WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A08H01_CONSENSUS (179 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 16 Sequences : less than 16 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 5467 166 |========== 6310 5301 777 |================================================ 3980 4524 729 |============================================= 2510 3795 985 |============================================================= 1580 2810 747 |============================================== 1000 2063 625 |======================================= 631 1438 466 |============================= 398 972 324 |==================== 251 648 219 |============= 158 429 135 |======== 100 294 85 |===== 63.1 209 55 |=== 39.8 154 57 |=== 25.1 97 20 |= 15.8 77 16 |= >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 61 <<<<<<<<<<<<<<<<< 10.0 61 13 |: 6.31 48 3 |: 3.98 45 5 |: 2.51 40 3 |: 1.58 37 4 |: 1.00 33 1 |: 0.63 32 2 |: 0.40 30 1 |: 0.25 29 1 |: 0.16 28 0 | 0.10 28 0 | 0.063 28 0 | 0.040 28 1 |: 0.025 27 1 |: 0.016 26 0 | 0.010 26 0 | 0.0063 26 0 | 0.0040 26 0 | 0.0025 26 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|485515|pir||S33622ADR6 protein - soybean >gi|29644... +2 163 6.0e-11 1 gi|7488713|pir||T08896Sali3-2 protein, aluminium-indu... +2 155 5.3e-10 1 gi|560554|gb|AAB31222.1|(S71728) truncated protein [S... -1 122 8.6e-07 1 gi|560556|gb|AAB31223.1|(S71730) influenza virus hema... -1 122 8.6e-07 1 gi|773414|gb|AAB05989.1|(U23751) beta galactosidase [... -1 122 8.6e-07 1 gi|7384996|gb|AAF61634.1|(AF153422) lacZ [Cloning vec... -1 122 8.6e-07 1 gi|9294786|gb|AAF86670.1|AF178449_1(AF178449) beta-ga... -1 122 8.6e-07 1 gi|7489187|pir||T02229protein BYJ15 - common tobacco ... +1 121 1.1e-06 1 gi|762925|emb|CAA59990.1|(X85998) elastin like protei... +2 118 2.3e-06 1 gi|119097|sp|P21747|EA92_VICFAEMBRYONIC ABUNDANT PROT... +2 122 2.6e-06 1 gi|100102|pir||S14068seed protein precursor - tick be... +2 119 5.7e-06 1 gi|135067|sp|P09059|SVF3_VICFAUNKNOWN SEED PROTEIN 30... +2 119 5.7e-06 1 gi|119096|sp|P21746|EA87_VICFAEMBRYONIC ABUNDANT PROT... +2 119 5.7e-06 1 gi|119095|sp|P21745|EA30_VICFAEMBRYONIC ABUNDANT PROT... +2 119 5.7e-06 1 gi|4028979|emb|CAA06470.1|(AJ005323) glutamate permea... -1 122 7.6e-06 1 gi|2129886|pir||S70755hypothetical protein - garden p... +2 115 9.3e-06 1 gi|7489188|pir||T02232protein BYJ6 - common tobacco (... +1 108 2.6e-05 1 gi|11993889|gb|AAG42155.1|(AY012159) virion-associate... +1 117 3.6e-05 1 gi|3402817|emb|CAA07704.1|(AJ007829) lacZ' [Cloning v... +2 100 0.00018 1 gi|9294789|gb|AAF86672.1|AF178450_1(AF178450) beta-ga... +2 100 0.00018 1 gi|7488827|pir||T06815probable embryonic abundant pro... +2 102 0.00028 1 gi|560558|gb|AAB31224.1|(S71742) influenza virus hema... -3 95 0.00062 1 gi|560560|gb|AAB31225.1|(S71745) influenza virus hema... -3 95 0.00062 1 gi|10281475|gb|AAG15510.1|U56995_1(U56995) mutant gre... +2 100 0.00092 1 gi|1684629|emb|CAA70550.1|(Y09374) lacZ-PhoC [synthet... +2 100 0.0010 1 gi|4028981|emb|CAA06471.1|(AJ005324) glutamate permea... +2 100 0.0018 1 gi|7489022|pir||T07178hypothetical protein SEND35, se... +2 80 0.024 1 gi|1172874|sp|Q08298|RD22_ARATHDEHYDRATION-RESPONSIVE... +2 76 0.028 2 gi|7649667|emb|CAB88874.1|(AJ005810) phosphatidylinos... +2 82 0.17 1 gi|126465|sp|P17588|LRP1_HSV1FLATENCY-RELATED PROTEIN... -3 43 0.23 3 gi|7106540|dbj|BAA92225.1|(AB038692) similar to the B... +2 69 0.33 1 gi|6319835ref|NP_009916.1| Protein with RNA recogniti... +1 42 0.43 3 gi|8052392|emb|CAB92249.1|(AL356595) putative single-... -1 45 0.51 2 gi|11277059|pir||T499002-oxoglutarate/malate transloc... +3 44 0.63 3 gi|7433739|pir||E72096[acyl-carrier-protein] S-malony... +2 72 0.66 1 gi|8978671|dbj|BAA98507.1|(AP002546) malonyl acyl car... +2 72 0.66 1 gi|1773024|gb|AAB40147.1|(U63336) MHC Class I region ... -1 51 0.71 2 gi|4336338|gb|AAD17764.1|(AF082394) rev protein [Huma... -1 45 0.80 2 gi|2108238|gb|AAB63364.1|(U97360) HFLK homolog [Trepo... -1 67 0.89 1 gi|7488674|pir||T07623extensin homolog HRGP2 - soybea... -1 65 0.90 1 gi|8927178|gb|AAF81989.1|AF178695_1(AF178695) gp15 an... +1 43 0.94 2 gi|7487811|pir||T00609hypothetical protein T8K22.16 -... -1 55 0.96 2 gi|2231161|gb|AAB61958.1|(L81159) immunoglobulin mu [... +2 63 0.96 1 gi|7476650|pir||B70553hypothetical protein Rv1137c - ... -3 41 0.96 2 gi|12328470|dbj|BAB21130.1|(AP002872) hypothetical pr... +1 45 0.97 2 gi|3093383|emb|CAA06601.1|(AJ005572) hypothetical pro... +1 63 0.990 1 gi|11346107|pir||H82787hypothetical protein XF0574 [i... -2 44 0.991 2 gi|100210|pir||S25299extensin precursor - tomato >gi|... -1 53 0.996 2 gi|7715060|gb|AAF67846.1|AF214016_2(AF214016) molybde... -3 43 0.999 2 gi|436130|emb|CAA54082.1|(X76634) ribulose-1,5-bispho... +3 57 0.999 1 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|6319835 | ___________________ gi|11277059 | _________________ gi|436130 | ________________ __________________________________________________ Query sequence: | | | | 60 0 20 40 Locus_ID Frame 2 Hits gi|485515 | ____________________________ gi|7488713 | _____________________________ gi|762925 | _______________________________ gi|119097 | _______________________________ gi|100102 | _______________________________ gi|135067 | _______________________________ gi|119096 | _______________________________ gi|119095 | _______________________________ gi|2129886 | _______________________________ gi|3402817 | _________________ gi|9294789 | _________________ gi|7488827 | _______________________________ gi|10281475 | _________________ gi|1684629 | _________________ gi|4028981 | _________________ gi|7489022 | ________________________ gi|1172874 | _______________________ gi|7649667 | _______________________ gi|7106540 | ________________________ gi|11277059 |_________________ gi|7433739 | _________________________________________ gi|8978671 | _________________________________________ gi|8927178 |___________ gi|2231161 | __________ gi|12328470 |___________________ __________________________________________________ Query sequence: | | | | 60 0 20 40 Locus_ID Frame 1 Hits gi|7489187 | ___________________ gi|7489188 | _________________ gi|11993889 | __________________ gi|1172874 | __________ gi|6319835 | _________ ___________ gi|11277059 | _________ gi|8927178 | __________________________ gi|12328470 | ____________________________ gi|3093383 | ____________ __________________________________________________ Query sequence: | | | | 60 0 20 40 Locus_ID Frame -1 Hits gi|560554 | ____________________ gi|560556 | ____________________ gi|773414 | ____________________ gi|7384996 | ____________________ gi|9294786 | ____________________ gi|4028979 | ____________________ gi|8052392 | ________________ gi|1773024 | _______________________________ gi|4336338 | _______________ gi|2108238 | _________________ gi|7488674 | __________________________________ gi|7487811 | __________ _____________ gi|100210 | _________________________________ __________________________________________________ Query sequence: | | | | 60 0 20 40 Locus_ID Frame -2 Hits gi|126465 |___________ gi|8052392 | _______________________ gi|7476650 | ____________________ gi|11346107 | ______________________________ gi|7715060 | ________ __________________________________________________ Query sequence: | | | | 60 0 20 40 Locus_ID Frame -3 Hits gi|560558 | _________________ gi|560560 | _________________ gi|126465 | ________________________________ gi|4336338 | _______________ gi|7476650 |_________________ gi|11346107 | ___________ gi|7715060 |____________________________________ __________________________________________________ Query sequence: | | | | 60 0 20 40
Use the
and
icons to retrieve links to Entrez:
WARNING: Descriptions of 11 database sequences were not reported due to the limiting value of parameter V = 50.>gi|485515|pir||S33622 ADR6 protein - soybean >gi|296445|emb|CAA49340.1| (X69639) auxin down regulated [Glycine max] >gi|2304955|gb|AAB65592.1| (U64866) similar to ADR6 encoded by GenBank Accession Number X69639; aluminum induced [Glycine max] Length = 272 Frame 2 hits (HSPs): _______ Annotated Domains: _____________________________________________ __________________________________________________ Database sequence: | | | | | | | 272 0 50 100 150 200 250 __________________ Annotated Domains: DOMO DM02982: 18..258 __________________ Plus Strand HSPs: Score = 163 (57.4 bits), Expect = 6.0e-11, P = 6.0e-11 Identities = 32/32 (100%), Positives = 32/32 (100%), Frame = +2 Query: 83 VRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 VRETTAFMVPLVAGDGTKTQALAICHSNTSGM Sbjct: 196 VRETTAFMVPLVAGDGTKTQALAICHSNTSGM 227
>gi|7488713|pir||T08896 Sali3-2 protein, aluminium-induced - soybean >gi|2317900|gb|AAB66369.1| (U89693) Sali3-2 [Glycine max] Length = 276 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | | | 276 0 50 100 150 200 250 Plus Strand HSPs: Score = 155 (54.6 bits), Expect = 5.3e-10, P = 5.3e-10 Identities = 29/33 (87%), Positives = 33/33 (100%), Frame = +2 Query: 80 RVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 +VRETTAF+VPLVAGDGTKTQALA+CHS+TSGM Sbjct: 199 KVRETTAFVVPLVAGDGTKTQALAVCHSDTSGM 231
>gi|560554|gb|AAB31222.1| (S71728) truncated protein [Saccharomyces cerevisiae] Length = 33 Frame -1 hits (HSPs): ___________________________________ __________________________________________________ Database sequence: | | | 33 0 20 Minus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.6e-07, P = 8.6e-07 Identities = 21/23 (91%), Positives = 22/23 (95%), Frame = -1 Query: 83 LVPNSCSPGDPLVLERPPPRWSS 15 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 8 LISNSCSPGDPLVLERPPPRWSS 30
>gi|560556|gb|AAB31223.1| (S71730) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal, frame 1} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 45 aa] Length = 45 Frame -1 hits (HSPs): _________________________ __________________________________________________ Database sequence: | | | | 45 0 20 40 Minus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.6e-07, P = 8.6e-07 Identities = 21/23 (91%), Positives = 22/23 (95%), Frame = -1 Query: 83 LVPNSCSPGDPLVLERPPPRWSS 15 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 20 LISNSCSPGDPLVLERPPPRWSS 42
