WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= B10H02.seq(1>437) (410 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 5 Sequences : less than 5 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 1416 273 |====================================================== 6310 1143 181 |==================================== 3980 962 151 |============================== 2510 811 149 |============================= 1580 662 123 |======================== 1000 539 54 |========== 631 485 49 |========= 398 436 50 |========== 251 386 27 |===== 158 359 12 |== 100 347 12 |== 63.1 335 8 |= 39.8 327 3 |: 25.1 324 4 |: 15.8 320 8 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 312 <<<<<<<<<<<<<<<<< 10.0 312 5 |= 6.31 307 4 |: 3.98 303 4 |: 2.51 299 4 |: 1.58 295 2 |: 1.00 293 1 |: 0.63 292 4 |: 0.40 288 3 |: 0.25 285 3 |: 0.16 282 3 |: 0.10 279 0 | 0.063 279 1 |: 0.040 278 2 |: 0.025 276 0 | 0.016 276 1 |: 0.010 275 2 |: 0.0063 273 0 | 0.0040 273 1 |: 0.0025 272 2 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|6066285|gb|AAF03236.1|AF180143_1(AF180143) ubiquit... +2 538 7.3e-51 1 gi|1174850|sp|P42749|UBC5_ARATHUBIQUITIN-CONJUGATING ... +2 499 9.9e-47 1 gi|1174847|sp|P42748|UBC4_ARATHUBIQUITIN-CONJUGATING ... +2 494 3.3e-46 1 gi|1076427|pir||S43784ubiquitin--protein ligase (EC 6... +2 494 3.3e-46 1 gi|9758043|dbj|BAB08506.1|(AB006707) ubiquitin-conjug... +2 494 3.3e-46 1 gi|136644|sp|P16577|UBC4_WHEATUBIQUITIN-CONJUGATING E... +2 490 8.9e-46 1 gi|629564|pir||S43786ubiquitin--protein ligase (EC 6.... +2 487 1.8e-45 1 gi|431270|gb|AAA32902.1|(L19356) ubiquitin conjugatin... +2 486 2.4e-45 1 gi|1076428|pir||S43785ubiquitin--protein ligase (EC 6... +2 469 1.5e-43 1 gi|1174851|sp|P42750|UBC6_ARATHUBIQUITIN-CONJUGATING ... +2 469 1.5e-43 1 gi|1076429|pir||S52661ubiquitin--protein ligase (EC 6... +2 466 3.1e-43 1 gi|431268|gb|AAA32901.1|(L19355) ubiquitin conjugatin... +2 456 3.6e-42 1 gi|11272330|pir||T50342ubiquitin conjugating enzyme [... +2 439 2.3e-40 1 gi|2815252|emb|CAA50503.1|(X71381) ubiquitin carrier ... +2 426 5.4e-39 1 gi|12325002|gb|AAG52444.1|AC010852_1(AC010852) putati... +2 426 5.4e-39 1 gi|6579192ref|NP_010904.2| ubiquitin-conjugating enzy... +2 400 3.1e-36 1 gi|602379|gb|AAB64489.1|(U18530) Ubiquitin-conjugatin... +2 373 2.2e-33 1 gi|7290876|gb|AAF46318.1|(AE003442) CG2257 gene produ... +2 360 5.3e-32 1 gi|4507783ref|NP_003335.1| ubiquitin-conjugating enzy... +2 359 6.8e-32 1 gi|12324943|gb|AAG52422.1|AC011622_10(AC011622) putat... +2 303 5.8e-26 1 gi|7332204|gb|AAF60891.1|(AC024876) contains similari... +2 226 8.4e-18 1 gi|7299561|gb|AAF54747.1|(AE003694) CG14739 gene prod... +2 215 1.2e-16 1 gi|464982|sp|P35128|UBC3_DROMEUBIQUITIN-CONJUGATING E... +2 210 4.2e-16 1 gi|12311787|emb|CAC24487.1|(AJ298327) putative ubiqui... +2 208 6.8e-16 1 gi|1850816|emb|CAA72184.1|(Y11349) ubiquitin conjugat... +2 206 1.1e-15 1 gi|6723905|emb|CAA21178.2|(AL031788) ubiquitin-conjug... +2 204 1.8e-15 1 gi|7437982|pir||T08465ubiquitin--protein ligase (EC 6... +2 202 2.9e-15 1 gi|3834310|gb|AAC83026.1|(AC005679) Similar to Ubiqui... +2 202 2.9e-15 1 gi|5381319|gb|AAD42941.1|AF091621_1(AF091621) ubiquit... +2 202 2.9e-15 1 gi|11359599|pir||T48741probable ubiquitin--protein li... +2 202 2.9e-15 1 gi|6320264ref|NP_010344.1| ubiquitin-conjugating enzy... +2 201 3.7e-15 1 gi|4507777ref|NP_003331.1| ubiquitin-conjugating enzy... +2 200 4.8e-15 1 gi|4507775ref|NP_003330.1| ubiquitin-conjugating enzy... +2 200 4.8e-15 1 gi|2136339|pir||I59365ubiquitin conjugating enzyme - ... +2 200 4.8e-15 1 gi|6320297ref|NP_010377.1| ubiquitin-conjugating enzy... +2 199 6.1e-15 1 gi|8393719ref|NP_057067.1| ubiquitin-conjugating enzy... +2 199 6.1e-15 1 gi|9802775|gb|AAF99844.1|AC051629_11(AC051629) Putati... +2 198 7.8e-15 1 gi|3915196|sp|Q95044|UBCB_SPISOUBIQUITIN-CONJUGATING ... +2 197 9.9e-15 1 gi|7493562|pir||T11716ubiquitin conjugating enzyme - ... +2 172 1.1e-14 2 gi|6319556ref|NP_009638.1| ubiquitin-conjugating enzy... +2 196 1.3e-14 1 gi|4507793ref|NP_003339.1| ubiquitin-conjugating enzy... +2 196 1.3e-14 1 gi|1717856|sp|P52486|UBC4_DROMEUBIQUITIN-CONJUGATING ... +2 196 1.3e-14 1 gi|12249089|dbj|BAB20414.1|(AB032739) bendless protei... +2 196 1.3e-14 1 gi|89812|pir||A40797ubiquitin-conjugating enzyme - bo... +2 195 1.6e-14 1 gi|464986|sp|P35132|UBC9_ARATHUBIQUITIN-CONJUGATING E... +2 195 1.6e-14 1 gi|4885417ref|NP_005330.1| huntingtin interacting pro... +2 195 1.6e-14 1 gi|7949049ref|NP_058066.1| huntingtin interacting pro... +2 195 1.6e-14 1 gi|11762186|gb|AAG40371.1|AF325019_1(AF325019) AT4g27... +2 195 1.6e-14 1 gi|12643427|sp|P35134|UBCB_ARATHUBIQUITIN-CONJUGATING... +2 195 1.6e-14 1 gi|2501431|sp|P70711|UB5D_RATUBIQUITIN-CONJUGATING EN... +2 194 2.1e-14 1
Use the and icons to retrieve links to Entrez:
WARNING: Descriptions of 262 database sequences were not reported due to the limiting value of parameter V = 50. >gi|6066285|gb|AAF03236.1|AF180143_1 (AF180143) ubiquitin carrier protein 4 [Glycine max] Length = 183 Frame 2 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | 183 0 50 100 150 Plus Strand HSPs: Score = 538 (189.4 bits), Expect = 7.3e-51, P = 7.3e-51 Identities = 98/102 (96%), Positives = 100/102 (98%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGPN+SPYHGGVWKVRVELPDAYP Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 >gi|1174850|sp|P42749|UBC5_ARATH UBIQUITIN-CONJUGATING ENZYME E2-21 KD 2 (UBIQUITIN-PROTEIN LIGASE 5) (UBIQUITIN CARRIER PROTEIN 5) Length = 185 Frame 2 hits (HSPs): ____________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 185 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00183: Ubiquitin-conjugating enzymes p 41..88 Entrez binding site: UBIQUITIN (BY SIMILARITY). 85 PFAM UQ_con: Ubiquitin-conjugating enzyme 1..145 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 1..144 PRODOM PD030859: UBC4(1) UBC5(1) 146..184 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 499 (175.7 bits), Expect = 9.9e-47, P = 9.9e-47 Identities = 91/102 (89%), Positives = 96/102 (94%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+V+F GP DS Y GGVWK+RVELPDAYP Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GFI KIYHPNVDEMSGSVCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 >gi|1174847|sp|P42748|UBC4_ARATH UBIQUITIN-CONJUGATING ENZYME E2-21 KD 1 (UBIQUITIN-PROTEIN LIGASE 4) (UBIQUITIN CARRIER PROTEIN 4) >gi|431266|gb|AAA32900.1| (L19354) ubiquitin conjugating enzyme [Arabidopsis thaliana] Length = 187 Frame 2 hits (HSPs): ____________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 187 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00183: Ubiquitin-conjugating enzymes p 41..88 DOMO DM00225: UBIQUITIN-CONJUGATINGENZYMES 1..147 Entrez binding site: UBIQUITIN (BY SIMILARITY). 