WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= SSH1E08.SEQ(1>177) (156 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 505,245 sequences; 158,518,215 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 12 Sequences : less than 12 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 3584 13 |= 6310 3571 148 |============ 3980 3423 405 |================================= 2510 3018 723 |============================================================ 1580 2295 743 |============================================================= 1000 1552 549 |============================================= 631 1003 345 |============================ 398 658 200 |================ 251 458 145 |============ 158 313 89 |======= 100 224 46 |=== 63.1 178 47 |=== 39.8 131 14 |= 25.1 117 22 |= 15.8 95 21 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 74 <<<<<<<<<<<<<<<<< 10.0 74 6 |: 6.31 68 9 |: 3.98 59 4 |: 2.51 55 3 |: 1.58 52 3 |: 1.00 49 4 |: 0.63 45 1 |: 0.40 44 0 | 0.25 44 2 |: 0.16 42 5 |: 0.10 37 0 | 0.063 37 1 |: 0.040 36 2 |: 0.025 34 1 |: 0.016 33 0 | 0.010 33 2 |: 0.0063 31 1 |: 0.0040 30 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|7670042|dbj|BAA94996.1|(AB026636) serine carboxype... +3 227 2.6e-17 1 gi|7485011|pir||G71414hydroxymandelonitrile lyase (EC... +3 206 3.4e-15 1 gi|2443888|gb|AAB71481.1|(AC002294) similar to serine... +3 201 1.8e-14 1 gi|1931640|gb|AAB65475.1|(U95973) Serine carboxypepti... +3 199 2.9e-14 1 gi|115871|sp||CBP2_WHEAT_2[Segment 2 of 2] SERINE CAR... +3 154 2.9e-10 1 gi|443482|pdb|3SC2|BChain B, Serine Carboxypeptidase ... +3 154 2.9e-10 1 gi|576336|pdb|1WHT|BChain B, Serine Carboxypeptidase ... +3 154 2.9e-10 1 gi|809128|pdb|1WHS|BChain B, Serine Carboxypeptidase ... +3 154 2.9e-10 1 gi|4539658|gb|AAD22151.1|AF061282_4(AF061282) serine ... +3 158 1.5e-09 1 gi|7428205|pir||A29639carboxypeptidase D (EC 3.4.16.6... +3 154 1.9e-09 1 gi|115865|sp||CBP2_HORVU_2[Segment 2 of 2] SERINE CAR... +3 146 2.0e-09 1 gi|226039|prf||1408163BCPase II B [Hordeum vulgare va... +3 146 2.0e-09 1 gi|2493493|sp|P55747|CP21_HORVUSERINE CARBOXYPEPTIDAS... +3 151 2.2e-09 1 gi|3738327|gb|AAC63668.1|(AC005170) putative serine c... +3 154 2.3e-09 1 gi|3738328|gb|AAC63669.1|(AC005170) putative serine c... +3 153 2.4e-09 1 gi|4539657|gb|AAD22150.1|AF061282_3(AF061282) serine-... +3 153 3.1e-09 1 gi|4510391|gb|AAD21479.1|(AC007017) putative serine c... +3 151 4.5e-09 1 gi|1706082|sp|P52711|CP23_HORVUSERINE CARBOXYPEPTIDAS... +3 151 5.6e-09 1 gi|1708277|sp|P52708|HNLS_SORBIP-(S)-HYDROXYMANDELONI... +3 148 6.2e-09 1 gi|1084468|pir||S53311hydroxymandelonitrile lyase (EC... +3 148 6.2e-09 1 gi|7269962|emb|CAB79779.1|(AL161577) SERINE CARBOXYPE... +3 148 1.0e-08 1 gi|6648211|gb|AAF21209.1|AC013483_33(AC013483) putati... +3 147 1.2e-08 1 gi|7428204|pir||T05701carboxypeptidase D (EC 3.4.16.6... +3 146 1.7e-08 1 gi|2493494|sp|P55748|CP22_HORVUSERINE CARBOXYPEPTIDAS... +3 145 1.9e-08 1 gi|6513922|gb|AAF14826.1|AC011664_8(AC011664) putativ... +3 140 7.5e-08 1 gi|2980785|emb|CAA18212.1|(AL022198) SERINE CARBOXYPE... +3 134 2.8e-07 1 gi|7573330|emb|CAB87800.1|(AL163818) serin carboxypep... +3 135 2.9e-07 1 gi|6598648|gb|AAF18665.1|AC007017_1(AC007017) putativ... +3 127 1.7e-06 1 gi|1171696|sp|P42661|NF31_NAEFOVIRULENCE-RELATED PROT... +3 102 0.00097 1 gi|4006820|gb|AAC95162.1|(AC005970) putative serine c... +3 97 0.0034 1 gi|4678931|emb|CAB41322.1|(AL049711) serine-type carb... +3 95 0.0058 1 gi|7523661|gb|AAF63101.1|AC006423_2(AC006423) Putativ... +3 93 0.0089 1 gi|7271957|gb|AAF44708.1|AF242849_1(AF242849) wound-i... +3 93 0.0094 1 gi|4678929|emb|CAB41320.1|(AL049711) serine-type carb... +3 90 0.019 1 gi|6598856|gb|AAF18710.1|AC010556_6(AC010556) putativ... +3 88 0.027 1 gi|2459435|gb|AAB80670.1|(AC002332) putative serine c... +3 87 0.037 1 gi|225815|prf||1314177BCPase I B [Hordeum vulgare var... +3 77 0.053 1 gi|584892|sp|P37890|CBP1_ORYSASERINE CARBOXYPEPTIDASE... +3 83 0.11 1 gi|6598853|gb|AAF18707.1|AC010556_3(AC010556) putativ... +3 82 0.12 1 gi|5748498|emb|CAB53091.1|(AL079349) SERINE CARBOXYPE... +3 82 0.12 1 gi|4678930|emb|CAB41321.1|(AL049711) serine-type carb... +3 82 0.13 1 gi|6598855|gb|AAF18709.1|AC010556_5(AC010556) putativ... +3 81 0.15 1 gi|7579025|gb|AAF64227.1|AF248647_1(AF248647) glucose... +3 81 0.15 1 gi|6598852|gb|AAF18706.1|AC010556_2(AC010556) putativ... +3 80 0.18 1 gi|6598854|gb|AAF18708.1|AC010556_4(AC010556) putativ... +3 77 0.34 1 gi|167012|gb|AAA32940.1|(J03897) carboxypeptidase I p... +3 75 0.47 1 gi|3169171|gb|AAC17814.1|(AC004401) putative serine c... +3 75 0.49 1 gi|6119535|gb|AAF04179.1|AC011560_20(AC011560) putati... +3 75 0.50 1 gi|2815493|sp|P07519|CBP1_HORVUSERINE CARBOXYPEPTIDAS... +3 75 0.56 1 gi|4101707|gb|AAD01265.1|(AF006080) glucose acyltrans... +3 73 0.70 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|7670042 |__________________________________________________ gi|7485011 |__________________________________________________ gi|2443888 |__________________________________________________ gi|1931640 |__________________________________________________ gi|115871 |__________________________________________________ gi|443482 |__________________________________________________ gi|576336 |__________________________________________________ gi|809128 |__________________________________________________ gi|4539658 |__________________________________________________ gi|7428205 |__________________________________________________ gi|115865 |__________________________________________________ gi|226039 |__________________________________________________ gi|2493493 |__________________________________________________ gi|3738327 |__________________________________________________ gi|3738328 |__________________________________________________ gi|4539657 |__________________________________________________ gi|4510391 |__________________________________________________ gi|1706082 |__________________________________________________ gi|1708277 | _________________________________________________ gi|1084468 | _________________________________________________ gi|7269962 |__________________________________________________ gi|6648211 |__________________________________________________ gi|7428204 |__________________________________________________ gi|2493494 |__________________________________________________ gi|6513922 |__________________________________________________ gi|2980785 |__________________________________________________ gi|7573330 |__________________________________________________ gi|6598648 |__________________________________________________ gi|1171696 |__________________________________________________ gi|4006820 |__________________________________________________ gi|4678931 |__________________________________________________ gi|7523661 |_______________________________________ gi|7271957 |__________________________________________________ gi|4678929 |__________________________________________________ gi|6598856 |__________________________________________________ gi|2459435 | __________________________________________ gi|225815 |__________________________________________________ gi|584892 | _____________________________________________ gi|6598853 |__________________________________________________ gi|5748498 |__________________________________________________ gi|4678930 | _________________________________________________ gi|6598855 |__________________________________________________ gi|7579025 |__________________________________________________ gi|6598852 |__________________________________________________ gi|6598854 |__________________________________________________ gi|167012 |__________________________________________________ gi|3169171 |__________________________________________________ gi|6119535 |__________________________________________________ gi|2815493 |__________________________________________________ gi|4101707 | _________________________________ __________________________________________________ Query sequence: | | | | 52 0 20 40
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 24 database sequences were not reported due to the limiting value of parameter V = 50. >gi|7670042|dbj|BAA94996.1| (AB026636) serine carboxypeptidase II-like protein [Arabidopsis thaliana] Length = 472 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 472 0 150 300 450 Plus Strand HSPs: Score = 227 (79.9 bits), Expect = 2.6e-17, P = 2.6e-17 Identities = 38/50 (76%), Positives = 46/50 (92%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP Y+KLIK GLKIW+YSGDADGR+PVIG+RYCVEALG+ +KS WR+W Sbjct: 369 SMLPTYSKLIKAGLKIWVYSGDADGRVPVIGSRYCVEALGISVKSEWRSW 418 >gi|7485011|pir||G71414 hydroxymandelonitrile lyase (EC 4.1.2.11) chain A - Arabidopsis thaliana >gi|2244867|emb|CAB10289.1| (Z97337) hydroxynitrile lyase like protein [Arabidopsis thaliana] >gi|7268256|emb|CAB78552.1| (AL161540) hydroxynitrile lyase like protein [Arabidopsis thaliana] Length = 407 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 407 0 150 300 Plus Strand HSPs: Score = 206 (72.5 bits), Expect = 3.4e-15, P = 3.4e-15 Identities = 35/50 (70%), Positives = 42/50 (84%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 SVLP+Y KLI GGL+IW+YSGD DG IPV+GTRY + ALGLP+K+ WR W Sbjct: 301 SVLPIYQKLIAGGLRIWVYSGDTDGCIPVLGTRYSLNALGLPIKTAWRPW 350 >gi|2443888|gb|AAB71481.1| (AC002294) similar to serine carboxypeptidases [Arabidopsis thaliana] Length = 470 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 470 0 150 300 450 Plus Strand HSPs: Score = 201 (70.8 bits), Expect = 1.8e-14, P = 1.8e-14 Identities = 31/50 (62%), Positives = 40/50 (80%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 SVLP+Y KLI GG ++W+YSGD DGR+PV+ TRYC+ L LP+K+ WR W Sbjct: 374 SVLPIYKKLIAGGFRVWVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPW 423 >gi|1931640|gb|AAB65475.1| (U95973) Serine carboxypeptidase isolog [Arabidopsis thaliana] Length = 465 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 465 0 150 300 450 Plus Strand HSPs: Score = 199 (70.1 bits), Expect = 2.9e-14, P = 2.9e-14 Identities = 33/50 (66%), Positives = 41/50 (82%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 SVLP+Y KLI GGL+IW+YSGD DGR+PV+ TRY + AL LP+K+ WR W Sbjct: 363 SVLPIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLNALELPIKTAWRPW 412 >gi|115871|sp||CBP2_WHEAT_2 [Segment 2 of 2] SERINE