Search Results

Basic Search | Intermediate Search | Gene Image Map | Home

Treponema denticola Search Results

Record: 1 of 1 MiniMap

Gene ID:TDE0592DNA Molecule Name: 1 GenBank ID: 42526108Gene Name: bccP fabE accB Definition: biotin carboxyl carrier protein of acetyl-CoA carboxylaseCellular Location: Periplasm [Evidence]Gene Start: 632028Gene Stop: 631456Gene Length: 573Molecular Weight*: 20031pI*:Net Charge*:EC: 6.4.1.2 Functional Class: Fatty acid and phospholipid metabolism; Other Gene Ontology:Pathway: pathway table Fatty acid biosynthesis (path 1) Propanoate metabolism Pyruvate metabolism Tetracycline biosynthesisSecondary Evidence: Chuakrut S, Arai H, Ishii M, Igarashi Y. Characterization of a bifunctional archaeal acyl coenzyme A carboxylase. J Bacteriol. 2003 Feb;185(3):938-47. PMID: 12533469 Cronan JE, Waldrop GL. Multi-subunit acetyl-CoA carboxylases. Prog Lipid Res. 2002 Sep;41(5):407-35. PMID: 12121720Comment: Related 'fab' genes are 3-oxoacyl-(acyl-carrier-protein) synthase I (fabB/fabF) TDE0038, synthase III (fabH) TDE0240 and TDE0602, reductase (fabG) TDE0598, malonyl-CoA:Acyl carrier protein transacylase (fabD) TDE0601, 3-hydroxydecanoyl-(acyl-carrier-protein) dehydratase (fabA/fabZ) TDE0823, as well as an acyl carrier protein (acpP) TDE1026. Related 'acc' genes are the acetyl-CoA carboxylase, biotin carboxylase subunit (accC) TDE0591, acetyl-CoA carboxylase beta subunit (accD) TDE0590 and the alpha subunit (accA) TDE0589.View in HOMD Genome ViewerBlast Summary: PSI-Blast Search TDE0592 has no significant similarity (BLAST p-value < 1e-03) to a Treponema pallidum gene. TDE0592 has no significant similarity (BLAST p-value < 1e-3) to a Borrelia burgdorferi gene.Top Blast Hits: Updated monthly Click here to view the entire PsiBlast results. gi|42526108|ref|NP_971206.1| acetyl-CoA carboxylase, biotin... 295 9e-79 gi|114566109|ref|YP_753263.1| oxaloacetate decarboxylase, a... 104 3e-21 gi|147677509|ref|YP_001211724.1| hypothetical protein PTH_1... 103 5e-21 gi|83699281|dbj|BAE54378.1| pyruvate carboxylase biotin-con... 102 9e-21 gi|83590368|ref|YP_430377.1| acetyl-CoA carboxylase, biotin... 102 1e-20 gi|87301581|ref|ZP_01084421.1| acetyl-CoA carboxylase, biot... 100 5e-20 gi|84518928|ref|ZP_01006277.1| acetyl-CoA biotin carboxyl c... 100 7e-20 gi|52840708|ref|YP_094507.1| acetyl CoA carboxylase, biotin... 100 8e-20 gi|113953615|ref|YP_729272.1| acetyl-CoA carboxylase, bioti... 99 9e-20 gi|78188338|ref|YP_378676.1| Acetyl-CoA biotin carboxyl car... 99 2e-19COGS Summary: COGS Search No hits to the COGs database.Blocks Summary: Blocks Search Significant hit ( 2.7e-21) to 3/3 blocks of the PR01071 family, which is described as "Acetyl-CoA biotin carboxyl carrier protein signature". Prints database entry for PR01071. PR01071A 118-131 4.4e-09 PR01071B 135-149 0.00034 PR01071C 150-163 0.00014 Significant hit ( 1.1e-09) to 1/8 blocks of the IPB001882 family, which is described as "Biotin-requiring enzymes attachment site.". Interpro entry for IPR001882. IPB001882H 126-171 1e-09 Significant hit ( 9.1e-07) to 1/1 blocks of the IPB003016 family, which is described as "2-oxo acid dehydrogenases acyltransferase component lipoyl binding site". Interpro entry for IPR003016. IPB003016 137-171 8.8e-07ProDom Summary: Protein Domain Search Residues 116 to 188 match (3e-19) PD:PD000268 which is described as COMPLETE PROTEOME BIOTIN PYRUVATE DIHYDROLIPOAMIDE CARBOXYLASE TRANSFERASE DEHYDROGENASE LIPOYL COMPONENTParalogs: Local Blast Search TDE0592 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.Pfam Summary: Pfam Search Residues 114 to 188 (E-value = 1.9e-31) place TDE0592 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)Top PDB Hits: PDB hits to TDE0592 from Psi-BLAST round 5 vs. nr database 35.9% similar to PDB:3BDO Solution Structure Of Apo-Biotinyl Domain From Acetyl Coenzyme A Carboxylase Of (Chain A; 2e-20) 35.9% similar to PDB:1BDO Structure Of The Biotinyl Domain Of Acetyl-Coenzyme A Carboxylase Determined By (2e-20) 35.9% similar to PDB:2BDO Solution Structure Of Holo-Biotinyl Domain From Acetyl Coenzyme A Carboxylase Of (Chain A; 2e-20) 36.4% similar to PDB:1A6X Structure Of The Apo-Biotin Carboxyl Carrier Protein (Apo-Bccp87) Of Escherichia (5e-20) 25.7% similar to PDB:1DD2 Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) (Chain A; 5e-05) 25.7% similar to PDB:1DCZ Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) (Chain A; 5e-05) 25.7% similar to PDB:1O78 Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutan (Chain A; 5e-05)Gene Protein Sequence: MKEDFILKVIEKFEKGDAVVLQIKQDDCELILKKEGAFPKKEAAIQSGAC GGVQTAYPMPYAAIPAGFQSGLPAGIPTAPAGTTGQAAAPQAASPAAESP AQASPAASSAQNLLEVKSPIVGTFYRAPSPDSPPYVEKGSSVKKGQPLCV LEAMKMMNTLECEYDGVIEEILVSNGDLVEFDQVLFKIKAKGene Nucleotide Sequence: Sequence Viewer ATGAAAGAAGATTTTATTTTGAAAGTGATAGAAAAGTTTGAAAAAGGCGA TGCTGTGGTCCTGCAGATAAAGCAGGACGACTGTGAGCTTATCTTAAAAA AAGAAGGAGCCTTTCCTAAAAAAGAAGCTGCCATTCAGTCAGGTGCGTGC GGAGGAGTGCAGACCGCCTATCCTATGCCCTATGCAGCGATACCGGCAGG ATTTCAATCCGGCCTTCCGGCGGGCATCCCGACAGCTCCGGCAGGAACAA CCGGGCAAGCGGCAGCGCCTCAAGCAGCAAGTCCTGCTGCAGAATCTCCT GCTCAAGCATCACCCGCAGCTTCATCGGCTCAAAACCTACTCGAAGTAAA AAGCCCCATTGTCGGAACCTTTTACAGGGCCCCGTCTCCCGATTCTCCGC CCTATGTTGAAAAAGGCAGCTCGGTAAAAAAAGGCCAACCCCTTTGTGTG CTTGAAGCCATGAAAATGATGAATACCCTCGAATGCGAATATGACGGAGT TATCGAGGAAATCTTAGTTTCAAACGGAGACCTTGTAGAATTCGATCAGG TCTTGTTTAAGATAAAGGCTAAG

Los Alamos National Laboratory • Est 1943