O54988 - (O54988) Serine/threonine protein kinase || Number of peptides = 6 || unambiguous || 99.6% Confident
PSA3_MOUSE - (O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) || Number of peptides = 12 || ambiguous || 99.6% Confident
Q9DCH4 - (Q9DCH4) 0610037M02Rik protein || Number of peptides = 4 || ambiguous || 99.6% Confident
NDKB_MOUSE - (Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18) || Number of peptides = 15 || unambiguous || 99.6% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 102 || ambiguous || 99.6% Confident
Q920C7 - (Q920C7) CDV-3B (Pp36) (Carnitine deficiency-associated protein CDV3B) || Number of peptides = 6 || ambiguous || 99.6% Confident
GDIC_MOUSE - (Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q99K86 - (Q99K86) Lutheran blood group (Auberger b antigen included) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9DCC4 - (Q9DCC4) 1110058B13Rik protein || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9CZ44 - (Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence || Number of peptides = 8 || unambiguous || 99.6% Confident
TBA1_HUMAN - (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) || Number of peptides = 165 || ambiguous || 99.6% Confident
HBD_HUMAN - (P02042) Hemoglobin delta chain || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9P2E6 - (Q9P2E6) Hypothetical protein KIAA1401 (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q922D8 - (Q922D8) Similar to C1-tetrahydrofolate synthase || Number of peptides = 24 || unambiguous || 99.6% Confident
TAG2_MOUSE - (Q9WVA4) Transgelin 2 || Number of peptides = 7 || unambiguous || 99.6% Confident
CD93_MOUSE - (O89103) Complement component C1q receptor precursor (Complement component 1, q subcomponent, receptor 1) (C1qRp) (C1qR(p)) (C1q/MBL/SPA receptor) (CD93 antigen) (Cell surface antigen AA4) (Lymphocyte antigen 68) || Number of peptides = 4 || unambiguous || 99.6% Confident
GIPC_MOUSE - (Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) || Number of peptides = 7 || unambiguous || 99.6% Confident
DEST_MOUSE - (Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) || Number of peptides = 20 || unambiguous || 99.6% Confident
RBB7_MOUSE - (Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q99LJ3 - (Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) || Number of peptides = 14 || unambiguous || 99.6% Confident
MCM7_MOUSE - (Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) || Number of peptides = 19 || unambiguous || 99.6% Confident
Q921G5 - (Q921G5) Similar to methyltransferase-like 1 (S. cerevisiae) || Number of peptides = 4 || ambiguous || 99.6% Confident
PYR1_HUMAN - (P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] || Number of peptides = 9 || unambiguous || 99.6% Confident
RL3_MOUSE - (P27659) 60S ribosomal protein L3 (J1 protein) || Number of peptides = 20 || unambiguous || 99.6% Confident
AAC1_HUMAN - (P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein) || Number of peptides = 17 || ambiguous || 99.6% Confident
S3B1_MOUSE - (Q99NB9) Splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit) || Number of peptides = 9 || ambiguous || 99.6% Confident
ROA2_MOUSE - (O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) || Number of peptides = 48 || ambiguous || 99.6% Confident
PRO1_MOUSE - (P10924) Profilin I || Number of peptides = 21 || unambiguous || 99.6% Confident
RNT1_MOUSE - (Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) || Number of peptides = 8 || ambiguous || 99.6% Confident
PSB3_MOUSE - (Q9R1P1) Proteasome subunit beta type 3 (EC 3.4.25.1) (Proteasome theta chain) (Proteasome chain 13) (Proteasome component C10-II) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CZY5 - (Q9CZY5) 2610312E17Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
K2C1_HUMAN - (P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q62189 - (Q62189) Small nuclear RNA (Small nuclear ribonucleoprotein polypeptide A) || Number of peptides = 1 || unambiguous || 99.6% Confident
NIDO_MOUSE - (P10493) Nidogen precursor (Entactin) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q99K88 - (Q99K88) Hypothetical 38.1 kDa protein || Number of peptides = 17 || ambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 213 || ambiguous || 99.6% Confident
Q8VCM7 - (Q8VCM7) Similar to fibrinogen, gamma polypeptide || Number of peptides = 3 || ambiguous || 99.6% Confident
RBB9_MOUSE - (O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 10 || unambiguous || 99.6% Confident
MKK2_MOUSE - (P49138) MAP kinase-activated protein kinase 2 (EC 2.7.1.-) (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAPK-2) (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
RS3A_MOUSE - (P97351) 40S ribosomal protein S3a || Number of peptides = 20 || ambiguous || 99.6% Confident
ELV1_MOUSE - (P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q8VCI5 - (Q8VCI5) Peroxisomal farnesylated protein || Number of peptides = 1 || unambiguous || 99.6% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 15 || ambiguous || 99.6% Confident
UNRI_MOUSE - (Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
GR78_MOUSE - (P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) || Number of peptides = 23 || unambiguous || 99.6% Confident
TCTP_MOUSE - (P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein) || Number of peptides = 18 || unambiguous || 99.6% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 92 || unambiguous || 99.6% Confident
GELS_MOUSE - (P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) || Number of peptides = 5 || unambiguous || 99.6% Confident
CCT1_MOUSE - (Q9QWV9) Cyclin T1 (Cyclin T) (CycT1) || Number of peptides = 7 || unambiguous || 99.6% Confident
GUAA_HUMAN - (P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q91WK2 - (Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD) || Number of peptides = 5 || unambiguous || 99.6% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 9 || ambiguous || 99.6% Confident
GBLP_HUMAN - (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) || Number of peptides = 12 || ambiguous || 99.6% Confident
IMD2_MOUSE - (P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) || Number of peptides = 22 || ambiguous || 99.6% Confident
AATC_MOUSE - (P05201) Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-1) || Number of peptides = 3 || unambiguous || 99.6% Confident
TRAL_MOUSE - (Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) || Number of peptides = 9 || unambiguous || 99.6% Confident
MDHC_MOUSE - (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) || Number of peptides = 13 || unambiguous || 99.6% Confident
PSD1_HUMAN - (Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) || Number of peptides = 6 || unambiguous || 99.6% Confident
PMG1_MOUSE - (Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) || Number of peptides = 26 || ambiguous || 99.6% Confident
ANX4_MOUSE - (P97429) Annexin A4 (Annexin IV) || Number of peptides = 7 || ambiguous || 99.6% Confident
PAK2_HUMAN - (Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) || Number of peptides = 6 || unambiguous || 99.6% Confident
HS74_MOUSE - (Q61316) Heat shock 70-related protein APG-2 || Number of peptides = 6 || unambiguous || 99.6% Confident
NPL1_MOUSE - (P28656) Nucleosome assembly protein 1-like 1 (NAP-1 related protein) (Brain protein DN38) || Number of peptides = 21 || ambiguous || 99.6% Confident
Q99KS1 - (Q99KS1) Hypothetical 16.5 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
TPP2_MOUSE - (Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) || Number of peptides = 13 || unambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 63 || ambiguous || 99.6% Confident
2AAA_HUMAN - (P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) || Number of peptides = 8 || ambiguous || 99.6% Confident
EWS_MOUSE - (Q61545) RNA-binding protein EWS || Number of peptides = 1 || ambiguous || 99.6% Confident
A2HS_MOUSE - (P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) || Number of peptides = 14 || unambiguous || 99.6% Confident
IF41_HUMAN - (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) || Number of peptides = 25 || ambiguous || 99.6% Confident
Q9R0U5 - (Q9R0U5) Matrin3 || Number of peptides = 6 || ambiguous || 99.6% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 25 || unambiguous || 99.6% Confident
6PGD_MOUSE - (Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) || Number of peptides = 9 || ambiguous || 99.6% Confident
Q9D902 - (Q9D902) C330006J08Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
RIR1_MOUSE - (P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain) || Number of peptides = 9 || unambiguous || 99.6% Confident
NDR2_MOUSE - (Q9QYG0) NDRG2 protein (Ndr2 protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q8VH51 - (Q8VH51) Transcription coactivator CAPER || Number of peptides = 5 || ambiguous || 99.6% Confident
YB1_MOUSE - (P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) || Number of peptides = 17 || ambiguous || 99.6% Confident
R11A_MOUSE - (Q9JLX1) Ras-related protein Rab-11A || Number of peptides = 6 || ambiguous || 99.6% Confident
MCM3_MOUSE - (P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) || Number of peptides = 25 || unambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 50 || unambiguous || 99.6% Confident
FCL_MOUSE - (P23591) GDP-fucose synthetase (FX protein) (Red cell NADP(H)-binding protein) (Transplantation antigen P35B) (Tum-P35B antigen) [Includes: GDP-mannose-4-keto-6-D epimerase (EC 5.1.3.-); GDP-4-keto-6-L-galactose reductase (EC 1.-.-.-)] || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9CV45 - (Q9CV45) 2310038O07Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CV31 - (Q9CV31) 2310014J01Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 99.6% Confident
PUR2_MOUSE - (Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)] || Number of peptides = 18 || unambiguous || 99.6% Confident
KPY2_MOUSE - (P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) || Number of peptides = 82 || unambiguous || 99.6% Confident
LA_MOUSE - (P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) || Number of peptides = 13 || ambiguous || 99.6% Confident
PSDD_MOUSE - (Q9WVJ2) 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q8QZT1 - (Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial || Number of peptides = 2 || unambiguous || 99.6% Confident
HBA_HUMAN - (P01922) Hemoglobin alpha chain || Number of peptides = 9 || unambiguous || 99.6% Confident
PIN1_MOUSE - (Q9QUR7) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (EC 5.2.1.8) (Rotamase Pin1) (PPIase Pin1) || Number of peptides = 3 || unambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 262 || unambiguous || 99.6% Confident
Q91W83 - (Q91W83) Putative TAT protein (Transactivating regulatory protein) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q9QZE7 - (Q9QZE7) Translin associated protein X (Translin-associated factor X) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9QZE5 - (Q9QZE5) Coat protein gamma-cop (Coatomer protein complex, subunit gamma 1) || Number of peptides = 3 || ambiguous || 99.6% Confident
NTF2_HUMAN - (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) || Number of peptides = 8 || ambiguous || 99.6% Confident
PA1B_HUMAN - (Q29459) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) || Number of peptides = 1 || unambiguous || 99.6% Confident
ARF1_HUMAN - (P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 || Number of peptides = 26 || ambiguous || 99.6% Confident
Q9DBY6 - (Q9DBY6) 1200009K13Rik protein || Number of peptides = 27 || ambiguous || 99.6% Confident
FKB3_MOUSE - (Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) || Number of peptides = 5 || unambiguous || 99.6% Confident
ENOB_HUMAN - (P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) || Number of peptides = 5 || unambiguous || 99.6% Confident
MCM2_MOUSE - (P97310) DNA replication licensing factor MCM2 || Number of peptides = 14 || unambiguous || 99.6% Confident
Q60817 - (Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) || Number of peptides = 11 || ambiguous || 99.6% Confident
Q91VW3 - (Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3 || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9DBR1 - (Q9DBR1) 5'-3' exoribonuclease 2 || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9QZ83 - (Q9QZ83) Gamma actin-like protein || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9EQR0 - (Q9EQR0) Fatty acid synthase || Number of peptides = 33 || unambiguous || 99.6% Confident
DP30_MOUSE - (Q99LT0) Dpy-30-like protein || Number of peptides = 3 || ambiguous || 99.6% Confident
S111_MOUSE - (P50543) Calgizzarin (Endothelial monocyte-activating polypeptide) (EMAP) || Number of peptides = 2 || unambiguous || 99.6% Confident
RS15_HUMAN - (P11174) 40S ribosomal protein S15 (RIG protein) (P11174) 40S ribosomal protein S15 (RIG protein) || Number of peptides = 9 || ambiguous || 99.6% Confident
LDHA_MOUSE - (P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) || Number of peptides = 30 || unambiguous || 99.6% Confident
Q9D3T6 - (Q9D3T6) 4933436C10Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
RS1A_HUMAN - (P39027) 40S ribosomal protein S15a || Number of peptides = 20 || unambiguous || 99.6% Confident
Q9BXJ9 - (Q9BXJ9) Putative acetyltransferase (Putative N-acetyltransferase) || Number of peptides = 5 || unambiguous || 99.6% Confident
PA1G_MOUSE - (Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) || Number of peptides = 13 || unambiguous || 99.6% Confident
SERA_MOUSE - (Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
TCPQ_MOUSE - (P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta) || Number of peptides = 9 || unambiguous || 99.6% Confident
O55181 - (O55181) RBP associated molecule RAM14-1 || Number of peptides = 25 || unambiguous || 99.6% Confident
ALFA_MOUSE - (P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q91VL3 - (Q91VL3) Similar to Rho guanine nucleotide exchange factor (GEF) 1 || Number of peptides = 9 || unambiguous || 99.6% Confident
RS23_HUMAN - (P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23 || Number of peptides = 18 || ambiguous || 99.6% Confident
Q9QYF4 - (Q9QYF4) SYNCRIP protein || Number of peptides = 5 || ambiguous || 99.6% Confident
Q91VL2 - (Q91VL2) Unknown (Protein for IMAGE:3669867) (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q925K4 - (Q925K4) Copine 1 protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
RHOA_MOUSE - (Q9QUI0) Transforming protein RhoA || Number of peptides = 8 || ambiguous || 99.6% Confident
GTP1_MOUSE - (P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) || Number of peptides = 10 || ambiguous || 99.6% Confident
Q91VC3 - (Q91VC3) Unknown (Protein for MGC:6715) (Hypothetical 46.8 kDa protein) || Number of peptides = 6 || ambiguous || 99.6% Confident
KINH_MOUSE - (Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) || Number of peptides = 14 || ambiguous || 99.6% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 22 || unambiguous || 99.6% Confident
O70140 - (O70140) Calcyclin binding protein (Fragment) || Number of peptides = 13 || unambiguous || 99.6% Confident
SYR_MOUSE - (Q9D0I9) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA ligase) (ArgRS) || Number of peptides = 6 || unambiguous || 99.6% Confident
VTDB_MOUSE - (P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9D7P7 - (Q9D7P7) 2300003G24Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 87 || ambiguous || 99.6% Confident
Q8R016 - (Q8R016) Similar to bleomycin hydrolase || Number of peptides = 18 || unambiguous || 99.6% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CYG6 - (Q9CYG6) 5730478E03Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CTB9 - (Q9CTB9) 1110030K07Rik protein (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9CZU3 - (Q9CZU3) 2610528A15Rik protein || Number of peptides = 6 || ambiguous || 99.6% Confident
PUR9_MOUSE - (Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] || Number of peptides = 10 || unambiguous || 99.6% Confident
SPCN_HUMAN - (Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) || Number of peptides = 12 || unambiguous || 99.6% Confident
ADHA_MOUSE - (P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) || Number of peptides = 43 || unambiguous || 99.6% Confident
Q91V41 - (Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) || Number of peptides = 9 || unambiguous || 99.6% Confident
VIME_MOUSE - (P20152) Vimentin || Number of peptides = 10 || unambiguous || 99.6% Confident
CDK4_MOUSE - (P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) || Number of peptides = 9 || unambiguous || 99.6% Confident
TRFE_MOUSE - (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) || Number of peptides = 67 || unambiguous || 99.6% Confident
CAP1_MOUSE - (P40124) Adenylyl cyclase-associated protein 1 (CAP 1) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q91V31 - (Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence) || Number of peptides = 2 || ambiguous || 99.6% Confident
PTPA_MOUSE - (P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) || Number of peptides = 10 || unambiguous || 99.6% Confident
TCPD_MOUSE - (P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) || Number of peptides = 13 || unambiguous || 99.6% Confident
K22E_HUMAN - (P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e) || Number of peptides = 9 || unambiguous || 99.6% Confident
U5S1_MOUSE - (O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) || Number of peptides = 5 || ambiguous || 99.6% Confident
APA4_MOUSE - (P06728) Apolipoprotein A-IV precursor (Apo-AIV) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q91V12 - (Q91V12) Acyl-CoA hydrolase (Hypothetical 37.6 kDa protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
RL12_MOUSE - (P35979) 60S ribosomal protein L12 || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9CT27 - (Q9CT27) 2610015J01Rik protein (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9CT17 - (Q9CT17) 2610019N13Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q62418 - (Q62418) Drebrin-like SH3 domain-containing protein SH3P7 || Number of peptides = 1 || unambiguous || 99.6% Confident
Q8R346 - (Q8R346) Similar to alanyl-tRNA synthetase (H. sapiens) || Number of peptides = 5 || unambiguous || 99.6% Confident
IF4G_HUMAN - (Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) || Number of peptides = 11 || unambiguous || 99.6% Confident
RS16_MOUSE - (P14131) 40S ribosomal protein S16 || Number of peptides = 3 || ambiguous || 99.6% Confident
FKB1_MOUSE - (P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) || Number of peptides = 12 || ambiguous || 99.6% Confident
Q924D2 - (Q924D2) Myosin light chain kinase (Fragment) || Number of peptides = 8 || unambiguous || 99.6% Confident
CDC2_MOUSE - (P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) || Number of peptides = 17 || ambiguous || 99.6% Confident
PDA4_MOUSE - (P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) || Number of peptides = 16 || unambiguous || 99.6% Confident
TSN_MOUSE - (Q62348) Translin || Number of peptides = 8 || unambiguous || 99.6% Confident
PDX5_MOUSE - (P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q99KP6 - (Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9QXD8 - (Q9QXD8) LIM domains containing protein 1 || Number of peptides = 4 || unambiguous || 99.6% Confident
RL15_MOUSE - (Q9CZM2) 60S ribosomal protein L15 || Number of peptides = 18 || unambiguous || 99.6% Confident
Q99K35 - (Q99K35) Similar to hypothetical protein LOC57333 (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
RAC1_HUMAN - (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) || Number of peptides = 7 || ambiguous || 99.6% Confident
O00512 - (O00512) B-cell CLL/lymphoma 9 || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CSH0 - (Q9CSH0) 2810036L13Rik protein (Fragment) || Number of peptides = 6 || ambiguous || 99.6% Confident
SODC_MOUSE - (P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9UM06 - (Q9UM06) ABP125 || Number of peptides = 5 || ambiguous || 99.6% Confident
CALM_HUMAN - (P02593) Calmodulin (P02593) Calmodulin || Number of peptides = 1 || ambiguous || 99.6% Confident
PSD7_MOUSE - (P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) || Number of peptides = 14 || ambiguous || 99.6% Confident
SBP1_MOUSE - (P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56) || Number of peptides = 13 || ambiguous || 99.6% Confident
DYJ2_HUMAN - (O43237) Dynein light intermediate chain 2, cytosolic (LIC53/55) (LIC-2) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q8VC30 - (Q8VC30) Similar to DKFZP586B1621 protein || Number of peptides = 4 || unambiguous || 99.6% Confident
MPRI_MOUSE - (Q07113) Cation-independent mannose-6-phosphate receptor precursor (CI Man-6-P receptor) (CI-MPR) (Insulin-like growth factor II receptor) (300 kDa mannose 6-phosphate receptor) (MPR 300) (MPR300) || Number of peptides = 13 || unambiguous || 99.6% Confident
WDR1_MOUSE - (O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) || Number of peptides = 16 || unambiguous || 99.6% Confident
RL2B_HUMAN - (P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a || Number of peptides = 9 || ambiguous || 99.6% Confident
K6PL_MOUSE - (P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) || Number of peptides = 12 || unambiguous || 99.6% Confident
IF36_HUMAN - (Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6) (Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6) || Number of peptides = 5 || ambiguous || 99.6% Confident
FETA_MOUSE - (P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) || Number of peptides = 111 || unambiguous || 99.6% Confident
PYR5_MOUSE - (P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] || Number of peptides = 4 || unambiguous || 99.6% Confident
PRS4_HUMAN - (Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) || Number of peptides = 11 || ambiguous || 99.6% Confident
QOR_MOUSE - (P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin) || Number of peptides = 2 || unambiguous || 99.6% Confident
ANX5_MOUSE - (P48036) Annexin V (Lipocortin V) (Endonexin II) (Calphobindin I) (CBP-I) (Placental anticoagulant protein I) (PAP-I) (PP4) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) (Anchorin CII) || Number of peptides = 6 || unambiguous || 99.6% Confident
DD15_MOUSE - (O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9CRY5 - (Q9CRY5) 3010001M15Rik protein (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q8VEJ9 - (Q8VEJ9) Vacuolar sorting protein 4 || Number of peptides = 4 || ambiguous || 99.6% Confident
MPK1_MOUSE - (P31938) Dual specificity mitogen-activated protein kinase kinase 1 (EC 2.7.1.-) (MAP kinase kinase 1) (MAPKK 1) (ERK activator kinase 1) (MAPK/ERK kinase 1) (MEK1) || Number of peptides = 4 || ambiguous || 99.6% Confident
RL23_HUMAN - (P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) || Number of peptides = 20 || ambiguous || 99.6% Confident
ROA1_MOUSE - (P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) || Number of peptides = 38 || ambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 97 || ambiguous || 99.6% Confident
Q9JM14 - (Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C) || Number of peptides = 3 || ambiguous || 99.6% Confident
DHAM_MOUSE - (P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2) || Number of peptides = 4 || unambiguous || 99.6% Confident