>gi|773414|gb|AAB05989.1| (U23751) beta galactosidase [Cloning vector pBBR1MCS-2] >gi|833819|gb|AAB06689.1| (U25059) LacZ alpha peptide [Cloning vector pBBR1MCS-3] >gi|833823|gb|AAB06692.1| (U25060) LacZ alpha peptide [Cloning vector pBBR1MCS-4] >gi|833827|gb|AAB06695.1| (U25061) LacZ alpha peptide [Cloning vector pBBR1MCS-5] Length = 121 Frame -1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 121 0 50 100 Minus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.6e-07, P = 8.6e-07 Identities = 21/23 (91%), Positives = 22/23 (95%), Frame = -1 Query: 83 LVPNSCSPGDPLVLERPPPRWSS 15 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55
>gi|7384996|gb|AAF61634.1| (AF153422) lacZ [Cloning vector pTG8] Length = 197 Frame -1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 197 0 50 100 150 Minus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.6e-07, P = 8.6e-07 Identities = 21/23 (91%), Positives = 22/23 (95%), Frame = -1 Query: 83 LVPNSCSPGDPLVLERPPPRWSS 15 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 36 LISNSCSPGDPLVLERPPPRWSS 58
>gi|9294786|gb|AAF86670.1|AF178449_1 (AF178449) beta-galactosidase alpha peptide [Integration vector pCD11PKS] >gi|9294795|gb|AAF86676.1|AF178452_1 (AF178452) beta-galactosidase alpha peptide [Integration vector pCD13PKS] Length = 127 Frame -1 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Minus Strand HSPs: Score = 122 (42.9 bits), Expect = 8.6e-07, P = 8.6e-07 Identities = 21/23 (91%), Positives = 22/23 (95%), Frame = -1 Query: 83 LVPNSCSPGDPLVLERPPPRWSS 15 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55
>gi|7489187|pir||T02229 protein BYJ15 - common tobacco (fragment) >gi|2280518|dbj|BAA21615.1| (AB005878) BYJ15 [Nicotiana tabacum] Length = 172 Frame 1 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 Plus Strand HSPs: Score = 121 (42.6 bits), Expect = 1.1e-06, P = 1.1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%), Frame = +1 Query: 16 ELHRGGGRSRTSGSPGLQEFGTS 84 ELHRGGGRSRTSGSPGLQEFGTS Sbjct: 2 ELHRGGGRSRTSGSPGLQEFGTS 24
>gi|762925|emb|CAA59990.1| (X85998) elastin like protein [Drosophila melanogaster] Length = 110 Frame 2 hits (HSPs): _________________ __________________________________________________ Database sequence: | | | | | | | 110 0 20 40 60 80 100 Plus Strand HSPs: Score = 118 (41.5 bits), Expect = 2.3e-06, P = 2.3e-06 Identities = 26/36 (72%), Positives = 27/36 (75%), Frame = +2 Query: 17 SSTAVAAALELVDPPGCRNSARVRETTAFMVPLVAG 124 SSTAVAAALELVDPPGCRNSAR R+ L AG Sbjct: 2 SSTAVAAALELVDPPGCRNSARDRQRANLNSQLYAG 37
>gi|119097|sp|P21747|EA92_VICFA EMBRYONIC ABUNDANT PROTEIN USP92 PRECURSOR >gi|82002|pir||S04136 embryonic abundant protein precursor (clone pUSP92) - tick bean >gi|22051|emb|CAA31602.1| (X13210) USP precursor [Vicia faba] Length = 268 Frame 2 hits (HSPs): ________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | | 268 0 50 100 150 200 250 __________________ Annotated Domains: Entrez Domain: 3 X 6 AA APPROXIMATE REPEATS. 50..106 Entrez Repetitive region: 1-1. 50..55 Entrez Repetitive region: 1-2. 83..88 Entrez Repetitive region: 1-3. 101..106 Entrez Domain: 2 X APPROXIMATE REPEATS. 166..222 Entrez Repetitive region: 2-1. 166..183 Entrez Repetitive region: 2-2. 202..222 Entrez glycosylation site: POTENTIAL. 259 PRODOM PD009870: 1..79 PRODOM PD013884: 86..126 PRODOM PD004669: 128..256 __________________ Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 2.6e-06, P = 2.6e-06 Identities = 23/36 (63%), Positives = 29/36 (80%), Frame = +2 Query: 71 NSARVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 N +VRETTA++V LVA DGTKT+AL +CH +T GM Sbjct: 192 NCHQVRETTAYVVSLVASDGTKTKALTVCHHDTRGM 227
>gi|100102|pir||S14068 seed protein precursor - tick bean >gi|22043|emb|CAA39696.1| (X56240) unknown seed protein [Vicia faba] Length = 268 Frame 2 hits (HSPs): ________ Annotated Domains: ____ __________________________________________________ Database sequence: | | | | | | | 268 0 50 100 150 200 250 __________________ Annotated Domains: Entrez domain: signal sequence 1..22 __________________ Plus Strand HSPs: Score = 119 (41.9 bits), Expect = 5.7e-06, P = 5.7e-06 Identities = 22/36 (61%), Positives = 29/36 (80%), Frame = +2 Query: 71 NSARVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 N +VR+TTA++V LVA DGTKT+AL +CH +T GM Sbjct: 192 NCHQVRDTTAYVVSLVASDGTKTKALTVCHHDTRGM 227
>gi|135067|sp|P09059|SVF3_VICFA UNKNOWN SEED PROTEIN 30.1 PRECURSOR (VF30.1) >gi|82000|pir||S03328 embryonic abundant protein precursor (clone pUSP14) - tick bean >gi|22046|emb|CAA31626.1| (X13242) seed protein [Vicia faba] Length = 268 Frame 2 hits (HSPs): ________ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | | | 268 0 50 100 150 200 250 __________________ Annotated Domains: PRODOM PD009870: 1..79 PRODOM PD013884: 86..126 PRODOM PD004669: 128..256 __________________ Plus Strand HSPs: Score = 119 (41.9 bits), Expect = 5.7e-06, P = 5.7e-06 Identities = 22/36 (61%), Positives = 29/36 (80%), Frame = +2 Query: 71 NSARVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 N +VR+TTA++V LVA DGTKT+AL +CH +T GM Sbjct: 192 NCHQVRDTTAYVVSLVASDGTKTKALTVCHHDTRGM 227