CARBOXYPEPTIDASE II CHAINS A AND B (CARBOXYPEPTIDASE D) (CPDW-II) (CP-WII) >gi|82623|pir||B29639 serine-type carboxypeptidase (EC 3.4.16.1) II B chain - wheat >gi|1421108|pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature >gi|1421113|pdb|1BCS|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Chymostatin, And Arginine At 100 Degrees Kelvin >gi|226041|prf||1408164B CPase II B [Triticum aestivum] Length = 160 Frame 3 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | 160 0 50 100 150 Plus Strand HSPs: Score = 154 (54.2 bits), Expect = 2.9e-10, P = 2.9e-10 Identities = 25/50 (50%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGLP + W W Sbjct: 54 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPW 103 >gi|443482|pdb|3SC2|B Chain B, Serine Carboxypeptidase Ii (E.C.3.4.16.1) (Cpdw-Ii) Length = 152 Frame 3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | || 152 0 50 100 150 Plus Strand HSPs: Score = 154 (54.2 bits), Expect = 2.9e-10, P = 2.9e-10 Identities = 25/50 (50%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGLP + W W Sbjct: 52 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPW 101 >gi|576336|pdb|1WHT|B Chain B, Serine Carboxypeptidase Ii (E.C.3.4.16.1) Complexed With L-Benzylsuccinate Length = 153 Frame 3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | 153 0 50 100 150 Plus Strand HSPs: Score = 154 (54.2 bits), Expect = 2.9e-10, P = 2.9e-10 Identities = 25/50 (50%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGLP + W W Sbjct: 52 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPW 101 >gi|809128|pdb|1WHS|B Chain B, Serine Carboxypeptidase Ii (E.C.3.4.16.1) (Native Form) Length = 153 Frame 3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | 153 0 50 100 150 Plus Strand HSPs: Score = 154 (54.2 bits), Expect = 2.9e-10, P = 2.9e-10 Identities = 25/50 (50%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGLP + W W Sbjct: 52 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPW 101 >gi|4539658|gb|AAD22151.1|AF061282_4 (AF061282) serine carboxypeptidase-like protein [Sorghum bicolor] Length = 657 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 657 0 150 300 450 600 Plus Strand HSPs: Score = 158 (55.6 bits), Expect = 1.5e-09, P = 1.5e-09 Identities = 26/50 (52%), Positives = 37/50 (74%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GLK+W++SGD D +P+ GTR + ALGLP+K+ W W Sbjct: 539 SMLPIYKELIGAGLKVWVFSGDTDTAVPLSGTRRSLAALGLPVKTSWYPW 588 >gi|7428205|pir||A29639 carboxypeptidase D (EC 3.4.16.6) - wheat Length = 423 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 423 0 150 300 Plus Strand HSPs: Score = 154 (54.2 bits), Expect = 1.9e-09, P = 1.9e-09 Identities = 25/50 (50%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGLP + W W Sbjct: 317 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPW 366 >gi|115865|sp||CBP2_HORVU_2 [Segment 2 of 2] SERINE CARBOXYPEPTIDASE II CHAINS A AND B (CARBOXYPEPTIDASE D) (CP-MII) >gi|82420|pir||B29640 serine-type carboxypeptidase (EC 3.4.16.1) II B chain - barley Length = 159 Frame 3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | 159 0 50 100 150 Plus Strand HSPs: Score = 146 (51.4 bits), Expect = 2.0e-09, P = 2.0e-09 Identities = 24/50 (48%), Positives = 34/50 (68%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGL + W W Sbjct: 54 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPW 103 >gi|226039|prf||1408163B CPase II B [Hordeum vulgare var. distichum] Length = 159 Frame 3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | 159 0 50 100 150 Plus Strand HSPs: Score = 146 (51.4 bits), Expect = 2.0e-09, P = 2.0e-09 Identities = 24/50 (48%), Positives = 34/50 (68%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGL + W W Sbjct: 54 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPW 103 >gi|2493493|sp|P55747|CP21_HORVU SERINE CARBOXYPEPTIDASE II-1 PRECURSOR (CP-MII.1) >gi|619352|gb|AAB31591.1| CP-MII.1=serine carboxypeptidase [Hordeum vulgare=barley, cv. Alexis, aleurone, Peptide, 324 aa] >gi|6093206|emb|CAB58992.1| (X78876) serine carboxypeptidase II-1 [Hordeum vulgare] Length = 324 Frame 3 hits (HSPs): ________ Annotated Domains: _______________________________________________ __________________________________________________ Database sequence: | | | | | | | | 324 0 50 100 150 200 250 300 __________________ Annotated Domains: Entrez active site: BY SIMILARITY. 41 Entrez active site: BY SIMILARITY. 239 Entrez active site: BY SIMILARITY. 291 Entrez glycosylation site: POTENTIAL. 10 Entrez glycosylation site: POTENTIAL. 