SBP2_MOUSE - (Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q8VEH5 - (Q8VEH5) Similar to KIAA0766 gene product || Number of peptides = 7 || unambiguous || 99.6% Confident
CH60_MOUSE - (P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65) || Number of peptides = 4 || unambiguous || 99.6% Confident
O88738 - (O88738) Ubiquitin-conjugating enzyme || Number of peptides = 13 || unambiguous || 99.6% Confident
ANX1_MOUSE - (P10107) Annexin I (Lipocortin I) (Calpactin II) (Chromobindin 9) (P35) (Phospholipase A2 inhibitory protein) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q93052 - (Q93052) LIPOMA PREFERRED partner (LPP) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9DAB4 - (Q9DAB4) 1700015E05Rik protein || Number of peptides = 10 || ambiguous || 99.6% Confident
Q9D1P4 - (Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9D819 - (Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene) || Number of peptides = 10 || unambiguous || 99.6% Confident
HNT1_MOUSE - (P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) || Number of peptides = 8 || unambiguous || 99.6% Confident
FKB4_MOUSE - (P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) || Number of peptides = 28 || unambiguous || 99.6% Confident
RL4_MOUSE - (Q9D8E6) 60S ribosomal protein L4 (L1) || Number of peptides = 21 || ambiguous || 99.6% Confident
A1T1_MOUSE - (P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 9 || ambiguous || 99.6% Confident
K6A1_MOUSE - (P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9D8S9 - (Q9D8S9) 1810037G04Rik protein || Number of peptides = 8 || unambiguous || 99.6% Confident
COF1_MOUSE - (P18760) Cofilin, non-muscle isoform || Number of peptides = 59 || unambiguous || 99.6% Confident
TERA_MOUSE - (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] || Number of peptides = 38 || ambiguous || 99.6% Confident
Q9ERD3 - (Q9ERD3) Telokin || Number of peptides = 3 || unambiguous || 99.6% Confident
O35737 - (O35737) Heterogeneous nuclear ribonucleoprotein H || Number of peptides = 9 || ambiguous || 99.6% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 46 || unambiguous || 99.6% Confident
RFA2_MOUSE - (Q62193) Replication protein A 32 kDa subunit (RP-A) (RF-A) (Replication factor-A protein 2) || Number of peptides = 5 || unambiguous || 99.6% Confident
ANX2_MOUSE - (P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV) || Number of peptides = 17 || unambiguous || 99.6% Confident
SYS_MOUSE - (P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9D1L0 - (Q9D1L0) Ethanol induced 6 || Number of peptides = 1 || unambiguous || 99.6% Confident
ARF4_MOUSE - (P36403) ADP-ribosylation factor 4 || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9CRK7 - (Q9CRK7) 9430095H01Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
RET1_MOUSE - (Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI) || Number of peptides = 7 || unambiguous || 99.6% Confident
SYG_MOUSE - (Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9CRI0 - (Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) || Number of peptides = 10 || ambiguous || 99.6% Confident
MK01_MOUSE - (P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) || Number of peptides = 6 || ambiguous || 99.6% Confident
PSA2_MOUSE - (P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) || Number of peptides = 5 || ambiguous || 99.6% Confident
CABA_MOUSE - (Q99020) CARG-binding factor-A (CBF-A) || Number of peptides = 26 || unambiguous || 99.6% Confident
PGK1_MOUSE - (P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) || Number of peptides = 27 || unambiguous || 99.6% Confident
Q9DAJ6 - (Q9DAJ6) 1500026J17Rik protein || Number of peptides = 8 || ambiguous || 99.6% Confident
RB1A_HUMAN - (P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein) || Number of peptides = 3 || ambiguous || 99.6% Confident
HBAZ_MOUSE - (P06467) Hemoglobin zeta chain || Number of peptides = 24 || unambiguous || 99.6% Confident
TCPE_MOUSE - (P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) || Number of peptides = 24 || unambiguous || 99.6% Confident
O00429 - (O00429) Dynamin-like protein || Number of peptides = 8 || ambiguous || 99.6% Confident
R37A_HUMAN - (P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a || Number of peptides = 20 || ambiguous || 99.6% Confident
SPCO_MOUSE - (Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) || Number of peptides = 22 || unambiguous || 99.6% Confident
ILK_MOUSE - (O55222) Integrin-linked protein kinase (EC 2.7.1.-) || Number of peptides = 6 || ambiguous || 99.6% Confident
LKHA_MOUSE - (P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 17 || unambiguous || 99.6% Confident
CRP1_MOUSE - (P04006) Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP) || Number of peptides = 5 || unambiguous || 99.6% Confident
FBL1_MOUSE - (Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) || Number of peptides = 5 || unambiguous || 99.6% Confident
EZRI_MOUSE - (P26040) Ezrin (p81) (Cytovillin) (Villin 2) || Number of peptides = 25 || unambiguous || 99.6% Confident
PGK1_HUMAN - (P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q8R081 - (Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L || Number of peptides = 13 || unambiguous || 99.6% Confident
Q9CR86 - (Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) || Number of peptides = 9 || ambiguous || 99.6% Confident
G6PI_MOUSE - (P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) || Number of peptides = 18 || ambiguous || 99.6% Confident
TAL1_MOUSE - (Q93092) Transaldolase (EC 2.2.1.2) || Number of peptides = 12 || unambiguous || 99.6% Confident
MCA1_MOUSE - (P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9JJH0 - (Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase || Number of peptides = 5 || ambiguous || 99.6% Confident
CGC8_MOUSE - (Q9D187) Hypothetical protein CGI-128 homolog || Number of peptides = 1 || ambiguous || 99.6% Confident
MCM6_MOUSE - (P97311) DNA replication licensing factor MCM6 (Mis5 homolog) || Number of peptides = 18 || unambiguous || 99.6% Confident
DPP3_MOUSE - (Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) || Number of peptides = 5 || unambiguous || 99.6% Confident
LGUL_MOUSE - (Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q99LT1 - (Q99LT1) Hypothetical 39.2 kDa protein (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q923D8 - (Q923D8) Similar to Rho GTPase activating protein 1 || Number of peptides = 1 || ambiguous || 99.6% Confident
DPY3_MOUSE - (Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein) || Number of peptides = 4 || unambiguous || 99.6% Confident
CRTC_MOUSE - (P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) || Number of peptides = 20 || unambiguous || 99.6% Confident
APA1_MOUSE - (Q00623) Apolipoprotein A-I precursor (Apo-AI) || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9WU78 - (Q9WU78) ALG-2 interacting protein AIP1 || Number of peptides = 6 || ambiguous || 99.6% Confident
P97315 - (P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) || Number of peptides = 6 || ambiguous || 99.6% Confident
NUCL_MOUSE - (P09405) Nucleolin (Protein C23) || Number of peptides = 18 || unambiguous || 99.6% Confident
Q8VDW0 - (Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family || Number of peptides = 14 || ambiguous || 99.6% Confident
Q9CQU0 - (Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q921M3 - (Q921M3) Similar to splicing factor 3b, subunit 3, 130kD || Number of peptides = 4 || ambiguous || 99.6% Confident
CLH1_HUMAN - (Q00610) Clathrin heavy chain 1 (CLH-17) || Number of peptides = 32 || unambiguous || 99.6% Confident
O35691 - (O35691) Pinin || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CR16 - (Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) || Number of peptides = 12 || unambiguous || 99.6% Confident
O15250 - (O15250) Aminopeptidase P-like (EC 3.4.11.9) (XAA-PRO aminopeptidase) (X-PRO aminopeptidase) (Proline aminopeptidase) (Aminoacylproline aminopeptidase) (Soluble aminopeptidase P) || Number of peptides = 7 || unambiguous || 99.6% Confident
ATOX_MOUSE - (O08997) Copper transport protein ATOX1 (Metal transport protein ATX1) || Number of peptides = 1 || unambiguous || 99.6% Confident
AAC4_MOUSE - (P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) || Number of peptides = 30 || unambiguous || 99.6% Confident
UBP5_MOUSE - (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) || Number of peptides = 8 || unambiguous || 99.6% Confident
O00301 - (O00301) KSRP || Number of peptides = 13 || unambiguous || 99.6% Confident
Q9WTQ5 - (Q9WTQ5) SSECKS (PKC binding protein SSECKS) || Number of peptides = 11 || unambiguous || 99.6% Confident
RL8_HUMAN - (P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8 || Number of peptides = 11 || ambiguous || 99.6% Confident
BTF3_MOUSE - (Q64152) Transcription factor BTF3 (RNA polymerase B transcription factor 3) || Number of peptides = 4 || ambiguous || 99.6% Confident
PCNA_MOUSE - (P17918) Proliferating cell nuclear antigen (PCNA) (Cyclin) || Number of peptides = 4 || ambiguous || 99.6% Confident
DYNA_MOUSE - (O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) || Number of peptides = 12 || unambiguous || 99.6% Confident
AMP2_MOUSE - (O08663) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2) (Peptidase M 2) (Initiation factor 2 associated 67 kDa glycoprotein) (p67) (p67eIF2) || Number of peptides = 2 || ambiguous || 99.6% Confident
TCPY_MOUSE - (Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) || Number of peptides = 6 || unambiguous || 99.6% Confident
TALI_MOUSE - (P26039) Talin || Number of peptides = 57 || unambiguous || 99.6% Confident
HS9B_MOUSE - (P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) || Number of peptides = 74 || ambiguous || 99.6% Confident
P70333 - (P70333) Heterogeneous nuclear ribonucleoprotein H' (hnRNP H') (FTP-3) || Number of peptides = 1 || ambiguous || 99.6% Confident
TF1B_MOUSE - (Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) || Number of peptides = 19 || unambiguous || 99.6% Confident
Q9CQM9 - (Q9CQM9) Thioredoxin-like 2 || Number of peptides = 12 || unambiguous || 99.6% Confident
Q9D0K4 - (Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase) || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9D7G0 - (Q9D7G0) 2310010D17Rik protein || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 38 || ambiguous || 99.6% Confident
PAB1_MOUSE - (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1) || Number of peptides = 30 || unambiguous || 99.6% Confident
TCPZ_MOUSE - (P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) || Number of peptides = 14 || unambiguous || 99.6% Confident
RS7_HUMAN - (P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) || Number of peptides = 13 || ambiguous || 99.6% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 122 || unambiguous || 99.6% Confident
TGT_MOUSE - (Q9JMA2) Queuine tRNA-ribosyltransferase (EC 2.4.2.29) (tRNA-guanine transglycosylase) (Guanine insertion enzyme) || Number of peptides = 2 || unambiguous || 99.6% Confident
PIMT_MOUSE - (P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) || Number of peptides = 6 || ambiguous || 99.6% Confident
ITH2_MOUSE - (Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9D0E1 - (Q9D0E1) 2610023M21Rik protein || Number of peptides = 9 || unambiguous || 99.6% Confident
G25B_HUMAN - (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) || Number of peptides = 9 || ambiguous || 99.6% Confident
ENOA_MOUSE - (P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) || Number of peptides = 59 || unambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 30 || ambiguous || 99.6% Confident
AAC2_MOUSE - (Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) || Number of peptides = 20 || ambiguous || 99.6% Confident
KPY1_HUMAN - (P14618) Pyruvate kinase, M1 isozyme (EC 2.7.1.40) (Pyruvate kinase muscle isozyme) (Cytosolic thyroid hormone-binding protein) (CTHBP) (THBP1) || Number of peptides = 10 || ambiguous || 99.6% Confident
CRKL_MOUSE - (P47941) Crk-like protein || Number of peptides = 9 || unambiguous || 99.6% Confident
MDHM_MOUSE - (P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37) || Number of peptides = 7 || ambiguous || 99.6% Confident
UBA1_MOUSE - (Q02053) Ubiquitin-activating enzyme E1 1 || Number of peptides = 44 || unambiguous || 99.6% Confident
Q9CQ99 - (Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) || Number of peptides = 3 || unambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 25 || ambiguous || 99.6% Confident
Q62009 - (Q62009) Osteoblast specific factor 2 precursor (OSF-2) || Number of peptides = 8 || unambiguous || 99.6% Confident
IRE1_MOUSE - (P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) || Number of peptides = 5 || ambiguous || 99.6% Confident
TRXB_MOUSE - (Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q9CQ60 - (Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) || Number of peptides = 11 || unambiguous || 99.6% Confident
CAH2_MOUSE - (P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) || Number of peptides = 20 || ambiguous || 99.6% Confident
DHCA_MOUSE - (P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) || Number of peptides = 5 || unambiguous || 99.6% Confident
PDX2_MOUSE - (Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) || Number of peptides = 21 || unambiguous || 99.6% Confident
Q99K51 - (Q99K51) Hypothetical 70.7 kDa protein || Number of peptides = 16 || unambiguous || 99.6% Confident
PCB1_HUMAN - (Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) || Number of peptides = 5 || unambiguous || 99.6% Confident
O88568 - (O88568) Heterogenous nuclear ribonucleoprotein U || Number of peptides = 12 || unambiguous || 99.6% Confident
RS3_MOUSE - (P17073) 40S ribosomal protein S3 || Number of peptides = 32 || ambiguous || 99.6% Confident
Q8VDM6 - (Q8VDM6) Similar to E1B-55 kDa-associated protein 5 || Number of peptides = 10 || unambiguous || 99.6% Confident
Q8VDM4 - (Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2) || Number of peptides = 21 || unambiguous || 99.6% Confident
HDGF_MOUSE - (P51859) Hepatoma-derived growth factor (HDGF) || Number of peptides = 13 || ambiguous || 99.6% Confident
UBC7_HUMAN - (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) || Number of peptides = 6 || ambiguous || 99.6% Confident
FUMH_MOUSE - (P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) || Number of peptides = 3 || unambiguous || 99.6% Confident
U186_MOUSE - (Q923D4) Hypothetical protein MGC11596 || Number of peptides = 8 || ambiguous || 99.6% Confident
O60705 - (O60705) LIM protein || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9CPS1 - (Q9CPS1) 2510002C21Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
COPB_MOUSE - (Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP) || Number of peptides = 11 || unambiguous || 99.6% Confident
ARP2_HUMAN - (O15142) Actin-like protein 2 (Actin-related protein 2) || Number of peptides = 5 || unambiguous || 99.6% Confident
IF32_MOUSE - (Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1) || Number of peptides = 3 || ambiguous || 99.6% Confident
RL7A_MOUSE - (P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) || Number of peptides = 23 || ambiguous || 99.6% Confident
RS29_HUMAN - (P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 || Number of peptides = 3 || ambiguous || 99.6% Confident
O88543 - (O88543) COP9 complex subunit 3 || Number of peptides = 1 || ambiguous || 99.6% Confident
PEBP_MOUSE - (P70296) Phosphatidylethanolamine-binding protein (PEBP) || Number of peptides = 11 || unambiguous || 99.6% Confident
SRC8_MOUSE - (Q60598) Src substrate cortactin || Number of peptides = 3 || ambiguous || 99.6% Confident
U2AF_MOUSE - (P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit) || Number of peptides = 1 || ambiguous || 99.6% Confident
CNBP_MOUSE - (P53996) Cellular nucleic acid binding protein (CNBP) || Number of peptides = 5 || ambiguous || 99.6% Confident
Y310_HUMAN - (O15027) Hypothetical protein KIAA0310 (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9Y6Y8 - (Q9Y6Y8) Phospholipase || Number of peptides = 5 || unambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 155 || unambiguous || 99.6% Confident
CPSM_HUMAN - (P31327) Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSASE I) || Number of peptides = 4 || unambiguous || 99.6% Confident
DYHC_MOUSE - (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) || Number of peptides = 34 || unambiguous || 99.6% Confident
O89112 - (O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9DBT2 - (Q9DBT2) 1200014H24Rik protein || Number of peptides = 5 || ambiguous || 99.6% Confident
IQG1_MOUSE - (Q9JKF1) Ras GTPase-activating-like protein IQGAP1 || Number of peptides = 17 || unambiguous || 99.6% Confident
LDHL_HUMAN - (Q9BYZ2) L-lactate dehydrogenase A-like (EC 1.1.1.27) || Number of peptides = 6 || unambiguous || 99.6% Confident
P2CA_MOUSE - (P49443) Protein phosphatase 2C alpha isoform (EC 3.1.3.16) (PP2C-alpha) (IA) (Protein phosphatase 1A) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9Z2X1 - (Q9Z2X1) Ribonucleoprotein F || Number of peptides = 5 || unambiguous || 99.6% Confident
Q9UEV9 - (Q9UEV9) Actin-binding protein homolog ABP-278 || Number of peptides = 15 || ambiguous || 99.6% Confident
PCB2_MOUSE - (Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q91ZP1 - (Q91ZP1) Fibrinogen B-beta-chain (Fragment) || Number of peptides = 7 || unambiguous || 99.6% Confident
CNE3_HUMAN - (O75131) Copine III || Number of peptides = 7 || unambiguous || 99.6% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 21 || unambiguous || 99.6% Confident
PDX4_MOUSE - (O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) || Number of peptides = 9 || unambiguous || 99.6% Confident
FUS_MOUSE - (P56959) RNA-binding protein FUS (Pigpen protein) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q91ZJ5 - (Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2 || Number of peptides = 4 || unambiguous || 99.6% Confident
IF6_MOUSE - (O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP)) || Number of peptides = 3 || ambiguous || 99.6% Confident
O08817 - (O08817) CW17 protein || Number of peptides = 8 || ambiguous || 99.6% Confident
HBB2_MOUSE - (P02089) Hemoglobin beta-2 chain (B2) (Minor) || Number of peptides = 35 || unambiguous || 99.6% Confident
TKT_MOUSE - (P40142) Transketolase (EC 2.2.1.1) (TK) (P68) || Number of peptides = 43 || unambiguous || 99.6% Confident
TPIS_MOUSE - (P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) || Number of peptides = 26 || unambiguous || 99.6% Confident
O35499 - (O35499) Nuclear autoantigenic sperm protein || Number of peptides = 13 || unambiguous || 99.6% Confident
PPS1_MOUSE - (Q60967) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1 (PAPS synthethase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (Sulfate adenylate transferase) (SAT) (ATP-sulfurylase); Adenylylsulfate kinase (EC 2.7.1.25) (Adenylylsulfate 3'-phosphotransferase) (APS kinase) (Adenosine-5'-phosphosulfate 3'-phosphotransferase) (3'-phosphoadenosine-5'-phosphosulfate synthetase)] || Number of peptides = 9 || unambiguous || 99.6% Confident
IF3A_MOUSE - (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin) || Number of peptides = 18 || unambiguous || 99.6% Confident
Q8VBT9 - (Q8VBT9) RIKEN cDNA 1190006K01 gene (Similar to alveolar soft part sarcoma chromosome region, candidate 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
LDHB_MOUSE - (P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H) || Number of peptides = 7 || ambiguous || 99.6% Confident
RL21_MOUSE - (O09167) 60S ribosomal protein L21 || Number of peptides = 7 || unambiguous || 99.6% Confident
PE15_MOUSE - (Q62048) Astrocytic phosphoprotein PEA-15 || Number of peptides = 9 || ambiguous || 99.6% Confident
DDX5_HUMAN - (P17844) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9Z1R2 - (Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9Z1N5 - (Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1) || Number of peptides = 12 || ambiguous || 99.6% Confident
O54789 - (O54789) Protein L (Fragment) || Number of peptides = 5 || ambiguous || 99.6% Confident
RAN_HUMAN - (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) || Number of peptides = 24 || ambiguous || 99.6% Confident
Q91YL6 - (Q91YL6) Hypothetical 34.0 kDa protein || Number of peptides = 3 || unambiguous || 99.6% Confident
P2AA_MOUSE - (P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) || Number of peptides = 5 || ambiguous || 99.6% Confident
GRBA_MOUSE - (Q60760) Growth factor receptor-bound protein 10 (GRB10 adaptor protein) || Number of peptides = 4 || ambiguous || 99.6% Confident
P2CG_MOUSE - (Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13) || Number of peptides = 5 || unambiguous || 99.6% Confident
SPS1_HUMAN - (P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1) || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9Z1F9 - (Q9Z1F9) ARX || Number of peptides = 5 || unambiguous || 99.6% Confident
RL30_HUMAN - (P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 || Number of peptides = 6 || ambiguous || 99.6% Confident
PYRG_MOUSE - (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) || Number of peptides = 10 || unambiguous || 99.6% Confident
P97825 - (P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) || Number of peptides = 6 || unambiguous || 99.6% Confident
O09132 - (O09132) A6 gene product || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9CXY6 - (Q9CXY6) 6230405A16Rik protein (Interleukin enhancer binding factor 2) (Similar to interleukin enhancer binding factor 2, 45kD) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9DCJ0 - (Q9DCJ0) 0610033N24Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
ADA_MOUSE - (P03958) Adenosine deaminase (EC 3.5.4.4) (Adenosine aminohydrolase) || Number of peptides = 3 || unambiguous || 99.6% Confident
CO3_MOUSE - (P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] || Number of peptides = 13 || unambiguous || 99.6% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 21 || ambiguous || 99.6% Confident
Q9JHQ5 - (Q9JHQ5) Leucine zipper transcription factor-like 1 || Number of peptides = 4 || unambiguous || 99.6% Confident
O88306 - (O88306) DJ-1 || Number of peptides = 7 || ambiguous || 99.6% Confident
RL9_MOUSE - (P51410) 60S ribosomal protein L9 || Number of peptides = 10 || ambiguous || 99.6% Confident
PRSX_HUMAN - (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) || Number of peptides = 13 || ambiguous || 99.6% Confident
SAHH_MOUSE - (P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) || Number of peptides = 13 || unambiguous || 99.6% Confident
DPY2_MOUSE - (O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) || Number of peptides = 27 || unambiguous || 99.6% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 5 || unambiguous || 99.6% Confident
HBE_MOUSE - (P02104) Hemoglobin epsilon-Y2 chain || Number of peptides = 30 || ambiguous || 99.6% Confident
RSP4_MOUSE - (P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor) || Number of peptides = 13 || ambiguous || 99.6% Confident
RL26_HUMAN - (Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26 || Number of peptides = 20 || ambiguous || 99.6% Confident
MTPN_MOUSE - (P80144) Myotrophin (V-1 protein) (Granule cell differentiation protein) || Number of peptides = 4 || ambiguous || 99.6% Confident