>gi|119096|sp|P21746|EA87_VICFA EMBRYONIC ABUNDANT PROTEIN USP87 PRECURSOR >gi|82001|pir||S04135 embryonic abundant protein precursor (clone pUSP87) - tick bean >gi|22049|emb|CAA31603.1| (X13211) USP precursor [Vicia faba] Length = 268 Frame 2 hits (HSPs): ________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | | 268 0 50 100 150 200 250 __________________ Annotated Domains: Entrez Domain: 3 X 6 AA APPROXIMATE REPEATS. 50..106 Entrez Repetitive region: 1-1. 50..55 Entrez Repetitive region: 1-2. 83..88 Entrez Repetitive region: 1-3. 101..106 Entrez Domain: 2 X APPROXIMATE REPEATS. 166..222 Entrez Repetitive region: 2-1. 166..183 Entrez Repetitive region: 2-2. 202..222 Entrez glycosylation site: POTENTIAL. 259 PRODOM PD009870: 1..79 PRODOM PD013884: 86..126 PRODOM PD004669: 128..256 __________________ Plus Strand HSPs: Score = 119 (41.9 bits), Expect = 5.7e-06, P = 5.7e-06 Identities = 22/36 (61%), Positives = 29/36 (80%), Frame = +2 Query: 71 NSARVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 N +VR+TTA++V LVA DGTKT+AL +CH +T GM Sbjct: 192 NCHQVRDTTAYVVSLVASDGTKTKALTVCHHDTRGM 227
>gi|119095|sp|P21745|EA30_VICFA EMBRYONIC ABUNDANT PROTEIN VF30.1 PRECURSOR >gi|82003|pir||S05471 embryonic abundant protein precursor (clone USP Vf30.1) - tick bean Length = 268 Frame 2 hits (HSPs): ________ Annotated Domains: _________________________________________________ __________________________________________________ Database sequence: | | | | | | | 268 0 50 100 150 200 250 __________________ Annotated Domains: DOMO DM02982: 17..258 Entrez Domain: 3 X 6 AA APPROXIMATE REPEATS. 50..106 Entrez Repetitive region: 1-1. 50..55 Entrez Repetitive region: 1-2. 83..88 Entrez Repetitive region: 1-3. 101..106 Entrez Domain: 2 X APPROXIMATE REPEATS. 166..222 Entrez Repetitive region: 2-1. 166..183 Entrez Repetitive region: 2-2. 202..222 Entrez glycosylation site: POTENTIAL. 259 PRODOM PD009870: 1..79 PRODOM PD013884: 86..126 PRODOM PD004669: 128..256 __________________ Plus Strand HSPs: Score = 119 (41.9 bits), Expect = 5.7e-06, P = 5.7e-06 Identities = 22/36 (61%), Positives = 29/36 (80%), Frame = +2 Query: 71 NSARVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 N +VR+TTA++V LVA DGTKT+AL +CH +T GM Sbjct: 192 NCHQVRDTTAYVVSLVASDGTKTKALTVCHHDTRGM 227
>gi|4028979|emb|CAA06470.1| (AJ005323) glutamate permease [synthetic construct] >gi|4028985|emb|CAA06473.1| (AJ005326) glutamate permease [synthetic construct] >gi|4028991|emb|CAA06476.1| (AJ005329) glutamate permease [synthetic construct] Length = 459 Frame -1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Minus Strand HSPs: Score = 122 (42.9 bits), Expect = 7.6e-06, P = 7.6e-06 Identities = 21/23 (91%), Positives = 22/23 (95%), Frame = -1 Query: 83 LVPNSCSPGDPLVLERPPPRWSS 15 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 206 LISNSCSPGDPLVLERPPPRWSS 228
>gi|2129886|pir||S70755 hypothetical protein - garden pea >gi|20914|emb|CAA38756.1| (X55012) unknown seed protein [Pisum sativum] Length = 221 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 115 (40.5 bits), Expect = 9.3e-06, P = 9.3e-06 Identities = 22/36 (61%), Positives = 27/36 (75%), Frame = +2 Query: 71 NSARVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 N +V +TTA+MV LVA DGTKT AL +CH +T GM Sbjct: 158 NCHQVSKTTAYMVSLVASDGTKTNALTVCHHDTRGM 193
>gi|7489188|pir||T02232 protein BYJ6 - common tobacco (fragment) >gi|2280520|dbj|BAA21616.1| (AB005879) BYJ6 [Nicotiana tabacum] Length = 177 Frame 1 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 177 0 50 100 150 Plus Strand HSPs: Score = 108 (38.0 bits), Expect = 2.6e-05, P = 2.6e-05 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = +1 Query: 22 HRGGGRSRTSGSPGLQEFGT 81 HRGGGRSRTSGSPGLQEFGT Sbjct: 5 HRGGGRSRTSGSPGLQEFGT 24
>gi|11993889|gb|AAG42155.1| (AY012159) virion-associated nuclear-shuttling protein [Mus musculus] Length = 576 Frame 1 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 576 0 150 300 450 Plus Strand HSPs: Score = 117 (41.2 bits), Expect = 3.6e-05, P = 3.6e-05 Identities = 22/22 (100%), Positives = 22/22 (100%), Frame = +1 Query: 16 ELHRGGGRSRTSGSPGLQEFGT 81 ELHRGGGRSRTSGSPGLQEFGT Sbjct: 6 ELHRGGGRSRTSGSPGLQEFGT 27
>gi|3402817|emb|CAA07704.1| (AJ007829) lacZ' [Cloning vector pGreen] Length = 120 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | 120 0 50 100 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.00018, P = 0.00018 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = +2 Query: 17 SSTAVAAALELVDPPGCRNS 76 SSTAVAAALELVDPPGCRNS Sbjct: 20 SSTAVAAALELVDPPGCRNS 39
>gi|9294789|gb|AAF86672.1|AF178450_1 (AF178450) beta-galactosidase alpha peptide [Integration vector pCD11PSK] >gi|9294798|gb|AAF86678.1|AF178453_1 (AF178453) beta-galactosidase alpha peptide [Integration vector pCD13PSK] Length = 127 Frame 2 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.00018, P = 0.00018 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = +2 Query: 17 SSTAVAAALELVDPPGCRNS 76 SSTAVAAALELVDPPGCRNS Sbjct: 20 SSTAVAAALELVDPPGCRNS 39
>gi|7488827|pir||T06815 probable embryonic abundant protein - garden pea (fragment) >gi|20912|emb|CAA38755.1| (X55011) internal part of pea Unknown Seed Protein (USP) [Pisum sativum] Length = 221 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | 221 0 50 100 150 200 Plus Strand HSPs: Score = 102 (35.9 bits), Expect = 0.00028, P = 0.00028 Identities = 20/36 (55%), Positives = 25/36 (69%), Frame = +2 Query: 71 NSARVRETTAFMVPLVAGDGTKTQALAICHSNTSGM 178 N +V +TTA+MV LVA DG KT L +CH +T GM Sbjct: 158 NCHQVSKTTAYMVSLVASDGYKTNDLTVCHHDTRGM 193