191 PFAM serine_carbpept: Serine carboxypeptidase 8..311 PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 281..298 PROSITE CARBOXYPEPT_SER_SER: Serine carboxypepti 37..44 __________________ Plus Strand HSPs: Score = 151 (53.2 bits), Expect = 2.2e-09, P = 2.2e-09 Identities = 24/50 (48%), Positives = 36/50 (72%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI G++IW++SGDAD +P+ TRY ++AL LP + W W Sbjct: 216 SMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPW 265 >gi|3738327|gb|AAC63668.1| (AC005170) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 474 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 474 0 150 300 450 Plus Strand HSPs: Score = 154 (54.2 bits), Expect = 2.3e-09, P = 2.3e-09 Identities = 27/50 (54%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW+YSGD D IPV TRY + L L +K+RW W Sbjct: 372 SMLPIYKELIAAGLRIWVYSGDTDSVIPVTATRYSLGKLNLRVKTRWYPW 421 >gi|3738328|gb|AAC63669.1| (AC005170) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 425 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 425 0 150 300 Plus Strand HSPs: Score = 153 (53.9 bits), Expect = 2.4e-09, P = 2.4e-09 Identities = 25/51 (49%), Positives = 35/51 (68%), Frame = +3 Query: 3 FSVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 FS+LP+Y +L GL+IW++SGD D +PV GTR + L LP+K+ W W Sbjct: 322 FSMLPIYKELTAAGLRIWVFSGDTDAVVPVTGTRLALSKLNLPVKTPWYPW 372 >gi|4539657|gb|AAD22150.1|AF061282_3 (AF061282) serine-type carboxypeptidase [Sorghum bicolor] Length = 483 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 483 0 150 300 450 Plus Strand HSPs: Score = 153 (53.9 bits), Expect = 3.1e-09, P = 3.1e-09 Identities = 25/50 (50%), Positives = 37/50 (74%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI+GGLK+W++SGD D +P+ TR + AL LP+K+ W W Sbjct: 378 SMLPIYRELIEGGLKVWVFSGDTDTVVPLSATRRSLAALSLPVKTSWYPW 427 >gi|4510391|gb|AAD21479.1| (AC007017) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 452 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | || 452 0 150 300 450 Plus Strand HSPs: Score = 151 (53.2 bits), Expect = 4.5e-09, P = 4.5e-09 Identities = 25/50 (50%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ GTRY + AL L S+W W Sbjct: 352 SMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPW 401 >gi|1706082|sp|P52711|CP23_HORVU SERINE CARBOXYPEPTIDASE II-3 PRECURSOR (CP-MII.3) >gi|629787|pir||S44191 carboxypeptidase D (EC 3.4.16.6) II-3 precursor - barley >gi|474392|emb|CAA55478.1| (X78877) serine carboxylase II-3 [Hordeum vulgare] >gi|619350|gb|AAB31589.1| CP-MII.3=serine carboxypeptidase [Hordeum vulgare=barley, cv. Alexis, aleurone, Peptide, 516 aa] Length = 516 Frame 3 hits (HSPs): _____ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 516 0 150 300 450 __________________ Annotated Domains: BLOCKS BL00131A: Serine carboxypeptidases, seri 97..112 BLOCKS BL00131B: Serine carboxypeptidases, seri 132..155 BLOCKS BL00131C: Serine carboxypeptidases, seri 169..192 BLOCKS BL00131D: Serine carboxypeptidases, seri 230..243 BLOCKS BL00131E: Serine carboxypeptidases, seri 299..308 BLOCKS BL00131F: Serine carboxypeptidases, seri 417..442 BLOCKS BL00131G: Serine carboxypeptidases, seri 466..502 DOMO DM00460: SERINECARBOXYPEPTIDASES,SERINE 84..506 Entrez active site: BY SIMILARITY. 236 Entrez active site: BY SIMILARITY. 427 Entrez active site: BY SIMILARITY. 484 Entrez glycosylation site: POTENTIAL. 194 Entrez glycosylation site: POTENTIAL. 205 Entrez glycosylation site: POTENTIAL. 301 Entrez glycosylation site: POTENTIAL. 380 PFAM serine_carbpept: Serine carboxypeptidase 90..504 PRINTS CRBOXYPTASEC1: Carboxypeptidase C serine 169..181 PRINTS CRBOXYPTASEC2: Carboxypeptidase C serine 182..192 PRINTS CRBOXYPTASEC3: Carboxypeptidase C serine 218..243 PRINTS CRBOXYPTASEC4: Carboxypeptidase C serine 474..487 PRODOM PD139543: CP23_HORVU 1..88 PRODOM PD001189: Q94269(7) Q17679(7) CBP3(3) 90..390 PRODOM PD150336: CBP2(2) 398..497 PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 474..491 PROSITE CARBOXYPEPT_SER_SER: Serine carboxypepti 232..239 __________________ Plus Strand HSPs: Score = 151 (53.2 bits), Expect = 5.6e-09, P = 5.6e-09 Identities = 23/50 (46%), Positives = 36/50 (72%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 +VLP+ +L+K +++W+YSGD DGR+PV +R V L LP+ ++WR W Sbjct: 404 TVLPIIQELMKNSIRVWVYSGDTDGRVPVTSSRLSVNQLQLPVAAKWRPW 453 >gi|1708277|sp|P52708|HNLS_SORBI P-(S)-HYDROXYMANDELONITRILE LYASE PRECURSOR (HYDROXYNITRILE LYASE) (HNL) >gi|666089|emb|CAA58876.1| (X84057) p-(S)-hydroxymandelonitrile lyase [Sorghum bicolor] Length = 366 Frame 3 hits (HSPs): ________ Annotated Domains: _______________________________________________ __________________________________________________ Database sequence: | | | | 366 0 150 300 __________________ Annotated Domains: Entrez active site: BY SIMILARITY. 69 Entrez active site: BY SIMILARITY. 270 Entrez active site: BY SIMILARITY. 325 Entrez glycosylation site: POTENTIAL. 28 Entrez glycosylation site: POTENTIAL. 221 PFAM serine_carbpept: Serine carboxypeptidase 4..345 PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 315..332 __________________ Plus Strand HSPs: Score = 148 (52.1 bits), Expect = 6.2e-09, P = 6.2e-09 Identities = 25/49 (51%), Positives = 35/49 (71%), Frame = +3 Query: 9 VLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 +LPVY +LI+ GL++W+YSGD D +PV TR + AL LP+K+ W W Sbjct: 248 LLPVYRELIQAGLRVWVYSGDTDSVVPVSSTRRSLAALELPVKTSWYPW 296 >gi|1084468|pir||S53311 hydroxymandelonitrile lyase (EC 4.1.2.11) chain A - sorghum (fragment) Length = 366 Frame 3 hits (HSPs): ________ Annotated Domains: ____ __________________________________________________ Database sequence: | | | | 366 0 150 300 __________________ Annotated Domains: PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 315..332 __________________ Plus Strand HSPs: Score = 148 (52.1 