MAP4_MOUSE - (P27546) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q91Y38 - (Q91Y38) UDP-N-acetylglucosaminyltransferase || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9CWI5 - (Q9CWI5) Ribosomal protein L15 || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9D892 - (Q9D892) 2010016I08Rik protein || Number of peptides = 3 || unambiguous || 99.6% Confident
O08794 - (O08794) Alpha glucosidase II, alpha subunit || Number of peptides = 33 || unambiguous || 99.6% Confident
Q91Y37 - (Q91Y37) Cytosolic aminopeptidase P || Number of peptides = 6 || unambiguous || 99.6% Confident
O08795 - (O08795) Alpha glucosidase II, beta subunit || Number of peptides = 4 || ambiguous || 99.6% Confident
Q99KR3 - (Q99KR3) Hypothetical 32.8 kDa protein || Number of peptides = 2 || unambiguous || 99.6% Confident
Q99PC3 - (Q99PC3) CGI-74-like SR-rich protein || Number of peptides = 7 || ambiguous || 99.6% Confident
Q8R1K5 - (Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) || Number of peptides = 14 || ambiguous || 99.6% Confident
HS9A_MOUSE - (P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) || Number of peptides = 84 || unambiguous || 99.6% Confident
FLNA_HUMAN - (P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) || Number of peptides = 38 || unambiguous || 99.6% Confident
H2AG_HUMAN - (P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) || Number of peptides = 13 || ambiguous || 99.6% Confident
PSA6_MOUSE - (Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) || Number of peptides = 4 || ambiguous || 99.6% Confident
CYPB_MOUSE - (P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) || Number of peptides = 9 || unambiguous || 99.6% Confident
GDIR_MOUSE - (Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) || Number of peptides = 14 || ambiguous || 99.6% Confident
RL7_MOUSE - (P14148) 60S ribosomal protein L7 || Number of peptides = 25 || ambiguous || 99.6% Confident
MYG1_MOUSE - (Q9JK81) MYG1 protein (Gamm1 protein) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9EPL8 - (Q9EPL8) RanBP7/importin 7 || Number of peptides = 4 || ambiguous || 99.6% Confident
ANX6_MOUSE - (P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II) || Number of peptides = 31 || unambiguous || 99.6% Confident
PPI1_MOUSE - (P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q8VI52 - (Q8VI52) Endophilin B1b || Number of peptides = 2 || ambiguous || 99.6% Confident
ARI1_MOUSE - (Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment) || Number of peptides = 5 || ambiguous || 99.6% Confident
IF5A_HUMAN - (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) || Number of peptides = 43 || ambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 108 || ambiguous || 99.6% Confident
ENPL_MOUSE - (P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) || Number of peptides = 24 || unambiguous || 99.6% Confident
Q9CWK1 - (Q9CWK1) 2410026J11Rik protein || Number of peptides = 10 || ambiguous || 99.6% Confident
PDX1_MOUSE - (P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) || Number of peptides = 28 || unambiguous || 99.6% Confident
143T_MOUSE - (P35216) 14-3-3 protein tau (14-3-3 protein theta) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q8TCG3 - (Q8TCG3) TPMsk3 (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
PDL1_MOUSE - (O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) || Number of peptides = 5 || unambiguous || 99.6% Confident
ALDR_MOUSE - (P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) || Number of peptides = 16 || ambiguous || 99.6% Confident
Q9CXA2 - (Q9CXA2) 2810055F11Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9DAE4 - (Q9DAE4) 1700012F10Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
BAG3_MOUSE - (Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) || Number of peptides = 2 || unambiguous || 99.6% Confident
RS8_HUMAN - (P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8 || Number of peptides = 7 || ambiguous || 99.6% Confident
Q9CQX8 - (Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) || Number of peptides = 3 || unambiguous || 99.6% Confident
RS24_HUMAN - (P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19) || Number of peptides = 18 || ambiguous || 99.6% Confident
MLEN_MOUSE - (Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) || Number of peptides = 3 || unambiguous || 99.6% Confident
UBCI_HUMAN - (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q8R574 - (Q8R574) Phosphoribosyl pyrophosphate synthetase-associated protein 2 || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9CSN8 - (Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) || Number of peptides = 11 || ambiguous || 99.6% Confident
Q9D967 - (Q9D967) 1810034K20Rik protein (Magnesium-dependent phosphatase-1) || Number of peptides = 1 || unambiguous || 99.6% Confident
IDHC_MOUSE - (O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q99J35 - (Q99J35) Hypothetical 41.0 kDa protein || Number of peptides = 5 || unambiguous || 99.6% Confident
CATA_MOUSE - (P24270) Catalase (EC 1.11.1.6) || Number of peptides = 8 || unambiguous || 99.6% Confident
SPH2_MOUSE - (Q9JIA7) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2) || Number of peptides = 3 || unambiguous || 99.5% Confident
Q9CPN8 - (Q9CPN8) 10 days embryo cDNA, RIKEN full-length enriched library, clone:2610036B18, full insert sequence (Igf2 mRNA-binding protein 3) || Number of peptides = 6 || unambiguous || 99.5% Confident
Q91VJ3 - (Q91VJ3) Similar to Adenosin kinase || Number of peptides = 8 || unambiguous || 99.5% Confident
TPM1_MOUSE - (P58771) Tropomyosin 1 alpha chain (Alpha-tropomyosin) || Number of peptides = 8 || ambiguous || 99.5% Confident
STB2_MOUSE - (Q64324) Syntaxin binding protein 2 (UNC-18 homolog 2) (UNC-18B) (MUSEC1) || Number of peptides = 5 || unambiguous || 99.5% Confident
O88701 - (O88701) Nucleosome assembly protein 1-like protein 4 || Number of peptides = 5 || unambiguous || 99.5% Confident
K6PF_MOUSE - (P47857) 6-phosphofructokinase, muscle type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme A) (PFK-A) || Number of peptides = 4 || ambiguous || 99.5% Confident
Q8VDP4 - (Q8VDP4) Hypothetical 112.5 kDa protein (Fragment) || Number of peptides = 8 || unambiguous || 99.5% Confident
O70565 - (O70565) Cp27 protein || Number of peptides = 6 || ambiguous || 99.5% Confident
TPM3_MOUSE - (P21107) Tropomyosin alpha 3 chain (Tropomyosin 3) (Tropomyosin gamma) || Number of peptides = 2 || ambiguous || 99.5% Confident
GFA1_MOUSE - (P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) || Number of peptides = 8 || unambiguous || 99.5% Confident
O95752 - (O95752) Chromosome-associated polypeptide-C || Number of peptides = 6 || unambiguous || 99.4% Confident
Q96F86 - (Q96F86) Hypothetical protein || Number of peptides = 2 || unambiguous || 99.4% Confident
ST13_MOUSE - (Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) || Number of peptides = 5 || unambiguous || 99.4% Confident
Q9DC56 - (Q9DC56) 1200003A09Rik protein || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9D0Q8 - (Q9D0Q8) 2600005K24Rik protein || Number of peptides = 5 || ambiguous || 99.4% Confident
TPMT_MOUSE - (O55060) Thiopurine S-methyltransferase (EC 2.1.1.67) (Thiopurine methyltransferase) || Number of peptides = 1 || unambiguous || 99.4% Confident
MCM4_MOUSE - (P49717) DNA replication licensing factor MCM4 (CDC21 homolog) (P1-CDC21) || Number of peptides = 19 || unambiguous || 99.4% Confident
GTT1_MOUSE - (Q64471) Glutathione S-transferase theta 1 (EC 2.5.1.18) (GST class-theta) || Number of peptides = 1 || unambiguous || 99.4% Confident
143E_HUMAN - (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) || Number of peptides = 13 || ambiguous || 99.4% Confident
Q9EQC8 - (Q9EQC8) Papillary renal cell carcinoma-associated protein || Number of peptides = 2 || unambiguous || 99.4% Confident
XPO4_MOUSE - (Q9ESJ0) Exportin 4 (Exp4) || Number of peptides = 5 || unambiguous || 99.4% Confident
THIO_MOUSE - (P10639) Thioredoxin (ATL-derived factor) (ADF) || Number of peptides = 13 || unambiguous || 99.4% Confident
Q9CQR6 - (Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit) || Number of peptides = 4 || ambiguous || 99.4% Confident
KC22_MOUSE - (O54833) Casein kinase II, alpha' chain (CK II) (EC 2.7.1.37) || Number of peptides = 3 || ambiguous || 99.4% Confident
Q922S1 - (Q922S1) Similar to phenylalanine-tRNA synthetase-like || Number of peptides = 7 || ambiguous || 99.4% Confident
Q9JKR6 - (Q9JKR6) 170 kDa glucose regulated protein GRP170 precursor || Number of peptides = 10 || unambiguous || 99.4% Confident
Q9DBQ4 - (Q9DBQ4) 1200016L19Rik protein || Number of peptides = 6 || ambiguous || 99.4% Confident
ODPA_MOUSE - (P35486) Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursor (EC 1.2.4.1) (PDHE1-A type I) || Number of peptides = 3 || ambiguous || 99.4% Confident
HBB0_MOUSE - (P04443) Hemoglobin beta-H0 chain || Number of peptides = 6 || unambiguous || 99.4% Confident
Q9CVB6 - (Q9CVB6) 2210023N03Rik protein (Fragment) || Number of peptides = 6 || ambiguous || 99.4% Confident
VAA1_MOUSE - (P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) || Number of peptides = 6 || unambiguous || 99.4% Confident
Q9DBF1 - (Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1) || Number of peptides = 3 || unambiguous || 99.4% Confident
DJA1_MOUSE - (P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) || Number of peptides = 12 || ambiguous || 99.4% Confident
Q920Q6 - (Q920Q6) RNA-binding protein Musashi2-L || Number of peptides = 2 || unambiguous || 99.4% Confident
Q9Z1Y4 - (Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) || Number of peptides = 2 || unambiguous || 99.4% Confident
Q8R2X0 - (Q8R2X0) Similar to EH-domain containing 2 || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9QZM1 - (Q9QZM1) PLIC-1 || Number of peptides = 2 || ambiguous || 99.4% Confident
Q9QZF4 - (Q9QZF4) Cytoplasmic linker protein 50 || Number of peptides = 3 || ambiguous || 99.4% Confident
AIP_MOUSE - (O08915) AH receptor-interacting protein (AIP) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9D8F9 - (Q9D8F9) 2010003J03Rik protein || Number of peptides = 2 || unambiguous || 99.4% Confident
Q91YE4 - (Q91YE4) 67 kDa polymerase-associated factor PAF67 || Number of peptides = 4 || ambiguous || 99.4% Confident
Z313_MOUSE - (Q9ET26) Zinc finger protein 313 || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9D0C4 - (Q9D0C4) 2610027O18Rik protein (RIKEN cDNA 2610027O18 gene) || Number of peptides = 5 || unambiguous || 99.4% Confident
Q9CRF9 - (Q9CRF9) 2410081F06Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 99.4% Confident
NPM_MOUSE - (Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38) || Number of peptides = 8 || ambiguous || 99.4% Confident
Q9D1G1 - (Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) || Number of peptides = 3 || unambiguous || 99.4% Confident
143B_MOUSE - (Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 22 || unambiguous || 99.4% Confident
Q9DC99 - (Q9DC99) 0710007A14Rik protein || Number of peptides = 4 || ambiguous || 99.4% Confident
CYC_MOUSE - (P00009) Cytochrome c, somatic || Number of peptides = 6 || ambiguous || 99.4% Confident
RS4_HUMAN - (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) || Number of peptides = 19 || ambiguous || 99.4% Confident
Q9CY91 - (Q9CY91) G1 to phase transition 2 || Number of peptides = 6 || ambiguous || 99.4% Confident
Q9D1M2 - (Q9D1M2) 1110003E08Rik protein || Number of peptides = 4 || ambiguous || 99.4% Confident
Q9CWW1 - (Q9CWW1) 2410003B16Rik protein || Number of peptides = 1 || ambiguous || 99.4% Confident
Q9CSM4 - (Q9CSM4) 60S ribosomal protein L27 (Fragment) || Number of peptides = 11 || ambiguous || 99.4% Confident
PSD3_MOUSE - (P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen) || Number of peptides = 7 || unambiguous || 99.4% Confident
GSH1_MOUSE - (P97494) Glutamate--cysteine ligase catalytic subunit (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS heavy chain) || Number of peptides = 8 || ambiguous || 99.4% Confident
CLP2_MOUSE - (Q08093) Calponin H2, smooth muscle || Number of peptides = 4 || ambiguous || 99.4% Confident
HDA1_MOUSE - (O09106) Histone deacetylase 1 (HD1) || Number of peptides = 4 || ambiguous || 99.4% Confident
RL5_MOUSE - (P47962) 60S ribosomal protein L5 || Number of peptides = 12 || ambiguous || 99.4% Confident
Q8VBV7 - (Q8VBV7) Hypothetical 23.3 kDa protein (Similar to COP9 homolog) (Expressed sequence AA408242) || Number of peptides = 3 || unambiguous || 99.4% Confident
O88477 - (O88477) Coding region determinant binding protein (Coding region determinant-binding protein) || Number of peptides = 2 || ambiguous || 99.4% Confident
RL17_MOUSE - (Q9CPR4) 60S ribosomal protein L17 (L23) || Number of peptides = 9 || ambiguous || 99.4% Confident
Q8VEE9 - (Q8VEE9) Similar to proteasome (Prosome, macropain) 26S subunit, non-ATPase, 5 || Number of peptides = 9 || unambiguous || 99.4% Confident
AK10_MOUSE - (O88845) A kinase anchor protein 10, mitochondrial (Protein kinase A anchoring protein 10) (PRKA10) (Dual specificity A-Kinase anchoring protein 2) (D-AKAP-2) (Fragment) || Number of peptides = 3 || unambiguous || 99.4% Confident
G3BP_MOUSE - (P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) || Number of peptides = 15 || unambiguous || 99.4% Confident
Q8QZY9 - (Q8QZY9) Splicing factor 3b, subunit 4, 49kD (Hypothetical 44.4 kDa protein) || Number of peptides = 4 || ambiguous || 99.4% Confident
R10A_MOUSE - (P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) || Number of peptides = 15 || ambiguous || 99.4% Confident
PSA1_MOUSE - (Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) || Number of peptides = 16 || ambiguous || 99.4% Confident
GYG2_HUMAN - (O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) || Number of peptides = 7 || unambiguous || 99.4% Confident
GLYG_MOUSE - (Q9R062) Glycogenin-1 (EC 2.4.1.186) || Number of peptides = 9 || unambiguous || 99.4% Confident
DLG2_HUMAN - (Q15700) Channel associated protein of synapse-110 (Chapsyn-110) (Discs, large homolog 2) || Number of peptides = 3 || unambiguous || 99.4% Confident
143Z_MOUSE - (P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) || Number of peptides = 6 || unambiguous || 99.4% Confident
Q91Z53 - (Q91Z53) Similar to glyoxylate reductase/hydroxypyruvate reductase || Number of peptides = 2 || unambiguous || 99.4% Confident
P70303 - (P70303) CTP synthetase homolog (CTPSH) || Number of peptides = 3 || unambiguous || 99.4% Confident
Q8VDD5 - (Q8VDD5) Nonmuscle heavy chain myosin II-A || Number of peptides = 6 || ambiguous || 99.4% Confident
AMPL_MOUSE - (Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) || Number of peptides = 10 || ambiguous || 99.4% Confident
RADI_MOUSE - (P26043) Radixin || Number of peptides = 9 || unambiguous || 99.4% Confident
Q9JK31 - (Q9JK31) ATFa-associated factor || Number of peptides = 2 || unambiguous || 99.3% Confident
Q91YS8 - (Q91YS8) Similar to calcium/calmodulin-dependent protein kinase I || Number of peptides = 3 || ambiguous || 99.3% Confident
Q9EPZ2 - (Q9EPZ2) ELAC2 || Number of peptides = 6 || unambiguous || 99.3% Confident
H2AZ_HUMAN - (P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z) || Number of peptides = 2 || ambiguous || 99.3% Confident
Q8R0B2 - (Q8R0B2) Hypothetical 26.4 kDa protein (Fragment) || Number of peptides = 3 || ambiguous || 99.3% Confident
DNPE_HUMAN - (Q9ULA0) Aspartyl aminopeptidase (EC 3.4.11.21) || Number of peptides = 1 || ambiguous || 99.3% Confident
STN1_MOUSE - (P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) || Number of peptides = 14 || unambiguous || 99.3% Confident
Q9CXT4 - (Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence || Number of peptides = 8 || ambiguous || 99.3% Confident
APA2_MOUSE - (P09813) Apolipoprotein A-II precursor (Apo-AII) || Number of peptides = 3 || unambiguous || 99.3% Confident
Q9CTD4 - (Q9CTD4) 6030455P07Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 99.3% Confident
Q9D285 - (Q9D285) Adult male colon cDNA, RIKEN full-length enriched library, clone:9030215D04, full insert sequence || Number of peptides = 3 || ambiguous || 99.3% Confident
Q91W50 - (Q91W50) Hypothetical 88.8 kDa protein || Number of peptides = 11 || unambiguous || 99.3% Confident
CBG_MOUSE - (Q06770) Corticosteroid-binding globulin precursor (CBG) (Transcortin) || Number of peptides = 2 || unambiguous || 99.3% Confident
PUA2_MOUSE - (P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase) || Number of peptides = 4 || unambiguous || 99.3% Confident
NCR2_MOUSE - (Q9WU42) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC) || Number of peptides = 11 || unambiguous || 99.2% Confident
C61A_MOUSE - (P46737) C6.1A protein || Number of peptides = 2 || ambiguous || 99.2% Confident
Q922F4 - (Q922F4) Unknown (Protein for MGC:6469) || Number of peptides = 4 || ambiguous || 99.2% Confident
Q9DAS8 - (Q9DAS8) 1600029N02Rik protein || Number of peptides = 3 || unambiguous || 99.2% Confident
Q922K2 - (Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment) || Number of peptides = 6 || ambiguous || 99.2% Confident
RL1X_MOUSE - (P11249) 60S ribosomal protein L18a || Number of peptides = 17 || ambiguous || 99.2% Confident
Q9D0X8 - (Q9D0X8) 1110055E19Rik protein || Number of peptides = 4 || ambiguous || 99.2% Confident
Q91VZ6 - (Q91VZ6) Similar to hypothetical protein FLJ13159 || Number of peptides = 2 || unambiguous || 99.2% Confident
KAC_MOUSE - (P01837) Ig kappa chain C region || Number of peptides = 2 || ambiguous || 99.2% Confident
MAT3_HUMAN - (P43243) Matrin 3 || Number of peptides = 8 || unambiguous || 99.1% Confident
MIF_MOUSE - (P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) || Number of peptides = 10 || unambiguous || 99.1% Confident
SNX3_MOUSE - (O70492) Sorting nexin 3 (SDP3 protein) || Number of peptides = 7 || ambiguous || 99.1% Confident
Q9CT05 - (Q9CT05) 2610027H02Rik protein (Fragment) || Number of peptides = 5 || ambiguous || 99.1% Confident
C1TC_HUMAN - (P11586) C-1-tetrahydrofolate synthase, cytoplasmic (C1-THF synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)] || Number of peptides = 1 || unambiguous || 99.1% Confident
Q99MP4 - (Q99MP4) Nucleolar protein C7 || Number of peptides = 3 || ambiguous || 99.1% Confident
SYV2_MOUSE - (Q9Z1Q9) Valyl-tRNA synthetase 2 (EC 6.1.1.9) (Valine--tRNA ligase 2) (ValRS 2) || Number of peptides = 9 || unambiguous || 99.1% Confident
Q9CXX7 - (Q9CXX7) Small nuclear ribonucleoprotein polypeptide A || Number of peptides = 1 || ambiguous || 99.1% Confident
NED4_MOUSE - (P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) || Number of peptides = 12 || unambiguous || 99.1% Confident
PRS7_MOUSE - (P46471) 26S protease regulatory subunit 7 (MSS1 protein) || Number of peptides = 12 || ambiguous || 99.1% Confident
SYD_MOUSE - (Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) || Number of peptides = 15 || ambiguous || 99.1% Confident
T172_HUMAN - (O14981) TBP-associated factor 172 (TAF-172) (TAF(II)170) || Number of peptides = 7 || unambiguous || 99.1% Confident
Q9R1D2 - (Q9R1D2) Cyclin-dependent kinase 6 || Number of peptides = 5 || unambiguous || 99.1% Confident
O94894 - (O94894) Hypothetical protein KIAA0801 || Number of peptides = 3 || unambiguous || 99.1% Confident
HBBZ_MOUSE - (P04444) Hemoglobin beta-H1 chain (Z protein) || Number of peptides = 2 || unambiguous || 99.1% Confident
UE3A_MOUSE - (O08759) Ubiquitin-protein ligase E3A (EC 6.3.2.-) (Oncogenic protein-associated protein E6-AP) || Number of peptides = 10 || unambiguous || 99.1% Confident
Q61152 - (Q61152) Protein-tyrosine phosphatase 18 (EC 3.1.3.48) (PTP-K1) (Fetal liver phosphatase 1) (FLP1) (PTP 49) (PTP HSCF) || Number of peptides = 1 || unambiguous || 99.1% Confident
Q99LX7 - (Q99LX7) Hypothetical 31.3 kDa protein (Fragment) || Number of peptides = 2 || unambiguous || 99.1% Confident
Q9CXZ2 - (Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence || Number of peptides = 8 || ambiguous || 99.1% Confident
Q91WQ3 - (Q91WQ3) Similar to tyrosyl-tRNA synthetase (Hypothetical 59.1 kDa protein) (Expressed sequence AL024047) || Number of peptides = 7 || ambiguous || 99.1% Confident
PSD9_MOUSE - (Q9CR00) 26S proteasome non-ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27) || Number of peptides = 3 || ambiguous || 99.1% Confident
ACDL_MOUSE - (P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD) || Number of peptides = 2 || unambiguous || 99.1% Confident
Q9JHU9 - (Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1) || Number of peptides = 3 || unambiguous || 99.1% Confident
MOES_MOUSE - (P26041) Moesin (Membrane-organizing extension spike protein) || Number of peptides = 11 || ambiguous || 99.0% Confident
Q60864 - (Q60864) MSTI1 || Number of peptides = 8 || unambiguous || 99.0% Confident
Q9D029 - (Q9D029) DNA segment, Chr 7, Wayne state University 128, expressed (Unknown) (Protein for MGC:19443) || Number of peptides = 3 || ambiguous || 99.0% Confident
O75433 - (O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog) || Number of peptides = 4 || unambiguous || 99.0% Confident
DCT2_MOUSE - (Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) || Number of peptides = 3 || ambiguous || 99.0% Confident
PHS3_HUMAN - (P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) || Number of peptides = 9 || unambiguous || 99.0% Confident
K1CJ_HUMAN - (P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) || Number of peptides = 2 || ambiguous || 98.9% Confident
TCP1_MOUSE - (P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) || Number of peptides = 9 || ambiguous || 98.9% Confident
RL6_MOUSE - (P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) || Number of peptides = 25 || unambiguous || 98.9% Confident
Q921R2 - (Q921R2) Similar to ribosomal protein S13 || Number of peptides = 11 || ambiguous || 98.9% Confident
NDKA_MOUSE - (P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) || Number of peptides = 20 || unambiguous || 98.9% Confident
Q9JKX6 - (Q9JKX6) Nudix hydrolase || Number of peptides = 2 || unambiguous || 98.9% Confident
Q9D1J1 - (Q9D1J1) 1110005F07Rik protein || Number of peptides = 2 || unambiguous || 98.9% Confident
TAGL_MOUSE - (P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27) || Number of peptides = 9 || unambiguous || 98.9% Confident
RS20_HUMAN - (P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 || Number of peptides = 3 || ambiguous || 98.9% Confident
GTM2_MOUSE - (P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5) || Number of peptides = 2 || unambiguous || 98.9% Confident
Q99PC9 - (Q99PC9) Protein phosphatase 2 regulatory subunit B56 delta isoform || Number of peptides = 4 || ambiguous || 98.9% Confident
Q91W48 - (Q91W48) Archain 1 || Number of peptides = 8 || unambiguous || 98.9% Confident
CALU_MOUSE - (O35887) Calumenin precursor || Number of peptides = 5 || ambiguous || 98.9% Confident
O35729 - (O35729) Polycomb-M33 interacting protein Ring1B (Fragment) || Number of peptides = 4 || ambiguous || 98.8% Confident
H12_MOUSE - (P15864) Histone H1.2 (H1 VAR.1) (H1C) || Number of peptides = 2 || unambiguous || 98.8% Confident
CYTB_MOUSE - (Q62426) Cystatin B (Stefin B) || Number of peptides = 4 || unambiguous || 98.8% Confident
AP19_MOUSE - (P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) || Number of peptides = 5 || ambiguous || 98.8% Confident