>gi|560558|gb|AAB31224.1| (S71742) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 50 aa] Length = 50 Frame -3 hits (HSPs): ____________________ __________________________________________________ Database sequence: | | | | 50 0 20 40 Minus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.00063, P = 0.00062 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = -3 Query: 75 EFLQPGGSTSSRAAATAVEL 16 EFLQPGGSTSSRAAATAVEL Sbjct: 28 EFLQPGGSTSSRAAATAVEL 47
>gi|560560|gb|AAB31225.1| (S71745) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal, frame 3} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 56 aa] Length = 56 Frame -3 hits (HSPs): __________________ __________________________________________________ Database sequence: | | | | 56 0 20 40 Minus Strand HSPs: Score = 95 (33.4 bits), Expect = 0.00063, P = 0.00062 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = -3 Query: 75 EFLQPGGSTSSRAAATAVEL 16 EFLQPGGSTSSRAAATAVEL Sbjct: 34 EFLQPGGSTSSRAAATAVEL 53
>gi|10281475|gb|AAG15510.1|U56995_1 (U56995) mutant green fluorescent protein [Cloning vector pGreenscript A] Length = 302 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | || 302 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.00092, P = 0.00092 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = +2 Query: 17 SSTAVAAALELVDPPGCRNS 76 SSTAVAAALELVDPPGCRNS Sbjct: 20 SSTAVAAALELVDPPGCRNS 39
>gi|1684629|emb|CAA70550.1| (Y09374) lacZ-PhoC [synthetic construct] Length = 316 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | | 316 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.0010, P = 0.0010 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = +2 Query: 17 SSTAVAAALELVDPPGCRNS 76 SSTAVAAALELVDPPGCRNS Sbjct: 20 SSTAVAAALELVDPPGCRNS 39
>gi|4028981|emb|CAA06471.1| (AJ005324) glutamate permease [synthetic construct] >gi|4028987|emb|CAA06474.1| (AJ005327) glutamate permease [synthetic construct] >gi|4028993|emb|CAA06477.1| (AJ005330) glutamate permease [synthetic construct] Length = 459 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Plus Strand HSPs: Score = 100 (35.2 bits), Expect = 0.0018, P = 0.0018 Identities = 20/20 (100%), Positives = 20/20 (100%), Frame = +2 Query: 17 SSTAVAAALELVDPPGCRNS 76 SSTAVAAALELVDPPGCRNS Sbjct: 193 SSTAVAAALELVDPPGCRNS 212
>gi|7489022|pir||T07178 hypothetical protein SEND35, senescence down-regulated - tomato (fragment) >gi|1418986|emb|CAA99758.1| (Z75522) unknown [Lycopersicon esculentum] Length = 91 Frame 2 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | | 91 0 20 40 60 80 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.024, P = 0.024 Identities = 16/29 (55%), Positives = 22/29 (75%), Frame = +2 Query: 89 ETT-AFMVPLVAGDGTKTQALAICHSNTS 172 ETT ++MV LV DG+K +A+A+CH TS Sbjct: 54 ETTESYMVSLVGVDGSKVKAVAVCHKGTS 82
>gi|1172874|sp|Q08298|RD22_ARATH DEHYDRATION-RESPONSIVE PROTEIN RD22 PRECURSOR >gi|479589|pir||S34823 dehydration-induced protein RD22 - Arabidopsis thaliana >gi|391608|dbj|BAA01546.1| (D10703) rd22 [Arabidopsis thaliana] >gi|447134|prf||1913421A rd22 gene [Arabidopsis thaliana] Length = 392 Frame 2 hits (HSPs): ____ Frame 1 hits (HSPs): __ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 392 0 150 300 __________________ Annotated Domains: DOMO DM02982: 118..391 Entrez Domain: 5 X APPROXIMATE REPEATS. 57..164 Entrez Repetitive region: 1. 57..75 Entrez Repetitive region: 2. 78..97 Entrez Repetitive region: 3. 100..120 Entrez Repetitive region: 4. 125..142 Entrez Repetitive region: 5. 145..164 PRODOM PD122867: RD22_ARATH 1..167 PRODOM PD004669: 169..390 __________________ Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.028, Sum P(2) = 0.028 Identities = 13/27 (48%), Positives = 19/27 (70%), Frame = +2 Query: 92 TTAFMVPLVAGDGTKTQALAICHSNTS 172 TT + VPL +G + +A+A+CH NTS Sbjct: 331 TTVYAVPLEGENGMRAKAVAVCHKNTS 357 Score = 31 (10.9 bits), Expect = 0.028, Sum P(2) = 0.028 Identities = 6/12 (50%), Positives = 8/12 (66%), Frame = +1 Query: 28 GGGRSRTSGSPG 63 GGG + +G PG Sbjct: 111 GGGVAVHTGKPG 122
>gi|7649667|emb|CAB88874.1| (AJ005810) phosphatidylinositol 4-kinase [Solanum tuberosum] Length = 517 Frame 2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 517 0 150 300 450 Plus Strand HSPs: Score = 82 (28.9 bits), Expect = 0.18, P = 0.17 Identities = 17/26 (65%), Positives = 20/26 (76%), Frame = +2 Query: 32 AAALELVDPPGCRNSARVRETTAFMV 109 AAALELVDPPGCRNS RE +++ Sbjct: 1 AAALELVDPPGCRNS---REKAPYLI 23