85 PFAM UQ_con: Ubiquitin-conjugating enzyme 1..145 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 1..144 PRODOM PD030859: UBC4(1) UBC5(1) 146..186 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 494 (173.9 bits), Expect = 3.3e-46, P = 3.3e-46 Identities = 89/102 (87%), Positives = 96/102 (94%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYV+F+GP DS Y GGVWK+RVELPDAYP Sbjct: 1 MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GFI KIYHPNVDE+SGSVCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNV 102 >gi|1076427|pir||S43784 ubiquitin--protein ligase (EC 6.3.2.19) - Arabidopsis thaliana Length = 189 Frame 2 hits (HSPs): ___________________________ Annotated Domains: _____ __________________________________________________ Database sequence: | | | | | 189 0 50 100 150 __________________ Annotated Domains: PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 494 (173.9 bits), Expect = 3.3e-46, P = 3.3e-46 Identities = 89/102 (87%), Positives = 96/102 (94%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYV+F+GP DS Y GGVWK+RVELPDAYP Sbjct: 1 MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GFI KIYHPNVDE+SGSVCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNV 102 >gi|9758043|dbj|BAB08506.1| (AB006707) ubiquitin-conjugating enzyme E2-21 kD 1 (ubiquitin-protein ligase 4) (ubiquitin carrier protein 4) [Arabidopsis thaliana] Length = 187 Frame 2 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | 187 0 50 100 150 Plus Strand HSPs: Score = 494 (173.9 bits), Expect = 3.3e-46, P = 3.3e-46 Identities = 89/102 (87%), Positives = 96/102 (94%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYV+F+GP DS Y GGVWK+RVELPDAYP Sbjct: 1 MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GFI KIYHPNVDE+SGSVCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNV 102 >gi|136644|sp|P16577|UBC4_WHEAT UBIQUITIN-CONJUGATING ENZYME E2-23 KD (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) >gi|100765|pir||A34506 23K ubiquitin carrier protein E2 - wheat >gi|170782|gb|AAA34309.1| (M28059) ubiquitin carrier protein [Triticum aestivum] Length = 184 Frame 2 hits (HSPs): ____________________________ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | 184 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00183: Ubiquitin-conjugating enzymes p 41..88 DOMO DM00225: UBIQUITIN-CONJUGATINGENZYMES 1..147 Entrez binding site: UBIQUITIN. 85 Entrez mutagenized site: C->S: LOSS OF ACTIVITY 85 Entrez Domain: ASP/GLU-RICH (BASIC). 141..176 PFAM UQ_con: Ubiquitin-conjugating enzyme 1..145 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 1..144 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 490 (172.5 bits), Expect = 8.9e-46, P = 8.9e-46 Identities = 90/102 (88%), Positives = 94/102 (92%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMDLMKLMMSDYKV+MINDGM EF+V FHGP DS Y GGVWKVRVEL +AYP Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFFVHFHGPKDSIYQGGVWKVRVELTEAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNI 102 >gi|629564|pir||S43786 ubiquitin--protein ligase (EC 6.3.2.19) - Arabidopsis thaliana Length = 187 Frame 2 hits (HSPs): ____________________________ Annotated Domains: _____ __________________________________________________ Database sequence: | | | | | 187 0 50 100 150 __________________ Annotated Domains: PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 487 (171.4 bits), Expect = 1.8e-45, P = 1.8e-45 Identities = 89/102 (87%), Positives = 95/102 (93%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREM +MKLMMSDYKVEMINDGMQEF+V+F GP DS Y GGVWK+RVELPDAYP Sbjct: 1 MSSPSKRREMLMMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GFI KIYHPNVDEMSGSVCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 >gi|431270|gb|AAA32902.1| (L19356) ubiquitin conjugating enzyme [Arabidopsis thaliana] Length = 142 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 142 0 50 100 Plus Strand HSPs: Score = 486 (171.1 bits), Expect = 2.4e-45, P = 2.4e-45 Identities = 88/98 (89%), Positives = 93/98 (94%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+V+F GP DS Y GGVWK+RVELPDAYP Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFD 379 YKSPS+GFI KIYHPNVDEMSGSVCLDVINQTWSPMF+ Sbjct: 61 YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFE 98 >gi|1076428|pir||S43785 ubiquitin--protein ligase (EC 6.3.2.19) - Arabidopsis thaliana Length = 185 Frame 2 hits (HSPs): ____________________________ Annotated Domains: ________________________________________ __________________________________________________ Database sequence: | | | | | 185 0 50 100 150 __________________ Annotated Domains: DOMO DM00225: UBIQUITIN-CONJUGATINGENZYMES 1..147 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 469 (165.1 bits), Expect = 1.5e-43, P = 1.5e-43 Identities = 82/102 (80%), Positives = 93/102 (91%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP DS Y GGVWK++VELP+AYP Sbjct: 1 MSSPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GF+NKIYHPNVDE SG+VCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINV 102 >gi|1174851|sp|P42750|UBC6_ARATH UBIQUITIN-CONJUGATING ENZYME E2-21 KD 3 (UBIQUITIN-PROTEIN LIGASE 6) (UBIQUITIN CARRIER PROTEIN 6) Length = 183 Frame 2 hits (HSPs): ____________________________ Annotated Domains: ________________________________________ __________________________________________________ Database sequence: | | | | | 183 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00183: Ubiquitin-conjugating enzymes p 41..88 DOMO DM00225: UBIQUITIN-CONJUGATINGENZYMES 1..147 Entrez binding site: UBIQUITIN (BY SIMILARITY). 