Q9Z1A1 - (Q9Z1A1) TFG protein (Trk-fused gene) || Number of peptides = 5 || unambiguous || 98.8% Confident
Q9CR49 - (Q9CR49) Hemoglobin Y, beta-like embryonic chain || Number of peptides = 5 || unambiguous || 98.8% Confident
RS17_MOUSE - (P06584) 40S ribosomal protein S17 || Number of peptides = 9 || ambiguous || 98.7% Confident
ACLY_MOUSE - (Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) || Number of peptides = 17 || unambiguous || 98.7% Confident
Q9R0C4 - (Q9R0C4) Intermediate filament protein nestin || Number of peptides = 7 || unambiguous || 98.7% Confident
Q9Z1J0 - (Q9Z1J0) Kinesin-related mitotic motor protein (Fragment) || Number of peptides = 6 || unambiguous || 98.7% Confident
TPM4_HUMAN - (P07226) Tropomyosin alpha 4 chain (Tropomyosin 4) (TM30p1) || Number of peptides = 2 || unambiguous || 98.7% Confident
PRSA_MOUSE - (O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1) || Number of peptides = 9 || ambiguous || 98.6% Confident
Q9DCZ6 - (Q9DCZ6) 2410007D12Rik protein (RIKEN cDNA 2410007D12 gene) || Number of peptides = 1 || unambiguous || 98.6% Confident
LIS1_MOUSE - (P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) || Number of peptides = 5 || ambiguous || 98.6% Confident
VDP_MOUSE - (Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment) || Number of peptides = 6 || unambiguous || 98.6% Confident
LEG3_MOUSE - (P16110) Galectin-3 (Galactose-specific lectin 3) (MAC-2 antigen) (IgE-binding protein) (35 kDa lectin) (Carbohydrate binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-34 galactoside-binding lectin) || Number of peptides = 1 || ambiguous || 98.6% Confident
RL2A_MOUSE - (P14115) 60S ribosomal protein L27a (L29) || Number of peptides = 6 || ambiguous || 98.6% Confident
ACF7_MOUSE - (Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF) || Number of peptides = 22 || unambiguous || 98.6% Confident
PLSL_MOUSE - (Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65) || Number of peptides = 11 || unambiguous || 98.6% Confident
SDFL_MOUSE - (Q9ESP1) Stromal cell-derived factor 2-like protein 1 precursor (SDF2 like protein 1) || Number of peptides = 4 || unambiguous || 98.6% Confident
RS11_HUMAN - (P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11 || Number of peptides = 9 || ambiguous || 98.6% Confident
Q9CX86 - (Q9CX86) 3010025E17Rik protein || Number of peptides = 12 || unambiguous || 98.6% Confident
BIN1_MOUSE - (O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) || Number of peptides = 3 || unambiguous || 98.6% Confident
Q9CVL3 - (Q9CVL3) 1810024J13Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 98.6% Confident
Q9CPT4 - (Q9CPT4) DNA segment, Chr 17, Wayne state University 104, expressed (Stromal cell-derived growth factor SF20/IL25) || Number of peptides = 2 || unambiguous || 98.6% Confident
PRO2_MOUSE - (Q9JJV2) Profilin II || Number of peptides = 2 || ambiguous || 98.6% Confident
Q91X94 - (Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) || Number of peptides = 7 || ambiguous || 98.6% Confident
Q9CY82 - (Q9CY82) 5730420M11Rik protein || Number of peptides = 4 || ambiguous || 98.6% Confident
AOP2_MOUSE - (O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) || Number of peptides = 9 || unambiguous || 98.6% Confident
SERC_MOUSE - (Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) || Number of peptides = 19 || unambiguous || 98.6% Confident
Q9WV39 - (Q9WV39) Damage-specific DNA binding protein 1 || Number of peptides = 5 || unambiguous || 98.6% Confident
FAS_MOUSE - (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) || Number of peptides = 22 || ambiguous || 98.5% Confident
COF2_MOUSE - (P45591) Cofilin, muscle isoform (Cofilin 2) || Number of peptides = 2 || ambiguous || 98.5% Confident
Q9NYE5 - (Q9NYE5) Gamma-filamin || Number of peptides = 8 || ambiguous || 98.5% Confident
Q91YR5 - (Q91YR5) Hypothetical 78.8 kDa protein || Number of peptides = 3 || unambiguous || 98.5% Confident
RSU1_MOUSE - (Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1) || Number of peptides = 8 || ambiguous || 98.4% Confident
Q8VHX8 - (Q8VHX8) Filamin A (Fragment) || Number of peptides = 1 || unambiguous || 98.4% Confident
CUL3_MOUSE - (Q9JLV5) Cullin homolog 3 (CUL-3) || Number of peptides = 8 || ambiguous || 98.4% Confident
Q99LF4 - (Q99LF4) Hypothetical 55.2 kDa protein || Number of peptides = 6 || ambiguous || 98.4% Confident
Q9CSP0 - (Q9CSP0) 2700023B17Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 98.3% Confident
CLI1_MOUSE - (Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) || Number of peptides = 5 || ambiguous || 98.3% Confident
DPY4_MOUSE - (O35098) Dihydropyrimidinase related protein-4 (DRP-4) (ULIP4 protein) || Number of peptides = 1 || ambiguous || 98.3% Confident
O55201 - (O55201) Chromatin structural protein homolog Supt5hp (Similar to suppressor of Ty (S.cerevisiae) 5 homolog) || Number of peptides = 5 || unambiguous || 98.3% Confident
Q9D6F9 - (Q9D6F9) Tubulin, beta 4 || Number of peptides = 5 || ambiguous || 98.3% Confident
CAN2_MOUSE - (O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80) || Number of peptides = 5 || unambiguous || 98.2% Confident
Q8WZA0 - (Q8WZA0) Leucine zipper & ICAT homologous protein LZIC || Number of peptides = 1 || unambiguous || 98.2% Confident
UBPA_MOUSE - (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15) (Ubiquitin thiolesterase 10) (Ubiquitin-specific processing protease 10) (Deubiquitinating enzyme 10) || Number of peptides = 4 || unambiguous || 98.2% Confident
PAK3_MOUSE - (Q61036) Serine/threonine-protein kinase PAK 3 (EC 2.7.1.-) (p21-activated kinase 3) (PAK-3) (Beta-PAK) (CDC42/RAC effector kinase PAK-B) || Number of peptides = 6 || ambiguous || 98.2% Confident
FSC1_MOUSE - (Q61553) Fascin (Singed-like protein) || Number of peptides = 11 || unambiguous || 98.2% Confident
O54724 - (O54724) Polymerase I-transcript release factor (Polymerase I and transcript release factor) || Number of peptides = 4 || ambiguous || 98.2% Confident
CAZ2_MOUSE - (P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2) || Number of peptides = 7 || unambiguous || 98.1% Confident
RS5_MOUSE - (P97461) 40S ribosomal protein S5 || Number of peptides = 7 || unambiguous || 98.1% Confident
Q9CZH0 - (Q9CZH0) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700098C24, full insert sequence || Number of peptides = 1 || ambiguous || 98.1% Confident
R23B_MOUSE - (P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58) || Number of peptides = 3 || ambiguous || 98.1% Confident
Q9CWU3 - (Q9CWU3) 2410004D02Rik protein || Number of peptides = 2 || ambiguous || 98.0% Confident
MBNL_HUMAN - (Q9NR56) Muscleblind-like protein (Triplet-expansion RNA-binding protein) || Number of peptides = 2 || unambiguous || 98.0% Confident
PTB_MOUSE - (P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) || Number of peptides = 10 || unambiguous || 98.0% Confident
MY9B_HUMAN - (Q13459) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 10 || unambiguous || 97.9% Confident
VAA1_HUMAN - (P38606) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) (Isoform VA68) || Number of peptides = 1 || unambiguous || 97.9% Confident
Q9Z130 - (Q9Z130) JKTBP (Heterogeneous nuclear ribonucleoprotein D-like) || Number of peptides = 4 || ambiguous || 97.9% Confident
Q9H1B7 - (Q9H1B7) Polyglutamine-containing protein || Number of peptides = 3 || unambiguous || 97.9% Confident
PFD5_MOUSE - (Q9WU28) Prefoldin subunit 5 (C-myc binding protein Mm-1) (Myc modulator 1) (EIG-1) || Number of peptides = 6 || ambiguous || 97.9% Confident
Q9CR15 - (Q9CR15) 1110014J22Rik protein || Number of peptides = 6 || unambiguous || 97.9% Confident
Q12839 - (Q12839) H326 protein || Number of peptides = 4 || unambiguous || 97.9% Confident
Q9DAH0 - (Q9DAH0) Four and a half LIM domains 4 || Number of peptides = 4 || unambiguous || 97.9% Confident
GTA4_MOUSE - (P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4) || Number of peptides = 6 || unambiguous || 97.8% Confident
RL24_HUMAN - (P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30) || Number of peptides = 4 || ambiguous || 97.8% Confident
RL10_MOUSE - (P45634) 60S ribosomal protein L10 (QM protein homolog) || Number of peptides = 12 || ambiguous || 97.8% Confident
SNXC_MOUSE - (O70493) Sorting nexin 12 (SDP8 protein) || Number of peptides = 3 || ambiguous || 97.8% Confident
TEBP_MOUSE - (Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23) || Number of peptides = 5 || ambiguous || 97.8% Confident
LEG1_MOUSE - (P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) || Number of peptides = 2 || ambiguous || 97.8% Confident
Q9JM65 - (Q9JM65) Nonclathrin coat protein epsilon-COP (Coatomer protein complex, subunit epsilon) || Number of peptides = 2 || unambiguous || 97.8% Confident
PSB5_MOUSE - (O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6) || Number of peptides = 4 || ambiguous || 97.7% Confident
KCRB_MOUSE - (Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) || Number of peptides = 15 || unambiguous || 97.7% Confident
Q9D7M3 - (Q9D7M3) 2310002N04Rik protein (RIKEN cDNA 2310002N04 gene) || Number of peptides = 3 || unambiguous || 97.6% Confident
ICAL_MOUSE - (P51125) Calpain inhibitor (Calpastatin) || Number of peptides = 8 || unambiguous || 97.6% Confident
Q9CRE7 - (Q9CRE7) 2410174K12Rik protein (Fragment) || Number of peptides = 8 || unambiguous || 97.4% Confident
P78344 - (P78344) Eukaryotic translation initiation factor 4 gamma 2 (P97) (Death associated protein 5) (DAP-5) (Translation repressor NAT1) || Number of peptides = 2 || unambiguous || 97.4% Confident
U2AG_MOUSE - (Q9D883) Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 snRNP auxiliary factor small subunit) || Number of peptides = 1 || ambiguous || 97.4% Confident
MGD1_MOUSE - (Q9QYH6) Melanoma-associated antigen D1 (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) (Dlxin-1) || Number of peptides = 4 || unambiguous || 97.4% Confident
Q8VCF4 - (Q8VCF4) Similar to hypothetical protein FLJ13213 || Number of peptides = 3 || unambiguous || 97.3% Confident
Q8R509 - (Q8R509) Polypirimidine tract binding protein || Number of peptides = 9 || unambiguous || 97.2% Confident
ARS1_MOUSE - (O54984) Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) || Number of peptides = 6 || ambiguous || 97.2% Confident
Q9P0H7 - (Q9P0H7) TIP120 protein || Number of peptides = 7 || ambiguous || 97.2% Confident
Q9CQU7 - (Q9CQU7) 4833408F11Rik protein (1100001J08Rik protein) (Peptidyl prolyl isomerase H) (Cyclophilin H) || Number of peptides = 2 || ambiguous || 97.2% Confident
VASP_MOUSE - (P70460) Vasodilator-stimulated phosphoprotein (VASP) || Number of peptides = 4 || ambiguous || 97.2% Confident
R13A_MOUSE - (P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen) || Number of peptides = 15 || unambiguous || 97.2% Confident
Q9D0V4 - (Q9D0V4) 2700047N05Rik protein || Number of peptides = 4 || ambiguous || 97.2% Confident
Q9CT38 - (Q9CT38) 1110021H02Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 97.2% Confident
Q9CVA3 - (Q9CVA3) 2210415M20Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 97.2% Confident
SMD1_HUMAN - (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) || Number of peptides = 4 || ambiguous || 97.1% Confident
O35945 - (O35945) Aldehyde dehydrogenase Ahd-2-like || Number of peptides = 5 || unambiguous || 97.1% Confident
EFTU_HUMAN - (P49411) Elongation factor Tu, mitochondrial precursor (P43) || Number of peptides = 5 || unambiguous || 97.1% Confident
HS71_MOUSE - (P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) || Number of peptides = 4 || ambiguous || 97.1% Confident
TBB3_MOUSE - (Q9ERD7) Tubulin beta-3 || Number of peptides = 6 || ambiguous || 97.1% Confident
SON_MOUSE - (Q9QX47) SON protein || Number of peptides = 6 || unambiguous || 97.0% Confident
C43B_MOUSE - (Q9EQG9) Goodpasture antigen-binding protein (EC 2.7.1.37) (GPBP) (Collagen type IV alpha 3 binding protein) || Number of peptides = 6 || unambiguous || 97.0% Confident
Q9R1T2 - (Q9R1T2) mRNA similar to human SUA1, complete CDS (2400010M20RIK protein) || Number of peptides = 4 || unambiguous || 97.0% Confident
Q8R3Y8 - (Q8R3Y8) Hypothetical 30.2 kDa protein || Number of peptides = 12 || unambiguous || 96.9% Confident
Q9DC49 - (Q9DC49) Repeat family 3 gene || Number of peptides = 1 || ambiguous || 96.9% Confident
Q61167 - (Q61167) APC-binding protein EB2 (Fragment) || Number of peptides = 1 || ambiguous || 96.8% Confident
O88179 - (O88179) Guanine nucleotide regulatory protein (Fragment) || Number of peptides = 4 || ambiguous || 96.8% Confident
Q9D2X9 - (Q9D2X9) 9130026N02Rik protein || Number of peptides = 2 || ambiguous || 96.8% Confident
PA1B_MOUSE - (Q61206) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) || Number of peptides = 5 || ambiguous || 96.6% Confident
VINC_MOUSE - (Q64727) Vinculin (Metavinculin) || Number of peptides = 7 || unambiguous || 96.5% Confident
ENOG_MOUSE - (P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2) || Number of peptides = 3 || ambiguous || 96.5% Confident
Q9H853 - (Q9H853) Hypothetical protein FLJ13940 || Number of peptides = 17 || unambiguous || 96.5% Confident
Q9Z326 - (Q9Z326) 49 kDa zinc finger protein || Number of peptides = 1 || ambiguous || 96.4% Confident
ENOA_HUMAN - (P06733) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase) || Number of peptides = 7 || unambiguous || 96.4% Confident
EF1D_MOUSE - (P57776) Elongation factor 1-delta (EF-1-delta) || Number of peptides = 10 || unambiguous || 96.4% Confident
Q96MZ8 - (Q96MZ8) Hypothetical protein FLJ31638 || Number of peptides = 13 || unambiguous || 96.4% Confident
SKD1_MOUSE - (P46467) SKD1 protein (Vacuolar sorting protein 4b) || Number of peptides = 6 || unambiguous || 96.4% Confident
Q9HBY8 - (Q9HBY8) Protein kinase || Number of peptides = 1 || ambiguous || 96.3% Confident
Q9EQ30 - (Q9EQ30) Ran binding protein 5 (Fragment) || Number of peptides = 4 || unambiguous || 96.3% Confident
S23A_MOUSE - (Q01405) Protein transport protein Sec23A (SEC23-related protein A) (Fragment) || Number of peptides = 4 || ambiguous || 96.3% Confident
Q9CXI5 - (Q9CXI5) 3230402M22Rik protein || Number of peptides = 2 || ambiguous || 96.3% Confident
Q9CT41 - (Q9CT41) 2600017A12Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 96.3% Confident
SWS1_MOUSE - (Q9D8Y0) Swiprosin 1 || Number of peptides = 1 || ambiguous || 96.3% Confident
SG2N_MOUSE - (Q9ERG2) Cell-cycle autoantigen SG2NA (S/G2 antigen) || Number of peptides = 6 || unambiguous || 96.3% Confident
O88443 - (O88443) SWAP-70 || Number of peptides = 3 || unambiguous || 96.3% Confident
DYL1_HUMAN - (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) || Number of peptides = 3 || ambiguous || 96.2% Confident
RL44_HUMAN - (P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a) || Number of peptides = 4 || ambiguous || 96.1% Confident
TYB4_MOUSE - (P20065) Thymosin beta-4 (T beta 4) || Number of peptides = 10 || ambiguous || 96.1% Confident
143F_HUMAN - (Q04917) 14-3-3 protein eta (Protein AS1) || Number of peptides = 1 || unambiguous || 96.0% Confident
DDX3_MOUSE - (Q62167) DEAD-box protein 3 (DEAD-box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1PAS1 related sequence 2) || Number of peptides = 3 || unambiguous || 96.0% Confident
O88545 - (O88545) COP9 complex subunit 6 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6) (ARABIDOPSIS) (Similar TO COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6) || Number of peptides = 2 || ambiguous || 95.9% Confident
Q8R1Q8 - (Q8R1Q8) Hypothetical 56.6 kDa protein || Number of peptides = 7 || unambiguous || 95.9% Confident
Q99LE7 - (Q99LE7) Similar to paxillin (Fragment) || Number of peptides = 4 || ambiguous || 95.9% Confident
Q8R223 - (Q8R223) Similar to autoantigen (Fragment) || Number of peptides = 1 || unambiguous || 95.8% Confident
GRB2_MOUSE - (Q60631) Growth factor receptor-bound protein 2 (GRB2 adapter protein) (SH2/SH3 adapter GRB2) || Number of peptides = 1 || ambiguous || 95.7% Confident
O88526 - (O88526) Nitrilase homolog 1 || Number of peptides = 1 || ambiguous || 95.7% Confident
Q924M4 - (Q924M4) RANBP9 isoform 1 || Number of peptides = 2 || ambiguous || 95.6% Confident
Q9CZX8 - (Q9CZX8) Ribosomal protein S19 || Number of peptides = 14 || unambiguous || 95.6% Confident
UBP4_MOUSE - (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15) (Ubiquitin thiolesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) || Number of peptides = 9 || unambiguous || 95.6% Confident
Q99LN9 - (Q99LN9) Similar to CG2245 gene product || Number of peptides = 1 || unambiguous || 95.5% Confident
RL35_HUMAN - (P42766) 60S ribosomal protein L35 || Number of peptides = 5 || unambiguous || 95.3% Confident
Q9DCG9 - (Q9DCG9) 0610038D11Rik protein || Number of peptides = 4 || ambiguous || 95.2% Confident
Q8R5F2 - (Q8R5F2) Hypothetical 31.3 kDa protein || Number of peptides = 3 || ambiguous || 95.1% Confident
Q99J36 - (Q99J36) Similar to hypothetical protein FLJ20274 || Number of peptides = 2 || unambiguous || 95.0% Confident
DLDH_MOUSE - (O08749) Dihydrolipoamide dehydrogenase, mitochondrial precursor (EC 1.8.1.4) || Number of peptides = 5 || ambiguous || 94.9% Confident
Q9JII6 - (Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase) || Number of peptides = 10 || unambiguous || 94.9% Confident
RL19_HUMAN - (P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19 || Number of peptides = 11 || ambiguous || 94.9% Confident
Q8R3P1 - (Q8R3P1) Similar to hypothetical protein MGC16714 || Number of peptides = 1 || unambiguous || 94.8% Confident
PRS6_MOUSE - (P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21) || Number of peptides = 8 || unambiguous || 94.8% Confident
SEP7_MOUSE - (O55131) Septin 7 (CDC10 protein homolog) || Number of peptides = 4 || ambiguous || 94.7% Confident
Q91YN5 - (Q91YN5) Hypothetical 58.6 kDa protein || Number of peptides = 2 || unambiguous || 94.6% Confident
Q91VM9 - (Q91VM9) Similar to pyrophosphatase (Inorganic) || Number of peptides = 2 || unambiguous || 94.6% Confident
H2B1_MOUSE - (P10853) Histone H2B F (H2B 291A) || Number of peptides = 6 || ambiguous || 94.5% Confident
CTE1_MOUSE - (O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) || Number of peptides = 12 || ambiguous || 94.2% Confident
ZO1_MOUSE - (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) || Number of peptides = 6 || unambiguous || 94.2% Confident
O09172 - (O09172) Gamma-glutamylcysteine synthetase, regulatory (EC 6.3.2.2) || Number of peptides = 3 || unambiguous || 94.1% Confident
ANM1_MOUSE - (Q9JIF0) Protein arginine N-methyltransferase 1 (EC 2.1.1.-) || Number of peptides = 9 || unambiguous || 94.1% Confident
Q9D823 - (Q9D823) Ribosomal protein L37 || Number of peptides = 4 || ambiguous || 94.0% Confident
PNPH_MOUSE - (P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) || Number of peptides = 5 || unambiguous || 94.0% Confident
TCPH_MOUSE - (P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) || Number of peptides = 8 || ambiguous || 94.0% Confident
RL29_MOUSE - (P47915) 60S ribosomal protein L29 || Number of peptides = 10 || unambiguous || 94.0% Confident
K6A3_HUMAN - (P51812) Ribosomal protein S6 kinase alpha 3 (EC 2.7.1.-) (S6K-alpha 3) (90 kDa ribosomal protein S6 kinase 3) (p90-RSK 3) (Ribosomal S6 kinase 2) (RSK-2) (pp90RSK2) (Insulin-stimulated protein kinase 1) (ISPK-1) || Number of peptides = 1 || unambiguous || 94.0% Confident
Q61123 - (Q61123) MEM3 || Number of peptides = 7 || ambiguous || 93.9% Confident
PSB2_MOUSE - (Q9R1P3) Proteasome subunit beta type 2 (EC 3.4.25.1) (Proteasome component C7-I) (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I) || Number of peptides = 1 || unambiguous || 93.9% Confident
PSE2_MOUSE - (P97372) Proteasome activator complex subunit 2 (Proteasome activator 28-beta subunit) (PA28beta) (PA28b) (Activator of multicatalytic protease subunit 2) (11S regulator complex beta subunit) (REG-beta) || Number of peptides = 4 || unambiguous || 93.8% Confident
Q923D2 - (Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein) || Number of peptides = 3 || unambiguous || 93.6% Confident
Q9DC46 - (Q9DC46) 1200003I18Rik protein || Number of peptides = 2 || unambiguous || 93.6% Confident
Y379_HUMAN - (O15084) Hypothetical protein KIAA0379 (Fragment) || Number of peptides = 2 || unambiguous || 93.5% Confident
PRS8_HUMAN - (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) || Number of peptides = 6 || ambiguous || 93.5% Confident
EF1G_MOUSE - (Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) || Number of peptides = 9 || unambiguous || 93.4% Confident
E2BA_HUMAN - (Q14232) Translation initiation factor eIF-2B alpha subunit (eIF-2B GDP-GTP exchange factor) || Number of peptides = 2 || unambiguous || 93.4% Confident
Q9DAR7 - (Q9DAR7) 1700001E16Rik protein (RIKEN cDNA 1700001E16 gene) || Number of peptides = 6 || unambiguous || 93.3% Confident
Q9D3R6 - (Q9D3R6) 4933439B08Rik protein || Number of peptides = 2 || ambiguous || 93.3% Confident
Q9H856 - (Q9H856) Hypothetical protein FLJ13936 (Fragment) || Number of peptides = 4 || unambiguous || 93.3% Confident
PHS1_MOUSE - (Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) || Number of peptides = 11 || unambiguous || 93.3% Confident
IDHP_MOUSE - (P54071) Isocitrate dehydrogenase [NADP], mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) (ICD-M) || Number of peptides = 2 || unambiguous || 93.2% Confident
S106_MOUSE - (P14069) Calcyclin (Prolactin receptor associated protein) (5B10) || Number of peptides = 1 || unambiguous || 93.2% Confident
O94915 - (O94915) Hypothetical protein KIAA0826 (Fragment) || Number of peptides = 4 || unambiguous || 93.1% Confident
PSA5_MOUSE - (Q9Z2U1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome zeta chain) (EC 3.4.25.1) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) || Number of peptides = 6 || unambiguous || 93.1% Confident
IMD2_HUMAN - (P12268) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) || Number of peptides = 1 || unambiguous || 93.0% Confident
UBPE_MOUSE - (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15) (Ubiquitin thiolesterase 14) (Ubiquitin-specific processing protease 14) (Deubiquitinating enzyme 14) || Number of peptides = 4 || unambiguous || 93.0% Confident
PHS_HUMAN - (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) || Number of peptides = 3 || ambiguous || 93.0% Confident
K2C8_MOUSE - (P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A) || Number of peptides = 2 || ambiguous || 92.8% Confident
Q8VCQ8 - (Q8VCQ8) Similar to caldesmon 1 || Number of peptides = 4 || unambiguous || 92.7% Confident
Q8VDP3 - (Q8VDP3) Similar to hypothetical protein FLJ11937 || Number of peptides = 9 || unambiguous || 92.6% Confident
Z147_MOUSE - (Q61510) Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp) || Number of peptides = 1 || unambiguous || 92.5% Confident
CSE1_MOUSE - (Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) || Number of peptides = 3 || ambiguous || 92.5% Confident
Q9CZP2 - (Q9CZP2) 1110025F24Rik protein || Number of peptides = 8 || unambiguous || 92.4% Confident
PSD6_MOUSE - (Q99JI4) 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit S10) (p42A) || Number of peptides = 5 || ambiguous || 92.3% Confident
Q8R4X3 - (Q8R4X3) SWAN || Number of peptides = 2 || ambiguous || 92.3% Confident