bits), Expect = 6.2e-09, P = 6.2e-09 Identities = 25/49 (51%), Positives = 35/49 (71%), Frame = +3 Query: 9 VLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 +LPVY +LI+ GL++W+YSGD D +PV TR + AL LP+K+ W W Sbjct: 248 LLPVYRELIQAGLRVWVYSGDTDSVVPVSSTRRSLAALELPVKTSWYPW 296 >gi|7269962|emb|CAB79779.1| (AL161577) SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana] Length = 465 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 465 0 150 300 450 Plus Strand HSPs: Score = 148 (52.1 bits), Expect = 1.0e-08, P = 1.0e-08 Identities = 24/50 (48%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 ++LP+Y +L GL+IWI+SGD D +PV TR+ + L LP+K+RW W Sbjct: 363 TMLPIYKELAASGLRIWIFSGDTDSVVPVTATRFSLSHLNLPVKTRWYPW 412 >gi|6648211|gb|AAF21209.1|AC013483_33 (AC013483) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 459 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Plus Strand HSPs: Score = 147 (51.7 bits), Expect = 1.2e-08, P = 1.2e-08 Identities = 25/50 (50%), Positives = 34/50 (68%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GLKIW++SGD D +P+ TRY V+AL L + W W Sbjct: 358 SMLPIYKELITAGLKIWVFSGDTDAVVPITATRYSVDALKLATITNWYPW 407 >gi|7428204|pir||T05701 carboxypeptidase D (EC 3.4.16.6) precursor - barley >gi|1731990|emb|CAA70815.1| (Y09602) serine carboxypeptidase II, CP-MII [Hordeum vulgare] Length = 476 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 476 0 150 300 450 Plus Strand HSPs: Score = 146 (51.4 bits), Expect = 1.7e-08, P = 1.7e-08 Identities = 24/50 (48%), Positives = 34/50 (68%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+Y +LI GL+IW++SGD D +P+ TRY + ALGL + W W Sbjct: 367 SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPW 416 >gi|2493494|sp|P55748|CP22_HORVU SERINE CARBOXYPEPTIDASE II-2 PRECURSOR (CP-MII.2) >gi|619351|gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. Alexis, aleurone, Peptide, 436 aa] >gi|6102957|emb|CAB59202.1| (X78878) serine carboxylase II-2 [Hordeum vulgare] Length = 436 Frame 3 hits (HSPs): _______ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | 436 0 150 300 __________________ Annotated Domains: Entrez active site: BY SIMILARITY. 149 Entrez active site: BY SIMILARITY. 350 Entrez active site: BY SIMILARITY. 403 Entrez glycosylation site: POTENTIAL. 107 PFAM serine_carbpept: Serine carboxypeptidase 5..423 PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 393..410 PROSITE CARBOXYPEPT_SER_SER: Serine carboxypepti 145..152 __________________ Plus Strand HSPs: Score = 145 (51.0 bits), Expect = 1.9e-08, P = 1.9e-08 Identities = 26/50 (52%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 SVL +Y +LI+ GL+IW++SGD D IPV TRY ++AL LP + W W Sbjct: 327 SVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTVTPWHAW 376 >gi|6513922|gb|AAF14826.1|AC011664_8 (AC011664) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 473 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 473 0 150 300 450 Plus Strand HSPs: Score = 140 (49.3 bits), Expect = 7.5e-08, P = 7.5e-08 Identities = 22/50 (44%), Positives = 33/50 (66%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 +VLP+Y ++I GG+++W++SGD D +PV TRY + L L K W W Sbjct: 372 TVLPIYREMIAGGIRVWVFSGDVDSVVPVTATRYSLARLSLSTKLPWYPW 421 >gi|2980785|emb|CAA18212.1| (AL022198) SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana] >gi|7269982|emb|CAB79799.1| (AL161577) SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana] Length = 425 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 425 0 150 300 Plus Strand HSPs: Score = 134 (47.2 bits), Expect = 2.8e-07, P = 2.8e-07 Identities = 25/50 (50%), Positives = 34/50 (68%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 SVL +Y +LI GL+IW++SGDAD +PV TRY ++AL L S + W Sbjct: 309 SVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPW 358 >gi|7573330|emb|CAB87800.1| (AL163818) serin carboxypeptidase-like protein [Arabidopsis thaliana] Length = 502 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 502 0 150 300 450 Plus Strand HSPs: Score = 135 (47.5 bits), Expect = 2.9e-07, P = 2.9e-07 Identities = 20/50 (40%), Positives = 35/50 (70%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 +V+P+ +L+ G+++W++SGD DGRIPV T+Y ++ + L K+ W W Sbjct: 397 TVIPLIKELMGQGVRVWVFSGDTDGRIPVTSTKYSLKKMNLTAKTAWHPW 446 >gi|6598648|gb|AAF18665.1|AC007017_1 (AC007017) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 447 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 447 0 150 300 Plus Strand HSPs: Score = 127 (44.7 bits), Expect = 1.7e-06, P = 1.7e-06 Identities = 21/50 (42%), Positives = 33/50 (66%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+ L++ L+IWI+SGD+D +P+ GTR+ + A+ L RW W Sbjct: 341 SMLPIIKNLLQAHLRIWIFSGDSDAVLPLSGTRHSINAMKLKSSKRWYPW 390 >gi|1171696|sp|P42661|NF31_NAEFO VIRULENCE-RELATED PROTEIN NF314 >gi|285409|pir||A43828 probable serine carboxypeptidase (EC 3.4.16.