85 PFAM UQ_con: Ubiquitin-conjugating enzyme 1..145 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 1..144 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 469 (165.1 bits), Expect = 1.5e-43, P = 1.5e-43 Identities = 82/102 (80%), Positives = 93/102 (91%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP DS Y GGVWK++VELP+AYP Sbjct: 1 MSSPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GF+NKIYHPNVDE SG+VCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINV 102 >gi|1076429|pir||S52661 ubiquitin--protein ligase (EC 6.3.2.19) - Arabidopsis thaliana >gi|807095|gb|AAB32508.1| UBC6=E2-related ubiquitin-conjugating protein [Arabidopsis thaliana, Peptide, 183 aa] >gi|3702350|gb|AAC62907.1| (AC005397) putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana] Length = 183 Frame 2 hits (HSPs): ____________________________ Annotated Domains: ________________________________________ __________________________________________________ Database sequence: | | | | | 183 0 50 100 150 __________________ Annotated Domains: DOMO DM00225: UBIQUITIN-CONJUGATINGENZYMES 1..147 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 73..88 __________________ Plus Strand HSPs: Score = 466 (164.0 bits), Expect = 3.1e-43, P = 3.1e-43 Identities = 81/102 (79%), Positives = 93/102 (91%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 M+SPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP DS Y GGVWK++VELP+AYP Sbjct: 1 MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPS+GF+NKIYHPNVDE SG+VCLDVINQTWSPMFDL N+ Sbjct: 61 YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINV 102 >gi|431268|gb|AAA32901.1| (L19355) ubiquitin conjugating enzyme [Arabidopsis thaliana] Length = 140 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 140 0 50 100 Plus Strand HSPs: Score = 456 (160.5 bits), Expect = 3.6e-42, P = 3.6e-42 Identities = 79/98 (80%), Positives = 90/98 (91%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP DS Y GGVWK++VELP+AYP Sbjct: 1 MSSPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFD 379 YKSPS+GF+NKIYHPNVDE SG+VCLDVINQTWSPMF+ Sbjct: 61 YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFE 98 >gi|11272330|pir||T50342 ubiquitin conjugating enzyme [imported] - fission yeast (Schizosaccharomyces pombe) >gi|6983771|emb|CAB75415.1| (AL139314) ubiquitin conjugating enzyme [Schizosaccharomyces pombe] Length = 184 Frame 2 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | 184 0 50 100 150 Plus Strand HSPs: Score = 439 (154.5 bits), Expect = 2.3e-40, P = 2.3e-40 Identities = 73/102 (71%), Positives = 92/102 (90%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSSP +R E D+MKL+MSDY+V ++ND MQEFYV+FHGP+++PY GG+WKV VELP YP Sbjct: 1 MSSPRRRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHGPSETPYSGGIWKVHVELPSEYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 +KSPSIGF+N+I+HPN+DE+SGSVCLDVINQTWSPMFD+ N+ Sbjct: 61 WKSPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMFDMINI 102 >gi|2815252|emb|CAA50503.1| (X71381) ubiquitin carrier protein [Arabidopsis thaliana] Length = 179 Frame 2 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | 179 0 50 100 150 Plus Strand HSPs: Score = 426 (150.0 bits), Expect = 5.4e-39, P = 5.4e-39 Identities = 73/94 (77%), Positives = 85/94 (90%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 M+SPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP D Y GGVWK++VELP+AYP Sbjct: 1 MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDGLYQGGVWKIKVELPEAYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWS 367 YKSPS+GF+NKIYHPNVDE SG+VCLDVINQTW+ Sbjct: 61 YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWN 94 >gi|12325002|gb|AAG52444.1|AC010852_1 (AC010852) putative ubiquitin-conjugating enzyme; 71876-72824 [Arabidopsis thaliana] Length = 170 Frame 2 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | | 170 0 50 100 150 Plus Strand HSPs: Score = 426 (150.0 bits), Expect = 5.4e-39, P = 5.4e-39 Identities = 76/87 (87%), Positives = 81/87 (93%), Frame = +2 Query: 131 MMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHP 310 MMSDYKVEMINDGMQEF+V+F GP DS Y GGVWK+RVELPDAYPYKSPS+GFI KIYHP Sbjct: 1 MMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHP 60 Query: 311 NVDEMSGSVCLDVINQTWSPMFDLSNL 391 NVDEMSGSVCLDVINQTWSPMFDL N+ Sbjct: 61 NVDEMSGSVCLDVINQTWSPMFDLVNV 87 >gi|6579192 ref|NP_010904.2| ubiquitin-conjugating enzyme; ubiquitin-protein ligase; Ubc8p [Saccharomyces cerevisiae] >gi|549146|sp|P28263|UBC8_YEAST UBIQUITIN-CONJUGATING ENZYME E2-24 KD (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) >gi|1078448|pir||B53516 ubiquitin--protein ligase (EC 6.3.2.19) UBC8 - yeast (Saccharomyces cerevisiae) Length = 218 Frame 2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | | 218 0 50 100 150 200 Plus Strand HSPs: Score = 400 (140.8 bits), Expect = 3.1e-36, P = 3.1e-36 Identities = 68/102 (66%), Positives = 87/102 (85%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP 265 MSS +R E D+MKL+MSD++V++IND MQEF+V+F GP D+PY GVW++ VELPD YP Sbjct: 1 MSSSKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYP 60 Query: 266 YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YKSPSIGF+NKI+HPN+D SGS+CLDVIN TWSP++DL N+ Sbjct: 61 YKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINI 102 >gi|602379|gb|AAB64489.1| (U18530) Ubiquitin-conjugating enzyme [Saccharomyces cerevisiae] Length = 206 Frame 2 hits (HSPs): ______________________ __________________________________________________ Database sequence: | | | | | | 206 0 50 100 150 200 Plus Strand HSPs: Score = 373 (131.3 bits), Expect = 2.2e-33, P = 2.2e-33 Identities = 62/90 (68%), Positives = 79/90 (87%), Frame = +2 Query: 122 MKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKI 301 MKL+MSD++V++IND MQEF+V+F GP D+PY GVW++ VELPD YPYKSPSIGF+NKI Sbjct: 1 MKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKI 60 Query: 302 YHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 +HPN+D SGS+CLDVIN TWSP++DL N+ Sbjct: 61 FHPNIDIASGSICLDVINSTWSPLYDLINI 90 >gi|7290876|gb|AAF46318.1| (AE003442) CG2257 gene product [alt 1] [Drosophila melanogaster] >gi|7290877|gb|AAF46319.1| (AE003442) CG2257 gene product [alt 2] [Drosophila melanogaster] Length = 183 Frame 2 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | | 183 0 50 100 150 Plus Strand HSPs: Score = 360 (126.7 bits), Expect = 5.3e-32, P = 5.3e-32 Identities = 66/104 (63%), Positives = 87/104 (83%), Frame = +2 Query: 86 MSSPS--KRR-EMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPD 256 MSSPS KRR + D++KL+ S ++V ++ G+ EF+V+F GP ++PY GGVWKVRV LPD Sbjct: 1 MSSPSAGKRRMDNDVIKLIESKHEVTILG-GLNEFHVKFFGPTETPYEGGVWKVRVYLPD 59 Query: 257 AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YP+KSPSIGF+NKIYHPN+DE SG+VCLDVINQ W+ ++DLSN+ Sbjct: 60 NYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNI 104 >gi|4507783 ref|NP_003335.1| ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8) [Homo sapiens] >gi|6678487 ref|NP_033485.1| ubiquitin-conjugating enzyme E2H [Mus musculus] >gi|11419570 ref|XP_004699.1| ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8) [Homo