Q99KN9 - (Q99KN9) Similar to KIAA0171 gene product (Fragment) || Number of peptides = 3 || unambiguous || 92.2% Confident
RLA0_MOUSE - (P14869) 60S acidic ribosomal protein P0 (L10E) || Number of peptides = 3 || ambiguous || 92.1% Confident
TES_MOUSE - (P47226) Testin (TES1/TES2) || Number of peptides = 5 || unambiguous || 92.1% Confident
RS10_MOUSE - (P09900) 40S ribosomal protein S10 || Number of peptides = 5 || ambiguous || 92.0% Confident
FRZB_MOUSE - (P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3) || Number of peptides = 7 || unambiguous || 92.0% Confident
Q91YZ8 - (Q91YZ8) Hypothetical 67.9 kDa protein || Number of peptides = 8 || ambiguous || 92.0% Confident
Q15047 - (Q15047) Hypothetical protein KIAA0067 || Number of peptides = 2 || unambiguous || 92.0% Confident
Q9D7S7 - (Q9D7S7) 3110001N18Rik protein || Number of peptides = 2 || unambiguous || 91.8% Confident
Q9Y6Y4 - (Q9Y6Y4) IDN3 protein || Number of peptides = 8 || ambiguous || 91.7% Confident
FSC1_HUMAN - (Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) || Number of peptides = 7 || ambiguous || 91.7% Confident
DPD2_MOUSE - (O35654) DNA polymerase delta subunit 2 (EC 2.7.7.7) || Number of peptides = 1 || unambiguous || 91.7% Confident
Q91YW2 - (Q91YW2) Similar to tight junction protein 1 (Fragment) || Number of peptides = 3 || unambiguous || 91.7% Confident
IDE_MOUSE - (Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 5 || unambiguous || 91.6% Confident
FABE_MOUSE - (Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) || Number of peptides = 2 || unambiguous || 91.5% Confident
Q9CPS7 - (Q9CPS7) 1810003N24Rik protein (Putative 25.7 kDa protein) (RIKEN cDNA 1810003N24 gene) || Number of peptides = 3 || unambiguous || 91.5% Confident
ITA3_MOUSE - (Q62470) Integrin alpha-3 precursor (Galactoprotein B3) (GAPB3) (VLA-3 alpha chain) (CD49c) || Number of peptides = 4 || unambiguous || 91.4% Confident
SYFB_MOUSE - (Q9WUA2) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20) (Phenylalanine--tRNA ligase beta chain) (PheRS) || Number of peptides = 6 || unambiguous || 91.3% Confident
YAP1_MOUSE - (P46938) 65 kDa Yes-associated protein (YAP65) || Number of peptides = 3 || ambiguous || 91.3% Confident
RL31_HUMAN - (P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31 || Number of peptides = 8 || ambiguous || 91.2% Confident
O88412 - (O88412) Zinc finger protein 105 || Number of peptides = 1 || unambiguous || 91.2% Confident
Q9DAD6 - (Q9DAD6) 1700012P12Rik protein (Profilin-III) || Number of peptides = 3 || unambiguous || 91.1% Confident
Q9D6M0 - (Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene) || Number of peptides = 3 || unambiguous || 91.0% Confident
ZYX_MOUSE - (Q62523) Zyxin || Number of peptides = 4 || unambiguous || 91.0% Confident
Q99JS9 - (Q99JS9) Similar to hypothetical protein MGC2744 || Number of peptides = 2 || unambiguous || 91.0% Confident
ILF3_MOUSE - (Q9Z1X4) Interleukin enhancer-binding factor 3 || Number of peptides = 8 || unambiguous || 90.9% Confident
DDB1_HUMAN - (Q16531) DNA damage binding protein 1 (Damage-specific DNA binding protein 1) (DDB p127 subunit) (DDBa) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (Xeroderma pigmentosum group E complementing protein) (XPCe) (X-associated protein 1) (XAP-1) || Number of peptides = 2 || unambiguous || 90.9% Confident
Q61482 - (Q61482) CDE1-binding protein CDEBP || Number of peptides = 1 || unambiguous || 90.9% Confident
IF2G_MOUSE - (Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X) || Number of peptides = 6 || ambiguous || 90.8% Confident
Q9ESF7 - (Q9ESF7) Sep2 (Fragment) || Number of peptides = 5 || unambiguous || 90.8% Confident
Q9ER98 - (Q9ER98) Stretch responsive muscle (X-chromosome) (SMPX protein) (Muscle-specific protein CSL) || Number of peptides = 2 || unambiguous || 90.7% Confident
CTF1_HUMAN - (Q16619) Cardiotrophin-1 (CT-1) || Number of peptides = 2 || unambiguous || 90.7% Confident
Q9DBI6 - (Q9DBI6) 1300007E16Rik protein || Number of peptides = 4 || unambiguous || 90.6% Confident
PPCE_MOUSE - (Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) || Number of peptides = 15 || unambiguous || 90.6% Confident
NF3L_MOUSE - (Q9EQ80) NIF3-like protein 1 || Number of peptides = 6 || unambiguous || 90.5% Confident
A2MG_MOUSE - (Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) || Number of peptides = 6 || unambiguous || 90.5% Confident
MBNL_MOUSE - (Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein) || Number of peptides = 5 || unambiguous || 90.5% Confident
O54807 - (O54807) Ankhzn protein || Number of peptides = 3 || unambiguous || 90.4% Confident
Q9JJB3 - (Q9JJB3) Brain cDNA, clone MNCb-3848, similar to Homo sapiens CGI-28 protein mRNA || Number of peptides = 3 || unambiguous || 90.3% Confident
Q61166 - (Q61166) APC-binding protein EB1 homolog || Number of peptides = 5 || unambiguous || 90.3% Confident
HEPS_MOUSE - (O35453) Serine protease hepsin (EC 3.4.21.-) || Number of peptides = 1 || ambiguous || 90.2% Confident
Q9D1Q6 - (Q9D1Q6) 1110001E24Rik protein (RIKEN cDNA 1110001E24 gene) || Number of peptides = 3 || unambiguous || 90.2% Confident
Q9Z0P5 - (Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) || Number of peptides = 4 || unambiguous || 90.1% Confident
ICE6_MOUSE - (O08738) Caspase-6 precursor (EC 3.4.22.-) (Apoptotic protease Mch-2) || Number of peptides = 1 || ambiguous || 90.1% Confident
Q9Z332 - (Q9Z332) Keratin 6 alpha || Number of peptides = 3 || ambiguous || 90.1% Confident
Q9BY44 - (Q9BY44) CDA02 || Number of peptides = 9 || unambiguous || 89.9% Confident
DYR_MOUSE - (P00375) Dihydrofolate reductase (EC 1.5.1.3) || Number of peptides = 5 || unambiguous || 89.9% Confident
Q91W89 - (Q91W89) Similar to mannosidase, alpha, class 2C, member 1 || Number of peptides = 2 || ambiguous || 89.9% Confident
HIC2_HUMAN - (Q96JB3) Hypermethylated in cancer 2 protein (Hic-2) (Hic-3) (HIC1-related gene on chromosome 22) || Number of peptides = 4 || unambiguous || 89.8% Confident
SMD3_HUMAN - (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) || Number of peptides = 2 || ambiguous || 89.7% Confident
DPOA_MOUSE - (P33609) DNA polymerase alpha catalytic subunit (EC 2.7.7.7) || Number of peptides = 8 || unambiguous || 89.7% Confident
Q921J0 - (Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) || Number of peptides = 2 || ambiguous || 89.5% Confident
Q8R1N4 - (Q8R1N4) Similar to KIAA1068 protein (Fragment) || Number of peptides = 3 || unambiguous || 89.5% Confident
Q9CW46 - (Q9CW46) 1300006N24Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 89.5% Confident
RTC1_MOUSE - (Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase) || Number of peptides = 3 || unambiguous || 89.5% Confident
ZAP3_MOUSE - (Q9R0I7) Nuclear protein ZAP3 || Number of peptides = 3 || ambiguous || 89.4% Confident
Q15042 - (Q15042) Hypothetical protein KIAA0066 (Fragment) || Number of peptides = 5 || unambiguous || 89.4% Confident
PSDB_HUMAN - (O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) || Number of peptides = 8 || unambiguous || 89.2% Confident
UBL3_MOUSE - (Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3) || Number of peptides = 3 || unambiguous || 89.1% Confident
Q922R8 - (Q922R8) Similar to protein disulfide isomerase-related protein || Number of peptides = 2 || unambiguous || 89.0% Confident
Q96ID5 - (Q96ID5) Hypothetical protein || Number of peptides = 1 || unambiguous || 88.9% Confident
CADC_HUMAN - (P55289) Brain-cadherin precursor (BR-cadherin) (Cadherin-12) (N-cadherin 2) (Cadherin, neural type, 2) || Number of peptides = 3 || unambiguous || 88.9% Confident
RL32_HUMAN - (P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32 || Number of peptides = 10 || ambiguous || 88.9% Confident
Q9JL35 - (Q9JL35) Nucleosome binding protein 1 (Nucleosome binding protein 45) (NBP-45) (GARP45 protein) || Number of peptides = 5 || ambiguous || 88.8% Confident
Q9DC63 - (Q9DC63) 1200002G09Rik protein || Number of peptides = 2 || unambiguous || 88.7% Confident
M1A2_HUMAN - (O60476) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2) || Number of peptides = 5 || unambiguous || 88.7% Confident
Q9UQ35 - (Q9UQ35) RNA binding protein || Number of peptides = 7 || unambiguous || 88.6% Confident
Q9Z1R1 - (Q9Z1R1) BAT2 || Number of peptides = 15 || unambiguous || 88.6% Confident
RL18_MOUSE - (P35980) 60S ribosomal protein L18 || Number of peptides = 6 || unambiguous || 88.5% Confident
Q8TDJ6 - (Q8TDJ6) Rabconnectin || Number of peptides = 9 || unambiguous || 88.5% Confident
Q62219 - (Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5) || Number of peptides = 3 || ambiguous || 88.5% Confident
Q921C3 - (Q921C3) WDR9 protein, form A || Number of peptides = 13 || ambiguous || 88.4% Confident
NMT1_MOUSE - (O70310) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97) (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) || Number of peptides = 2 || unambiguous || 88.4% Confident
Q9NVF3 - (Q9NVF3) Hypothetical protein FLJ10773 || Number of peptides = 2 || unambiguous || 88.3% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 9 || ambiguous || 87.9% Confident
Q9P229 - (Q9P229) Hypothetical protein KIAA1499 (Fragment) || Number of peptides = 4 || unambiguous || 87.8% Confident
PSB6_MOUSE - (Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y) || Number of peptides = 2 || unambiguous || 87.8% Confident
ADK_MOUSE - (P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment) || Number of peptides = 3 || ambiguous || 87.7% Confident
MM09_HUMAN - (P14780) 92 kDa type IV collagenase precursor (EC 3.4.24.35) (92 kDa gelatinase) (Matrix metalloproteinase-9) (MMP-9) (Gelatinase B) (GELB) || Number of peptides = 17 || unambiguous || 87.6% Confident
Q8R0H9 - (Q8R0H9) Similar to golgi associated, gamma adaptin ear containing, ARF binding protein 1 || Number of peptides = 3 || unambiguous || 87.4% Confident
Q9CQ16 - (Q9CQ16) Ribosomal protein L27a (Ribosmal protein L27a) || Number of peptides = 1 || ambiguous || 87.4% Confident
Q9BYK8 - (Q9BYK8) DJ697K14.6 (Novel protein, KIAA1769) || Number of peptides = 9 || unambiguous || 87.3% Confident
Q9D2N1 - (Q9D2N1) 4632406N01Rik protein || Number of peptides = 1 || unambiguous || 87.2% Confident
Q8TDK3 - (Q8TDK3) Gm133 (Fragment) || Number of peptides = 1 || ambiguous || 87.1% Confident
Q13129 - (Q13129) RLF || Number of peptides = 2 || unambiguous || 87.1% Confident
VAB2_MOUSE - (P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) || Number of peptides = 7 || ambiguous || 87.1% Confident
DLP2_HUMAN - (Q9P1A6) Disks large-associated protein 2 (DAP-2) (SAP90/PSD-95-associated protein 2) (SAPAP2) (PSD-95/SAP90 binding protein 2) (Fragment) || Number of peptides = 10 || unambiguous || 87.0% Confident
Q61823 - (Q61823) MA-3 protein || Number of peptides = 3 || unambiguous || 87.0% Confident
Q9D8G6 - (Q9D8G6) 2010002I23Rik protein || Number of peptides = 2 || ambiguous || 86.9% Confident
Q9CY26 - (Q9CY26) 2700085E05Rik protein || Number of peptides = 3 || unambiguous || 86.7% Confident
Q9H6M7 - (Q9H6M7) Hypothetical protein FLJ22087 || Number of peptides = 4 || ambiguous || 86.5% Confident
Q921S0 - (Q921S0) Similar to hypothetical protein FLJ12810 || Number of peptides = 3 || unambiguous || 86.4% Confident
A1A1_HUMAN - (P05023) Sodium/potassium-transporting ATPase alpha-1 chain precursor (EC 3.6.3.9) (Sodium pump 1) (Na+/K+ ATPase 1) || Number of peptides = 2 || unambiguous || 86.1% Confident
Q9R0E2 - (Q9R0E2) Lysyl hydroxylase 1 (Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1) || Number of peptides = 2 || unambiguous || 86.0% Confident
Q9HC82 - (Q9HC82) Rb-associated protein || Number of peptides = 4 || ambiguous || 86.0% Confident
22A3_MOUSE - (P70122) Protein 22A3 || Number of peptides = 2 || unambiguous || 85.6% Confident
RAGE_MOUSE - (Q62151) Advanced glycosylation end product-specific receptor precursor (Receptor for advanced glycosylation end products) || Number of peptides = 2 || unambiguous || 85.4% Confident
SPEE_MOUSE - (Q64674) Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) || Number of peptides = 3 || unambiguous || 85.2% Confident
PMGE_MOUSE - (P15327) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM) || Number of peptides = 5 || unambiguous || 85.1% Confident
HS71_HUMAN - (P08107) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) || Number of peptides = 2 || unambiguous || 85.0% Confident
Q9CWR2 - (Q9CWR2) 2410008A19Rik protein || Number of peptides = 2 || unambiguous || 84.8% Confident
Q99LC3 - (Q99LC3) RIKEN cDNA 2900053E13 gene || Number of peptides = 4 || unambiguous || 84.7% Confident
RL13_MOUSE - (P47963) 60S ribosomal protein L13 (A52) || Number of peptides = 7 || unambiguous || 84.7% Confident
DPO2_MOUSE - (P33611) DNA polymerase alpha 70 kDa subunit (DNA polymerase subunit B) || Number of peptides = 2 || ambiguous || 84.6% Confident
GATM_MOUSE - (Q9D964) Glycine amidinotransferase, mitochondrial precursor (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) || Number of peptides = 2 || unambiguous || 84.6% Confident
AFP1_HUMAN - (P53367) Arfaptin 1 || Number of peptides = 3 || unambiguous || 84.6% Confident
Q9CWS0 - (Q9CWS0) 2410006N07Rik protein || Number of peptides = 3 || unambiguous || 84.1% Confident
CIN2_HUMAN - (Q99250) Sodium channel protein, brain II alpha subunit || Number of peptides = 4 || unambiguous || 84.0% Confident
Q9DAB5 - (Q9DAB5) Histone H2B || Number of peptides = 5 || unambiguous || 83.8% Confident
P137_MOUSE - (Q60865) GPI-anchored protein p137 (p137GPI) || Number of peptides = 2 || unambiguous || 83.8% Confident
GSHP_MOUSE - (P46412) Plasma glutathione peroxidase precursor (EC 1.11.1.9) (GSHPx-P) || Number of peptides = 2 || ambiguous || 83.8% Confident
DHSO_MOUSE - (Q64442) Sorbitol dehydrogenase (EC 1.1.1.14) (L-iditol 2-dehydrogenase) (Fragment) || Number of peptides = 2 || ambiguous || 83.7% Confident
Q9UG94 - (Q9UG94) Hypothetical protein || Number of peptides = 2 || unambiguous || 83.6% Confident
ABCR_HUMAN - (P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein) || Number of peptides = 5 || unambiguous || 83.6% Confident
ACBP_MOUSE - (P31786) Acyl-CoA-binding protein (ACBP) (Diazepam binding inhibitor) (DBI) (Endozepine) (EP) || Number of peptides = 2 || unambiguous || 83.4% Confident
Q99NA2 - (Q99NA2) BHLH factor Math6 || Number of peptides = 6 || unambiguous || 83.3% Confident
SPSY_MOUSE - (P97355) Spermine synthase (EC 2.5.1.22) (Spermidine aminopropyltransferase) (SPMSY) || Number of peptides = 4 || unambiguous || 83.2% Confident
Q99P31 - (Q99P31) Hsp70 binding protein (RIKEN cDNA 1500019G21 gene) || Number of peptides = 3 || unambiguous || 83.2% Confident
Q61769 - (Q61769) Ki-67 protein || Number of peptides = 10 || unambiguous || 83.1% Confident
MYHB_MOUSE - (O08638) Myosin heavy chain, smooth muscle isoform (SMMHC) || Number of peptides = 10 || unambiguous || 82.9% Confident
Q8R4A0 - (Q8R4A0) Translocated promoter region protein (Fragment) || Number of peptides = 5 || unambiguous || 82.8% Confident
Q9H3S7 - (Q9H3S7) Protein tyrosine phosphatase HD-PTP (Protein tyrosine phosphatase TD14) || Number of peptides = 5 || unambiguous || 82.8% Confident
Q9CZ56 - (Q9CZ56) 2810405J23Rik protein || Number of peptides = 6 || ambiguous || 82.8% Confident
UGDH_MOUSE - (O70475) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc dehydrogenase) (UDP-GlcDH) (UDPGDH) || Number of peptides = 4 || unambiguous || 82.7% Confident
Q9D0U2 - (Q9D0U2) 1190002C07Rik protein || Number of peptides = 4 || unambiguous || 82.5% Confident
Q8R1B4 - (Q8R1B4) Similar to eukaryotic translation initiation factor 3, subunit 8 (110kD) || Number of peptides = 7 || unambiguous || 82.5% Confident
Q99JX4 - (Q99JX4) Similar to dendritic cell protein || Number of peptides = 3 || ambiguous || 82.5% Confident
O75213 - (O75213) Hypothetical protein || Number of peptides = 3 || ambiguous || 82.3% Confident
Q9UFU8 - (Q9UFU8) Hypothetical protein (Fragment) || Number of peptides = 10 || unambiguous || 82.2% Confident
BAC1_MOUSE - (P97302) Transcription regulator protein BACH1 (BTB and CNC homolog 1) || Number of peptides = 5 || unambiguous || 82.2% Confident
CO1C_MOUSE - (Q9WUM4) Coronin 1C (Coronin 3) || Number of peptides = 4 || ambiguous || 82.1% Confident
NIBL_MOUSE - (Q8R1F1) Niban-like protein || Number of peptides = 5 || unambiguous || 82.1% Confident
H105_MOUSE - (Q61699) Heat-shock protein 105 kDa (Heat shock-related 100 kDa protein E7I) (HSP-E7I) (Heat shock 110 kDa protein) (42 degrees C-HSP) || Number of peptides = 10 || unambiguous || 82.0% Confident
Q15290 - (Q15290) RB protein binding protein || Number of peptides = 4 || ambiguous || 81.8% Confident
Q9D8X5 - (Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) || Number of peptides = 15 || ambiguous || 81.6% Confident
Q9D107 - (Q9D107) 2010015D08Rik protein || Number of peptides = 1 || ambiguous || 81.5% Confident
Q9Y3J2 - (Q9Y3J2) DJ222E13.3 (Novel protein) (Fragment) || Number of peptides = 2 || unambiguous || 81.4% Confident
Q8R2J0 - (Q8R2J0) L-type voltage-gated calcium channel Cav1.3(1a) subunit || Number of peptides = 7 || ambiguous || 81.4% Confident
Q8VDJ3 - (Q8VDJ3) Similar to lipoprotein-binding protein (Expressed sequence AA960365) || Number of peptides = 10 || unambiguous || 81.3% Confident
TRFL_MOUSE - (P08071) Lactotransferrin precursor (Lactoferrin) || Number of peptides = 5 || unambiguous || 81.3% Confident
APOA_HUMAN - (P08519) Apolipoprotein(a) precursor (EC 3.4.21.-) (Apo(a)) (Lp(a)) || Number of peptides = 5 || unambiguous || 81.2% Confident
Q9JK49 - (Q9JK49) Erythroblast macrophage protein EMP || Number of peptides = 1 || ambiguous || 81.2% Confident
Q8QZW7 - (Q8QZW7) Similar to GABA-A receptor pi subunit (Hypothetical 50.4 kDa protein) || Number of peptides = 2 || unambiguous || 81.1% Confident
2ABA_HUMAN - (Q00007) Serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alpha isoform (PP2A, subunit B, B-alpha isoform) (PP2A, subunit B, B55-alpha isoform) (PP2A, subunit B, PR55-alpha isoform) (PP2A, subunit B, R2-alpha isoform) || Number of peptides = 2 || unambiguous || 81.0% Confident
ITH3_MOUSE - (Q61704) Inter-alpha-trypsin inhibitor heavy chain H3 precursor (ITI heavy chain H3) || Number of peptides = 11 || unambiguous || 81.0% Confident
Q99K30 - (Q99K30) Similar to hypothetical protein FLJ21935 || Number of peptides = 3 || unambiguous || 80.9% Confident
BAG1_MOUSE - (Q60739) BAG-family molecular chaperone regulator-1 (BCL-2 binding athanogene-1) (BAG-1) || Number of peptides = 4 || unambiguous || 80.7% Confident
ALD1_MOUSE - (P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7) || Number of peptides = 8 || unambiguous || 80.7% Confident
RL28_MOUSE - (P41105) 60S ribosomal protein L28 || Number of peptides = 6 || unambiguous || 80.4% Confident
PKL2_HUMAN - (Q16513) Protein kinase C-like 2 (EC 2.7.1.-) (Protein-kinase C-related kinase 2) || Number of peptides = 4 || unambiguous || 80.4% Confident
Q9D3B7 - (Q9D3B7) 6330404L05Rik protein || Number of peptides = 4 || ambiguous || 80.3% Confident
DNL1_MOUSE - (P37913) DNA ligase I (EC 6.5.1.1) (Polydeoxyribonucleotide synthase [ATP]) || Number of peptides = 4 || unambiguous || 80.3% Confident
SEP2_MOUSE - (P42208) Septin 2 (NEDD5 protein) || Number of peptides = 4 || unambiguous || 80.3% Confident
O70209 - (O70209) Alpha-actinin-2 associated LIM protein || Number of peptides = 2 || unambiguous || 80.3% Confident
ENOB_MOUSE - (P21550) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (Enolase 3) || Number of peptides = 2 || ambiguous || 80.3% Confident
PRI2_MOUSE - (P33610) DNA primase large subunit (EC 2.7.7.-) (DNA primase 58 kDa subunit) (P58) || Number of peptides = 3 || unambiguous || 80.2% Confident
KNG_MOUSE - (O08677) Kininogen precursor [Contains: Bradykinin] || Number of peptides = 5 || ambiguous || 80.2% Confident
Q9Y387 - (Q9Y387) CGI-77 protein || Number of peptides = 2 || unambiguous || 80.1% Confident
Q8R2P4 - (Q8R2P4) Hypothetical 20.8 kDa protein || Number of peptides = 1 || ambiguous || 80.0% Confident
PSD4_MOUSE - (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) || Number of peptides = 8 || unambiguous || 79.8% Confident
Q8VHQ0 - (Q8VHQ0) SPI3L2 || Number of peptides = 3 || unambiguous || 79.7% Confident
Q8R320 - (Q8R320) Similar to N-arginine dibasic convertase 1 || Number of peptides = 3 || unambiguous || 79.6% Confident
Q62176 - (Q62176) SEB4 || Number of peptides = 1 || unambiguous || 79.6% Confident
NEBU_HUMAN - (P20929) Nebulin || Number of peptides = 16 || unambiguous || 79.5% Confident
Q9WTM5 - (Q9WTM5) DNA helicase || Number of peptides = 3 || ambiguous || 79.5% Confident
Q9CU90 - (Q9CU90) 5133400F09Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 79.3% Confident
Q9CSH3 - (Q9CSH3) 2810028N01Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 79.3% Confident
143G_HUMAN - (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 4 || ambiguous || 79.1% Confident
PUR6_MOUSE - (Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)] || Number of peptides = 2 || unambiguous || 79.0% Confident
RIK3_HUMAN - (Q9Y572) Receptor-interacting serine/threonine protein kinase 3 (EC 2.7.1.-) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3) || Number of peptides = 3 || unambiguous || 78.8% Confident
ARR1_HUMAN - (P49407) Beta-arrestin 1 (Arrestin, beta 1) || Number of peptides = 3 || unambiguous || 78.7% Confident
Q91XC8 - (Q91XC8) Similar to death-associated protein (Hypothetical 11.2 kDa protein) || Number of peptides = 4 || ambiguous || 78.7% Confident
GSHC_MOUSE - (P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase) || Number of peptides = 2 || unambiguous || 78.3% Confident
FINC_HUMAN - (P02751) Fibronectin precursor (FN) (Cold-insoluble globulin) (CIG) || Number of peptides = 5 || unambiguous || 78.3% Confident
Q922H3 - (Q922H3) Similar to glutamate rich WD repeat protein GRWD (Fragment) || Number of peptides = 1 || ambiguous || 78.2% Confident
Q922K6 - (Q922K6) Unknown (Protein for MGC:7530) || Number of peptides = 6 || unambiguous || 78.2% Confident
Q9EQ18 - (Q9EQ18) SIR2L2 || Number of peptides = 2 || unambiguous || 77.9% Confident
PTNC_MOUSE - (P35831) Protein-tyrosine phosphatase, non-receptor type 12 (EC 3.1.3.48) (Protein-tyrosine phosphatase P19) (P19-PTP) (MPTP-PEST) || Number of peptides = 6 || unambiguous || 77.9% Confident
SNX2_MOUSE - (Q9CWK8) Sorting nexin 2 || Number of peptides = 3 || unambiguous || 77.9% Confident
O94836 - (O94836) Hypothetical protein KIAA0731 (Fragment) || Number of peptides = 3 || unambiguous || 77.8% Confident
GALC_MOUSE - (P54818) Galactocerebrosidase precursor (EC 3.2.1.46) (GALCERASE) (Galactosylceramidase) (Galactosylceramide beta-galactosidase) (Galactocerebroside beta-galactosidase) || Number of peptides = 4 || unambiguous || 77.4% Confident
IF2A_HUMAN - (P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) || Number of peptides = 4 || unambiguous || 77.1% Confident
Q8WVJ5 - (Q8WVJ5) Similar to RIKEN cDNA 2310035L15 gene || Number of peptides = 1 || unambiguous || 77.0% Confident
KF1A_MOUSE - (P33173) Kinesin-like protein KIF1A || Number of peptides = 2 || unambiguous || 76.7% Confident
BS4_MOUSE - (P54729) BS4 protein || Number of peptides = 3 || unambiguous || 76.6% Confident
MAP4_HUMAN - (P27816) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 5 || unambiguous || 76.5% Confident
Q91VX2 - (Q91VX2) Similar to KIAA0144 gene product || Number of peptides = 3 || unambiguous || 76.4% Confident
