: Potato inhibitor I famil 44..107 PRINTS POTATOINHBTR1: Potato inhibitor motif I 46..59 PRINTS POTATOINHBTR2: Potato inhibitor motif II 72..83 PRINTS POTATOINHBTR3: Potato inhibitor motif II 84..94 PRODOM PD027510: IPIA(1) IPIB(1) 1..42 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 44..106 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 47..58 __________________ Plus Strand HSPs: Score = 97 (34.1 bits), Expect = 0.00039, P = 0.00039 Identities = 20/43 (46%), Positives = 27/43 (62%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP L + T+L G VT D RC+RVR++V + Q P+IG Sbjct: 65 ENPKLTNVQTILNGGPVTEDLRCNRVRLFVNVLDFIVQTPQIG 107 >gi|1127128|pdb|1HYM|B Chain B, Hydrolyzed Trypsin Inhibitor (Cmti-V, Minimized Average Nmr Structure) Length = 24 Frame 3 hits (HSPs): __________________________________________________ __________________________________________________ Database sequence: | | | 24 0 20 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.00050, P = 0.00050 Identities = 16/24 (66%), Positives = 19/24 (79%), Frame = +3 Query: 60 DFRCDRVRVWVTKHGIVYQAPRIG 131 DFRC+RVR+WV K G+V PRIG Sbjct: 1 DFRCNRVRIWVNKRGLVVSPPRIG 24 >gi|6730431|pdb|1DWM|A Chain A, Solution Structure Of Linum Usitatissinum Trypsin Inhibitor (Luti) Length = 70 Frame 3 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | | 70 0 20 40 60 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.00050, P = 0.00050 Identities = 21/41 (51%), Positives = 25/41 (60%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN V A + +GS +T DFRCDRV V V HG+V P I Sbjct: 29 ENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSVPHI 69 >gi|10178197|dbj|BAB11621.1| (AB016875) gene_id:K9D7.8~unknown protein [Arabidopsis thaliana] Length = 72 Frame 3 hits (HSPs): ______________________________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 Plus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.00050, P = 0.00050 Identities = 21/42 (50%), Positives = 25/42 (59%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP + A +L G++V F C RV VWV GIV Q P IG Sbjct: 31 ENPKMKAVIILDGTVVPEIFICSRVYVWVNDCGIVVQIPIIG 72 >gi|68798|pir||TIPO1A chymotrypsin inhibitor I chain A - potato Length = 70 Frame 3 hits (HSPs): ______________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 70 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 10..21 __________________ Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 0.0073, P = 0.0073 Identities = 19/42 (45%), Positives = 28/42 (66%), Frame = +3 Query: 6 ENPLV-DANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 +N L+ + + +L GS VT DFRC+RVR++ G V Q PR+ Sbjct: 28 QNSLISNVHILLNGSPVTMDFRCNRVRLFDDILGSVVQIPRV 69 >gi|124126|sp|P01052|ICIA_SOLTU CHYMOTRYPSIN INHIBITOR I, A, B AND C SUBUNITS Length = 71 Frame 3 hits (HSPs): ______________________________ Annotated Domains: ______________________________________________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 8..31 BLOCKS BL00285B: Potato inhibitor I family prot 42..57 Entrez active site: REACTIVE BOND. 47..48 PFAM potato_inhibit: Potato inhibitor I famil 8..71 PRINTS POTATOINHBTR1: Potato inhibitor motif I 10..23 PRINTS POTATOINHBTR2: Potato inhibitor motif II 36..47 PRINTS POTATOINHBTR3: Potato inhibitor motif II 48..58 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 8..69 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 11..22 __________________ Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 0.0073, P = 0.0073 Identities = 19/42 (45%), Positives = 28/42 (66%), Frame = +3 Query: 6 ENPLV-DANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 +N L+ + + +L GS VT DFRC+RVR++ G V Q PR+ Sbjct: 29 QNSLISNVHILLNGSPVTMDFRCNRVRLFDDILGSVVQIPRV 70 >gi|169491|gb|AAA69780.1| (L06137) proteinase inhibitor I [Solanum tuberosum] Length = 107 Frame 3 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 Plus Strand HSPs: Score = 85 (29.9 bits), Expect = 0.0073, P = 0.0073 Identities = 19/42 (45%), Positives = 27/42 (64%), Frame = +3 Query: 6 ENPLVD-ANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN L++ +L GS VT D+RC+RVR++ G V Q PR+ Sbjct: 65 ENSLINNVQILLNGSPVTMDYRCNRVRLFDNILGSVVQIPRV 106 >gi|124130|sp|P08454|ICID_SOLTU WOUND-INDUCED PROTEINASE INHIBITOR I PRECURSOR (CHYMOTRYPSIN INHIBITOR I, D SUBUNIT) >gi|294283|gb|AAA69781.1| (L06606) proteinase inhibitor I [Solanum tuberosum] Length = 107 Frame 3 hits (HSPs): _____________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 44..67 BLOCKS BL00285B: Potato inhibitor I family prot 78..93 Entrez active site: REACTIVE BOND. 83..84 PFAM potato_inhibit: Potato inhibitor I famil 44..107 PRINTS POTATOINHBTR1: Potato inhibitor motif I 46..59 PRINTS POTATOINHBTR2: Potato inhibitor motif II 72..83 PRINTS POTATOINHBTR3: Potato inhibitor motif II 84..94 PRODOM PD010350: ICI1(3) ICID(1) Q07459(1) 1..42 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 44..105 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 47..58 __________________ Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 0.0094, P = 0.0093 Identities = 19/42 (45%), Positives = 27/42 (64%), Frame = +3 Query: 6 ENPLV-DANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN L+ + +L GS VT D+RC+RVR++ G V Q PR+ Sbjct: 65 ENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVVQIPRV 106 >gi|169542|gb|AAA72133.1| (L06985) proteinase inhibitor I [Solanum tuberosum] Length = 106 Frame 3 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | | | 106 0 20 40 60 80 100 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 0.0094, P = 0.0093 Identities = 19/42 (45%), Positives = 27/42 (64%), Frame = +3 Query: 6 ENPLVD-ANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN L++ +L GS VT D+RC+RVR++ G V Q PR+ Sbjct: 64 ENSLINNVQILLNGSPVTMDYRCNRVRLFDNILGDVVQIPRV 105 >gi|225840|prf||1314299A proteinase inhibitor I [Solanum tuberosum] Length = 107 Frame 3 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 0.0094, P = 0.0093 Identities = 19/42 (45%), Positives = 27/42 (64%), Frame = +3 Query: 6 ENPLV-DANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN L+ + +L GS VT D+RC+RVR++ G V Q PR+ Sbjct: 65 ENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVVQIPRV 106 >gi|2129998|pir||S66278 serine proteinase inhibitor - potato (fragment) >gi|930365|gb|AAC49603.1| (U30861) wound-inducible proteinase inhibitor I [Solanum tuberosum] Length = 101 Frame 3 hits (HSPs): ______________________ Annotated Domains: _______ __________________________________________________ Database sequence: | | | | | || 101 0 20 40 60 80 100 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 41..52 __________________ Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 0.0094, P = 0.0093 Identities = 19/42 (45%), Positives = 27/42 (64%), Frame = +3 Query: 6 ENPLV-DANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN L+ + +L GS VT D+RC+RVR++ G V Q PR+ Sbjct: 59 ENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVVQIPRV 100 >gi|3928101|gb|AAC79627.1| (AC005770) putative protease inhibitor [Arabidopsis thaliana] Length = 71 Frame 3 hits (HSPs): _______________________________ __________________________________________________ Database sequence: | | | | | 71 0 20 40 60 Plus Strand HSPs: Score = 84 (29.6 bits), Expect = 0.0094, P = 0.0093 Identities = 19/43 (44%), Positives = 24/43 (55%), Frame = +3 Query: 3 GENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 GEN ++ V G+ VT D C RVRVWV + IV + P G Sbjct: 29 GENSSLNVVVVSDGNYVTEDLSCYRVRVWVDEIRIVVRNPTAG 71 >gi|266330|sp|Q00783|ICI1_SOLTU PROTEINASE INHIBITOR I PRECURSOR >gi|7438244|pir||S26717 proteinase inhibitor I precursor - potato >gi|21559|emb|CAA78259.1| (Z12611) proteinase inhibitor I [Solanum tuberosum] Length = 107 Frame 3 hits (HSPs): _____________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 44..67 BLOCKS BL00285B: Potato inhibitor I family prot 78..93 Entrez active site: REACTIVE BOND (BY SIMILARIT 83..84 PFAM potato_inhibit: Potato inhibitor I famil 44..107 PRINTS POTATOINHBTR1: Potato inhibitor motif I 46..59 PRINTS POTATOINHBTR2: Potato inhibitor motif II 72..83 PRINTS POTATOINHBTR3: Potato inhibitor motif II 84..94 PRODOM PD010350: ICI1(3) ICID(1) Q07459(1) 1..42 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 44..106 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 47..58 __________________ Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 0.015, P = 0.015 Identities = 19/43 (44%), Positives = 26/43 (60%), Frame = +3 Query: 6 ENPLV-DANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 EN L+ + + +L GS VT D RCDRVR++ G V P +G Sbjct: 65 ENSLISNVHILLNGSPVTLDIRCDRVRLFDNILGYVVDIPVVG 107 >gi|100458|pir||S25159 proteinase inhibitor I - potato (cultivar Ilam Hardy) >gi|21528|emb|CAA47907.1| (X67675) proteinase inhibitor I [Solanum tuberosum] >gi|21530|emb|CAA48136.1| (X67950) protease inhibitor I [Solanum tuberosum] Length = 107 Frame 3 hits (HSPs): _____________________ Annotated Domains: ______ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 47..58 __________________ Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.025, P = 0.025 Identities = 18/42 (42%), Positives = 26/42 (61%), Frame = +3 Query: 6 ENPLVD-ANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN L++ +L GS V D+RC+RVR++ G V Q PR+ Sbjct: 65 ENSLINNVQILLNGSPVAMDYRCNRVRLFDNILGSVVQIPRV 106 >gi|461598|sp|P80211|ATSI_AMACA TRYPSIN/SUBTILISIN INHIBITOR (ATSI) >gi|541827|pir||S40496 serine proteinase inhibitor - love-lies-bleeding Length = 69 Frame 3 hits (HSPs): ______________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 7..30 BLOCKS BL00285B: Potato inhibitor I family prot 40..55 DOMO DM00902: POTATOINHIBITORIFAMILY 2..68 Entrez active site: REACTIVE BOND (BY SIMILARIT 45..46 PFAM potato_inhibit: Potato inhibitor I famil 7..69 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 7..67 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 10..21 __________________ Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.025, P = 0.025 Identities = 19/41 (46%), Positives = 24/41 (58%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 ENP V + + S T DFRCDRV V V G+V + PR+ Sbjct: 28 ENPNVRSIVKHERSGFTKDFRCDRVWVVVDSTGVVVRTPRV 68 >gi|6453287|emb|CAB61327.1| (AJ132473) trypsin inhibitor [Amaranthus hypochondriacus] Length = 76 Frame 3 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | | 76 0 20 40 60 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.025, P = 0.025 Identities = 19/41 (46%), Positives = 24/41 (58%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 ENP V + + S T DFRCDRV V V G+V + PR+ Sbjct: 35 ENPNVRSIVKHERSGFTKDFRCDRVWVVVDSTGVVVRTPRV 75 >gi|2129494|pir||S66650 proteinase inhibitor BWI-1 - common buckwheat >gi|1168155|gb|AAB35320.1| BWI-1=protease inhibitor/trypsin inhibitor [Fagopyrum esculentum=buckwheat plants, cv. Shatilovskaya-5, seeds, Peptide, 69 aa] Length = 69 Frame 3 hits (HSPs): _____________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 10..21 __________________ Plus Strand HSPs: Score = 79 (27.8 bits), Expect = 0.032, P = 0.031 Identities = 18/39 (46%), Positives = 23/39 (58%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAP 122 EN V A + +GS V D RCDRV V+V + G+V P Sbjct: 28 ENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDTP 66 >gi|1836152|gb|AAB46906.1| BTI-2=trypsin inhibitor isoform [Fagopyrum esculentum=buckwheat, Monch, seeds, Peptide, 69 aa] Length = 69 Frame 3 hits (HSPs): _____________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 10..21 __________________ Plus Strand HSPs: Score = 79 (27.8 bits), Expect = 0.032, P = 0.031 Identities = 18/39 (46%), Positives = 23/39 (58%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAP 122 EN V A + +GS V D RCDRV V+V + G+V P Sbjct: 28 ENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDTP 66 >gi|124122|sp|P01053|ICI2_HORVU SUBTILISIN-CHYMOTRYPSIN INHIBITOR-2 (CI-2A) >gi|2144581|pir||EIBH2A subtilisin/chymotrypsin inhibitor 2A - barley >gi|18951|emb|CAA28988.1| (X05404) chymotrypsin inhibitor-2 (AA 1-84) [Hordeum vulgare] Length = 84 Frame 3 hits (HSPs): __________________ Annotated Domains: _________________________________________ __________________________________________________ Database sequence: | | | | | | 84 0 20 40 60 80 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 21..44 BLOCKS BL00285B: Potato inhibitor I family prot 54..69 DOMO DM00902: POTATOINHIBITORIFAMILY 15..82 Entrez active site: REACTIVE BOND. 60..61 PFAM potato_inhibit: Potato inhibitor I famil 21..83 PRINTS POTATOINHBTR1: Potato inhibitor motif I 23..36 PRINTS POTATOINHBTR2: Potato inhibitor motif II 48..59 PRINTS POTATOINHBTR3: Potato inhibitor motif II 60..70 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 21..82 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 25..36 __________________ Plus Strand HSPs: Score = 78 (27.5 bits), Expect = 0.041, P = 0.040 Identities = 15/30 (50%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V K + Q PR+G Sbjct: 55 GTIVTMEYRIDRVRLFVDKLDNIAQVPRVG 84 >gi|443451|pdb|3CI2| Chymotrypsin Inhibitor 2 (Serine Proteinase Inhibitor 2) (Nmr, 20 Structures) Length = 66 Frame 3 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | 66 0 20 40 60 Plus Strand HSPs: Score = 78 (27.5 bits), Expect = 0.041, P = 0.040 Identities = 15/30 (50%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V K + Q PR+G Sbjct: 37 GTIVTMEYRIDRVRLFVDKLDNIAQVPRVG 66 >gi|494714|pdb|1YPA|I Chain I, Chymotrypsin Inhibitor 2 (Ci2) Mutant With Ser 31 Replaced By Ala, Glu 33 Replaced By Ala, And Glu 34 Replaced By Ala (S31a,E33a,E34a) Length = 64 Frame 3 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 64 0 20 40 60 Plus Strand HSPs: Score = 78 (27.5 bits), Expect = 0.041, P = 0.040 Identities = 15/30 (50%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V K + Q PR+G Sbjct: 35 GTIVTMEYRIDRVRLFVDKLDNIAQVPRVG 64 >gi|494715|pdb|1YPB|I Chain I, Chymotrypsin Inhibitor 2 (Ci2) Mutant With Ser 31 Replaced By Gly, Glu 33 Replaced By Ala, And Glu 34 Replaced By Ala (S31g,E33a,E34a) Length = 64 Frame 3 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 64 0 20 40 60 Plus Strand HSPs: Score = 78 (27.5 bits), Expect = 0.041, P = 0.040 Identities = 15/30 (50%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V K + Q PR+G Sbjct: 35 GTIVTMEYRIDRVRLFVDKLDNIAQVPRVG 64 >gi|494716|pdb|1YPC|I Chain