sapiens] >gi|586141|sp|P37286|UBCH_HUMAN UBIQUITIN-CONJUGATING ENZYME E2-21 KDA (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) (UBCH2) (E2-20K) >gi|631492|pir||A53516 ubiquitin--protein ligase (EC 6.3.2.19) E2H - human >gi|1363983|pir||JC4308 ubiquitin--protein ligase (EC 6.3.2.19) - mouse >gi|474827|emb|CAA82525.1| (Z29328) Ubiquitin-conjugating enzyme UbcH2 [Homo sapiens] >gi|483538|emb|CAA82527.1| (Z29330) ubiquitin-conjugating enzyme UbcH2 [Homo sapiens] >gi|897847|gb|AAA91975.1| (U19854) E2-20K [Mus musculus] Length = 183 Frame 2 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | | 183 0 50 100 150 Plus Strand HSPs: Score = 359 (126.4 bits), Expect = 6.8e-32, P = 6.8e-32 Identities = 65/104 (62%), Positives = 88/104 (84%), Frame = +2 Query: 86 MSSPS--KRR-EMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPD 256 MSSPS KRR + D++KL+ S ++V ++ G+ EF V+F+GP +PY GGVWKVRV+LPD Sbjct: 1 MSSPSPGKRRMDTDVVKLIESKHEVTILG-GLNEFVVKFYGPQGTPYEGGVWKVRVDLPD 59 Query: 257 AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YP+KSPSIGF+NKI+HPN+DE SG+VCLDVINQTW+ ++DL+N+ Sbjct: 60 KYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNI 104 >gi|12324943|gb|AAG52422.1|AC011622_10 (AC011622) putative ubiquitin-protein ligase, 5' partial; 197-892 [Arabidopsis thaliana] Length = 143 Frame 2 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | 143 0 50 100 Plus Strand HSPs: Score = 303 (106.7 bits), Expect = 5.8e-26, P = 5.8e-26 Identities = 53/59 (89%), Positives = 56/59 (94%), Frame = +2 Query: 215 YHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 Y GGVWK+RVELPDAYPYKSPS+GFI KIYHPNVDEMSGSVCLDVINQTWSPMFDL N+ Sbjct: 2 YEGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 60 >gi|7332204|gb|AAF60891.1| (AC024876) contains similarity to SW:UBCH_HUMAN [Caenorhabditis elegans] Length = 241 Frame 2 hits (HSPs): ____________________________ __________________________________________________ Database sequence: | | | | | | 241 0 50 100 150 200 Plus Strand HSPs: Score = 226 (79.6 bits), Expect = 8.4e-18, P = 8.4e-18 Identities = 39/69 (56%), Positives = 53/69 (76%), Frame = +2 Query: 215 YHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT----------W 364 Y GVW++RV++PD YP+KSPSIGF+NKI+HPN+DE SG+VCLDVINQ W Sbjct: 70 YENGVWRIRVDMPDKYPFKSPSIGFLNKIFHPNIDEASGTVCLDVINQVGIGGRSVWKAW 129 Query: 365 SPMFDLSNL 391 + ++DL+N+ Sbjct: 130 TALYDLTNI 138 Score = 96 (33.8 bits), Expect = 0.0066, P = 0.0066 Identities = 24/73 (32%), Positives = 42/73 (57%), Frame = +2 Query: 101 KRR-EMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSP 277 KRR + D++KL+ +++V+++N G EF V+FHGP D + + R LP + K Sbjct: 9 KRRIDCDVVKLISHNHEVQIVN-GCSEFIVRFHGPKDRNFSPKNFNFRQVLP-IFRTKIL 66 Query: 278 SIGFINKIYHPNVD 319 + + N ++ VD Sbjct: 67 AAAYENGVWRIRVD 80 >gi|7299561|gb|AAF54747.1| (AE003694) CG14739 gene product [Drosophila melanogaster] Length = 206 Frame 2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | | 206 0 50 100 150 200 Plus Strand HSPs: Score = 215 (75.7 bits), Expect = 1.2e-16, P = 1.2e-16 Identities = 37/97 (38%), Positives = 59/97 (60%), Frame = +2 Query: 101 KRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPS 280 +R + D+ +L+ S Y+ ++D M V GP S Y GG+W V V +P YP +P Sbjct: 16 RRLDRDVNRLLASGYRTT-VDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPR 74 Query: 281 IGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 + F+ KI HPN++ ++G VC++V+ Q WS +DL N+ Sbjct: 75 VRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNI 111 >gi|464982|sp|P35128|UBC3_DROME UBIQUITIN-CONJUGATING ENZYME E2-17 KDA (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) (BENDLESS PROTEIN) >gi|422431|pir||S35793 gene bendless protein - fruit fly (Drosophila melanogaster) >gi|304668|gb|AAA28392.1| (L20126) neural protein [Drosophila melanogaster] >gi|546724|gb|AAB30753.1| (S70118) ubiquitin-conjugating enzyme homolog=ben [Drosophila melanogaster, pupa, Peptide, 151 aa] >gi|7292948|gb|AAF48338.1| (AE003494) ben gene product [Drosophila melanogaster] >gi|743005|prf||2011314A bendless gene [Drosophila melanogaster] Length = 151 Frame 2 hits (HSPs): ___________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | || 151 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00183: Ubiquitin-conjugating enzymes p 44..91 DOMO DM00225: UBIQUITIN-CONJUGATINGENZYMES 1..148 Entrez binding site: UBIQUITIN (BY SIMILARITY). 87 PFAM UQ_con: Ubiquitin-conjugating enzyme 1..146 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 2..145 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 76..90 __________________ Plus Strand HSPs: Score = 210 (73.9 bits), Expect = 4.2e-16, P = 4.2e-16 Identities = 42/104 (40%), Positives = 61/104 (58%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSDYK-VEMIND--GMQEFYVQFHGPNDSPYHGGVWKVRVELPD 256 MSS +R + +LM + I D + F+V GPNDSP+ GGV+K+ + LP+ Sbjct: 1 MSSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPE 60 Query: 257 AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YP +P + FI KIYHPN+D + G +CLDV+ WSP + + Sbjct: 61 DYPMSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIRTI 104 >gi|12311787|emb|CAC24487.1| (AJ298327) putative ubiquitin-conjugating enzyme [Platichthys flesus] Length = 98 Frame 2 hits (HSPs): _______________________________________ __________________________________________________ Database sequence: | | | | | | 98 0 20 40 60 80 Plus Strand HSPs: Score = 208 (73.2 bits), Expect = 6.8e-16, P = 6.8e-16 Identities = 35/78 (44%), Positives = 49/78 (62%), Frame = +2 Query: 158 INDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSV 337 + + M + GPNDSPYHGGV+ + V P YP+K P I F KIYHPN++ +GS+ Sbjct: 19 VGEDMFHWQATITGPNDSPYHGGVFFLSVHFPTDYPFKPPKISFTTKIYHPNINS-NGSI 77 Query: 338 CLDVINQTWSPMFDLSNL 391 CLD++ WSP +S + Sbjct: 78 CLDILRSQWSPALTVSKV 95 >gi|1850816|emb|CAA72184.1| (Y11349) ubiquitin conjugating enzyme [Drosophila melanogaster] >gi|7294892|gb|AAF50222.1| (AE003551) UbcD4 gene product [Drosophila melanogaster] Length = 199 Frame 2 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | | 199 0 50 100 150 Plus Strand HSPs: Score = 206 (72.5 bits), Expect = 1.1e-15, P = 1.1e-15 Identities = 34/104 (32%), Positives = 63/104 (60%), Frame = +2 Query: 83 NMS-SPSKRREMDLMK---LMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVEL 250 NM+ S KR ++M+ ++ K+E++ND E + GP D+PY GG + + +++ Sbjct: 3 NMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKV 62 Query: 251 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDL 382 P+ YP+ P + FI +I+HPN+ ++G++CLD++ W+ L Sbjct: 63 PETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTL 106 >gi|6723905|emb|CAA21178.2| (AL031788) ubiquitin-conjugating enzyme [Schizosaccharomyces pombe] Length = 217 Frame 2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | | 217 0 50 100 150 200 Plus Strand HSPs: Score = 204 (71.8 bits), Expect = 1.8e-15, P = 1.8e-15 Identities = 38/105 (36%), Positives = 60/105 (57%), Frame = +2 Query: 86 MSSPSKRR---EM-DLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELP 253 MS RR E+ D+ + + +V IND + F GP +PY GG + V +E+P Sbjct: 1 MSDNRSRRIAKELADVQQDKQAGIQVWTINDDISHLKGMFRGPEGTPYEGGYFVVDIEIP 60 Query: 254 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSN 388 YP++ P + F KIYHPNV +G++CLD++ WSP++ + + Sbjct: 61 IDYPFRPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTMKS 105 >gi|7437982|pir||T08465 ubiquitin--protein ligase (EC 6.3.2.19) - fruit fly (Drosophila melanogaster) >gi|1359614|emb|CAA63424.1| (X92838) ubiquitin conjugating enzyme [Drosophila melanogaster] Length = 199 Frame 2 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | | 199 0 50 100 150 Plus Strand HSPs: Score = 202 (71.1 bits), Expect = 2.9e-15, P = 2.9e-15 Identities = 34/104 (32%), Positives = 62/104 (59%), Frame = +2 Query: 83 NMS-SPSKRREMDLMK---LMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVEL 250 NM+ S KR ++M+ ++ K+E++ND E + GP D+PY GG + + +++ Sbjct: 3 NMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKV 62 Query: 251 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDL 382 P+ YP+ P FI +I+HPN+ ++G++CLD++ W+ L Sbjct: 63 PETYPFNPPKARFITRIWHPNISSVTGAICLDILKDNWAAAMTL 106 >gi|3834310|gb|AAC83026.1| (AC005679) Similar to Ubiquitin-conjugating enzyme E2-17 KD gb|D83004 from Homo sapiens. ESTs gb|T88233, gb|Z24464, gb|N37265, gb|H36151, gb|Z34711, gb|AA040983, and gb|T22122 come from this gene. [Arabidopsis thaliana] Length = 163 Frame 2 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | | 163 0 50 100 150 Plus Strand HSPs: Score = 202 (71.1 bits), Expect = 2.9e-15, P = 2.9e-15 Identities = 33/73 (45%), Positives = 48/73 (65%), Frame = +2 Query: 164 DGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCL 343 D M+ F V GP SPY GGV+K+ + LP+ YP +P + F+ KIYHPN+D++ G +CL Sbjct: 32 DNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKL-GRICL 90 Query: 344 DVINQTWSPMFDL 382 D++ WSP + Sbjct: 91 DILKDKWSPALQI 103 >gi|5381319|gb|AAD42941.1|AF091621_1 (AF091621) ubiquitin-conjugating enzyme E2 [Catharanthus roseus] Length = 153 Frame 2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 153 0 50 100 150 Plus Strand HSPs: Score = 202 (71.1 bits), Expect = 2.9e-15, P = 2.9e-15 Identities = 33/73 (45%), Positives = 48/73 (65%), Frame = +2 Query: 164 DGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCL 343 D M++F V GP SPY GGV+K+ + LP+ YP P + F+ KIYHPN+D++ G +CL Sbjct: 32 DNMRDFNVMILGPAQSPYEGGVFKLELFLPEEYPMAPPKVRFLTKIYHPNIDKL-GRICL 90 Query: 344 DVINQTWSPMFDL 382 D++ WSP + Sbjct: 91 DILKDKWSPALQI 103 >gi|11359599|pir||T48741 probable ubiquitin--protein ligase [imported] - Neurospora crassa >gi|7635791|emb|CAB88557.1| (AL353819) probable ubiquitin--protein ligase [Neurospora crassa] Length = 235 Frame 2 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | | 235 0 50 100 150 200 Plus Strand HSPs: Score = 202 (71.1 bits), Expect = 2.9e-15, P = 2.9e-15 Identities = 31/61 (50%), Positives = 46/61 (75%), Frame = +2 Query: 191 FHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSP 370 F GP DSPY GG ++V +++PD YP+K PS+ I KI+HPNV ++G++CLD++ WSP Sbjct: 42 FSGPPDSPYAGGTYEVDIQIPDKYPFKPPSMYLITKIWHPNVSSVTGAICLDILGTAWSP 101 Query: 371 M 373 + Sbjct: 102 V 102 >gi|6320264 ref|NP_010344.1| ubiquitin-conjugating enzyme; Ubc5p [Saccharomyces cerevisiae] >gi|136646|sp|P15732|UBC5_YEAST UBIQUITIN-CONJUGATING ENZYME E2-16 KD (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) >gi|101686|pir||S22858 ubiquitin--protein ligase (EC 6.3.2.19) UBC5 - yeast (Saccharomyces cerevisiae) >gi|295934|emb|CAA35529.1| (X17494) ubiquitin-conjugating enzyme [Saccharomyces cerevisiae] >gi|706825|emb|CAA58975.1| (X84162) ubiquitin conjugating enzyme [Saccharomyces cerevisiae] >gi|798910|emb|CAA89088.1| (Z49209) Ubc5p [Saccharomyces cerevisiae] >gi|1431507|emb|CAA98877.1| (Z74355) ORF YDR059c [Saccharomyces cerevisiae] Length = 148 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 148 0 50 100 Plus Strand HSPs: Score = 201 (70.8 bits), Expect = 3.7e-15, P = 3.7e-15 Identities = 41/103 (39%), Positives = 61/103 (59%), Frame = +2 Query: 86 MSSPSKR--REM-DLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPD 256 MSS SKR +E+ DL + + + D + + GP+DSPY GGV+ + + P Sbjct: 1 MSS-SKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59 Query: 257 AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YP+K P + F KIYHPN++ SG++CLD++ WSP LS + Sbjct: 60 DYPFKPPKVNFTTKIYHPNINS-SGNICLDILKDQWSPALTLSKV 103 >gi|4507777 ref|NP_003331.1| ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); UbcH5C [Homo sapiens] >gi|11435728 ref|XP_003400.1| ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5) [Homo sapiens] >gi|1351345|sp|P47986|UB5C_HUMAN UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 3 (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) (E2(17)KB 3) >gi|1085588|pir||S53358 ubiquitin-conjugating enzyme E2.17kB - rat >gi|595666|gb|AAA85100.1| (U13175) ubiquitin conjugating enzyme [Rattus norvegicus] >gi|595670|gb|AAA85102.1| (U13177) ubiquitin conjugating enzyme [Rattus norvegicus] >gi|1145691|gb|AAA91461.1| (U39318) UbcH5C [Homo sapiens] >gi|6474928|dbj|BAA87330.1| (AB006852) phosphoarginine phosphatase [Rattus norvegicus] >gi|7012908|gb|AAF35234.1| (AF224669) ubiquitin-conjugating enzyme E2D 3 [Homo sapiens] Length = 147 Frame 2 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | 147 0 50 100 Plus Strand HSPs: Score = 200 (70.4 bits), Expect = 4.8e-15, P = 4.8e-15 Identities = 32/78 (41%), Positives = 48/78 (61%), Frame = +2 Query: 158 INDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSV 337 + D M + GPNDSPY GGV+ + + P YP+K P + F +IYHPN++ +GS+ Sbjct: 26 VGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSI 84 Query: 338 CLDVINQTWSPMFDLSNL 391 CLD++ WSP +S + Sbjct: 85 CLDILRSQWSPALTISKV 102 >gi|4507775 ref|NP_003330.1| ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5); UbcH5B [Homo sapiens] >gi|9910600 ref|NP_064296.1| ubiquitin conjugating enzyme 2e [Mus musculus] >gi|1717849|sp|P51669|UB5B_HUMAN UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 2 (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) (E2(17)KB 2) >gi|1085589|pir||S53359 ubiquitin conjugating enzyme (E217kB) - rat >gi|595668|gb|AAA85101.1| (U13176) ubiquitin conjugating enzyme [Rattus norvegicus] >gi|1145689|gb|AAA91460.1| (U39317) UbcH5B [Homo sapiens] >gi|1480742|gb|AAB05772.1| (U62483) ubiquitin conjugating enzyme [Mus musculus] Length = 147 Frame 2 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | 147 0 50 100 Plus Strand HSPs: Score = 200 (70.4 bits), Expect = 4.8e-15, P = 4.8e-15 Identities = 32/78 (41%), Positives = 48/78 (61%), Frame = +2 Query: 158 INDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSV 337 + D M + GPNDSPY GGV+ + + P YP+K P + F +IYHPN++ +GS+ Sbjct: 26 VGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSI 84 Query: 338 CLDVINQTWSPMFDLSNL 391 CLD++ WSP +S + Sbjct: 85 CLDILRSQWSPALTISKV 102 >gi|2136339|pir||I59365 ubiquitin conjugating enzyme - human >gi|765056|gb|AAC41750.1| (L40146) ubiquitin conjugating enzyme [Homo sapiens] >gi|1096569|prf||2111484A ubiquitin-conjugating enzyme [Homo sapiens] Length = 147 Frame 2 hits (HSPs): ___________________________ Annotated Domains: ______ __________________________________________________ Database sequence: | | | | 147 0 50 100 __________________ Annotated Domains: PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 74..88 __________________ Plus Strand HSPs: Score = 200 (70.4 bits), Expect = 4.8e-15, P = 4.8e-15 Identities = 32/78 (41%), Positives = 48/78 (61%), Frame = +2 Query: 158 INDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSV 337 + D M + GPNDSPY GGV+ + + P YP+K P + F +IYHPN++ +GS+ Sbjct: 26 VGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSI 84 Query: 338 CLDVINQTWSPMFDLSNL 391 CLD++ WSP +S + Sbjct: 85 CLDILRSQWSPALTISKV 102 >gi|6320297 ref|NP_010377.1| ubiquitin-conjugating enzyme; Ubc13p [Saccharomyces cerevisiae] >gi|1717864|sp|P52490|UBCC_YEAST UBIQUITIN-CONJUGATING ENZYME E2-17.5 KDA (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) >gi|2131382|pir||S58092 hypothetical protein YDR092w - yeast (Saccharomyces cerevisiae) >gi|914876|emb|CAA90451.1| (Z50111) unknown [Saccharomyces cerevisiae] >gi|1480355|emb|CAA67806.1| (X99443) ubiquitin-conjugating enzyme [Saccharomyces cerevisiae] Length = 153 Frame 2 hits (HSPs): _________________________________ __________________________________________________ Database sequence: | | | | | 153 0 50 100 150 Plus Strand HSPs: Score = 199 (70.1 bits), Expect = 6.1e-15, P = 6.1e-15 Identities = 40/101 (39%), Positives = 60/101 (59%), Frame = +2 Query: 86 MSSPSKRREMDLMKLMMSD----YKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELP 253 M+S KR + KL+ SD E +D ++ F V GP SPY G++++ + LP Sbjct: 1 MASLPKRIIKETEKLV-SDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLP 59 Query: 254 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDL 382 D YP ++P + F+ KIYHPN+D + G +CLDV+ WSP + Sbjct: 60 DDYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQI 101 >gi|8393719 ref|NP_057067.1| ubiquitin-conjugating enzyme HBUCE1 [Homo sapiens] >gi|4868140|gb|AAD31180.1|AF125044_1 (AF125044) ubiquitin-conjugating enzyme HBUCE1 [Homo sapiens] >gi|7022710|dbj|BAA91697.1| (AK001446) unnamed protein product [Homo sapiens] Length = 147 Frame 2 hits (HSPs): ___________________________ __________________________________________________ Database sequence: | | | | 147 0 50 100 Plus Strand HSPs: Score = 199 (70.1 bits), Expect = 6.1e-15, P = 6.1e-15 Identities = 32/78 (41%), Positives = 48/78 (61%), Frame = +2 Query: 158 INDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSV 337 + D + + GPNDSPY GGV+ + + P YP+K P + F KIYHPN++ +GS+ Sbjct: 26 VGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGSI 84 Query: 338 CLDVINQTWSPMFDLSNL 391 CLD++ WSP +S + Sbjct: 85 CLDILRSQWSPALTVSKV 102 >gi|9802775|gb|AAF99844.1|AC051629_11 (AC051629) Putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana] Length = 153 Frame 2 hits (HSPs): ________________________ __________________________________________________ Database sequence: | | | | | 153 0 50 100 150 Plus Strand HSPs: Score = 198 (69.7 bits), Expect = 7.8e-15, P = 7.8e-15 Identities = 32/73 (43%), Positives = 48/73 (65%), Frame = +2 Query: 164 DGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCL 343 + M+ F V GP SPY GGV+K+ + LP+ YP +P + F+ KIYHPN+D++ G +CL Sbjct: 32 ENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKL-GRICL 90 Query: 344 DVINQTWSPMFDL 382 D++ WSP + Sbjct: 91 DILKDKWSPALQI 103 >gi|3915196|sp|Q95044|UBCB_SPISO UBIQUITIN-CONJUGATING ENZYME E2-C (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) >gi|1493838|gb|AAB06237.1| (U52949) cyclin-specific ubiquitin carrier protein E2-C [Spisula solidissima] Length = 177 Frame 2 hits (HSPs): __________________________________ Annotated Domains: ____________________________________________ __________________________________________________ Database sequence: | | | | | 177 0 50 100 150 __________________ Annotated Domains: Entrez binding site: UBIQUITIN. 114 Entrez mutagenized site: C->S: INHIBITION OF CY 114 PFAM UQ_con: Ubiquitin-conjugating enzyme 22..172 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 22..163 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 103..117 __________________ Plus Strand HSPs: Score = 197 (69.3 bits), Expect = 9.9e-15, P = 9.9e-15 Identities = 41/118 (34%), Positives = 68/118 (57%), Frame = +2 Query: 38 RRKGKARDQPKHTQRNMSSPSKRREMDLMKLMMS-DYKVEMINDG--MQEFYVQFHGPND 208 R+K + RD +R+ S SKR + +L L+MS D + DG + ++ GP D Sbjct: 14 RQKERPRDMTTSKERH--SVSKRLQQELRTLLMSGDPGITAFPDGDNLFKWVATLDGPKD 71 Query: 209 SPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSN 388 + Y +K+ +E P YPYK P + F +HPNVD+ SG++CLD++ + W+ +D+ Sbjct: 72 TVYESLKYKLTLEFPSDYPYKPPVVKFTTPCWHPNVDQ-SGNICLDILKENWTASYDVRT 130 Query: 389 L 391 + Sbjct: 131 I 131 >gi|7493562|pir||T11716 ubiquitin conjugating enzyme - fission yeast (Schizosaccharomyces pombe) >gi|3560247|emb|CAA20714.1| (AL031532) ubiquitin conjugating enzyme [Schizosaccharomyces pombe] Length = 177 Frame 2 hits (HSPs): ___________________ Frame 1 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | 177 0 50 100 150 Plus Strand HSPs: Score = 172 (60.5 bits), Expect = 1.1e-14, Sum P(2) = 1.1e-14 Identities = 26/64 (40%), Positives = 47/64 (73%), Frame = +2 Query: 200 PNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFD 379 P++ Y GG +K R+++ D YP+ P + +NKIYHPN+D + G+VCL+++ Q W+P+ + Sbjct: 60 PDEGYYKGGKFKFRIQIDDNYPHDPPKVKCLNKIYHPNID-IEGNVCLNILRQDWNPVLN 118 Query: 380 LSNL 391 L+++ Sbjct: 119 LNSI 122 Score = 38 (13.4 bits), Expect = 1.1e-14, Sum P(2) = 1.1e-14 Identities = 9/29 (31%), Positives = 12/29 (41%), Frame = +1 Query: 22 KEKAKEKKRQSKGPTKTHTEKHVFPKQAP 108 KE KEK P + +K V + P Sbjct: 10 KEAQKEKNASGISPAQIRIQKDVTDLEIP 38 >gi|6319556 ref|NP_009638.1| ubiquitin-conjugating enzyme; Ubc4p [Saccharomyces cerevisiae] >gi|136645|sp|P15731|UBC4_YEAST UBIQUITIN-CONJUGATING ENZYME E2-16 KDA (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) >gi|101685|pir||S22857 ubiquitin--protein ligase (EC 6.3.2.19) UBC4 - yeast (Saccharomyces cerevisiae) >gi|5107650|pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme >gi|295933|emb|CAA35528.1| (X17493) ubiquitin conjugating enzyme [Saccharomyces cerevisiae] >gi|536344|emb|CAA85027.1| (Z35951) ORF YBR082c [Saccharomyces cerevisiae] >gi|974207|emb|CAA53942.1| (X76294) identical to UBC4 S.cerevisiae; ORF YBRO45 [Saccharomyces cerevisiae] Length = 148 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 148 0 50 100 Plus Strand HSPs: Score = 196 (69.0 bits), Expect = 1.3e-14, P = 1.3e-14 Identities = 41/103 (39%), Positives = 60/103 (58%), Frame = +2 Query: 86 MSSPSKR--REM-DLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPD 256 MSS SKR +E+ DL + + + D + + GP DSPY GGV+ + + P Sbjct: 1 MSS-SKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPT 59 Query: 257 AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 YP+K P I F KIYHPN++ +G++CLD++ WSP LS + Sbjct: 60 DYPFKPPKISFTTKIYHPNINA-NGNICLDILKDQWSPALTLSKV 103 >gi|4507793 ref|NP_003339.1| ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13) [Homo sapiens] >gi|12737571 ref|XP_006823.2| ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13) [Homo sapiens] >gi|2501432|sp|Q16781|UBCC_HUMAN UBIQUITIN-CONJUGATING ENZYME E2-17 KDA (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) (UBC13) >gi|2146981|pir||JC4894 ubiquitin--protein ligase (EC 6.3.2.19) E2N - human >gi|1181558|dbj|BAA11675.1| (D83004) ubiquitin-conjugating enzyme E2 UbcH-ben [Homo sapiens] >gi|12653255|gb|AAH00396.1|AAH00396 (BC000396) ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13) [Homo sapiens] Length = 152 Frame 2 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | || 152 0 50 100 150 Plus Strand HSPs: Score = 196 (69.0 bits), Expect = 1.3e-14, P = 1.3e-14 Identities = 33/79 (41%), Positives = 49/79 (62%), Frame = +2 Query: 146 KVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 325 K E + F+V GP DSP+ GG +K+ + LP+ YP +P + F+ KIYHPNVD++ Sbjct: 24 KAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL 83 Query: 326 SGSVCLDVINQTWSPMFDL 382 G +CLD++ WSP + Sbjct: 84 -GRICLDILKDKWSPALQI 101 >gi|1717856|sp|P52486|UBC4_DROME UBIQUITIN-CONJUGATING ENZYME E2-22 KD (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) Length = 199 Frame 2 hits (HSPs): ___________________________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | 199 0 50 100 150 __________________ Annotated Domains: BLOCKS BL00183: Ubiquitin-conjugating enzymes p 48..95 DOMO DM00225: UBIQUITIN-CONJUGATINGENZYMES 2..153 DOMO DM05814: 155..198 Entrez binding site: UBIQUITIN (BY SIMILARITY). 92 PFAM UQ_con: Ubiquitin-conjugating enzyme 4..151 PFAM UBA: UBA domain 161..199 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 5..148 PRODOM PD030862: P91633(1) UBC4(1) 150..198 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 80..95 __________________ Plus Strand HSPs: Score = 196 (69.0 bits), Expect = 1.3e-14, P = 1.3e-14 Identities = 33/104 (31%), Positives = 62/104 (59%), Frame = +2 Query: 83 NMS-SPSKRREMDLMK---LMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVEL 250 NM+ S KR ++M+ ++ K+E++N + E + GP D+PY GG + + +++ Sbjct: 3 NMAVSRIKREFKEVMRSEEIVQCSIKIELVNGQLTELRGEIAGPPDTPYEGGKFVLEIKV 62 Query: 251 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDL 382 P+ YP+ P FI +I+HPN+ ++G++CLD++ W+ L Sbjct: 63 PETYPFNPPKARFITRIWHPNISSVTGAICLDILKDNWAAAMTL 106 >gi|12249089|dbj|BAB20414.1| (AB032739) bendless protein [Rattus norvegicus] Length = 152 Frame 2 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | || 152 0 50 100 150 Plus Strand HSPs: Score = 196 (69.0 bits), Expect = 1.3e-14, P = 1.3e-14 Identities = 33/79 (41%), Positives = 49/79 (62%), Frame = +2 Query: 146 KVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 325 K E + F+V GP DSP+ GG +K+ + LP+ YP +P + F+ KIYHPNVD++ Sbjct: 24 KAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL 83 Query: 326 SGSVCLDVINQTWSPMFDL 382 G +CLD++ WSP + Sbjct: 84 -GRICLDILKDKWSPALQI 101 >gi|89812|pir||A40797 ubiquitin-conjugating enzyme - bovine >gi|233966|gb|AAB19536.1| (S51016) E2(25K)=multiubiquitinating enzyme [cattle, thymus, Peptide, 200 aa] [Bos taurus] Length = 200 Frame 2 hits (HSPs): _____________________ Annotated Domains: _____ __________________________________________________ Database sequence: | | | | | 200 0 50 100 150 __________________ Annotated Domains: PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 80..95 __________________ Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 1.6e-14, P = 1.6e-14 Identities = 27/79 (34%), Positives = 52/79 (65%), Frame = +2 Query: 146 KVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 325 KV+++++ E + GP D+PY GG +++ +++P+ YP+ P + FI KI+HPN+ + Sbjct: 28 KVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSV 87 Query: 326 SGSVCLDVINQTWSPMFDL 382 +G++CLD++ W+ L Sbjct: 88 TGAICLDILKDQWAAAMTL 106 >gi|464986|sp|P35132|UBC9_ARATH UBIQUITIN-CONJUGATING ENZYME E2-17 KD 9 (UBIQUITIN-PROTEIN LIGASE 9) (UBIQUITIN CARRIER PROTEIN 9) (UBCAT4B) >gi|421857|pir||S32674 ubiquitin--protein ligase (EC 6.3.2.19) UBC9 - Arabidopsis thaliana >gi|297884|emb|CAA78714.1| (Z14990) ubiquitin conjugating enzyme homolog [Arabidopsis thaliana] >gi|349211|gb|AAA32894.1| (L00639) ubiquitin conjugating enzyme [Arabidopsis thaliana] >gi|600391|emb|CAA51201.1| (X72626) ubiquitin conjugating enzyme E2 [Arabidopsis thaliana] >gi|4455355|emb|CAB36765.1| (AL035524) ubiquitin-protein ligase UBC9 [Arabidopsis thaliana] >gi|7269650|emb|CAB79598.1| (AL161572) ubiquitin-protein ligase UBC9 [Arabidopsis thaliana] Length = 148 Frame 2 hits (HSPs): ___________________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | 148 0 50 100 __________________ Annotated Domains: BLOCKS BL00183: Ubiquitin-conjugating enzymes p 42..89 Entrez binding site: UBIQUITIN (BY SIMILARITY). 