Q9CRT6 - (Q9CRT6) 3110083O19Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 76.4% Confident
O88190 - (O88190) Cadherin-related neural recepter 3 (Fragment) || Number of peptides = 5 || ambiguous || 76.3% Confident
SUCA_MOUSE - (Q9WUM5) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, alpha chain) (SCS-alpha) || Number of peptides = 3 || unambiguous || 76.3% Confident
KAPA_MOUSE - (P05132) cAMP-dependent protein kinase, alpha-catalytic subunit (EC 2.7.1.37) (PKA C-alpha) || Number of peptides = 3 || unambiguous || 76.3% Confident
PL10_MOUSE - (P16381) Putative ATP-dependent RNA helicase PL10 || Number of peptides = 4 || ambiguous || 76.2% Confident
Q9QZJ4 - (Q9QZJ4) TPR-containing protein involved in spermatogenesis TPIS || Number of peptides = 7 || unambiguous || 75.8% Confident
NAH2_HUMAN - (Q9UBY0) Sodium/hydrogen exchanger 2 (Na(+)/H(+) exchanger 2) (NHE-2) || Number of peptides = 7 || unambiguous || 75.8% Confident
RS2_MOUSE - (P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein) || Number of peptides = 4 || ambiguous || 75.5% Confident
Q9WVM3 - (Q9WVM3) Prediabetic NOD sera-reactive autoantigen || Number of peptides = 2 || unambiguous || 75.5% Confident
O70481 - (O70481) Ubiquitin-protein ligase E3 COMPONEN N-recognin (Ubiquitin-protein ligase E3-alpha) || Number of peptides = 10 || unambiguous || 75.5% Confident
Q8VD36 - (Q8VD36) Similar to hypothetical protein FLJ12168 || Number of peptides = 1 || unambiguous || 75.4% Confident
Q9DBY0 - (Q9DBY0) 1200010K03Rik protein || Number of peptides = 2 || unambiguous || 75.4% Confident
Q9CWX9 - (Q9CWX9) 4930588A18Rik protein || Number of peptides = 1 || unambiguous || 75.4% Confident
Q9WVQ5 - (Q9WVQ5) MMRP19 (Monocyte macrophage 19) || Number of peptides = 2 || ambiguous || 75.3% Confident
POSC_MOUSE - (Q9Z2Y8) Proline synthetase co-transcribed bacterial homolog protein || Number of peptides = 2 || unambiguous || 75.2% Confident
Q9CRY6 - (Q9CRY6) 3000004N20Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 74.9% Confident
RB27_HUMAN - (P51159) Ras-related protein Rab-27a (RAB-27) (GTP-binding protein Ram) || Number of peptides = 1 || unambiguous || 74.8% Confident
Q99K76 - (Q99K76) Hypothetical 31.2 kDa protein || Number of peptides = 1 || ambiguous || 74.5% Confident
Q12912 - (Q12912) Lymphoid-restricted membrane protein || Number of peptides = 1 || unambiguous || 74.4% Confident
Z239_HUMAN - (Q16600) Zinc finger protein 239 (Zinc finger protein MOK-2) (HOK-2) || Number of peptides = 1 || ambiguous || 74.4% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 4 || ambiguous || 74.3% Confident
Q922B6 - (Q922B6) Unknown (Protein for MGC:7807) || Number of peptides = 2 || ambiguous || 74.2% Confident
ABE1_HUMAN - (Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68) (Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68) || Number of peptides = 8 || ambiguous || 74.1% Confident
Q96QC2 - (Q96QC2) Hypothetical protein KIAA0170 || Number of peptides = 9 || unambiguous || 73.9% Confident
Q9H426 - (Q9H426) DJ781B1.3 (A novel protein similar to myeloblast KIAA0237 protein and rat protein NIM2) (Fragment) || Number of peptides = 4 || unambiguous || 73.8% Confident
IGJ_HUMAN - (P01591) Immunoglobulin J chain || Number of peptides = 1 || unambiguous || 73.7% Confident
EZH2_MOUSE - (Q61188) Enhancer of zeste homolog 2 (ENX-1) || Number of peptides = 3 || ambiguous || 73.7% Confident
Q62262 - (Q62262) Spermatid perinuclear RNA binding protein || Number of peptides = 3 || ambiguous || 73.7% Confident
MK14_MOUSE - (P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1) || Number of peptides = 3 || ambiguous || 73.7% Confident
Q9JHJ3 - (Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) || Number of peptides = 11 || unambiguous || 73.7% Confident
Q9QXG8 - (Q9QXG8) Sir2alpha protein || Number of peptides = 3 || unambiguous || 73.7% Confident
TCPG_MOUSE - (P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin) || Number of peptides = 3 || unambiguous || 73.6% Confident
Q9D8R7 - (Q9D8R7) 1810043M20Rik protein || Number of peptides = 1 || unambiguous || 73.6% Confident
Q99984 - (Q99984) mRNA expressed in osteoblast || Number of peptides = 2 || unambiguous || 73.6% Confident
O88653 - (O88653) MEK binding partner 1 (Mitogen-activated protein kinase kinase 1 interacting protein 1) || Number of peptides = 1 || ambiguous || 73.6% Confident
Q922W2 - (Q922W2) Unknown (Protein for MGC:7055) || Number of peptides = 3 || ambiguous || 73.6% Confident
RPB3_HUMAN - (P19387) DNA-directed RNA polymerase II 33 kDa polypeptide (EC 2.7.7.6) (RPB3) (RNA polymerase II subunit 3) (RPB33) (RPB31) || Number of peptides = 1 || unambiguous || 73.5% Confident
Q9CX63 - (Q9CX63) 6030468B19Rik protein || Number of peptides = 1 || ambiguous || 73.4% Confident
Q924S9 - (Q924S9) Dscr6 protein || Number of peptides = 1 || ambiguous || 73.4% Confident
Q9NYJ1 - (Q9NYJ1) E2IG2 || Number of peptides = 2 || unambiguous || 73.4% Confident
Q8VI37 - (Q8VI37) Paxillin alpha || Number of peptides = 3 || unambiguous || 73.3% Confident
TPP2_HUMAN - (P29144) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) || Number of peptides = 5 || unambiguous || 73.0% Confident
S11Y_HUMAN - (Q9UDP3) Putative S100 calcium-binding protein H_NH0456N16.1 || Number of peptides = 1 || unambiguous || 73.0% Confident
Q91VR6 - (Q91VR6) Similar to siah binding protein 1, FBP interacting repressor, pyrimidine tr || Number of peptides = 6 || unambiguous || 72.9% Confident
AMPB_MOUSE - (Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV) || Number of peptides = 5 || unambiguous || 72.8% Confident
OL7E_MOUSE - (Q60886) Olfactory receptor 7E (M3) (Fragment) || Number of peptides = 1 || unambiguous || 72.5% Confident
SYEP_HUMAN - (P07814) Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)] || Number of peptides = 13 || unambiguous || 72.5% Confident
Q96PJ3 - (Q96PJ3) IFGP2 (Fragment) || Number of peptides = 1 || unambiguous || 72.5% Confident
A1T2_MOUSE - (P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 5 || ambiguous || 72.5% Confident
Q9D8V3 - (Q9D8V3) 1810030J04Rik protein || Number of peptides = 1 || unambiguous || 72.5% Confident
P70388 - (P70388) RAD50 || Number of peptides = 5 || unambiguous || 72.5% Confident
Q9UNI5 - (Q9UNI5) Zinc finger protein FOG-2 || Number of peptides = 3 || ambiguous || 72.5% Confident
Q96B33 - (Q96B33) Similar to RIKEN cDNA 2310014B08 gene (Fragment) || Number of peptides = 2 || unambiguous || 71.9% Confident
FYV1_MOUSE - (Q9Z1T6) FYVE finger-containing phosphoinositide kinase (EC 2.7.1.68) (1-phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) (p235) || Number of peptides = 9 || unambiguous || 71.9% Confident
O14710 - (O14710) Cell cycle progression 2 protein || Number of peptides = 1 || ambiguous || 71.9% Confident
PPI2_MOUSE - (P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) || Number of peptides = 4 || ambiguous || 71.5% Confident
AD24_MOUSE - (Q9R160) ADAM 24 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 24) (Testase 1) || Number of peptides = 4 || unambiguous || 71.4% Confident
Q9Z247 - (Q9Z247) FK506 binding protein 9 precursor (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS) || Number of peptides = 2 || unambiguous || 71.4% Confident
O35864 - (O35864) 38 kDa MOV34 ISOLOGUE (Kip1 C-terminus interacting protein-2) (COP9 (Constitutive photomorphogenic), subunit 5) (Arabidopsis) || Number of peptides = 2 || ambiguous || 71.0% Confident
Q9NS87 - (Q9NS87) Kinesin-like protein 2 || Number of peptides = 6 || unambiguous || 70.9% Confident
K1CI_HUMAN - (P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9) || Number of peptides = 7 || unambiguous || 70.9% Confident
SCP1_MOUSE - (Q62209) Synaptonemal complex protein 1 (SCP-1 protein) || Number of peptides = 7 || unambiguous || 70.7% Confident
Q9D2Z4 - (Q9D2Z4) 9130010J17Rik protein || Number of peptides = 1 || unambiguous || 70.4% Confident
Q96PW1 - (Q96PW1) Hypothetical protein KIAA1927 (Fragment) || Number of peptides = 1 || unambiguous || 70.4% Confident
Q9CQE0 - (Q9CQE0) 2410015A17Rik protein || Number of peptides = 1 || ambiguous || 70.2% Confident
Q8R3C0 - (Q8R3C0) Similar to hypothetical protein FLJ13081 || Number of peptides = 7 || unambiguous || 70.2% Confident
Q96A49 - (Q96A49) SYAP1 || Number of peptides = 4 || unambiguous || 70.1% Confident
Q91VS8 - (Q91VS8) Similar to KIAA0793 gene product || Number of peptides = 3 || unambiguous || 69.6% Confident
Q9DC92 - (Q9DC92) 0710008M05Rik protein (Non-canonical ubiquitin conjugating enzyme 1) || Number of peptides = 3 || ambiguous || 69.6% Confident
Q8VE71 - (Q8VE71) Hypothetical 72.9 kDa protein (Fragment) || Number of peptides = 4 || unambiguous || 69.6% Confident
Q9NU61 - (Q9NU61) DJ93K22.1 (Novel protein (contains DKFZP564B116)) || Number of peptides = 7 || ambiguous || 69.3% Confident
Q923Q2 - (Q923Q2) DM544J17.1 (Novel protein similar to rat RhoGap) (Fragment) || Number of peptides = 3 || unambiguous || 69.2% Confident
Q9D8X2 - (Q9D8X2) 1810023B24Rik protein || Number of peptides = 2 || unambiguous || 69.2% Confident
Q9CW15 - (Q9CW15) 2810470J21Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 69.1% Confident
Q9DAW9 - (Q9DAW9) 1600014M03Rik protein || Number of peptides = 2 || ambiguous || 69.1% Confident
Q8WZ74 - (Q8WZ74) Cortactin-binding protein 2 (Hypothetical protein KIAA1758) || Number of peptides = 6 || unambiguous || 69.1% Confident
R35A_MOUSE - (O55142) 60S ribosomal protein L35a || Number of peptides = 6 || ambiguous || 69.1% Confident
PSDC_MOUSE - (Q9D8W5) 26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit p55) || Number of peptides = 3 || ambiguous || 68.9% Confident
Q99NH2 - (Q99NH2) PAR-3 180 kDa isoform || Number of peptides = 4 || unambiguous || 68.8% Confident
MC3A_HUMAN - (O60318) 80 kda MCM3-associated protein (GANP protein) || Number of peptides = 9 || unambiguous || 68.7% Confident
Q9CRS2 - (Q9CRS2) 4432404J10Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 68.5% Confident
RLA1_MOUSE - (P47955) 60S acidic ribosomal protein P1 || Number of peptides = 2 || unambiguous || 68.3% Confident
Q9D9F8 - (Q9D9F8) 1700081O04Rik protein || Number of peptides = 3 || unambiguous || 68.0% Confident
TRFM_MOUSE - (Q9R0R1) Melanotransferrin precursor (Membrane-bound transferrin-like protein p97) (MTf) || Number of peptides = 3 || unambiguous || 67.9% Confident
PRVA_MOUSE - (P32848) Parvalbumin alpha || Number of peptides = 2 || ambiguous || 67.9% Confident
Q9Z0H9 - (Q9Z0H9) Ubiquitin/60S ribosomal fusion protein (Ubiquitin A-52 residue ribosomal protein fusion product 1) || Number of peptides = 2 || ambiguous || 67.6% Confident
MEI1_MOUSE - (Q60954) Homeobox protein Meis1 (Myeloid ecotropic viral integration site-1) || Number of peptides = 2 || ambiguous || 67.6% Confident
Q8R2Y6 - (Q8R2Y6) Hypothetical 35.4 kDa protein || Number of peptides = 5 || ambiguous || 67.5% Confident
Q96NA8 - (Q96NA8) Hypothetical protein FLJ31164 || Number of peptides = 4 || unambiguous || 67.4% Confident
Q9CQI2 - (Q9CQI2) Lipin 1 || Number of peptides = 4 || ambiguous || 67.4% Confident
Q8WWL2 - (Q8WWL2) Spir-2 protein (Fragment) || Number of peptides = 5 || unambiguous || 67.4% Confident
Q9UIF8 - (Q9UIF8) Bromodomain adjacent to zinc finger domain 2B || Number of peptides = 10 || unambiguous || 67.2% Confident
RET3_MOUSE - (P02695) Retinoic acid-binding protein I, cellular (CRABP-I) || Number of peptides = 2 || ambiguous || 67.1% Confident
RRA_MOUSE - (P11416) Retinoic acid receptor alpha (RAR-alpha) || Number of peptides = 2 || ambiguous || 67.1% Confident
SBP1_HUMAN - (Q13228) Selenium-binding protein 1 || Number of peptides = 1 || ambiguous || 67.1% Confident
Q9CXG3 - (Q9CXG3) 3732410E19Rik protein || Number of peptides = 2 || unambiguous || 67.1% Confident
Q9UI45 - (Q9UI45) PHD finger protein 3 || Number of peptides = 10 || unambiguous || 67.0% Confident
Q9EQ00 - (Q9EQ00) cAMP-dependent protein kinase regulatory subunit || Number of peptides = 5 || unambiguous || 67.0% Confident
HMMR_HUMAN - (O75330) Hyaluronan mediated motility receptor (Intracellular hyaluronic acid binding protein) (Receptor for hyaluronan-mediated motility) (CD168 antigen) || Number of peptides = 2 || unambiguous || 66.9% Confident
Q9CZF1 - (Q9CZF1) 2810005O12Rik protein || Number of peptides = 1 || unambiguous || 66.9% Confident
PGCV_HUMAN - (P13611) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP) || Number of peptides = 8 || unambiguous || 66.9% Confident
Q9CWR1 - (Q9CWR1) 2410008B13Rik protein || Number of peptides = 2 || unambiguous || 66.8% Confident
HAT1_HUMAN - (O14929) Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48) || Number of peptides = 2 || unambiguous || 66.8% Confident
TR16_MOUSE - (Q9Z0W1) Tumor necrosis factor receptor superfamily member 16 precursor (Low-affinity nerve growth factor receptor) (NGF receptor) (Low affinity neurotrophin receptor p75NTR) || Number of peptides = 3 || unambiguous || 66.7% Confident
CA1B_MOUSE - (Q61245) Collagen alpha 1(XI) chain precursor || Number of peptides = 7 || unambiguous || 66.5% Confident
Q8R3E6 - (Q8R3E6) Similar to chromosome 14 open reading frame 3 || Number of peptides = 3 || unambiguous || 66.5% Confident
ETFB_MOUSE - (Q9DCW4) Electron transfer flavoprotein beta-subunit (Beta-ETF) || Number of peptides = 5 || unambiguous || 66.5% Confident
Q99K41 - (Q99K41) Similar to elastin microfibril interface located protein || Number of peptides = 7 || unambiguous || 66.5% Confident
FMO5_MOUSE - (P97872) Dimethylaniline monooxygenase [N-oxide forming] 5 (EC 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) || Number of peptides = 4 || unambiguous || 66.4% Confident
VEGD_MOUSE - (P97946) Vascular endothelial growth factor D precursor (VEGF-D) (c-fos induced growth factor) (FIGF) || Number of peptides = 2 || unambiguous || 66.3% Confident
Q9DC15 - (Q9DC15) 1200007E24Rik protein || Number of peptides = 4 || unambiguous || 66.0% Confident
O60279 - (O60279) Hypothetical protein KIAA0527 (Fragment) || Number of peptides = 4 || unambiguous || 65.8% Confident
O95205 - (O95205) Zinc finger protein || Number of peptides = 2 || ambiguous || 65.7% Confident
MAP2_MOUSE - (P20357) Microtubule-associated protein 2 (MAP 2) || Number of peptides = 5 || unambiguous || 65.7% Confident
Q99JQ4 - (Q99JQ4) Hypothetical 23.0 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 65.6% Confident
Q96M01 - (Q96M01) Hypothetical protein FLJ32940 || Number of peptides = 2 || unambiguous || 65.5% Confident
MEPA_MOUSE - (P28825) Meprin A alpha-subunit precursor (EC 3.4.24.18) (Endopeptidase-2) (MEP-1) || Number of peptides = 4 || ambiguous || 65.5% Confident
Q9DA10 - (Q9DA10) 1700023I07Rik protein || Number of peptides = 1 || unambiguous || 65.5% Confident
O70274 - (O70274) MPRL-2 || Number of peptides = 1 || ambiguous || 65.5% Confident
O75206 - (O75206) Hypothetical protein || Number of peptides = 4 || ambiguous || 65.5% Confident
Q8VCN9 - (Q8VCN9) Similar to tubulin-specific chaperone c || Number of peptides = 4 || unambiguous || 65.4% Confident
ZO3_MOUSE - (Q9QXY1) Tight junction protein ZO-3 (Zonula occludens 3 protein) (Zona occludens 3 protein) (Tight junction protein 3) || Number of peptides = 3 || unambiguous || 65.4% Confident
PESC_MOUSE - (Q9EQ61) Pescadillo homolog 1 || Number of peptides = 5 || unambiguous || 65.4% Confident
Z334_HUMAN - (Q9HCZ1) Zinc finger protein 334 || Number of peptides = 2 || unambiguous || 65.2% Confident
ARF5_HUMAN - (P26437) ADP-ribosylation factor 5 (P26437) ADP-ribosylation factor 5 || Number of peptides = 1 || ambiguous || 65.2% Confident
Q8VD71 - (Q8VD71) Similar to hypothetical protein FLJ12438 || Number of peptides = 3 || unambiguous || 65.2% Confident
PM17_MOUSE - (Q60696) Melanocyte protein Pmel 17 precursor (Silver locus protein) || Number of peptides = 5 || unambiguous || 65.1% Confident
Q9CYT1 - (Q9CYT1) DNA segment, KIST 1 || Number of peptides = 2 || ambiguous || 64.9% Confident
Q9HCM0 - (Q9HCM0) Hypothetical protein KIAA1552 (Fragment) || Number of peptides = 4 || unambiguous || 64.7% Confident
Q9D157 - (Q9D157) 0610025K21Rik protein || Number of peptides = 3 || unambiguous || 64.4% Confident
Q9D0H2 - (Q9D0H2) 2610017G09Rik protein || Number of peptides = 2 || unambiguous || 64.2% Confident
Q9CS69 - (Q9CS69) 5730455C01Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 64.2% Confident
Q96N79 - (Q96N79) Hypothetical protein FLJ31289 || Number of peptides = 4 || unambiguous || 64.2% Confident
Q9DCB7 - (Q9DCB7) 3100001N19Rik protein || Number of peptides = 5 || ambiguous || 64.2% Confident
Q9EPU6 - (Q9EPU6) Pumilio 1 || Number of peptides = 9 || unambiguous || 64.2% Confident
Q9CTH2 - (Q9CTH2) 1110008J20Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 64.2% Confident
Q9CSL1 - (Q9CSL1) 2510006G12Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 64.2% Confident
O88903 - (O88903) SH3 domain-containing adapter protein || Number of peptides = 4 || unambiguous || 64.1% Confident
Q9QYY0 - (Q9QYY0) GRB2-associated binding protein 1 || Number of peptides = 3 || unambiguous || 64.1% Confident
Q8R550 - (Q8R550) Ruk(xl) protein || Number of peptides = 2 || unambiguous || 64.1% Confident
CO1B_MOUSE - (Q9WUM3) Coronin 1B (Coronin 2) || Number of peptides = 2 || unambiguous || 64.1% Confident
MSLN_HUMAN - (Q13421) Mesothelin precursor (CAK1 antigen) || Number of peptides = 3 || ambiguous || 64.0% Confident
Q99NF0 - (Q99NF0) MLN51 protein || Number of peptides = 4 || unambiguous || 63.9% Confident
Q99LI0 - (Q99LI0) Similar to thyroid hormone receptor interactor 10 || Number of peptides = 2 || ambiguous || 63.9% Confident
ODBA_MOUSE - (P50136) 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component alpha chain (E1)) (BCKDH E1-alpha) || Number of peptides = 2 || unambiguous || 63.9% Confident
CES2_HUMAN - (Q9BXF3) Cat eye syndrome critical region protein 2 || Number of peptides = 9 || unambiguous || 63.8% Confident
SKD1_HUMAN - (O75351) SKD1 protein (Vacuolar sorting protein 4b) || Number of peptides = 1 || ambiguous || 63.7% Confident
Q96G90 - (Q96G90) Hypothetical protein || Number of peptides = 1 || unambiguous || 63.7% Confident
Q9WVN7 - (Q9WVN7) Protein kinase Myak-S || Number of peptides = 2 || ambiguous || 63.5% Confident
Q9UH87 - (Q9UH87) Transposase-like protein || Number of peptides = 1 || ambiguous || 63.5% Confident
Q9CZN0 - (Q9CZN0) 2700049A03Rik protein || Number of peptides = 4 || unambiguous || 63.4% Confident
Q61285 - (Q61285) ALDR protein (ATP-binding cassette, sub-family D (ALD), member 2) || Number of peptides = 3 || unambiguous || 63.2% Confident
Q9GZP4 - (Q9GZP4) AD039 (Hypothetical protein) (HT014) || Number of peptides = 3 || unambiguous || 63.1% Confident
CSN2_HUMAN - (Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15) (Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15) || Number of peptides = 3 || ambiguous || 63.1% Confident
Q9D3K6 - (Q9D3K6) 9130005N14Rik protein || Number of peptides = 4 || ambiguous || 63.0% Confident
Q9D9A2 - (Q9D9A2) 1700121J11Rik protein || Number of peptides = 3 || unambiguous || 63.0% Confident
7B2_MOUSE - (P12961) Neuroendocrine protein 7B2 precursor (Secretogranin V) || Number of peptides = 2 || ambiguous || 62.9% Confident
Q8VDZ6 - (Q8VDZ6) Hypothetical 41.8 kDa protein || Number of peptides = 2 || ambiguous || 62.9% Confident
HP28_HUMAN - (Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) || Number of peptides = 1 || unambiguous || 62.8% Confident
Q9H9P5 - (Q9H9P5) Hypothetical protein FLJ12623 || Number of peptides = 2 || ambiguous || 62.8% Confident
SOS1_MOUSE - (Q62245) Son of sevenless protein homolog 1 (SOS-1) (mSOS-1) || Number of peptides = 6 || unambiguous || 62.8% Confident
ACDM_MOUSE - (P45952) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor (EC 1.3.99.3) (MCAD) || Number of peptides = 4 || unambiguous || 62.8% Confident
Q9P015 - (Q9P015) HSPC145 (HSPC145 protein) || Number of peptides = 2 || ambiguous || 62.5% Confident
Q9P2P6 - (Q9P2P6) Hypothetical protein KIAA1300 (Fragment) || Number of peptides = 7 || unambiguous || 62.5% Confident
Q9H7U3 - (Q9H7U3) Hypothetical protein FLJ14257 || Number of peptides = 7 || ambiguous || 62.2% Confident
Q07900 - (Q07900) M130 antigen cytoplasmic variant 2 precursor || Number of peptides = 3 || unambiguous || 62.2% Confident
Q9H089 - (Q9H089) Hypothetical protein FLJ11301 || Number of peptides = 4 || unambiguous || 61.9% Confident
Q91WJ8 - (Q91WJ8) Similar to far upstream element (FUSE) binding protein 1 || Number of peptides = 10 || unambiguous || 61.9% Confident
HXK4_HUMAN - (P35557) Hexokinase D (EC 2.7.1.1) (Hexokinase type IV) (HK IV) (HK4) (Glucokinase) || Number of peptides = 1 || unambiguous || 61.8% Confident
FOLC_MOUSE - (P48760) Folylpolyglutamate synthase, mitochondrial precursor (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (FPGS) || Number of peptides = 4 || unambiguous || 61.7% Confident
Q96RI6 - (Q96RI6) Unconventional myosin 1G valine form (Fragment) || Number of peptides = 2 || ambiguous || 61.6% Confident
NCA1_MOUSE - (P13595) Neural cell adhesion molecule 1, 180 kDa isoform precursor (N-CAM 180) (NCAM-180) || Number of peptides = 4 || unambiguous || 61.6% Confident
Q9ERM4 - (Q9ERM4) Mg53d08.r1 (Fragment) || Number of peptides = 2 || unambiguous || 61.6% Confident
EGF_HUMAN - (P01133) Pro-epidermal growth factor precursor (EGF) [Contains: Epidermal growth factor (Urogastrone)] || Number of peptides = 4 || unambiguous || 61.6% Confident
KFP3_MOUSE - (P70188) Kinesin-associated protein 3 (KAP3) || Number of peptides = 2 || ambiguous || 61.6% Confident
KI67_HUMAN - (P46013) Antigen KI-67 || Number of peptides = 16 || unambiguous || 61.6% Confident
Q9BSS2 - (Q9BSS2) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 61.4% Confident
Q9DAR9 - (Q9DAR9) 1700001D09Rik protein || Number of peptides = 4 || unambiguous || 61.4% Confident
IMB1_MOUSE - (P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG) || Number of peptides = 5 || ambiguous || 61.4% Confident
O43304 - (O43304) Hypothetical protein KIAA0420 (Fragment) || Number of peptides = 6 || unambiguous || 61.3% Confident
MSE5_HUMAN - (Q00587) Serum protein MSE55 || Number of peptides = 1 || unambiguous || 61.1% Confident
Q8TEC6 - (Q8TEC6) Hypothetical protein FLJ23651 || Number of peptides = 2 || unambiguous || 61.1% Confident
O75663 - (O75663) DJ69E11.3 (Yeast YPR037W and WORM C02C2.6 PREDICTED proteins like) || Number of peptides = 2 || unambiguous || 61.1% Confident
Q9BQ50 - (Q9BQ50) 3'-5' exonuclease TREX2-like protein || Number of peptides = 2 || unambiguous || 61.1% Confident
Q9H430 - (Q9H430) DJ756N5.1.1 (Continues in Em:AL133324 as dJ1161H23.3 ) (Fragment) || Number of peptides = 6 || ambiguous || 61.1% Confident
ZN41_HUMAN - (P51814) Zinc finger protein 41 || Number of peptides = 2 || unambiguous || 61.0% Confident
Q8TD23 - (Q8TD23) TRAF6-binding zinc finger protein || Number of peptides = 1 || unambiguous || 61.0% Confident
ZF38_MOUSE - (Q07231) Zinc finger protein 38 (Zfp-38) (CtFIN51) (Transcription factor RU49) || Number of peptides = 4 || ambiguous || 61.0% Confident
Z287_MOUSE - (Q9EQB9) Zinc finger protein ZNF287 (Zinc finger protein SKAT-2) || Number of peptides = 1 || ambiguous || 61.0% Confident
ZN43_HUMAN - (P17038) Zinc finger protein 43 (Zinc protein HTF6) (Zinc finger protein KOX27) || Number of peptides = 3 || unambiguous || 61.0% Confident