-) NF314 - Naegleria fowleri >gi|159720|gb|AAA29384.1| (M88397) virulence-related protein [Naegleria fowleri] Length = 482 Frame 3 hits (HSPs): _____ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | 482 0 150 300 450 __________________ Annotated Domains: BLOCKS BL00131A: Serine carboxypeptidases, seri 27..42 BLOCKS BL00131B: Serine carboxypeptidases, seri 60..83 BLOCKS BL00131C: Serine carboxypeptidases, seri 96..119 BLOCKS BL00131D: Serine carboxypeptidases, seri 157..170 BLOCKS BL00131E: Serine carboxypeptidases, seri 189..198 BLOCKS BL00131F: Serine carboxypeptidases, seri 389..414 BLOCKS BL00131G: Serine carboxypeptidases, seri 441..477 DOMO DM00460: SERINECARBOXYPEPTIDASES,SERINE 14..481 Entrez active site: BY SIMILARITY. 163 Entrez active site: BY SIMILARITY. 399 Entrez active site: BY SIMILARITY. 459 PFAM serine_carbpept: Serine carboxypeptidase 20..479 PRINTS CRBOXYPTASEC1: Carboxypeptidase C serine 96..108 PRINTS CRBOXYPTASEC2: Carboxypeptidase C serine 109..119 PRINTS CRBOXYPTASEC3: Carboxypeptidase C serine 145..170 PRINTS CRBOXYPTASEC4: Carboxypeptidase C serine 449..462 PRODOM PD001189: Q94269(7) Q17679(7) CBP3(3) 20..478 PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 449..466 PROSITE CARBOXYPEPT_SER_SER: Serine carboxypepti 159..166 __________________ Plus Strand HSPs: Score = 102 (35.9 bits), Expect = 0.00097, P = 0.00097 Identities = 20/50 (40%), Positives = 31/50 (62%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 ++LP Y KL+ ++I +YSGD D + +GT+ ++ L L S WRTW Sbjct: 377 TILPFYAKLLPH-IRILVYSGDTDMVVNGLGTQAAIDKLQLQETSSWRTW 425 >gi|4006820|gb|AAC95162.1| (AC005970) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 487 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 487 0 150 300 450 Plus Strand HSPs: Score = 97 (34.1 bits), Expect = 0.0034, P = 0.0034 Identities = 16/50 (32%), Positives = 29/50 (58%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S++P+ L+ G+++ +YSGD D IP T ++ + L + + WR W Sbjct: 384 SMVPILHDLMGEGVRVLVYSGDVDAAIPFTATMAVLKTMNLTVVNEWRPW 433 >gi|4678931|emb|CAB41322.1| (AL049711) serine-type carboxypeptidase like protein [Arabidopsis thaliana] Length = 501 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 501 0 150 300 450 Plus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.0058, P = 0.0058 Identities = 17/51 (33%), Positives = 31/51 (60%), Frame = +3 Query: 6 SVLPVYTKLIKGG-LKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+LP+ +L+K L++W+Y+GD D IP+ T + ++ + L + W W Sbjct: 397 SMLPILKELMKHDQLRVWVYTGDTDTVIPLTVTMHALKMMNLTAVTDWLPW 447 >gi|7523661|gb|AAF63101.1|AC006423_2 (AC006423) Putative serine carboxypeptidases [Arabidopsis thaliana] Length = 479 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 479 0 150 300 450 Plus Strand HSPs: Score = 93 (32.7 bits), Expect = 0.0089, P = 0.0089 Identities = 14/39 (35%), Positives = 28/39 (71%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEAL 122 ++LP+ +++K + +W++SGD D IP++G+R V+ L Sbjct: 366 NMLPILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVKEL 404 >gi|7271957|gb|AAF44708.1|AF242849_1 (AF242849) wound-inducible carboxypeptidase [Lycopersicon esculentum] Length = 498 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 498 0 150 300 450 Plus Strand HSPs: Score = 93 (32.7 bits), Expect = 0.0094, P = 0.0094 Identities = 17/50 (34%), Positives = 27/50 (54%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S++P + L G + I+SGD D +P G+ ++LG P+ WR W Sbjct: 399 SMIPYHKNLTARGYRAIIFSGDHDMCVPFTGSAVWTKSLGYPIVDEWRPW 448 >gi|4678929|emb|CAB41320.1| (AL049711) serine-type carboxypeptidase like protein [Arabidopsis thaliana] Length = 482 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 482 0 150 300 450 Plus Strand HSPs: Score = 90 (31.7 bits), Expect = 0.019, P = 0.019 Identities = 16/50 (32%), Positives = 28/50 (56%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S+ P+ +L+ G+++ +Y+GD D IP T V+ + L + WR W Sbjct: 379 SLTPILQELMGKGVRVMLYNGDVDLVIPFTSTLAVVKTMNLTVVKEWRPW 428 >gi|6598856|gb|AAF18710.1|AC010556_6 (AC010556) putative serine carboxypeptidase [Arabidopsis thaliana] Length = 441 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 441 0 150 300 Plus Strand HSPs: Score = 88 (31.0 bits), Expect = 0.028, P = 0.027 Identities = 16/50 (32%), Positives = 28/50 (56%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S +P + G + I+SGD D +P+IGT+ +++L + +WR W Sbjct: 343 SSVPYHMNNSINGYRSLIFSGDHDFEVPLIGTQVWIKSLNYAIVDKWRPW 392 >gi|2459435|gb|AAB80670.1| (AC002332) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 458 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | || 458 0 150 300 450 Plus Strand HSPs: Score = 87 (30.6 bits), Expect = 0.037, P = 0.037 Identities = 19/46 (41%), Positives = 27/46 (58%), Frame = +3 Query: 30 LIKGGLKIWIYSGDADGRIPVIGTRYCV----EALGLPLKSRWRTW 155 L+K G+ +++YSGD D IP+ G+R V E LGL +R W Sbjct: 359 LVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVW 404 >gi|225815|prf||1314177B CPase I B [Hordeum vulgare var. distichum] Length = 148 Frame 3 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | 148 0 50 100 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.054, P = 0.053 Identities = 15/50 (30%), Positives = 25/50 (50%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S++ + L G + I+SGD D +P G+ ++LG + WR W Sbjct: 49 SMIAYHKNLTSQGYRAIIFSGDHDMXVPFTGSEAWTKSLGYGVVDSWRPW 98 >gi|584892|sp|P37890|CBP1_ORYSA SERINE CARBOXYPEPTIDASE I PRECURSOR (CARBOXYPEPTIDASE C) >gi|629805|pir||S43516 carboxypeptidase C (EC 3.4.16.5) precursor - rice >gi|409580|dbj|BAA04510.1| (D17586) serine carboxypeptidase I [Oryza sativa] Length = 510 Frame 3 hits (HSPs): ______ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 510 0 150 300 450 __________________ Annotated Domains: BLOCKS BL00131A: Serine carboxypeptidases, seri 54..69 BLOCKS BL00131B: Serine carboxypeptidases, seri 87..110 BLOCKS BL00131C: Serine carboxypeptidases, seri 128..151 BLOCKS BL00131D: Serine carboxypeptidases, seri 188..201 BLOCKS BL00131E: Serine carboxypeptidases, seri 220..229 BLOCKS BL00131F: Serine carboxypeptidases, seri 424..449 BLOCKS BL00131G: Serine carboxypeptidases, seri 469..505 DOMO DM00460: SERINECARBOXYPEPTIDASES,SERINE 42..509 Entrez active site: BY SIMILARITY. 