85 PFAM UQ_con: Ubiquitin-conjugating enzyme 1..144 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 2..143 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 74..88 __________________ Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 1.6e-14, P = 1.6e-14 Identities = 37/100 (37%), Positives = 59/100 (59%), Frame = +2 Query: 98 SKR--REM-DLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPY 268 SKR +E+ DL K + + + M + GP+DSPY GGV+ V + P YP+ Sbjct: 3 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPF 62 Query: 269 KSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 K P + F K++HPN++ +GS+CLD++ + WSP +S + Sbjct: 63 KPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKV 102 >gi|4885417 ref|NP_005330.1| huntingtin interacting protein 2; ubiquitin-conjugating enzyme E2-25 KDA; ubiquitin-protein ligase; ubiquitin carrier protein [Homo sapiens] >gi|11435922 ref|XP_003428.1| huntingtin interacting protein 2 [Homo sapiens] >gi|2507504|sp|P27924|UBC1_HUMAN UBIQUITIN-CONJUGATING ENZYME E2-25 KDA (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) (HUNTINGTIN INTERACTING PROTEIN) (HIP-2) >gi|1381164|gb|AAC50633.1| (U58522) huntingtin interacting protein [Homo sapiens] >gi|4996608|dbj|BAA78555.1| (AB022435) E2 ubiquitin-conjugating enzyme [Homo sapiens] Length = 200 Frame 2 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | 200 0 50 100 150 Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 1.6e-14, P = 1.6e-14 Identities = 27/79 (34%), Positives = 52/79 (65%), Frame = +2 Query: 146 KVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 325 KV+++++ E + GP D+PY GG +++ +++P+ YP+ P + FI KI+HPN+ + Sbjct: 28 KVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSV 87 Query: 326 SGSVCLDVINQTWSPMFDL 382 +G++CLD++ W+ L Sbjct: 88 TGAICLDILKDQWAAAMTL 106 >gi|7949049 ref|NP_058066.1| huntingtin interacting protein 2 [Mus musculus] >gi|2897818|dbj|BAA24927.1| (AB011081) huntingtin interacting protein-2 [Mus musculus] Length = 200 Frame 2 hits (HSPs): _____________________ __________________________________________________ Database sequence: | | | | | 200 0 50 100 150 Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 1.6e-14, P = 1.6e-14 Identities = 27/79 (34%), Positives = 52/79 (65%), Frame = +2 Query: 146 KVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 325 KV+++++ E + GP D+PY GG +++ +++P+ YP+ P + FI KI+HPN+ + Sbjct: 28 KVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSV 87 Query: 326 SGSVCLDVINQTWSPMFDL 382 +G++CLD++ W+ L Sbjct: 88 TGAICLDILKDQWAAAMTL 106 >gi|11762186|gb|AAG40371.1|AF325019_1 (AF325019) AT4g27960 [Arabidopsis thaliana] Length = 178 Frame 2 hits (HSPs): _____________________________ __________________________________________________ Database sequence: | | | | | 178 0 50 100 150 Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 1.6e-14, P = 1.6e-14 Identities = 37/100 (37%), Positives = 59/100 (59%), Frame = +2 Query: 98 SKR--REM-DLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPY 268 SKR +E+ DL K + + + M + GP+DSPY GGV+ V + P YP+ Sbjct: 33 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPF 92 Query: 269 KSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 K P + F K++HPN++ +GS+CLD++ + WSP +S + Sbjct: 93 KPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKV 132 >gi|12643427|sp|P35134|UBCB_ARATH UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 11 (UBIQUITIN-PROTEIN LIGASE 11) (UBIQUITIN CARRIER PROTEIN 11) >gi|12322738|gb|AAG51362.1|AC012562_23 (AC012562) putative ubiquitin conjugating enzyme; 52410-53412 [Arabidopsis thaliana] Length = 148 Frame 2 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | | 148 0 50 100 Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 1.6e-14, P = 1.6e-14 Identities = 38/100 (38%), Positives = 59/100 (59%), Frame = +2 Query: 98 SKR--REM-DLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPY 268 SKR +E+ DL K S+ + + M + GP +SPY GGV+ V + P YP+ Sbjct: 3 SKRILKELKDLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPF 62 Query: 269 KSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLSNL 391 K P + F K+YHPN++ +GS+CLD++ + WSP +S + Sbjct: 63 KPPKVSFKTKVYHPNINS-NGSICLDILKEQWSPALTISKV 102 >gi|2501431|sp|P70711|UB5D_RAT UBIQUITIN-CONJUGATING ENZYME E2-17 KD 4 (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN) (E2(17)KB 4) >gi|1515423|gb|AAC52942.1| (U56407) Ubiquitin conjugating enzyme [Rattus norvegicus] Length = 147 Frame 2 hits (HSPs): ___________________________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | 147 0 50 100 __________________ Annotated Domains: Entrez binding site: UBIQUITIN (BY SIMILARITY). 85 PFAM UQ_con: Ubiquitin-conjugating enzyme 1..144 PRODOM PD000461: UBC2(10) UBC4(7) UBC7(7) 2..143 PROSITE UBIQUITIN_CONJUGAT: Ubiquitin-conjugatin 74..88 __________________ Plus Strand HSPs: Score = 194 (68.3 bits), Expect = 2.1e-14, P = 2.1e-14 Identities = 31/78 (39%), Positives = 48/78 (61%), Frame = +2 Query: 158 INDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSV 337 + + M + GPNDSPY GG + + ++ P YP+K P + F +IYHPNV+ +GS+ Sbjct: 26 VGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNS-NGSI 84 Query: 338 CLDVINQTWSPMFDLSNL 391 CLD++ WSP +S + Sbjct: 85 CLDILRSQWSPALTISKV 102 WARNING: HSPs involving 262 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.96 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.358 0.155 0.580 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.322 0.136 0.421 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.347 0.152 0.563 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.341 0.147 0.553 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.346 0.151 0.522 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.363 0.165 0.606 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 136 135 10. 73 3 12 22 0.11 33 30 0.099 36 +2 0 136 135 10. 73 3 12 22 0.11 33 30 0.099 36 +1 0 136 135 10. 73 3 12 22 0.11 33 30 0.099 36 -1 0 136 136 10. 73 3 12 22 0.11 33 30 0.10 36 -2 0 136 135 10. 73 3 12 22 0.11 33 30 0.099 36 -3 0 136 135 10. 73 3 12 22 0.11 33 30 0.099 36 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 312 No. of states in DFA: 589 (58 KB) Total size of DFA: 199 KB (256 KB) Time to generate neighborhood: 0.00u 0.01s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 150.07u 1.32s 151.39t Elapsed: 00:00:26 Total cpu time: 150.12u 1.34s 151.46t Elapsed: 00:00:26 Start: Wed Feb 6 12:06:05 2002 End: Wed Feb 6 12:06:31 2002 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000