ZFP2_MOUSE - (P08043) Zinc finger protein 2 (Zfp-2) (mKR2 protein) || Number of peptides = 2 || ambiguous || 61.0% Confident
TS24_MOUSE - (P53995) Protein TSG24 (Meiotic check point regulator) || Number of peptides = 14 || unambiguous || 60.8% Confident
O08972 - (O08972) Hypothetical 25.4 kDa protein || Number of peptides = 5 || ambiguous || 60.8% Confident
Q9Y3T0 - (Q9Y3T0) Hypothetical protein (Fragment) || Number of peptides = 1 || unambiguous || 60.5% Confident
LSM5_HUMAN - (Q9Y4Y9) U6 snRNA-associated Sm-like protein LSm5 || Number of peptides = 2 || unambiguous || 60.5% Confident
Q923C3 - (Q923C3) Similar to regulator of differentiation (In S. pombe) 1 || Number of peptides = 2 || ambiguous || 60.5% Confident
PLD2_MOUSE - (P97813) Phospholipase D2 (EC 3.1.4.4) (PLD 2) (Choline phosphatase 2) (Phosphatidylcholine-hydrolyzing phospholipase D2) (PLD1C) (mPLD2) || Number of peptides = 4 || unambiguous || 60.4% Confident
RS6_HUMAN - (P10660) 40S ribosomal protein S6 (Phosphoprotein NP33) (P10660) 40S ribosomal protein S6 (Phosphoprotein NP33) || Number of peptides = 8 || ambiguous || 60.4% Confident
O75130 - (O75130) Hypothetical protein KIAA0635 || Number of peptides = 9 || unambiguous || 60.2% Confident
Q9Y373 - (Q9Y373) CGI-63 protein || Number of peptides = 3 || unambiguous || 60.2% Confident
LGR6_HUMAN - (Q9HBX8) Leucine-rich repeat-containing G protein-coupled receptor 6 || Number of peptides = 4 || unambiguous || 60.1% Confident
Q9D7L5 - (Q9D7L5) 2310003M01Rik protein || Number of peptides = 1 || unambiguous || 60.0% Confident
CYA8_MOUSE - (P97490) Adenylate cyclase, type VIII (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Ca(2+)/calmodulin activated adenylyl cyclase) || Number of peptides = 5 || unambiguous || 60.0% Confident
Q9JLT4 - (Q9JLT4) Thioredoxin reductase 2, mitochondrial precursor (EC 1.6.4.5) || Number of peptides = 2 || unambiguous || 60.0% Confident
Q9CXP5 - (Q9CXP5) 3110043A19Rik protein || Number of peptides = 2 || ambiguous || 60.0% Confident
P70212 - (P70212) Hypothetical 22.7 kDa protein || Number of peptides = 1 || ambiguous || 59.9% Confident
Q9D7W8 - (Q9D7W8) 2210019E14Rik protein || Number of peptides = 1 || unambiguous || 59.9% Confident
Q9DB51 - (Q9DB51) 1500011L16Rik protein || Number of peptides = 1 || ambiguous || 59.8% Confident
M3K2_HUMAN - (Q9Y2U5) Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.1.-) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2) || Number of peptides = 9 || unambiguous || 59.8% Confident
ODC_HUMAN - (Q9BQT8) Mitochondrial 2-oxodicarboxylate carrier || Number of peptides = 3 || unambiguous || 59.7% Confident
Q8VGJ7 - (Q8VGJ7) Olfactory receptor MOR136-11 || Number of peptides = 3 || unambiguous || 59.3% Confident
RFL1_HUMAN - (O75677) Ret finger protein-like 1 || Number of peptides = 6 || unambiguous || 59.3% Confident
RBB4_MOUSE - (Q60972) Chromatin assembly factor 1 subunit C (CAF-1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF-I 48 kDa subunit) (CAF-Ip48) (Retinoblastoma binding protein p48) (Retinoblastoma-binding protein 4) (RBBP-4) || Number of peptides = 4 || ambiguous || 59.2% Confident
Q96AQ8 - (Q96AQ8) Similar to RIKEN cDNA 6230416A05 gene || Number of peptides = 5 || unambiguous || 59.1% Confident
ELO2_MOUSE - (Q9JLJ4) Elongation of very long chain fatty acids protein 2 || Number of peptides = 1 || unambiguous || 59.1% Confident
GTO1_HUMAN - (P78417) Glutathione transferase omega 1 (EC 2.5.1.18) (GSTO 1-1) || Number of peptides = 1 || unambiguous || 59.0% Confident
CG99_MOUSE - (Q9CQE8) Hypothetical protein CGI-99 homolog || Number of peptides = 2 || ambiguous || 58.9% Confident
USF2_MOUSE - (Q64705) Upstream stimulatory factor 2 (Upstream transcription factor 2) (Major late transcription factor 2) || Number of peptides = 4 || unambiguous || 58.7% Confident
PTN_MOUSE - (P20935) Pleiotrophin precursor (PTN) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding growth factor 8) (HBGF-8) (Osteoblast specific factor 1) (OSF-1) (Heparin-binding neutrophic factor) (HBNF) || Number of peptides = 1 || ambiguous || 58.6% Confident
RP1_MOUSE - (P56716) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein homolog) || Number of peptides = 8 || unambiguous || 58.5% Confident
ZN30_HUMAN - (P17039) Zinc finger protein 30 (Zinc finger protein KOX28) (Fragment) || Number of peptides = 1 || ambiguous || 58.5% Confident
Q8WX42 - (Q8WX42) BA100C15.1 (Novel protein) (Fragment) || Number of peptides = 4 || unambiguous || 58.4% Confident
Q9Y2J5 - (Q9Y2J5) Hypothetical protein KIAA0990 (Chondroitin synthase) || Number of peptides = 2 || unambiguous || 58.4% Confident
DRG1_MOUSE - (P32233) Developmentally regulated GTP-binding protein 1 (DRG 1) (Nedd3 protein) || Number of peptides = 1 || ambiguous || 58.4% Confident
Q96PV7 - (Q96PV7) Hypothetical protein KIAA1931 (Fragment) || Number of peptides = 4 || unambiguous || 58.3% Confident
Q9ESJ5 - (Q9ESJ5) GluR-delta2 philic-protein || Number of peptides = 2 || unambiguous || 58.3% Confident
Q9CQC6 - (Q9CQC6) 1200015E15Rik protein (KIAA0005 gene product) || Number of peptides = 2 || ambiguous || 58.2% Confident
M2OM_MOUSE - (Q9CR62) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) || Number of peptides = 3 || unambiguous || 58.2% Confident
NAC1_MOUSE - (P70414) Sodium/calcium exchanger 1 precursor (Na(+)/Ca(2+)-exchange protein 1) || Number of peptides = 4 || unambiguous || 58.2% Confident
Q9P1H6 - (Q9P1H6) PRO1410 || Number of peptides = 1 || unambiguous || 58.1% Confident
Q9CWF2 - (Q9CWF2) 2410129E14Rik protein || Number of peptides = 1 || ambiguous || 58.1% Confident
SNPH_HUMAN - (O15079) Syntaphilin || Number of peptides = 1 || unambiguous || 58.0% Confident
MDR1_HUMAN - (P08183) Multidrug resistance protein 1 (P-glycoprotein 1) (CD243 antigen) || Number of peptides = 2 || unambiguous || 58.0% Confident
PP1A_HUMAN - (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) || Number of peptides = 3 || ambiguous || 57.8% Confident
Q8WWB5 - (Q8WWB5) Similar to RIKEN cDNA 2700059L22 gene || Number of peptides = 3 || unambiguous || 57.6% Confident
GTA1_MOUSE - (P13745) Glutathione S-transferase Ya chain (EC 2.5.1.18) (GST class-alpha) || Number of peptides = 2 || ambiguous || 57.2% Confident
Q9H0V0 - (Q9H0V0) Hypothetical protein || Number of peptides = 2 || ambiguous || 57.2% Confident
Q9H9L6 - (Q9H9L6) Hypothetical protein FLJ12668 || Number of peptides = 3 || unambiguous || 57.2% Confident
Q96JG9 - (Q96JG9) Hypothetical protein KIAA1858 (Fragment) || Number of peptides = 6 || unambiguous || 57.2% Confident
Q9P280 - (Q9P280) Hypothetical protein KIAA1448 (Fragment) || Number of peptides = 3 || unambiguous || 57.1% Confident
O54774 - (O54774) MBLVR || Number of peptides = 1 || ambiguous || 57.1% Confident
Q9Z1K7 - (Q9Z1K7) APC2 protein || Number of peptides = 10 || unambiguous || 57.1% Confident
PUR1_HUMAN - (Q06203) Amidophosphoribosyltransferase precursor (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (ATASE) (GPAT) || Number of peptides = 3 || unambiguous || 57.0% Confident
Q9Y5R3 - (Q9Y5R3) N-acetylglucosamine 6-O-sulfotransferase (L-selectin ligand sulfotransferase GST-3) || Number of peptides = 1 || unambiguous || 57.0% Confident
O88442 - (O88442) Aortic carboxypeptidase-like protein ACLP || Number of peptides = 5 || unambiguous || 57.0% Confident
RB5B_HUMAN - (P35239) Ras-related protein Rab-5B (P35239) Ras-related protein Rab-5B || Number of peptides = 5 || ambiguous || 56.8% Confident
TRHY_HUMAN - (Q07283) Trichohyalin || Number of peptides = 6 || unambiguous || 56.7% Confident
KF1B_MOUSE - (Q60575) Kinesin-like protein KIF1B || Number of peptides = 5 || unambiguous || 56.7% Confident
Q9ET47 - (Q9ET47) Espin || Number of peptides = 2 || unambiguous || 56.7% Confident
VIS3_MOUSE - (P35333) Visinin-like protein 3 (VILIP-3) (Neural visinin-like protein 3) (NVL-3) (NVP-3) (Hippocalcin-like protein 1) || Number of peptides = 1 || ambiguous || 56.5% Confident
TYB0_HUMAN - (P13472) Thymosin beta-10 || Number of peptides = 3 || unambiguous || 56.2% Confident
Q9NZM9 - (Q9NZM9) Serine/threonine kinase || Number of peptides = 3 || unambiguous || 56.2% Confident
Q8VI75 - (Q8VI75) RANBP4 || Number of peptides = 5 || unambiguous || 56.1% Confident
Q8VHA6 - (Q8VHA6) SOCS box protein ASB-18 || Number of peptides = 6 || unambiguous || 56.0% Confident
Q9D4X4 - (Q9D4X4) 4930544L10Rik protein || Number of peptides = 1 || ambiguous || 55.6% Confident
Q9D5G1 - (Q9D5G1) 4930444P10Rik protein || Number of peptides = 4 || unambiguous || 55.6% Confident
CES5_HUMAN - (Q9BXW7) Cat eye syndrome critical region protein 5 precursor || Number of peptides = 4 || unambiguous || 55.6% Confident
NME4_MOUSE - (Q03391) Glutamate [NMDA] receptor subunit epsilon 4 precursor (N-methyl D-aspartate receptor subtype 2D) (NR2D) (NMDAR2D) || Number of peptides = 7 || unambiguous || 55.5% Confident
PTNB_MOUSE - (P35235) Protein-tyrosine phosphatase, non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase SYP) || Number of peptides = 6 || ambiguous || 55.4% Confident
Q96DT6 - (Q96DT6) Putative autophagy-related cysteine endopeptidase || Number of peptides = 1 || ambiguous || 55.3% Confident
Q9P2P5 - (Q9P2P5) Hypothetical protein KIAA1301 (Fragment) || Number of peptides = 7 || unambiguous || 55.1% Confident
ACE_MOUSE - (P09470) Angiotensin-converting enzyme, somatic isoform precursor (EC 3.4.15.1) (ACE) (Dipeptidyl carboxypeptidase I) (Kininase II) || Number of peptides = 3 || ambiguous || 55.1% Confident
GA6S_HUMAN - (P34059) N-acetylgalactosamine-6-sulfatase precursor (EC 3.1.6.4) (N-acetylgalactosamine-6-sulfate sulfatase) (Galactose-6-sulfate sulfatase) (GalNAc6S sulfatase) (Chondroitinsulfatase) (Chondroitinase) || Number of peptides = 1 || unambiguous || 55.0% Confident
Q9DBE0 - (Q9DBE0) Adult male liver cDNA, RIKEN full-length enriched library, clone:1300015E02, full insert sequence || Number of peptides = 3 || unambiguous || 55.0% Confident
COPA_HUMAN - (P53621) Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) [Contains: Xenin (Xenopsin-related peptide); Proxenin] || Number of peptides = 10 || unambiguous || 55.0% Confident
Q9CWN3 - (Q9CWN3) 2410016C14Rik protein || Number of peptides = 6 || unambiguous || 55.0% Confident
Q924X9 - (Q924X9) Type II cAMP-dependent protein kinase anchoring protein Ht31 (Fragment) || Number of peptides = 4 || unambiguous || 55.0% Confident
BRD2_HUMAN - (P25440) Bromodomain-containing protein 2 (RING3 protein) || Number of peptides = 3 || ambiguous || 54.9% Confident
GDFF_HUMAN - (Q99988) Growth/differentiation factor 15 precursor (GDF-15) (Placental bone morphogenic protein) (Placental TGF-beta) (Macrophage inhibitory cytokine-1) (MIC-1) (Prostate differentiation factor) (NSAID-regulated protein 1) (NRG-1) || Number of peptides = 2 || ambiguous || 54.9% Confident
ITA5_MOUSE - (P11688) Integrin alpha-5 precursor (Fibronectin receptor alpha subunit) (Integrin alpha-F) (VLA-5) (CD49e) || Number of peptides = 2 || unambiguous || 54.7% Confident
Q96AE7 - (Q96AE7) Similar to hypothetical protein FLJ10890 || Number of peptides = 5 || unambiguous || 54.6% Confident
Q9GZS0 - (Q9GZS0) Dynein axonemal intermediate chain || Number of peptides = 5 || unambiguous || 54.6% Confident
Q9CYN8 - (Q9CYN8) 5730403H22Rik protein || Number of peptides = 2 || ambiguous || 54.6% Confident
Q8TET9 - (Q8TET9) FLJ00072 protein (Fragment) || Number of peptides = 1 || unambiguous || 54.6% Confident
Q9D516 - (Q9D516) 4930527D15Rik protein || Number of peptides = 3 || ambiguous || 54.6% Confident
O70495 - (O70495) Plenty-of-prolines-101 || Number of peptides = 5 || unambiguous || 54.5% Confident
Q9D6U5 - (Q9D6U5) 2310057C03Rik protein || Number of peptides = 4 || ambiguous || 54.5% Confident
Q16256 - (Q16256) WT1 || Number of peptides = 1 || unambiguous || 54.4% Confident
Q8TAA0 - (Q8TAA0) Similar to PRAM-1 protein, PML-RARA target gene encoding an adaptor molecule-1 || Number of peptides = 11 || unambiguous || 54.4% Confident
ZEP1_HUMAN - (P15822) Zinc finger protein 40 (Human immunodeficiency virus type I enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex binding protein 1) (MBP-1) (Positive regulatory domain II binding factor 1) (PRDII-BF1) || Number of peptides = 13 || unambiguous || 54.3% Confident
CA1H_HUMAN - (P39060) Collagen alpha 1(XVIII) chain precursor [Contains: Endostatin] || Number of peptides = 4 || unambiguous || 54.2% Confident
IM9A_MOUSE - (Q9WV98) Mitochondrial import inner membrane translocase subunit TIM9 A || Number of peptides = 1 || ambiguous || 54.1% Confident
O75127 - (O75127) Hypothetical protein KIAA0632 (Fragment) || Number of peptides = 7 || unambiguous || 54.0% Confident
A2HS_HUMAN - (P02765) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Alpha-2-Z-globulin) (Ba-alpha-2-glycoprotein) (PRO2743) || Number of peptides = 3 || unambiguous || 53.9% Confident
TRL3_HUMAN - (Q9HCF6) Long transient receptor potential channel 3 (LTrpC3) (Fragment) || Number of peptides = 4 || unambiguous || 53.9% Confident
ERR2_HUMAN - (O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor, beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2) || Number of peptides = 5 || unambiguous || 53.9% Confident
RL27_HUMAN - (P08526) 60S ribosomal protein L27 || Number of peptides = 5 || unambiguous || 53.9% Confident
Q9CQZ0 - (Q9CQZ0) 0610012C09Rik protein (Similar to HSPC160 protein) || Number of peptides = 2 || ambiguous || 53.8% Confident
SNX1_HUMAN - (Q13596) Sorting nexin 1 || Number of peptides = 1 || unambiguous || 53.7% Confident
CDNB_MOUSE - (P46414) Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) || Number of peptides = 3 || unambiguous || 53.7% Confident
GLUC_MOUSE - (P55095) Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP); Glucagon; Glucagon-like peptide 1 (GLP1); Glucagon-like peptide 2 (GLP2)] || Number of peptides = 3 || unambiguous || 53.7% Confident
Q9BYZ4 - (Q9BYZ4) PRTD-NY2 || Number of peptides = 7 || unambiguous || 53.6% Confident
Q9NZ71 - (Q9NZ71) Helicase-like protein NHL (BK3184A7.3.5) (LOC51750), isoform 5 (Hypothetical protein KIAA1088) || Number of peptides = 1 || unambiguous || 53.6% Confident
FABB_MOUSE - (P51880) Fatty acid-binding protein, brain (B-FABP) (Brain lipid-binding protein) (BLBP) || Number of peptides = 32 || unambiguous || 53.6% Confident
Q9CWQ9 - (Q9CWQ9) 2410008J01Rik protein || Number of peptides = 2 || ambiguous || 53.5% Confident
Q9BS40 - (Q9BS40) Latexin protein || Number of peptides = 1 || ambiguous || 53.3% Confident
Q61627 - (Q61627) Glutamate receptor delta-1 subunit precursor || Number of peptides = 3 || unambiguous || 53.3% Confident
Q9P2B8 - (Q9P2B8) Hypothetical protein KIAA1429 (Fragment) || Number of peptides = 3 || unambiguous || 53.3% Confident
UBP7_HUMAN - (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15) (Ubiquitin thiolesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus associated ubiquitin-specific protease) || Number of peptides = 5 || unambiguous || 53.3% Confident
CTNB_MOUSE - (Q02248) Beta-catenin || Number of peptides = 4 || ambiguous || 53.3% Confident
Q9CS12 - (Q9CS12) C430040P13Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 53.3% Confident
Q9C0C4 - (Q9C0C4) Hypothetical protein KIAA1739 (Fragment) || Number of peptides = 3 || unambiguous || 53.3% Confident
NX2A_HUMAN - (Q9P2S2) Neurexin 2-alpha precursor (Neurexin II-alpha) || Number of peptides = 4 || unambiguous || 53.2% Confident
COPP_MOUSE - (O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) || Number of peptides = 1 || unambiguous || 53.0% Confident
Q9NYU1 - (Q9NYU1) UDP-glucose:glycoprotein glucosyltransferase 2 precursor || Number of peptides = 2 || unambiguous || 52.9% Confident
ACTZ_HUMAN - (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) || Number of peptides = 11 || ambiguous || 52.8% Confident
SHK2_HUMAN - (Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2) || Number of peptides = 4 || unambiguous || 52.8% Confident
BCKD_MOUSE - (O55028) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial precursor (EC 2.7.1.115) (Branched-chain alpha-ketoacid dehydrogenase kinase) (BCKDHKIN) (BCKD-kinase) || Number of peptides = 5 || unambiguous || 52.8% Confident
CLUS_MOUSE - (Q06890) Clusterin precursor (Sulfated glycoprotein 2) (SGP-2) (Clustrin) (Apolipoprotein J) (Apo-J) || Number of peptides = 1 || unambiguous || 52.8% Confident
Q9CRW0 - (Q9CRW0) 2310026E23Rik protein (Fragment) || Number of peptides = 5 || unambiguous || 52.6% Confident
Q92644 - (Q92644) Gonadotropin-releasing hormone receptor || Number of peptides = 2 || unambiguous || 52.4% Confident
PM34_HUMAN - (O43808) Peroxisomal membrane protein PMP34 (34 kDa peroxisomal membrane protein) (Solute carrier family 25, member 17) || Number of peptides = 1 || unambiguous || 52.4% Confident
AGM1_MOUSE - (Q9CYR6) Phosphoacetylglucosamine mutase (EC 5.4.2.3) (PAGM) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase) || Number of peptides = 5 || unambiguous || 52.4% Confident
CU32_HUMAN - (P57056) Putative protein C21orf32 || Number of peptides = 1 || unambiguous || 52.4% Confident
DDX9_MOUSE - (O70133) ATP-dependent RNA helicase A (Nuclear DNA helicase II) (NDH II) (DEAD-box protein 9) (mHEL-5) || Number of peptides = 12 || unambiguous || 52.4% Confident
Q9D768 - (Q9D768) 2010009L17Rik protein || Number of peptides = 2 || ambiguous || 52.2% Confident
Q9DCZ7 - (Q9DCZ7) WD40 protein Ciao1 || Number of peptides = 1 || ambiguous || 52.2% Confident
GRF1_HUMAN - (Q12849) G-rich sequence factor-1 (GRSF-1) || Number of peptides = 2 || unambiguous || 52.1% Confident
H11_MOUSE - (P43275) Histone H1.1 (H1 VAR.3) (H1A) || Number of peptides = 1 || unambiguous || 52.1% Confident
Q15170 - (Q15170) Transcription factor S-II-related protein (PP21) || Number of peptides = 4 || unambiguous || 52.0% Confident
O75162 - (O75162) Hypothetical protein KIAA0675 || Number of peptides = 3 || unambiguous || 52.0% Confident
HXK2_MOUSE - (O08528) Hexokinase type II (EC 2.7.1.1) (HK II) || Number of peptides = 3 || unambiguous || 51.7% Confident
Z174_HUMAN - (Q15697) Zinc finger protein 174 (AW-1) || Number of peptides = 1 || unambiguous || 51.7% Confident
ZRF1_MOUSE - (P54103) Zuotin related factor-1 || Number of peptides = 4 || ambiguous || 51.7% Confident
RS28_HUMAN - (P25112) 40S ribosomal protein S28 (P25112) 40S ribosomal protein S28 || Number of peptides = 1 || ambiguous || 51.6% Confident
Q9CX98 - (Q9CX98) 8430436A10Rik protein || Number of peptides = 4 || unambiguous || 51.6% Confident
NO56_MOUSE - (Q9D6Z1) Nucleolar protein Nop56 (Nucleolar protein 5A) || Number of peptides = 5 || unambiguous || 51.6% Confident
PLD1_HUMAN - (Q13393) Phospholipase D1 (EC 3.1.4.4) (PLD 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D1) (hPLD1) || Number of peptides = 3 || unambiguous || 51.6% Confident
Q9WVN6 - (Q9WVN6) MOR 5'beta3 (Olfactory receptor MOR1-2) || Number of peptides = 2 || ambiguous || 51.5% Confident
CC37_MOUSE - (Q61081) Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) || Number of peptides = 4 || unambiguous || 51.5% Confident
PKL1_HUMAN - (Q16512) Protein kinase C-like 1 (EC 2.7.1.-) (Protein-kinase C-related kinase 1) (Protein kinase C-like PKN) (Serine-threonine protein kinase N) || Number of peptides = 7 || unambiguous || 51.4% Confident
R22A_MOUSE - (P35285) Ras-related protein Rab-22A (RAB-14) (Fragment) || Number of peptides = 1 || ambiguous || 51.3% Confident
REST_HUMAN - (P30622) Restin (Cytoplasmic linker protein-170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament associated protein) || Number of peptides = 5 || unambiguous || 51.1% Confident
Q9Z104 - (Q9Z104) SMARCE1-related protein (HMG domain protein HMGX2) (High mobility group 20 B) || Number of peptides = 5 || unambiguous || 51.0% Confident
Q9GZW2 - (Q9GZW2) Hypothetical protein FLJ23544 || Number of peptides = 1 || unambiguous || 50.9% Confident
Q91Y58 - (Q91Y58) DNA-dependent ATPase SNF2L || Number of peptides = 6 || unambiguous || 50.9% Confident
Q96IJ6 - (Q96IJ6) GDP-mannose pyrophosphorylase A || Number of peptides = 1 || unambiguous || 50.9% Confident
Q96DK1 - (Q96DK1) Hypothetical protein FLJ25287 || Number of peptides = 2 || unambiguous || 50.8% Confident
Q8WUF0 - (Q8WUF0) Nit protein 2 || Number of peptides = 2 || ambiguous || 50.8% Confident
Q8TF24 - (Q8TF24) Hypothetical protein KIAA1978 (Fragment) || Number of peptides = 1 || unambiguous || 50.8% Confident
Q99MR9 - (Q99MR9) Type 1 protein phosphatase targeting subunit RGL/GM || Number of peptides = 4 || unambiguous || 50.7% Confident
PSB4_MOUSE - (P99026) Proteasome subunit beta type 4 precursor (EC 3.4.25.1) (Proteasome beta chain) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome chain 3) || Number of peptides = 4 || unambiguous || 50.7% Confident
CTNS_MOUSE - (P57757) Cystinosin || Number of peptides = 1 || unambiguous || 50.7% Confident
Q9D3S5 - (Q9D3S5) 4933437F05Rik protein || Number of peptides = 2 || unambiguous || 50.7% Confident
ZO2_MOUSE - (Q9Z0U1) Tight junction protein ZO-2 (Zonula occludens 2 protein) (Zona occludens 2 protein) (Tight junction protein 2) || Number of peptides = 4 || unambiguous || 50.7% Confident
Q96DU7 - (Q96DU7) Inositol 1,4,5-trisphosphate 3-kinase C || Number of peptides = 15 || unambiguous || 50.6% Confident
Q9JJ63 - (Q9JJ63) Brain cDNA, clone MNCb-4173 || Number of peptides = 5 || unambiguous || 50.5% Confident
UBL1_MOUSE - (Q9R0P9) Ubiquitin carboxyl-terminal hydrolase isozyme L1 (EC 3.4.19.12) (UCH-L1) (Ubiquitin thiolesterase L1) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5) || Number of peptides = 1 || ambiguous || 50.5% Confident
Q8WXA6 - (Q8WXA6) AF15q14 isoform 2 || Number of peptides = 1 || unambiguous || 50.5% Confident
Q9P2F6 - (Q9P2F6) Hypothetical protein KIAA1391 (Fragment) || Number of peptides = 5 || unambiguous || 50.2% Confident
Q8R3L8 - (Q8R3L8) Hypothetical 16.2 kDa protein || Number of peptides = 2 || unambiguous || 50.2% Confident
Q9D8N8 - (Q9D8N8) 1810054D07Rik protein || Number of peptides = 1 || unambiguous || 50.2% Confident
T10A_HUMAN - (O00220) Tumor necrosis factor receptor superfamily member 10A precursor (Death receptor 4) (TNF-related apoptosis-inducing ligand receptor 1) (TRAIL receptor-1) (TRAIL-R1) || Number of peptides = 2 || unambiguous || 50.1% Confident
Q9H845 - (Q9H845) Hypothetical protein FLJ13950 || Number of peptides = 6 || unambiguous || 50.1% Confident
Q62285 - (Q62285) Uromodulin || Number of peptides = 1 || unambiguous || 50.0% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/data/search/2002-TK-LungDevo/lung_E16_cyto_2
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
UO5498899.6%688.7%12331414855.1(O54988) Serine/threonine protein kinase
*	TK251102_lung_cytoE16_2_step07.3730.3730.3	1.422	0.0622	3866.25	1	1510.0%	1	K.AAQSGEGDEALVPTQTLAEKPTEGPEAGGAEEEPPGGER.V
	TK251102_lung_cytoE16_2_step08.3470.3470.3	1.1845	0.0784	3089.84	82	1330.0%	1	K.GNDTDSGTGSTVENSSGDLNLSISSFLSKAK.D
	TK251102_lung_cytoE16_2_step11.3598.3598.2	3.2149	0.4451	2454.78	1	4000.0%	2	R.WTTSQLLQHPFVTVDSNKPVR.E
	TK251102_lung_cytoE16_2_step12.2591.2591.2	1.6061	0.028	1609.62	6	4090.0%	1	K.DQYFMQRHQLLK.R
*	TK251102_lung_cytoE16_2_step11.4637.4637.3	0.9659	0.2462	4338.18	57	600.0%	1	K.AAQSGEGDEALVPTQTLAEKPTEGPEAGGAEEEPPGGERVEDK.Q
UPSA3_MOUSE99.6%123614.2%254282745.4(O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K)
	TK251102_lung_cytoE16_2_step11.1392.1392.1	1.2939	0.1796	935.13	193	3570.0%	1	K.GRHEIVPK.D