I, Chymotrypsin Inhibitor 2 (Ci2) Mutant With Glu 33 Replaced By Ala And Glu 34 Replaced By Ala (E33a,E34a) Length = 64 Frame 3 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 64 0 20 40 60 Plus Strand HSPs: Score = 78 (27.5 bits), Expect = 0.041, P = 0.040 Identities = 15/30 (50%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V K + Q PR+G Sbjct: 35 GTIVTMEYRIDRVRLFVDKLDNIAQVPRVG 64 >gi|2118425|pir||S61830 subtilisin/chymotrypsin inhibitor - maize >gi|475253|emb|CAA55588.1| (X78988) proteinase inhibitor [Zea mays] >gi|475922|emb|CAA49593.1| (X69972) proteinase inhibitor [Zea mays] >gi|559538|emb|CAA57677.1| (X82187) substilin /chymotrypsin-like inhibitor [Zea mays] Length = 73 Frame 3 hits (HSPs): ___________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 73 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 17..28 __________________ Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.052, P = 0.050 Identities = 19/42 (45%), Positives = 26/42 (61%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 + P D + GS+VTAD+R +RVR++V IV Q P IG Sbjct: 35 DKPDADIVVLPVGSVVTADYRPNRVRIFVD---IVAQTPHIG 73 >gi|224447|prf||1105220A inhibitor,subtilisin [Vicia faba] Length = 62 Frame 3 hits (HSPs): __________________________________ __________________________________________________ Database sequence: | | | | | 62 0 20 40 60 Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.066, P = 0.064 Identities = 17/42 (40%), Positives = 25/42 (59%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 E P + V +GS VTAD++ RVR++V + V +A IG Sbjct: 21 EKPEAEIQVVPQGSFVTADYKFQRVRLYVDESNKVVRAAPIG 62 >gi|493947|pdb|1COA|I Chain I, Chymotrypsin Inhibitor 2 (Ci2) Mutant With Ile 76 Replaced By Val (I76v) Length = 64 Frame 3 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 64 0 20 40 60 Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.066, P = 0.064 Identities = 15/30 (50%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V K V + PR+G Sbjct: 35 GTIVTMEYRIDRVRLFVDKLDNVAEVPRVG 64 >gi|124123|sp|P08626|ICI3_HORVU SUBTILISIN-CHYMOTRYPSIN INHIBITOR-2 (CI-2B) >gi|82384|pir||B29537 chymotrypsin inhibitor 2B - barley (fragment) >gi|18953|emb|CAA28989.1| (X05405) chymotrypsin inhibitor (AA 1-72) [Hordeum vulgare] Length = 72 Frame 3 hits (HSPs): _____________________ Annotated Domains: ____________________________________________ __________________________________________________ Database sequence: | | | | | 72 0 20 40 60 __________________ Annotated Domains: Entrez active site: REACTIVE BOND. 48..49 PFAM potato_inhibit: Potato inhibitor I famil 10..72 __________________ Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.084, P = 0.081 Identities = 14/30 (46%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V + + Q PR+G Sbjct: 43 GTIVTMEYRIDRVRLFVDRLDNIAQVPRVG 72 >gi|100574|pir||S18818 chymotrypsin inhibitor 2 - barley >gi|19005|emb|CAA40350.1| (X57035) chymotrypsin inhibitor 2 [Hordeum vulgare] >gi|228413|prf||1803525A chymotrypsin inhibitor 2 [Hordeum vulgare] Length = 84 Frame 3 hits (HSPs): __________________ Annotated Domains: _______ __________________________________________________ Database sequence: | | | | | | 84 0 20 40 60 80 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 25..36 __________________ Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.084, P = 0.081 Identities = 14/30 (46%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V + + Q PR+G Sbjct: 55 GTIVTMEYRIDRVRLFVDRLDNIAQVPRVG 84 >gi|544883|gb|AAB29664.1| ATI=trypsin inhibitor [Amaranthus hypochondriacus=amaranth, line 