194 Entrez active site: BY SIMILARITY. 434 Entrez active site: BY SIMILARITY. 487 Entrez glycosylation site: POTENTIAL. 154 Entrez glycosylation site: POTENTIAL. 268 Entrez glycosylation site: POTENTIAL. 418 Entrez other site: MICROBODY TARGETING SIGNAL ( 508..510 PFAM serine_carbpept: Serine carboxypeptidase 47..507 PRINTS CRBOXYPTASEC1: Carboxypeptidase C serine 128..140 PRINTS CRBOXYPTASEC2: Carboxypeptidase C serine 141..151 PRINTS CRBOXYPTASEC3: Carboxypeptidase C serine 176..201 PRINTS CRBOXYPTASEC4: Carboxypeptidase C serine 477..490 PRODOM PD139529: CBP1_ORYSA 1..45 PRODOM PD001189: Q94269(7) Q17679(7) CBP3(3) 47..506 PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 477..494 PROSITE CARBOXYPEPT_SER_SER: Serine carboxypepti 190..197 __________________ Plus Strand HSPs: Score = 83 (29.2 bits), Expect = 0.12, P = 0.11 Identities = 18/46 (39%), Positives = 24/46 (52%), Frame = +3 Query: 21 YTKLIKG-GLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 Y K + G G + +IYSGD D +P GT +LG + WR W Sbjct: 415 YHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLGYGVIDSWRPW 460 >gi|6598853|gb|AAF18707.1|AC010556_3 (AC010556) putative serine carboxypeptidase [Arabidopsis thaliana] Length = 441 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 441 0 150 300 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 0.12, P = 0.12 Identities = 16/50 (32%), Positives = 25/50 (50%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S +P + G + IYSGD D +P +GT+ + +L + WR W Sbjct: 343 SSMPYHVNNSISGYRSLIYSGDHDLEVPYLGTQAWIRSLNYSIIDDWRPW 392 >gi|5748498|emb|CAB53091.1| (AL079349) SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein [Arabidopsis thaliana] >gi|7267993|emb|CAB78333.1| (AL161535) SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein [Arabidopsis thaliana] Length = 456 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | || 456 0 150 300 450 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 0.13, P = 0.12 Identities = 16/50 (32%), Positives = 25/50 (50%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S++ + L G + IYSGD D +P G+ ++LG + WR W Sbjct: 370 SMIDFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTKSLGYKVIDEWRAW 419 >gi|4678930|emb|CAB41321.1| (AL049711) serine-type carboxypeptidase like protein [Arabidopsis thaliana] Length = 487 Frame 3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 487 0 150 300 450 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 0.14, P = 0.13 Identities = 15/49 (30%), Positives = 28/49 (57%), Frame = +3 Query: 9 VLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 ++P+ +L+ G+++ IY+GD D IP T V+ + L + +R W Sbjct: 385 MIPILHELMGEGVRVMIYNGDVDLEIPFASTLAVVKEMNLTVVKEFRPW 433 >gi|6598855|gb|AAF18709.1|AC010556_5 (AC010556) putative serine carboxypeptidase [Arabidopsis thaliana] Length = 441 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 441 0 150 300 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 0.16, P = 0.15 Identities = 16/50 (32%), Positives = 25/50 (50%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S +P + G + IYSGD D +P +GT+ + +L + WR W Sbjct: 343 SSIPYHMNNSINGYRSLIYSGDHDFEVPFLGTQAWIRSLNYSVIDDWRPW 392 >gi|7579025|gb|AAF64227.1|AF248647_1 (AF248647) glucose acyltransferase [Lycopersicon pennellii] Length = 464 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 464 0 150 300 450 Plus Strand HSPs: Score = 81 (28.5 bits), Expect = 0.17, P = 0.15 Identities = 17/50 (34%), Positives = 24/50 (48%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 SV+ + L + IYSGD D +P + T +E L LP+ W W Sbjct: 362 SVIDDHQHLTSKSCRALIYSGDHDMVVPHLSTEEWIETLKLPIADDWEPW 411 >gi|6598852|gb|AAF18706.1|AC010556_2 (AC010556) putative serine carboxypeptidase [Arabidopsis thaliana] Length = 441 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 441 0 150 300 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.20, P = 0.18 Identities = 16/50 (32%), Positives = 26/50 (52%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S +P + G + IYSGD D ++P +GT+ + +L + WR W Sbjct: 343 SSVPYHMNNSIDGYRSLIYSGDHDIQVPFLGTQAWIRSLNYSIIDDWRPW 392 >gi|6598854|gb|AAF18708.1|AC010556_4 (AC010556) putative serine carboxypeptidase [Arabidopsis thaliana] Length = 438 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 438 0 150 300 Plus Strand HSPs: Score = 77 (27.1 bits), Expect = 0.42, P = 0.34 Identities = 16/50 (32%), Positives = 24/50 (48%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S +P + G + IYSGD D +P + T+ V +L + WR W Sbjct: 340 SSVPYHMNNSINGYRSLIYSGDHDLNVPFLATQAWVRSLNYSIIDNWRPW 