LOCUS       XM_749365                315 bp    mRNA    linear   PLN 27-FEB-2008
DEFINITION  Aspergillus fumigatus Af293 nucleosome binding protein (Nhp6a),
            putative (AFUA_3G11610), partial mRNA.
ACCESSION   XM_749365
VERSION     XM_749365.1  GI:70999477
KEYWORDS    .
SOURCE      Aspergillus fumigatus Af293
  ORGANISM  Aspergillus fumigatus Af293
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae;
            mitosporic Trichocomaceae; Aspergillus.
REFERENCE   1  (bases 1 to 315)
  AUTHORS   Nierman,W.C., Pain,A., Anderson,M.J., Wortman,J.R., Kim,H.S.,
            Arroyo,J., Berriman,M., Abe,K., Archer,D.B., Bermejo,C.,
            Bennett,J., Bowyer,P., Chen,D., Collins,M., Coulsen,R., Davies,R.,
            Dyer,P.S., Farman,M., Fedorova,N., Fedorova,N., Feldblyum,T.V.,
            Fischer,R., Fosker,N., Fraser,A., Garcia,J.L., Garcia,M.J.,
            Goble,A., Goldman,G.H., Gomi,K., Griffith-Jones,S., Gwilliam,R.,
            Haas,B., Haas,H., Harris,D., Horiuchi,H., Huang,J., Humphray,S.,
            Jimenez,J., Keller,N., Khouri,H., Kitamoto,K., Kobayashi,T.,
            Konzack,S., Kulkarni,R., Kumagai,T., Lafton,A., Latge,J.P., Li,W.,
            Lord,A., Lu,C., Majoros,W.H., May,G.S., Miller,B.L., Mohamoud,Y.,
            Molina,M., Monod,M., Mouyna,I., Mulligan,S., Murphy,L., O'Neil,S.,
            Paulsen,I., Penalva,M.A., Pertea,M., Price,C., Pritchard,B.L.,
            Quail,M.A., Rabbinowitsch,E., Rawlins,N., Rajandream,M.A.,
            Reichard,U., Renauld,H., Robson,G.D., Rodriguez de Cordoba,S.,
            Rodriguez-Pena,J.M., Ronning,C.M., Rutter,S., Salzberg,S.L.,
            Sanchez,M., Sanchez-Ferrero,J.C., Saunders,D., Seeger,K.,
            Squares,R., Squares,S., Takeuchi,M., Tekaia,F., Turner,G., Vazquez
            de Aldana,C.R., Weidman,J., White,O., Woodward,J., Yu,J.H.,
            Fraser,C., Galagan,J.E., Asai,K., Machida,M., Hall,N., Barrell,B.
            and Denning,D.W.
  TITLE     Genomic sequence of the pathogenic and allergenic filamentous
            fungus Aspergillus fumigatus
  JOURNAL   Nature 438 (7071), 1151-1156 (2005)
   PUBMED   16372009
REFERENCE   2  (bases 1 to 315)
  AUTHORS   Nierman,W., Wortman,J., Pain,A., Anderson,M.J., Arroya,J., Hall,N.,
            Barrell,B., Fraser,C. and Denning,D.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2005) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_007196).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..315
                     /organism="Aspergillus fumigatus Af293"
                     /mol_type="mRNA"
                     /strain="Af293"
                     /db_xref="taxon:330879"
                     /chromosome="3"
     gene            <1..>315
                     /locus_tag="AFUA_3G11610"
                     /old_locus_tag="Afu3g11610"
                     /db_xref="GeneID:3512633"
     CDS             1..315
                     /locus_tag="AFUA_3G11610"
                     /old_locus_tag="Afu3g11610"
                     /note="encoded by transcript AFUA_3G11610A;
                     similar to non-histone chromatin protein; Nhp6ap
                     (GI:6325309) [Saccharomyces cerevisiae]"
                     /codon_start=1
                     /product="nucleosome binding protein (Nhp6a)"
                     /protein_id="XP_754458.1"
                     /db_xref="GI:70999478"
                     /db_xref="GeneID:3512633"
                     /translation="MPKEKTSTRTKTKRVERKKKDPNAPKRGLSAYMFFANENRDKVR
                     EENPGISFGQVGKMLGERWKALSDSERRPYEEKAAADKKRYEDEKASYNAAQDEDEEE
                     SS"
ORIGIN      
        1 atgcctaagg aaaagacttc cacccgcacc aagaccaagc gcgtcgagag aaagaagaag
       61 gaccccaatg cccccaagcg tggtctttct gcctacatgt tcttcgccaa tgagaaccgt
      121 gacaaggtcc gcgaggagaa ccccggcatc tcgttcggcc aggtcggcaa gatgctcgga
      181 gagagatgga aggccctgag cgacagcgaa cgccgaccct acgaggagaa ggccgccgcc
      241 gacaagaagc gttacgaaga cgagaaggcg agctacaacg ccgctcaaga cgaggacgaa
      301 gaggaatcct cttaa
//