>gi|126465|sp|P17588|LRP1_HSV1F LATENCY-RELATED PROTEIN 1 >gi|74037|pir||WMBEL1 latency-related protein 1 - human herpesvirus 1 (strain F) >gi|330134|gb|AAA45799.1| (J04323) latency-related protein 1 [human herpesvirus 1] Length = 340 Frame -2 hits (HSPs): ___ Frame -3 hits (HSPs): ___ _____ Annotated Domains: __________________________________________ __________________________________________________ Database sequence: | | | | 340 0 150 300 __________________ Annotated Domains: DOMO DM06168: 91..209 Entrez Domain: 2 X 17 AA REPEATS. 27..75 Entrez Repetitive region: 1. 27..43 Entrez Repetitive region: 2. 59..75 PRODOM PD030351: LRP1(1) Q69079(1) Q9YPF7(1) 1..24 PRODOM PD015574: 26..123 PRODOM PD030352: LRP1(1) Q69079(1) Q9YPF7(1) 125..156 PRODOM PD019794: LRP1(1) Q69079(1) Q9YPF7(1) 158..208 PRODOM PD028664: LRP1(1) Q69079(1) Q9YPF7(1) 210..248 PRODOM PD060918: LRP1_HSV1F 250..283 __________________ Minus Strand HSPs: Score = 43 (15.1 bits), Expect = 0.26, Sum P(3) = 0.23 Identities = 11/25 (44%), Positives = 13/25 (52%), Frame = -3 Query: 108 TMKAVVSRTRAEFLQPGGSTSSRAA 34 T VS +R LQPG + SR A Sbjct: 215 TWLPAVSGSRVRRLQPGTAARSRVA 239 Score = 35 (12.3 bits), Expect = 0.26, Sum P(3) = 0.23 Identities = 8/15 (53%), Positives = 10/15 (66%), Frame = -3 Query: 150 ASA*VLVPSPATNGT 106 A+A L P PA +GT Sbjct: 12 AAALWLTPEPAQHGT 26 Score = 32 (11.3 bits), Expect = 0.26, Sum P(3) = 0.23 Identities = 7/12 (58%), Positives = 7/12 (58%), Frame = -2 Query: 37 GRHRGGAPSXRR 2 GR RGG RR Sbjct: 313 GRGRGGRGGGRR 324
>gi|7106540|dbj|BAA92225.1| (AB038692) similar to the BURP domain [Vigna unguiculata] Length = 132 Frame 2 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | 132 0 50 100 Plus Strand HSPs: Score = 69 (24.3 bits), Expect = 0.41, P = 0.33 Identities = 13/29 (44%), Positives = 21/29 (72%), Frame = +2 Query: 89 ETT-AFMVPLVAGDGTKTQALAICHSNTS 172 ETT + VPL +G + +A+A+CH++TS Sbjct: 69 ETTRTYPVPLEGANGIRVKAVAVCHTDTS 97
>gi|6319835 ref|NP_009916.1| Protein with RNA recognition motifs; Gbp2p [Saccharomyces cerevisiae] >gi|140346|sp|P25555|GBP2_YEAST SINGLE-STRAND TELOMERIC DNA-BINDING PROTEIN GBP2 (G-STRAND BINDING PROTEIN 2) (RAP1 LOCALIZATION FACTOR 6) >gi|83139|pir||S19338 hypothetical protein YCL011c - yeast (Saccharomyces cerevisiae) >gi|1907133|emb|CAA42348.1| (X59720) YCL011c, len:427 [Saccharomyces cerevisiae] Length = 427 Frame 3 hits (HSPs): ____ Frame 1 hits (HSPs): __ __ __________________________________________________ Database sequence: | | | | 427 0 150 300 Plus Strand HSPs: Score = 42 (14.8 bits), Expect = 0.56, Sum P(3) = 0.43 Identities = 8/10 (80%), Positives = 8/10 (80%), Frame = +1 Query: 25 RGGGRSRTSG 54 RGGGR RT G Sbjct: 93 RGGGRGRTLG 102 Score = 36 (12.7 bits), Expect = 0.56, Sum P(3) = 0.43 Identities = 9/22 (40%), Positives = 14/22 (63%), Frame = +3 Query: 75 RHESVKQQLSWFHWWLVMEPKL 140 ++ESV+ +S F L M+ KL Sbjct: 170 KNESVQDAISKFDGALFMDRKL 191 Score = 32 (11.3 bits), Expect = 0.56, Sum P(3) = 0.43 Identities = 6/13 (46%), Positives = 7/13 (53%), Frame = +1 Query: 130 NQNSGTCYLPLKY 168 N N G C L + Y Sbjct: 411 NYNYGGCSLQISY 423
>gi|8052392|emb|CAB92249.1| (AL356595) putative single-strand DNA binding protein [Streptomyces coelicolor A3(2)] Length = 156 Frame -1 hits (HSPs): _______ Frame -2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | 156 0 50 100 150 Minus Strand HSPs: Score = 45 (15.8 bits), Expect = 0.71, Sum P(2) = 0.51 Identities = 8/18 (44%), Positives = 12/18 (66%), Frame = -1 Query: 80 VPNSCSPGDPLVLERPPP 27 VP +PG+P+ +RP P Sbjct: 135 VPAGGTPGEPVPEQRPDP 152 Score = 39 (13.7 bits), Expect = 0.71, Sum P(2) = 0.51 Identities = 8/27 (29%), Positives = 15/27 (55%), Frame = -2 Query: 160 VANSKCLSFG-SITSHQWNHESCCFTD 83 +AN + F ++T+ W+ E +TD Sbjct: 21 LANGPSVRFRLAVTARYWDREKNAWTD 47
>gi|11277059|pir||T49900 2-oxoglutarate/malate translocator-like protein T24H18.30 [similarity] - Arabidopsis thaliana >gi|7630042|emb|CAB88250.1| (AL353013) 2-oxoglutarate/malate translocator precursor-like protein [Arabidopsis thaliana] Length = 557 Frame 3 hits (HSPs): ___ Frame 2 hits (HSPs): ___ Frame 1 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | 557 0 150 300 450 Plus Strand HSPs: Score = 44 (15.5 bits), Expect = 1.0, Sum P(3) = 0.63 Identities = 6/20 (30%), Positives = 11/20 (55%), Frame = +3 Query: 57 PRAAGIRHESVKQQLSWFHW 116 P +A + ++KQ + W W Sbjct: 283 PLSANLAFNTIKQTIGWTDW 302 Score = 36 (12.7 bits), Expect = 1.0, Sum P(3) = 0.63 Identities = 8/20 (40%), Positives = 12/20 (60%), Frame = +2 Query: 2 STXARSSTAVAAALELVDPP 61 ST ++S+ VA+A PP Sbjct: 60 STLVKASSTVASASSSPTPP 79 Score = 31 (10.9 bits), Expect = 1.0, Sum P(3) = 0.63 Identities = 5/11 (45%), Positives = 7/11 (63%), Frame = +1 Query: 142 GTCYLPLKYFW 174 G Y+PL +W Sbjct: 519 GANYVPLAKWW 529
>gi|7433739|pir||E72096 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) fabD CP0461 [similarity] - Chlamydophila pneumoniae (strains CWL029 and AR39) >gi|4376572|gb|AAD18446.1| (AE001614) Malonyl Acyl Carrier Transcyclase [Chlamydophila pneumoniae CWL029] >gi|7189383|gb|AAF38298.1| (AE002207) malonyl CoA-acyl carrier protein transacylase [Chlamydophila pneumoniae AR39] Length = 308 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | | | 308 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 72 (25.3 bits), Expect = 1.1, P = 0.66 Identities = 18/50 (36%), Positives = 27/50 (54%), Frame = +2 Query: 29 VAAALELVDPPGCRNSARVRETTAFMVPL--VAGDGTKTQALAICHSNTS 172 V A+EL GC+ + R++ + AF PL VA DG A+C ++S Sbjct: 175 VDQAIELFRDLGCKKAVRLKVSGAFHTPLMQVAQDGLAPDIYALCMKDSS 224