389 >gi|167012|gb|AAA32940.1| (J03897) carboxypeptidase I precursor [Hordeum vulgare] Length = 412 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 412 0 150 300 Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.64, P = 0.47 Identities = 15/50 (30%), Positives = 25/50 (50%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S++ + L G + I+SGD D +P G+ ++LG + WR W Sbjct: 313 SMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKSLGYGVVDSWRPW 362 >gi|3169171|gb|AAC17814.1| (AC004401) putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 433 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 433 0 150 300 Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.68, P = 0.49 Identities = 15/50 (30%), Positives = 25/50 (50%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S +P + G + IYSGD D +P + T+ +++L + WR W Sbjct: 335 SSVPYHMNNSVSGYRSLIYSGDHDLVVPFLATQAWIKSLNYSIIDEWRPW 384 >gi|6119535|gb|AAF04179.1|AC011560_20 (AC011560) putative glucose acyltransferase [Arabidopsis thaliana] Length = 437 Frame 3 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 437 0 150 300 Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.69, P = 0.50 Identities = 16/50 (32%), Positives = 24/50 (48%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S +P + G I+SGD D +P +GT+ + +L L WR W Sbjct: 339 SSVPYHMNNSIDGYASLIFSGDHDMEVPYLGTQAWIRSLNYSLIDDWRPW 388 >gi|2815493|sp|P07519|CBP1_HORVU SERINE CARBOXYPEPTIDASE I PRECURSOR (CARBOXYPEPTIDASE C) (CP-MI) >gi|7428202|pir||CPBHS carboxypeptidase C (EC 3.4.16.5) precursor - barley >gi|1731988|emb|CAA70816.1| (Y09603) serine carboxypeptidase I, CP-MI [Hordeum vulgare] Length = 499 Frame 3 hits (HSPs): ______ Annotated Domains: ______________________________________________ __________________________________________________ Database sequence: | | | | | 499 0 150 300 450 __________________ Annotated Domains: BLOCKS BL00131A: Serine carboxypeptidases, seri 48..63 BLOCKS BL00131B: Serine carboxypeptidases, seri 81..104 BLOCKS BL00131C: Serine carboxypeptidases, seri 122..145 BLOCKS BL00131D: Serine carboxypeptidases, seri 182..195 BLOCKS BL00131E: Serine carboxypeptidases, seri 214..223 BLOCKS BL00131F: Serine carboxypeptidases, seri 413..438 BLOCKS BL00131G: Serine carboxypeptidases, seri 458..494 Entrez active site: BY SIMILARITY. 188 Entrez active site: BY SIMILARITY. 423 Entrez active site: BY SIMILARITY. 476 Entrez glycosylation site 148 Entrez glycosylation site 262 Entrez glycosylation site 407 Entrez other site: MICROBODY TARGETING SIGNAL ( 497..499 PFAM serine_carbpept: Serine carboxypeptidase 41..496 PRINTS CRBOXYPTASEC1: Carboxypeptidase C serine 122..134 PRINTS CRBOXYPTASEC2: Carboxypeptidase C serine 135..145 PRINTS CRBOXYPTASEC3: Carboxypeptidase C serine 170..195 PRINTS CRBOXYPTASEC4: Carboxypeptidase C serine 466..479 PRODOM PD001189: Q94269(7) Q17679(7) CBP3(3) 41..495 PROSITE CARBOXYPEPT_SER_HIS: Serine carboxypepti 466..483 PROSITE CARBOXYPEPT_SER_SER: Serine carboxypepti 184..191 __________________ Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.81, P = 0.56 Identities = 15/50 (30%), Positives = 25/50 (50%), Frame = +3 Query: 6 SVLPVYTKLIKGGLKIWIYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 S++ + L G + I+SGD D +P G+ ++LG + WR W Sbjct: 400 SMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKSLGYGVVDSWRPW 449 >gi|4101707|gb|AAD01265.1| (AF006080) glucose acyltransferase [Solanum berthaultii] Length = 461 Frame 3 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 461 0 150 300 450 Plus Strand HSPs: Score = 73 (25.7 bits), Expect = 1.2, P = 0.70 Identities = 13/33 (39%), Positives = 18/33 (54%), Frame = +3 Query: 57 IYSGDADGRIPVIGTRYCVEALGLPLKSRWRTW 155 IYSGD D +P + T ++ L LP+ W W Sbjct: 376 IYSGDHDMVVPHLSTEEWIDTLKLPIADDWEPW 408 WARNING: HSPs involving 24 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=6.00 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.325 0.147 0.501 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.360 0.162 0.692 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.341 0.151 0.474 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.385 0.176 0.717 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.338 0.145 0.471 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.343 0.154 0.480 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 51 51 10. 57 3 12 22 0.10 29 26 0.077 29 +2 0 51 51 10. 57 3 12 22 0.10 29 26 0.077 29 +1 0 52 51 10. 57 3 12 22 0.10 29 26 0.077 29 -1 0 52 51 10. 57 3 12 22 0.10 29 26 0.077 29 -2 0 51 51 10. 57 3 12 22 0.10 29 26 0.077 29 -3 0 51 51 10. 57 3 12 22 0.10 29 26 0.077 29 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 8:50 PM CDT May 27, 2000 Format: BLAST # of letters in database: 158,518,215 # of sequences in database: 505,245 # of database sequences satisfying E: 74 No. of states in DFA: 568 (56 KB) Total size of DFA: 103 KB (128 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 4 Search cpu time: 74.88u 1.08s 75.96t Elapsed: 00:00:26 Total cpu time: 74.93u 1.14s 76.07t Elapsed: 00:00:26 Start: Wed Feb 14 10:55:17 2001 End: Wed Feb 14 10:55:43 2001 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000