53, seeds, Peptide, 69 aa] Length = 69 Frame 3 hits (HSPs): ______________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 10..21 __________________ Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.084, P = 0.081 Identities = 19/41 (46%), Positives = 23/41 (56%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 ENP V + S T DFRCDRV V V G+V + PR+ Sbjct: 28 ENPNVRDIVKHERSGFTKDFRCDRVWVVVDYTGVVVRTPRV 68 >gi|640139|pdb|2CI2|I Chain I, Chymotrypsin Inhibitor 2 (CI-2) >gi|640318|pdb|2SNI|I Chain I, Subtilisin Novo (E.C.3.4.21.14) Complex With Chymotrypsin Inhibitor 2 (CI-2) Length = 83 Frame 3 hits (HSPs): ___________________ __________________________________________________ Database sequence: | | | | | | 83 0 20 40 60 80 Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.084, P = 0.081 Identities = 14/30 (46%), Positives = 22/30 (73%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 G+IVT ++R DRVR++V K + + PR+G Sbjct: 54 GTIVTMEYRIDRVRLFVDKLDNIAEVPRVG 83 >gi|1836151|gb|AAB46905.1| BTI-1=7.634 kda trypsin inhibitor isoform [Fagopyrum esculentum=buckwheat, Monch, seeds, Peptide, 69 aa] Length = 69 Frame 3 hits (HSPs): _____________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 69 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 10..21 __________________ Plus Strand HSPs: Score = 73 (25.7 bits), Expect = 0.14, P = 0.13 Identities = 17/39 (43%), Positives = 22/39 (56%), Frame = +3 Query: 6 ENPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAP 122 EN V A + +GS V D CDRV V+V + G+V P Sbjct: 28 ENEDVRAIVLPEGSAVPRDLLCDRVDVFVDERGVVVDTP 66 >gi|1083950|pir||JC2380 subtilisin inhibitor CLSI-I - Canavalia lineata >gi|913680|gb|AAB32689.1| subtilisin inhibitor, CLSI-I [Canavalia lineata, seeds, Peptide, 65 aa] >gi|1092515|prf||2024227A subtilisin inhibitor [Canavalia lineata] Length = 65 Frame 3 hits (HSPs): ______________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 65 0 20 40 60 __________________ Annotated Domains: DOMO DM00902: POTATOINHIBITORIFAMILY 1..65 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 7..18 __________________ Plus Strand HSPs: Score = 71 (25.0 bits), Expect = 0.22, P = 0.20 Identities = 16/38 (42%), Positives = 23/38 (60%), Frame = +3 Query: 18 VDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 V+ V GS VTAD++ RVR++V + V + P IG Sbjct: 28 VEIQVVPPGSFVTADYKPQRVRLYVDESNKVTRTPGIG 65 >gi|124119|sp|P05118|ICI1_LYCES WOUND-INDUCED PROTEINASE INHIBITOR I PRECURSOR >gi|82105|pir||A24048 proteinase inhibitor I precursor - tomato >gi|170518|gb|AAA34199.1| (K03290) wound-induced proteinase inhibitor I prepropeptide [Lycopersicon esculentum] >gi|170520|gb|AAA34200.1| (M13938) proteinase inhibitor I [Lycopersicon esculentum] Length = 111 Frame 3 hits (HSPs): ___________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 111 0 50 100 __________________ Annotated Domains: BLOCKS BL00285A: Potato inhibitor I family prot 48..71 BLOCKS BL00285B: Potato inhibitor I family prot 82..97 DOMO DM02780: POTATOINHIBITORIFAMILY 1..40 DOMO DM00902: POTATOINHIBITORIFAMILY 42..110 Entrez active site: REACTIVE BOND (BY SIMILARIT 87..88 PFAM potato_inhibit: Potato inhibitor I famil 48..111 PRINTS POTATOINHBTR1: Potato inhibitor motif I 50..63 PRINTS POTATOINHBTR2: Potato inhibitor motif II 76..87 PRINTS POTATOINHBTR3: Potato inhibitor motif II 88..98 PRODOM PD010350: ICI1(3) ICID(1) Q07459(1) 1..41 PRODOM PD002604: ICI1(4) ICIA(2) ICIC(2) 48..109 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 51..62 __________________ Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.33, P = 0.28 Identities = 17/40 (42%), Positives = 24/40 (60%), Frame = +3 Query: 6 ENP-LVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAP 122 ENP + + +L GS +T D+ CDRVR++ G V Q P Sbjct: 69 ENPSITNIPILLSGSPITLDYLCDRVRLFDNILGFVVQMP 108 >gi|1361981|pir||S55592 trypsin inhibitor - winter squash >gi|887420|emb|CAA57307.1| (X81647) Pumpkin fruit trypsin inhibitor [Cucurbita maxima] Length = 67 Frame 3 hits (HSPs): _________________________________ Annotated Domains: _________ __________________________________________________ Database sequence: | | | | | 67 0 20 40 60 __________________ Annotated Domains: PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 7..18 __________________ Plus Strand HSPs: Score = 69 (24.3 bits), Expect = 0.37, P = 0.31 Identities = 18/43 (41%), Positives = 25/43 (58%), Frame = +3 Query: 6 ENPLVDANTVLKG-SIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 ENP +D + +G + T D+R +RVRV+ G V PRIG Sbjct: 25 ENPSLDVILMPRGQNWATKDYRPNRVRVFNDDSGKVNSIPRIG 67 >gi|7438245|pir||T06181 subtilisin-chymotrypsin inhibitor 2 - barley >gi|1617121|emb|CAA69915.1| (Y08625) subtilisin-chymotrypsin inhibitor 2 [Hordeum vulgare] Length = 68 Frame 3 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | | 68 0 20 40 60 Plus Strand HSPs: Score = 68 (23.9 bits), Expect = 0.49, P = 0.39 Identities = 16/30 (53%), Positives = 20/30 (66%), Frame = +3 Query: 42 GSIVTADFRCDRVRVWVTKHGIVYQAPRIG 131 GSIVT + +RVRVWV K V + P+IG Sbjct: 42 GSIVTQEIDLNRVRVWVDK---VAKVPKIG 68 >gi|2118424|pir||S06251 proteinase inhibitor I precursor - potato (cv. Russet Burbank) >gi|169493|gb|AAA33816.1| (M17108) proteinase inhibitor I [Solanum tuberosum] Length = 107 Frame 3 hits (HSPs): _____________________ Annotated Domains: _________________ ______ __________________________________________________ Database sequence: | | | | | | | 107 0 20 40 60 80 100 __________________ Annotated Domains: Entrez domain: signal sequence 1..23 Entrez domain: propeptide 24..36 PROSITE POTATO_INHIBITOR: Potato inhibitor I fam 47..58 __________________ Plus Strand HSPs: Score = 74 (26.0 bits), Expect = 0.52, P = 0.41 Identities = 18/42 (42%), Positives = 26/42 (61%), Frame = +3 Query: 6 ENPLV-DANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRI 128 EN L+ + +L GS VT D+R +RVR++ G V Q PR+ Sbjct: 65 ENSLITNVQILLNGSPVTMDYRSNRVRLFDNILGDVVQIPRV 106 WARNING: HSPs involving 20 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.97 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.359 0.167 0.578 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.369 0.165 0.644 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.355 0.161 0.568 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.382 0.179 0.691 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.345 0.153 0.536 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.355 0.156 0.550 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 128 128 10. 72 3 12 22 0.11 33 29 0.12 35 +2 0 128 128 10. 72 3 12 22 0.11 33 29 0.12 35 +1 0 129 129 10. 72 3 12 22 0.11 33 29 0.12 35 -1 0 129 129 10. 72 3 12 22 0.11 33 29 0.12 35 -2 0 128 128 10. 72 3 12 22 0.11 33 29 0.12 35 -3 0 128 128 10. 72 3 12 22 0.11 33 29 0.12 35 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 70 No. of states in DFA: 592 (58 KB) Total size of DFA: 174 KB (192 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 128.03u 1.15s 129.18t Elapsed: 00:00:41 Total cpu time: 128.07u 1.17s 129.24t Elapsed: 00:00:42 Start: Fri Jan 18 15:59:03 2002 End: Fri Jan 18 15:59:45 2002 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000