>gi|8978671|dbj|BAA98507.1| (AP002546) malonyl acyl carrier transcyclase [Chlamydophila pneumoniae J138] Length = 308 Frame 2 hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | | | 308 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 72 (25.3 bits), Expect = 1.1, P = 0.66 Identities = 18/50 (36%), Positives = 27/50 (54%), Frame = +2 Query: 29 VAAALELVDPPGCRNSARVRETTAFMVPL--VAGDGTKTQALAICHSNTS 172 V A+EL GC+ + R++ + AF PL VA DG A+C ++S Sbjct: 175 VDQAIELFRDLGCKKAVRLKVSGAFHTPLMQVAQDGLAPDIYALCMKDSS 224
>gi|1773024|gb|AAB40147.1| (U63336) MHC Class I region proline rich protein [Homo sapiens] Length = 253 Frame -1 hits (HSPs): __ _______ __________________________________________________ Database sequence: | | | | | || 253 0 50 100 150 200 250 Minus Strand HSPs: Score = 51 (18.0 bits), Expect = 1.2, Sum P(2) = 0.71 Identities = 13/32 (40%), Positives = 15/32 (46%), Frame = -1 Query: 116 PMEP*KLLFHGLVPNSCSPGDPLVLERPPPRW 21 P +P L G P S P P +L PPP W Sbjct: 116 PGDPKSALHRG-PPGSRGPLIPPLLSLPPPPW 146 Score = 36 (12.7 bits), Expect = 1.2, Sum P(2) = 0.71 Identities = 5/7 (71%), Positives = 6/7 (85%), Frame = -1 Query: 128 HHQPPME 108 HHQPP + Sbjct: 74 HHQPPTQ 80
>gi|4336338|gb|AAD17764.1| (AF082394) rev protein [Human immunodeficiency virus type 1] Length = 116 Frame -1 hits (HSPs): ________ Frame -3 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | 116 0 50 100 Minus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.6, Sum P(2) = 0.80 Identities = 8/19 (42%), Positives = 13/19 (68%), Frame = -1 Query: 80 VPNSC--SPGDPLVLERPP 30 +P+SC P +P+ L+ PP Sbjct: 59 IPSSCLGRPAEPVPLQLPP 77 Score = 31 (10.9 bits), Expect = 1.6, Sum P(2) = 0.80 Identities = 7/17 (41%), Positives = 10/17 (58%), Frame = -3 Query: 129 PSPATNGTMKAVVSRTR 79 P P NG+ +A +R R Sbjct: 27 PYPKPNGSRQARRNRRR 43
>gi|2108238|gb|AAB63364.1| (U97360) HFLK homolog [Treponema pallidum] Length = 220 Frame -1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | | 220 0 50 100 150 200 Minus Strand HSPs: Score = 67 (23.6 bits), Expect = 2.2, P = 0.89 Identities = 13/19 (68%), Positives = 14/19 (73%), Frame = -1 Query: 83 LVPNSCSPGDPLVLERPPP 27 L +SC PG PLVLERP P Sbjct: 195 LQKDSCRPGGPLVLERPHP 213
>gi|7488674|pir||T07623 extensin homolog HRGP2 - soybean (fragment) >gi|347455|gb|AAA33971.1| (L22030) hydroxyproline-rich glycoprotein [Glycine max] Length = 169 Frame -1 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | 169 0 50 100 150 Minus Strand HSPs: Score = 65 (22.9 bits), Expect = 2.3, P = 0.90 Identities = 14/42 (33%), Positives = 19/42 (45%), Frame = -1 Query: 143 PEFWFHHQPPMEP*K---LLFHGLVPNSCSPGDPLVLERPPP 27 P +++H PP P +H P S SP P + PPP Sbjct: 34 PPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPPSPYYYKSPPP 75
>gi|8927178|gb|AAF81989.1|AF178695_1 (AF178695) gp15 antigen [Cryptosporidium parvum] Length = 104 Frame 2 hits (HSPs): ______ Frame 1 hits (HSPs): ________________ __________________________________________________ Database sequence: | | | | | | | 104 0 20 40 60 80 100 Plus Strand HSPs: Score = 43 (15.1 bits), Expect = 2.8, Sum P(2) = 0.94 Identities = 12/33 (36%), Positives = 17/33 (51%), Frame = +1 Query: 28 GGGRSRTSGSPGLQEF--GTSP*NNSFHGSIGG 120 G R+ GS G +E G ++S GS+GG Sbjct: 66 GEDTGRSEGSQGSEEHQDGEDDSSDSSGGSVGG 98 Score = 29 (10.2 bits), Expect = 2.8, Sum P(2) = 0.94 Identities = 7/13 (53%), Positives = 9/13 (69%), Frame = +2 Query: 2 STXARSSTAVAAA 40 S+ + SST VA A Sbjct: 47 SSSSSSSTTVAPA 59
>gi|7487811|pir||T00609 hypothetical protein T8K22.16 - Arabidopsis thaliana >gi|3184285|gb|AAC18932.1| (AC004136) hypothetical protein [Arabidopsis thaliana] Length = 310 Frame -1 hits (HSPs): ___ __ __________________________________________________ Database sequence: | | | | | | | | 310 0 50 100 150 200 250 300 Minus Strand HSPs: Score = 55 (19.4 bits), Expect = 3.1, Sum P(2) = 0.96 Identities = 9/14 (64%), Positives = 11/14 (78%), Frame = -1 Query: 128 HHQPPMEP*KLLFH 87 HHQPP + KL+FH Sbjct: 151 HHQPPPQQRKLMFH 164 Score = 30 (10.6 bits), Expect = 3.1, Sum P(2) = 0.96 Identities = 5/11 (45%), Positives = 6/11 (54%), Frame = -1 Query: 59 GDPLVLERPPP 27 G L +PPP Sbjct: 200 GGSLTFRQPPP 210
>gi|2231161|gb|AAB61958.1| (L81159) immunoglobulin mu [Equus caballus] Length = 154 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 154 0 50 100 150 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 3.1, P = 0.96 Identities = 11/11 (100%), Positives = 11/11 (100%), Frame = +2 Query: 50 VDPPGCRNSAR 82 VDPPGCRNSAR Sbjct: 1 VDPPGCRNSAR 11
>gi|7476650|pir||B70553 hypothetical protein Rv1137c - Mycobacterium tuberculosis (strain H37RV) >gi|2117175|emb|CAB09025.1| (Z95584) hypothetical protein Rv1137c [Mycobacterium tuberculosis] Length = 122 Frame -2 hits (HSPs): __________ Frame -3 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 122 0 50 100 Minus Strand HSPs: Score = 41 (14.4 bits), Expect = 3.3, Sum P(2) = 0.96 Identities = 7/21 (33%), Positives = 12/21 (57%), Frame = -3 Query: 63 PGGSTSSRAAATAVELLACVE 1 P +T+ + A+ LLAC + Sbjct: 91 PSSTTTPSSTPQAIRLLACTD 111 Score = 39 (13.7 bits), Expect = 3.3, Sum P(2) = 0.96 Identities = 8/23 (34%), Positives = 12/23 (52%), Frame = -2 Query: 133 GSITSHQWNHESCCFTDSCRIPA 65 G+ T + H CF+ + R PA Sbjct: 55 GAETMQRARHTGSCFSANARGPA 77
>gi|12328470|dbj|BAB21130.1| (AP002872) hypothetical protein [Oryza sativa] Length = 234 Frame 2 hits (HSPs): _____ Frame 1 hits (HSPs): ________ __________________________________________________ Database sequence: | | | | | | 234 0 50 100 150 200 Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 3.5, Sum P(2) = 0.97 Identities = 12/34 (35%), Positives = 16/34 (47%), Frame = +1 Query: 76 GTSP*NNSFHGSI-GGW*WNQNSGTCYLPLKYFW 174 GT+P N F G+ GG WN + L + W Sbjct: 139 GTTPPKNVFSGAEDGGHDWNVAASVSALEKREDW 172 Score = 37 (13.0 bits), Expect = 3.5, Sum P(2) = 0.97 Identities = 8/22 (36%), Positives = 12/22 (54%), Frame = +2 Query: 2 STXARSSTAVAAALELVDPPGC 67 ++ A + A AAA +PP C Sbjct: 21 ASTAITLAAAAAAAATCEPPRC 42
>gi|3093383|emb|CAA06601.1| (AJ005572) hypothetical protein [Plasmodium falciparum] Length = 186 Frame 1 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 186 0 50 100 150 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 4.6, P = 0.99 Identities = 13/14 (92%), Positives = 13/14 (92%), Frame = +1 Query: 43 RTSGSPGLQEFGTS 84 RTSGSPGLQEF TS Sbjct: 1 RTSGSPGLQEFCTS 14
>gi|11346107|pir||H82787 hypothetical protein XF0574 [imported] - Xylella fastidiosa (strain 9a5c) >gi|9105438|gb|AAF83384.1|AE003904_5 (AE003904) hypothetical protein [Xylella fastidiosa] Length = 136 Frame -2 hits (HSPs): _____________ Frame -3 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | 136 0 50 100 Minus Strand HSPs: Score = 44 (15.5 bits), Expect = 4.7, Sum P(2) = 0.99 Identities = 13/35 (37%), Positives = 19/35 (54%), Frame = -2 Query: 157 ANSKCLSFGSITSHQWNHESCCFTDSCRIPAARGI 53 A S+C S + ++ H + CFT SC A RG+ Sbjct: 5 AMSRCRGVWSELA-RYRH-TYCFTFSCFGNATRGV 37 Score = 30 (10.6 bits), Expect = 4.7, Sum P(2) = 0.99 Identities = 6/13 (46%), Positives = 7/13 (53%), Frame = -3 Query: 45 SRAAATAVELLAC 7 SR A V +L C Sbjct: 60 SRVQAVVVSILQC 72
>gi|100210|pir||S25299 extensin precursor - tomato >gi|170444|gb|AAA34164.1| (M76671) extensin (class II) [Lycopersicon esculentum] Length = 322 Frame -1 hits (HSPs): _____ __ Annotated Domains: ___ ________________________________________ __________________________________________________ Database sequence: | | | | | | | | 322 0 50 100 150 200 250 300 __________________ Annotated Domains: DOMO DM08271: H-A-P-PREPEAT 69..249 DOMO DM05291: 251..322 Entrez domain: signal sequence 1..20 __________________ Minus Strand HSPs: Score = 53 (18.7 bits), Expect = 5.6, Sum P(2) = 1.0 Identities = 13/34 (38%), Positives = 16/34 (47%), Frame = -1 Query: 128 HHQPPMEP*KLLFHGLVPNSCSPGDPLVLERPPP 27 HH PP P + H P+ SP P+ PPP Sbjct: 86 HHSPP-PPSPVYDH---PSPSSPPPPVYYSPPPP 115 Score = 30 (10.6 bits), Expect = 5.6, Sum P(2) = 1.0 Identities = 5/7 (71%), Positives = 6/7 (85%), Frame = -1 Query: 35 PPPRWSS 15 PPP +SS Sbjct: 284 PPPTYSS 290
>gi|7715060|gb|AAF67846.1|AF214016_2 (AF214016) molybdenum cofactor synthesis-step 1 protein B splice type I [Mus musculus] Length = 207 Frame -2 hits (HSPs): ___ Frame -3 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | 207 0 50 100 150 200 Minus Strand HSPs: Score = 43 (15.1 bits), Expect = 6.5, Sum P(2) = 1.0 Identities = 16/43 (37%), Positives = 21/43 (48%), Frame = -3 Query: 129 PSPATNGTMKAVVSRTRAEFLQPGGS--TSSRAAATAVELLACV 4 P P +N + V S RA + GG T A A+A+ LL V Sbjct: 88 PGPTSN-QLTHVDSAGRASMVDVGGKPETERVAVASAMVLLGPV 130 Score = 35 (12.3 bits), Expect = 6.5, Sum P(2) = 1.0 Identities = 7/9 (77%), Positives = 8/9 (88%), Frame = -2 Query: 154 NSKCLSFGS 128 +SKCLS GS Sbjct: 71 HSKCLSTGS 79
>gi|436130|emb|CAA54082.1| (X76634) ribulose-1,5-bisphosphate carboxylase [Physcomitrella patens] Length = 77 Frame 3 hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | 77 0 20 40 60 Plus Strand HSPs: Score = 57 (20.1 bits), Expect = 6.6, P = 1.0 Identities = 14/21 (66%), Positives = 15/21 (71%), Frame = +3 Query: 51 WIPRAAGIR---HESVKQQLS 104 WIPRAAGIR + S QQLS Sbjct: 1 WIPRAAGIRGRQNPSKSQQLS 21 WARNING: HSPs involving 11 database sequences were not reported due to the limiting value of parameter B = 50. Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.83 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.352 0.156 0.646 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.314 0.123 0.345 same same same Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.340 0.153 0.597 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.351 0.161 0.648 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.350 0.149 0.573 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.325 0.131 0.384 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 59 58 10. 58 3 12 22 0.093 30 26 0.089 30 +2 0 59 58 10. 58 3 12 23 0.12 29 26 0.12 29 +1 0 59 58 10. 58 3 12 22 0.093 30 26 0.089 30 -1 0 59 58 10. 58 3 12 22 0.093 30 26 0.089 30 -2 0 59 58 10. 58 3 12 22 0.093 30 26 0.089 30 -3 0 59 59 10. 58 3 12 22 0.095 30 26 0.094 30 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 61 No. of states in DFA: 580 (57 KB) Total size of DFA: 120 KB (128 KB) Time to generate neighborhood: 0.00u 0.01s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 73.28u 1.06s 74.34t Elapsed: 00:00:13 Total cpu time: 73.31u 1.11s 74.42t Elapsed: 00:00:13 Start: Mon Oct 1 21:02:18 2001 End: Mon Oct 1 21:02:31 2001 WARNINGS ISSUED: 2
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000