	TK251102_lung_cytoE16_2_step07.2052.2052.2	0.8841	0.0586	1620.2	123	1920.0%	1	K.AFELELSWVGELTK.G
	TK251102_lung_cytoE16_2_step05.3796.3796.1	2.1263	0.4553	1382.86	1	4620.0%	3	R.HVGMAVAGLLADAR.S
	TK251102_lung_cytoE16_2_step02.1746.1746.1	1.2496	0.1061	724.49	7	7000.0%	3	R.HEIVPK.D
UQ9DCH499.6%4611.4%361380005.6(Q9DCH4) 0610037M02Rik protein
	TK251102_lung_cytoE16_2_step07.4428.4428.2	3.7889	0.698	1715.63	1	7140.0%	2	R.LHPVILASIVDSYER.R
	TK251102_lung_cytoE16_2_step06.1729.1729.1	0.9864	0.1139	775.71	12	5000.0%	1	R.RNEGAAR.V
	TK251102_lung_cytoE16_2_step01.5359.5359.2	3.5987	0.6967	2052.02	1	5280.0%	1	R.IQDALSTVLQYAEDVLSGK.V
UNDKB_MOUSE99.6%155941.4%152173637.5(Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18)
	TK251102_lung_cytoE16_2_step01.1495.1495.1	1.4737	0.1696	561.72	1	7500.0%	1	R.LVAMK.F
	TK251102_lung_cytoE16_2_step03.4743.4743.2	3.0829	0.6047	2095.85	1	4720.0%	1	K.YMNSGPVVAMVWEGLNVVK.T
*	TK251102_lung_cytoE16_2_step02.4273.4273.2	2.0338	0.4074	1963.06	1	4640.0%	6	K.EIHLWFKPEELIDYK.S
	TK251102_lung_cytoE16_2_step04.3380.3380.1	2.0419	0.4157	1177.84	1	5560.0%	4	K.DRPFFPGLVK.Y
	TK251102_lung_cytoE16_2_step01.1771.1771.1	2.7548	0.033	1487.82	1	6540.0%	1	R.NIIHGSDSVESAEK.E
UTBBX_HUMAN99.6%102214851.8%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain
	TK251102_lung_cytoE16_2_step01.4806.4806.2	3.333	0.6234	2711.66	1	3750.0%	3	K.LTTPTYGDLNHLVSATMSGVTTCLR.F
	TK251102_lung_cytoE16_2_step07.4690.4690.2	4.7635	0.5741	1961.79	1	7060.0%	13	K.GHYTEGAELVDSVLDVVR.K
	TK251102_lung_cytoE16_2_step01.2426.2426.1	1.1398	0.126	1130.89	69	3890.0%	1	R.FPGQLNADLR.K
	TK251102_lung_cytoE16_2_step08.4633.4633.2	1.5816	0.1751	2028.33	1	2650.0%	2	K.MAVTFIGNSTAIQELFKR.I
	TK251102_lung_cytoE16_2_step01.2618.2618.1	1.2805	0.0219	1320.9	39	3640.0%	1	R.IMNTFSVVPSPK.V
	TK251102_lung_cytoE16_2_step11.5796.5796.2	3.0408	0.5627	1623.29	1	6540.0%	8	R.LHFFMPGFAPLTSR.G
	TK251102_lung_cytoE16_2_step05.3501.3501.2	2.6283	0.409	1273.58	1	7500.0%	3	R.KLAVNMVPFPR.L
	TK251102_lung_cytoE16_2_step01.3834.3834.2	2.4027	0.3152	3105.31	2	2500.0%	3	K.FWEVISDEHGIDPTGTYHGDSDLQLDR.I
	TK251102_lung_cytoE16_2_step01.3771.3771.1	0.9168	0.0615	1230.03	4	4440.0%	1	R.ISEQFTAMFR.R
	TK251102_lung_cytoE16_2_step01.3922.3922.2	1.3096	0.2617	1661.15	2	3210.0%	1	R.ALTVPELTQQVFDAK.N
	TK251102_lung_cytoE16_2_step08.4737.4737.2	4.2123	0.3148	1873.77	1	6880.0%	10	K.MAVTFIGNSTAIQELFK.R
	TK251102_lung_cytoE16_2_step04.2145.2145.2	1.8459	0.054	1824.49	1	3750.0%	4	R.EIVHIQAGQCGNQIGAK.F
	TK251102_lung_cytoE16_2_step07.4418.4418.3	2.7778	0.3084	2803.06	1	2400.0%	9	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK251102_lung_cytoE16_2_step01.0290.0290.1	2.1956	0.08	1446.7	1	6360.0%	1	K.EVDEQMLNVQNK.N
	TK251102_lung_cytoE16_2_step01.3519.3519.2	3.2484	0.5356	1617.51	1	7140.0%	1	R.AILVDLEPGTMDSVR.S
UQ920C799.6%62019.6%281297296.1(Q920C7) CDV-3B (Pp36) (Carnitine deficiency-associated protein CDV3B)
	TK251102_lung_cytoE16_2_step11.2700.2700.3	1.4	0.1747	3243.3	1	1690.0%	2	K.TAPVQAPPAPVTVTETPEPAMPSGVYRPPGAR.L
	TK251102_lung_cytoE16_2_step03.3095.3095.2	3.6747	0.6602	2523.95	1	4320.0%	4	R.KTPQGPPEIYSDTQFPSLQSTAK.H
UGDIC_MOUSE99.6%6818.7%445505376.2(Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3)
*	TK251102_lung_cytoE16_2_step12.2412.2412.2	0.9769	0.0825	3011.94	12	1200.0%	1	K.EIRPALELLEPIEQKFVSISDLFVPK.D
	TK251102_lung_cytoE16_2_step03.4650.4650.2	4.2429	0.6344	2298.3	1	5260.0%	2	K.KFDLGQDVIDFTGHSLALYR.T
	TK251102_lung_cytoE16_2_step07.3071.3071.3	1.487	0.0904	2654.6	35	1630.0%	1	R.LSAIYGGTYMLNKPIEEIIVQNGK.V
	TK251102_lung_cytoE16_2_step12.2413.2413.2	2.0231	0.1916	1387.7	1	5830.0%	1	R.FKLPGQPPASMGR.G
UQ99K8699.6%81212.2%650708586.5(Q99K86) Lutheran blood group (Auberger b antigen included)
	TK251102_lung_cytoE16_2_step10.2418.2418.2	3.0419	0.4996	2155.28	1	4720.0%	2	R.DANFHCAAHYDLPSGQHGR.L
	TK251102_lung_cytoE16_2_step10.2705.2705.3	1.519	0.1096	2130.19	24	2250.0%	1	R.DYVCVVKAGAAGTSEATSSVR.V
	TK251102_lung_cytoE16_2_step09.4383.4383.3	2.0211	0.0479	2932.99	6	1880.0%	1	R.LTLHYPTEHVEFWVGSPSTTEGWVR.E
*	TK251102_lung_cytoE16_2_step12.2077.2077.1	0.5356	0.0304	1397.29	4	1540.0%	1	K.EGGGGWEGAFLQGM.-
UQ9DCC499.6%51116.8%274286947.3(Q9DCC4) 1110058B13Rik protein
	TK251102_lung_cytoE16_2_step10.1611.1611.1	1.1057	0.0282	723.32	40	5000.0%	1	K.HPAQLR.T
	TK251102_lung_cytoE16_2_step08.3509.3509.2	2.5956	0.464	2003.04	1	5280.0%	3	R.TDVLTPAGTTIHGLHALER.G
	TK251102_lung_cytoE16_2_step10.1587.1587.2	1.5518	0.0166	2328.61	2	2750.0%	1	R.VLRVSPNLPCVVQEGAMVMAR.G
UQ9CZ4499.6%81018.6%370407105.1(Q9CZ44) 10, 11 days embryo cDNA, RIKEN full-length enriched library, clone:2810407C17, full insert sequence
	TK251102_lung_cytoE16_2_step05.2325.2325.2	3.2583	0.5509	1693.92	1	6790.0%	1	R.LAHGGQVNLDMEDHR.D
*	TK251102_lung_cytoE16_2_step10.0099.0099.2	0.9789	0.0754	2968.99	43	1460.0%	1	R.DLIHDQDEEEEEEEGQRFYAGGSER.S
	TK251102_lung_cytoE16_2_step03.3414.3414.1	1.153	0.2782	976.36	5	5710.0%	1	R.DEDFVKPK.G
	TK251102_lung_cytoE16_2_step03.1937.1937.1	0.9803	0.0095	1027.48	1	4380.0%	1	R.RGEVPAELR.R
	TK251102_lung_cytoE16_2_step06.4348.4348.2	1.217	0.0463	1849.69	6	3330.0%	1	R.RLAHGGQVNLDMEDHR.D
*	TK251102_lung_cytoE16_2_step07.2236.2236.1	1.9145	0.3874	1220.59	1	5500.0%	2	R.HSGQDVHVVLK.L
UTBA1_HUMAN99.6%165450764.3%451501525.1(P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1)
	TK251102_lung_cytoE16_2_step06.3674.3674.2	2.8463	0.4393	2752.44	1	3910.0%	4	K.AYHEQLSVAEITNACFEPANQMVK.C
	TK251102_lung_cytoE16_2_step04.3427.3427.1	1.0218	0.1032	1413.93	1	4090.0%	6	R.QLFHPEQLITGK.E
	TK251102_lung_cytoE16_2_step08.2710.2710.2	1.6036	0.1705	1876.4	1	3930.0%	1	R.RNLDIERPTYTNLNR.L
	TK251102_lung_cytoE16_2_step07.4495.4495.2	2.3652	0.5245	1760.65	1	4330.0%	53	R.IHFPLATYAPVISAEK.A
	TK251102_lung_cytoE16_2_step08.4794.4794.3	4.8571	0.5175	3393.22	1	2820.0%	3	K.LADQCTGLQGFLVFHSFGGGTGSGFTSLLMER.L
	TK251102_lung_cytoE16_2_step01.4111.4111.2	3.5531	0.3579	1703.18	1	6070.0%	2	R.AVFVDLEPTVIDEVR.T
	TK251102_lung_cytoE16_2_step02.3541.3541.2	1.5033	0.1887	2009.55	3	2630.0%	2	K.TIGGGDDSFNTFFSETGAGK.H
	TK251102_lung_cytoE16_2_step01.1716.1716.1	1.3304	0.1768	1017.94	2	5560.0%	9	K.DVNAAIATIK.T
	TK251102_lung_cytoE16_2_step05.3172.3172.2	1.9667	0.3757	1381.77	1	7000.0%	1	R.LDHKFDLMYAK.R
	TK251102_lung_cytoE16_2_step01.3882.3882.2	1.2207	0.1797	1588.1	1	3750.0%	1	R.SIQFVDWCPTGFK.V
	TK251102_lung_cytoE16_2_step02.4747.4747.2	3.5523	0.5076	1488.51	1	6920.0%	3	R.LISQIVSSITASLR.F
	TK251102_lung_cytoE16_2_step09.4468.4468.2	1.2331	0.0315	2411.78	1	2750.0%	9	R.FDGALNVDLTEFQTNLVPYPR.I
	TK251102_lung_cytoE16_2_step04.4217.4217.3	2.7961	0.478	4302.65	1	1620.0%	11	R.ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDK.T
	TK251102_lung_cytoE16_2_step08.4683.4683.2	1.7996	0.3731	2333.99	1	2890.0%	34	R.AFVHWYVGEGMEEGEFSEAR.E
	TK251102_lung_cytoE16_2_step01.2684.2684.2	2.0055	0.266	1827.49	1	4120.0%	2	K.VGINYQPPTVVPGGDLAK.V
	TK251102_lung_cytoE16_2_step06.1745.1745.1	1.2984	0.1705	777.59	6	5000.0%	2	R.GHYTIGK.E
	TK251102_lung_cytoE16_2_step09.0975.0975.1	0.882	0.211	508.92	2	6670.0%	8	K.HVPR.A
UHBD_HUMAN99.6%104228.1%146159248.0(P02042) Hemoglobin delta chain
*	TK251102_lung_cytoE16_2_step01.2539.2539.1	1.2209	0.2029	1522.73	3	3330.0%	1	K.GTFSQLSELHCDK.L
*	TK251102_lung_cytoE16_2_step03.1842.1842.3	1.0989	0.0583	2044.94	14	1810.0%	1	R.FFESFGDLSSPDAVMGNPK.V
*	TK251102_lung_cytoE16_2_step08.3715.3715.3	2.2329	0.2456	2632.76	1	2380.0%	2	K.GTFSQLSELHCDKLHVDPENFR.L
UQ9P2E699.6%445.6%853970498.0(Q9P2E6) Hypothetical protein KIAA1401 (Fragment)
*	TK251102_lung_cytoE16_2_step01.2884.2884.1	1.1822	0.0122	1468.26	98	2690.0%	1	R.LSWPGSSADSVHAR.C
*	TK251102_lung_cytoE16_2_step01.0439.0439.1	0.8613	0.08	657.43	1	6000.0%	1	K.GRLALK.T
	TK251102_lung_cytoE16_2_step01.3815.3815.1	1.0665	0.021	1584.07	10	4170.0%	1	R.QLANQKQQHLAFR.D
*	TK251102_lung_cytoE16_2_step12.2493.2493.2	3.2607	0.5742	1651.72	1	6070.0%	1	K.DGPPHQVLVVPLHSR.I
UQ922D899.6%246011.3%9351012567.1(Q922D8) Similar to C1-tetrahydrofolate synthase
	TK251102_lung_cytoE16_2_step06.1977.1977.1	1.0246	0.2042	715.59	187	6000.0%	1	R.RLGIEK.T
	TK251102_lung_cytoE16_2_step06.1672.1672.1	1.0417	0.2844	737.77	1	6670.0%	2	R.HAVVVGR.S
	TK251102_lung_cytoE16_2_step11.2632.2632.1	2.0948	0.381	1534.99	1	5670.0%	2	K.MHGGGPTVTAGLPLPK.A
*	TK251102_lung_cytoE16_2_step09.4321.4321.2	1.565	0.3442	1640.34	1	3670.0%	4	K.STTTIGLVQALGAHLR.Q
	TK251102_lung_cytoE16_2_step10.2241.2241.1	2.4107	0.1769	1392.67	1	5910.0%	4	K.THLSLSHNPEQK.G
*	TK251102_lung_cytoE16_2_step04.1929.1929.2	1.6572	0.2502	1203.41	2	6500.0%	1	R.KITIGQSPTEK.G
*	TK251102_lung_cytoE16_2_step04.3315.3315.2	2.739	0.4668	2125.85	1	5790.0%	1	K.CTHWAEGGQGALALAQAVQR.A
	TK251102_lung_cytoE16_2_step04.3373.3373.1	0.9405	0.0075	1182.71	36	3330.0%	1	R.DDSNLYINVK.L
*	TK251102_lung_cytoE16_2_step04.2471.2471.1	1.6371	0.08	1006.57	1	7140.0%	2	R.KFSDIQIR.R
UTAG2_MOUSE99.6%71124.1%212235977.1(Q9WVA4) Transgelin 2
*	TK251102_lung_cytoE16_2_step02.2718.2718.2	1.96	0.3356	1657.84	1	5360.0%	1	K.LINSLYPEGQAPVKK.I
	TK251102_lung_cytoE16_2_step01.3995.3995.1	1.266	0.1679	1596.98	1	4230.0%	2	R.DDGLFSGDPNWFPK.K
	TK251102_lung_cytoE16_2_step07.4420.4420.3	1.9001	0.1419	2765.6	1	2260.0%	1	K.IEKQYDADLEQILIQWITTQCR.E
*	TK251102_lung_cytoE16_2_step01.2067.2067.1	1.0147	0.0722	1529.84	2	3850.0%	1	K.LINSLYPEGQAPVK.K
	TK251102_lung_cytoE16_2_step07.4822.4822.2	3.4629	0.4775	2396.22	1	4720.0%	2	K.QYDADLEQILIQWITTQCR.E
UCD93_MOUSE99.6%464.5%644693555.1(O89103) Complement component C1q receptor precursor (Complement component 1, q subcomponent, receptor 1) (C1qRp) (C1qR(p)) (C1q/MBL/SPA receptor) (CD93 antigen) (Cell surface antigen AA4) (Lymphocyte antigen 68)
*	TK251102_lung_cytoE16_2_step06.3957.3957.2	1.2325	0.121	1978.77	21	2650.0%	1	R.CNENGGNLATVKSEEEAR.H
*	TK251102_lung_cytoE16_2_step07.3480.3480.2	3.3196	0.6004	1280.51	1	8500.0%	2	R.HVQQALTQLLK.T
UGIPC_MOUSE99.6%71115.3%333361295.9(Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1)
	TK251102_lung_cytoE16_2_step11.1956.1956.2	1.6278	0.129	1854.81	13	3330.0%	1	K.AIEKVDDLLESYMGIR.D
*	TK251102_lung_cytoE16_2_step07.4456.4456.2	1.3069	0.1681	1866.0	13	2630.0%	2	R.SAGGHPGSGPQLGTGRGTLR.L
	TK251102_lung_cytoE16_2_step12.2405.2405.2	3.4985	0.5385	1622.82	1	6790.0%	1	R.LVFHTQLAHGSPTGR.I
*	TK251102_lung_cytoE16_2_step08.1658.1658.2	2.3114	0.5542	1436.28	1	5670.0%	2	R.SAGGHPGSGPQLGTGR.G
UDEST_MOUSE99.6%207840.6%165185228.0(Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF)
*	TK251102_lung_cytoE16_2_step07.4786.4786.2	4.3072	0.6358	2079.8	1	6250.0%	7	R.KEELMFFLWAPEQAPLK.S
	TK251102_lung_cytoE16_2_step02.3175.3175.2	1.0786	0.0254	1253.16	4	5000.0%	1	K.AVIFCLSADKK.C
	TK251102_lung_cytoE16_2_step03.2851.2851.1	1.5127	0.0676	1059.38	4	6250.0%	2	K.HFVGMLPEK.D
*	TK251102_lung_cytoE16_2_step09.2480.2480.1	1.2246	0.0345	691.61	4	7000.0%	4	K.KFPGIK.H
	TK251102_lung_cytoE16_2_step10.2985.2985.2	2.8506	0.3626	1491.07	1	8180.0%	2	K.HFVGMLPEKDCR.Y
*	TK251102_lung_cytoE16_2_step07.1912.1912.1	0.8221	0.0381	1062.64	69	4380.0%	1	K.KCIVVEEGK.E
*	TK251102_lung_cytoE16_2_step01.1498.1498.1	1.7982	0.3054	1543.67	1	5420.0%	1	K.HEYQANGPEDLNR.T
URBB7_MOUSE99.6%92525.6%425477905.0(Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7)
	TK251102_lung_cytoE16_2_step08.4539.4539.3	1.6925	0.268	4112.33	1	1350.0%	2	R.SNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADK.T
	TK251102_lung_cytoE16_2_step12.3392.3392.3	3.9548	0.4874	3620.45	1	2670.0%	1	K.LHTFESHKDEIFQVHWSPHNETILASSGTDR.R
	TK251102_lung_cytoE16_2_step10.4338.4338.2	3.1245	0.3068	2776.34	1	3260.0%	2	K.DYALHWLVLGTHTSDEQNHLVVAR.V
	TK251102_lung_cytoE16_2_step09.1748.1748.2	2.568	0.414	1793.74	1	4000.0%	4	K.HPAKPDPSGECNPDLR.L
UQ99LJ399.6%142429.0%400459185.0(Q99LJ3) Hypothetical 45.9 kDa protein (Fragment)
	TK251102_lung_cytoE16_2_step08.3121.3121.2	3.3829	0.4937	2292.59	1	5000.0%	1	R.ASFNHFDRDHSGTLGPEEFK.A
	TK251102_lung_cytoE16_2_step03.1962.1962.1	1.2996	0.0019	948.5	83	5710.0%	1	K.SIVNYKPK.I
	TK251102_lung_cytoE16_2_step04.3899.3899.2	1.8023	0.3701	1982.12	1	5310.0%	3	R.ISIEMHGTLEDQLSHLR.Q
	TK251102_lung_cytoE16_2_step04.1504.1504.2	2.7464	0.3081	1327.34	1	8000.0%	1	R.RDQALTEEHAR.Q
	TK251102_lung_cytoE16_2_step03.3179.3179.1	2.0426	0.413	1294.52	1	5000.0%	2	R.LAILGIHNEVSK.I
	TK251102_lung_cytoE16_2_step11.5084.5084.3	4.1688	0.578	4363.79	1	1890.0%	1	R.AAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFK.A
*	TK251102_lung_cytoE16_2_step09.2231.2231.2	1.859	0.1763	1317.57	3	6670.0%	1	K.HTNYNMEHIR.V
UMCM7_MOUSE99.6%196323.5%719812116.4(Q61881) DNA replication licensing factor MCM7 (CDC47 homolog)
*	TK251102_lung_cytoE16_2_step11.2289.2289.2	3.0052	0.4182	1296.11	1	7500.0%	1	K.YGTQLVHLAHR.E
*	TK251102_lung_cytoE16_2_step06.1548.1548.1	1.0226	0.0236	1186.7	1	4500.0%	1	R.GPSSSKPRVIR.E
	TK251102_lung_cytoE16_2_step12.1573.1573.1	1.8006	0.3833	1591.86	1	5000.0%	2	R.LAQHITYVHQHSR.Q
*	TK251102_lung_cytoE16_2_step04.3640.3640.2	2.4365	0.4061	1489.85	1	6670.0%	1	R.TQRPADVIFATIR.E
	TK251102_lung_cytoE16_2_step02.3445.3445.2	1.0839	0.1544	1894.14	1	3440.0%	1	R.CSILAAANPAYGRYNPR.R
*	TK251102_lung_cytoE16_2_step08.2514.2514.3	0.7332	0.0346	4654.12	103	370.0%	1	R.IAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHWIVK.M
	TK251102_lung_cytoE16_2_step11.5362.5362.3	1.1506	0.0531	4616.78	2	1250.0%	1	R.MVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNR.S
*	TK251102_lung_cytoE16_2_step04.4419.4419.2	2.9471	0.5329	2022.72	1	4440.0%	7	R.IAQPGDHVSVTGIFLPVLR.T
*	TK251102_lung_cytoE16_2_step01.1252.1252.1	1.0903	0.0216	603.59	1	8750.0%	1	K.LLTVR.G
*	TK251102_lung_cytoE16_2_step05.4744.4744.2	3.1034	0.5261	1842.28	1	5290.0%	1	K.ALLLLLVGGVDQSPQGMK.I
UQ921G599.6%4421.6%268305787.1(Q921G5) Similar to methyltransferase-like 1 (S. cerevisiae)
	TK251102_lung_cytoE16_2_step01.4756.4756.1	1.0064	0.1853	850.5	11	4170.0%	1	K.NFPAVFR.R
	TK251102_lung_cytoE16_2_step10.2187.2187.2	2.3681	0.6003	1350.48	1	6360.0%	1	R.AHSNPMADHTLR.Y
	TK251102_lung_cytoE16_2_step10.4350.4350.3	1.2071	0.0811	4127.33	1	1250.0%	1	K.HSGAQVEFADIGCGYGGLLVALSPLFPDTLILGLEIRVK.V
UPYR1_HUMAN99.6%9174.0%22252429146.4(P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)]
*	TK251102_lung_cytoE16_2_step10.3641.3641.2	3.1775	0.3612	1670.19	1	6540.0%	2	K.DQMSHLFNVAHTLR.M
*	TK251102_lung_cytoE16_2_step03.4858.4858.3	0.9319	0.0558	2669.18	12	1200.0%	1	R.MAEIGEHVAPSEAGNSLEQAQAAAER.L
*	TK251102_lung_cytoE16_2_step05.2444.2444.1	0.7626	0.0748	765.44	44	5000.0%	1	R.FHLPPR.I
*	TK251102_lung_cytoE16_2_step07.4431.4431.2	2.274	0.2862	2447.36	1	2950.0%	3	K.AIVHAVGQELQVTGPFNLQLIAK.D
*	TK251102_lung_cytoE16_2_step01.3892.3892.1	1.139	0.0533	1471.59	93	2690.0%	1	R.ASDPGLPAEEPKEK.S
*	TK251102_lung_cytoE16_2_step12.1059.1059.1	1.319	0.1201	773.5	1	8000.0%	1	R.LHHNPR.R
URL3_MOUSE99.6%206221.6%4024599310.2(P27659) 60S ribosomal protein L3 (J1 protein)
*	TK251102_lung_cytoE16_2_step04.3487.3487.2	1.0994	0.2042	1764.34	21	2670.0%	4	K.DDASKPVHLTAFLGYK.A
	TK251102_lung_cytoE16_2_step06.1989.1989.1	1.3274	0.2659	884.62	7	5000.0%	2	K.AGMTHIVR.E
	TK251102_lung_cytoE16_2_step01.2331.2331.1	0.9151	0.1223	763.49	5	5000.0%	1	K.AFMGPLK.K
*	TK251102_lung_cytoE16_2_step04.4655.4655.2	1.6846	0.2879	2451.71	1	3570.0%	1	K.SINPLGGFVHYGEVTNDFIMLK.G
	TK251102_lung_cytoE16_2_step10.3249.3249.2	2.5858	0.5362	985.07	1	8750.0%	2	R.HGSLGFLPR.K
	TK251102_lung_cytoE16_2_step09.2969.2969.2	3.3657	0.4627	1827.57	1	6560.0%	5	K.KAHLMEIQVNGGTVAEK.L
*	TK251102_lung_cytoE16_2_step07.1831.1831.2	1.9611	0.459	969.84	1	8570.0%	1	R.IIAHTQMR.L
UAAC1_HUMAN99.6%17534.5%8921029745.4(P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein)
	TK251102_lung_cytoE16_2_step04.1701.1701.2	2.5277	0.2724	1414.44	1	6360.0%	1	R.VPENTMHAMQQK.L
	TK251102_lung_cytoE16_2_step12.1173.1173.1	1.3997	0.4063	721.5	1	7000.0%	3	R.LHKPPK.V
	TK251102_lung_cytoE16_2_step05.3755.3755.2	3.2965	0.5776	1502.17	1	7730.0%	5	K.NVNIQNFHISWK.D
	TK251102_lung_cytoE16_2_step10.2709.2709.1	1.3777	0.2814	1229.73	11	3330.0%	1	R.HRPELIDYGK.L
US3B1_MOUSE99.6%9137.1%13041458167.1(Q99NB9) Splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit)
	TK251102_lung_cytoE16_2_step05.4097.4097.2	1.5447	0.0721	1918.05	8	2780.0%	1	R.AFAVVASALGIPSLLPFLK.A
	TK251102_lung_cytoE16_2_step11.4477.4477.2	1.2395	0.0101	1987.02	104	2860.0%	1	K.TEILPPFFKHFWQHR.M
	TK251102_lung_cytoE16_2_step10.2907.2907.2	1.5578	0.1696	2010.96	1	3530.0%	2	K.KLSSWDQAETPGHTPSLR.W
	TK251102_lung_cytoE16_2_step12.2037.2037.1	1.0916	0.1189	911.1	9	5000.0%	1	K.HFWQHR.M
	TK251102_lung_cytoE16_2_step08.1427.1427.2	2.0687	0.4091	1734.76	1	5560.0%	2	R.GDTPGHATPGHGGATSSAR.K
	TK251102_lung_cytoE16_2_step09.1433.1433.1	0.9908	0.0072	687.64	21	5000.0%	1	K.MTPPIK.D
	TK251102_lung_cytoE16_2_step01.2710.2710.1	0.8535	0.0306	1533.26	3	3330.0%	1	R.GGDSIGETPTPGASKR.K
UROA2_MOUSE99.6%4825041.9%341359938.6(O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1)
	TK251102_lung_cytoE16_2_step08.1810.1810.2	2.3827	0.4685	1413.67	1	6820.0%	7	K.YHTINGHNAEVR.K
	TK251102_lung_cytoE16_2_step05.3719.3719.3	1.9606	0.2363	2435.41	14	1920.0%	1	R.NMGGPYGGGNYGPGGSGGSGGYGGRSR.Y
	TK251102_lung_cytoE16_2_step08.4263.4263.2	1.9371	0.2833	1930.78	1	3750.0%	9	R.KLFIGGLSFETTEESLR.N
	TK251102_lung_cytoE16_2_step03.4218.4218.2	2.1332	0.3427	1800.38	1	5000.0%	1	K.LFIGGLSFETTEESLR.N
	TK251102_lung_cytoE16_2_step01.2466.2466.1	1.7771	0.0721	735.14	5	6670.0%	1	K.LFVGGIK.E
	TK251102_lung_cytoE16_2_step03.1139.1139.1	0.7138	0.1573	783.17	16	2140.0%	1	K.SGNFGGSR.N
	TK251102_lung_cytoE16_2_step12.0143.0143.3	1.1543	0.0867	2276.09	115	1180.0%	1	R.GFGFVTFDDHDPVDKIVLQK.Y
	TK251102_lung_cytoE16_2_step01.0638.0638.1	0.6415	0.0178	421.43	14	6670.0%	1	R.QSGK.K
	TK251102_lung_cytoE16_2_step09.2836.2836.1	1.7961	0.181	863.64	1	6430.0%	5	K.KLFVGGIK.E
	TK251102_lung_cytoE16_2_step09.3195.3195.2	2.7382	0.4795	1880.74	1	5000.0%	4	K.LFVGGIKEDTEEHHLR.D
	TK251102_lung_cytoE16_2_step02.2109.2109.2	2.1563	0.443	1378.99	1	4640.0%	1	R.GGGGNFGPGPGSNFR.G
	TK251102_lung_cytoE16_2_step01.3064.3064.1	1.178	0.1865	1190.76	8	3890.0%	2	K.IDTIEIITDR.Q
	TK251102_lung_cytoE16_2_step04.1545.1545.1	1.7297	0.23	1341.62	1	4580.0%	4	R.EESGKPGAHVTVK.K
UPRO1_MOUSE99.6%2110362.6%139148268.3(P10924) Profilin I
	TK251102_lung_cytoE16_2_step01.2084.2084.1	2.3568	0.4094	1216.18	1	5000.0%	1	K.DSPSVWAAVPGK.T
*	TK251102_lung_cytoE16_2_step01.3718.3718.1	2.2527	0.488	1458.04	1	5000.0%	2	R.SSFFVNGLTLGGQK.C
*	TK251102_lung_cytoE16_2_step01.4116.4116.2	2.0902	0.3158	1617.79	1	5000.0%	1	K.TFVSITPAEVGVLVGK.D
*	TK251102_lung_cytoE16_2_step02.3218.3218.2	1.4512	0.1135	1686.44	1	3750.0%	2	K.STGGAPTFNVTVTMTAK.T
	TK251102_lung_cytoE16_2_step09.2108.2108.2	1.3081	0.1543	1153.23	2	6500.0%	2	K.EGVHGGLINKK.C
	TK251102_lung_cytoE16_2_step02.3493.3493.1	1.9672	0.1355	876.73	1	6430.0%	9	K.TLVLLMGK.E
	TK251102_lung_cytoE16_2_step02.2001.2001.1	1.8744	0.0337	1025.61	10	5560.0%	2	K.EGVHGGLINK.K
	TK251102_lung_cytoE16_2_step02.2242.2242.1	1.2897	0.1954	1169.38	1	5000.0%	2	K.CYEMASHLR.R
URNT1_MOUSE99.6%8109.5%11131226576.7(Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog)
	TK251102_lung_cytoE16_2_step04.1283.1283.3	1.2427	0.0508	1818.36	5	2330.0%	1	K.TFAVDETSVSGYIYHK.L
	TK251102_lung_cytoE16_2_step08.2109.2109.1	1.2042	0.0063	723.66	14	5000.0%	1	K.GIGHVIK.V
	TK251102_lung_cytoE16_2_step11.4312.4312.3	0.9086	0.0133	3201.96	94	740.0%	1	K.DGPLGETVLECYNCGCRNVFLLGFIPAK.A
	TK251102_lung_cytoE16_2_step01.3784.3784.3	1.4461	0.0234	1913.0	16	1910.0%	1	K.AGAKPDQIGIITPYEGQR.S
	TK251102_lung_cytoE16_2_step11.1873.1873.2	2.919	0.5497	1492.32	1	6920.0%	1	R.GNTSGSHIVNHLVR.A
	TK251102_lung_cytoE16_2_step06.3432.3432.3	1.555	0.0205	2675.93	95	1820.0%	2	K.DFIILSCVRANEHQGIGFLNDPR.R
UPSB3_MOUSE99.6%73716.1%205229656.5(Q9R1P1) Proteasome subunit beta type 3 (EC 3.4.25.1) (Proteasome theta chain) (Proteasome chain 13) (Proteasome component C10-II)
*	TK251102_lung_cytoE16_2_step05.3955.3955.2	3.7016	0.5475	1555.76	1	7860.0%	6	R.DAVSGMGVIVHVIEK.D
	TK251102_lung_cytoE16_2_step02.3275.3275.3	1.6231	0.0358	2141.63	23	2500.0%	1	R.QIKPYTLMSMVANLLYEK.R
UQ9CZY599.6%115.3%285306555.6(Q9CZY5) 2610312E17Rik protein
	TK251102_lung_cytoE16_2_step10.1777.1777.2	3.8034	0.5492	1534.46	1	7860.0%	1	R.AHAGQVTCVAASPHK.D
UK2C1_HUMAN99.6%101626.9%643658868.1(P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein)
*	TK251102_lung_cytoE16_2_step01.2144.2144.3	1.1536	0.0908	2623.35	1	1430.0%	1	R.FSSCGGGGGSFGAGGGFGSRSLVNLGGSK.S
*	TK251102_lung_cytoE16_2_step05.4716.4716.2	3.2545	0.5416	1995.11	1	6000.0%	3	R.THNLEPYFESFINNLR.R
*	TK251102_lung_cytoE16_2_step01.3288.3288.1	1.8536	0.2478	1386.73	3	4550.0%	1	K.SLNNQFASFIDK.V
*	TK251102_lung_cytoE16_2_step11.3941.3941.2	1.2275	0.1916	2329.15	28	2000.0%	1	K.QISNLQQSISDAEQRGENALK.D
*	TK251102_lung_cytoE16_2_step08.1997.1997.1	1.0402	0.02	624.67	3	7500.0%	1	R.QFSSR.S
*	TK251102_lung_cytoE16_2_step01.1532.1532.1	1.8081	0.2328	1340.81	1	5910.0%	1	K.SKAEAESLYQSK.Y
*	TK251102_lung_cytoE16_2_step09.4263.4263.3	1.8301	0.2792	3314.21	6	1380.0%	1	R.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G
*	TK251102_lung_cytoE16_2_step05.4863.4863.3	5.0934	0.7009	4529.37	1	2630.0%	1	K.LDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNR.S
UQ6218999.6%119.8%287318359.8(Q62189) Small nuclear RNA (Small nuclear ribonucleoprotein polypeptide A)
*	TK251102_lung_cytoE16_2_step03.3193.3193.2	4.0464	0.5821	2652.12	1	3520.0%	1	K.AVQGGAAAPVVGAVQPVPGMPPMPQAPR.I
UNIDO_MOUSE99.6%685.3%12451366235.5(P10493) Nidogen precursor (Entactin)
*	TK251102_lung_cytoE16_2_step11.3438.3438.2	0.8201	0.1214	2241.37	16	1670.0%	1	R.DYATGFCCRCVANYTGNGR.Q
	TK251102_lung_cytoE16_2_step04.1753.1753.1	1.2965	0.05	1132.69	6	5560.0%	1	R.QCVAEGSPQR.V
*	TK251102_lung_cytoE16_2_step05.3884.3884.2	2.6145	0.3716	2145.05	1	3750.0%	2	K.SSNAGHQGVWVFEIGSPATAK.G
*	TK251102_lung_cytoE16_2_step01.3371.3371.1	1.302	0.1555	1534.92	14	3640.0%	1	R.ACRDVDECQHSR.C
	TK251102_lung_cytoE16_2_step04.5285.5285.1	0.269	0.0044	415.05	3	5000.0%	1	R.VNGK.V
UQ99K8899.6%179319.5%365381477.7(Q99K88) Hypothetical 38.1 kDa protein
	TK251102_lung_cytoE16_2_step07.4276.4276.2	2.0414	0.2852	1310.81	1	6000.0%	9	R.ILVTLLHTLER.V
	TK251102_lung_cytoE16_2_step03.1770.1770.1	1.5099	0.1757	1045.62	1	3890.0%	1	R.HGSNLEAMGK.L
	TK251102_lung_cytoE16_2_step08.1987.1987.1	0.9657	0.0178	803.65	8	7000.0%	1	K.KWQVSR.E
	TK251102_lung_cytoE16_2_step02.3165.3165.2	2.7979	0.5544	1936.06	1	3950.0%	2	K.VNIDGGAIALGHPLGASGCR.I
	TK251102_lung_cytoE16_2_step09.3544.3544.2	3.3614	0.4755	1755.98	1	5330.0%	2	K.AGHFDKEIVPVLVSSR.K
	TK251102_lung_cytoE16_2_step12.1625.1625.1	1.5412	0.1686	944.46	4	6430.0%	1	K.APHLTHLR.T
UHS7C_MOUSE99.6%2131033936.7%646708715.5(P08109) Heat shock cognate 71 kDa protein
	TK251102_lung_cytoE16_2_step04.2808.2808.2	3.8286	0.5229	1485.65	1	6540.0%	14	K.SQIHDIVLVGGSTR.I
	TK251102_lung_cytoE16_2_step06.3456.3456.2	2.9695	0.4221	1238.94	1	8890.0%	7	R.MVNHFIAEFK.R
	TK251102_lung_cytoE16_2_step01.3388.3388.1	1.8349	0.2298	1256.01	5	4440.0%	2	R.FEELNADLFR.G
	TK251102_lung_cytoE16_2_step09.3939.3939.2	2.1377	0.4081	1657.08	1	5770.0%	7	K.HWPFMVVNDAGRPK.V
	TK251102_lung_cytoE16_2_step01.0227.0227.1	1.2465	0.1196	944.6	2	5710.0%	1	K.VCNPIITK.L
	TK251102_lung_cytoE16_2_step07.5032.5032.2	2.1558	0.4074	3002.14	1	2880.0%	32	R.TLSSSTQASIEIDSLYEGIDFYTSITR.A
	TK251102_lung_cytoE16_2_step01.0842.0842.1	1.3142	0.0241	488.36	3	8330.0%	1	K.ILDK.C
	TK251102_lung_cytoE16_2_step01.1712.1712.2	3.3382	0.5206	1693.1	1	5330.0%	1	K.STAGDTHLGGEDFDNR.M
	TK251102_lung_cytoE16_2_step03.4851.4851.2	4.5573	0.5331	2518.76	1	4350.0%	91	R.GVPQIEVTFDIDANGILNVSAVDK.S
	TK251102_lung_cytoE16_2_step01.3051.3051.2	2.149	0.3775	1790.2	1	4690.0%	1	R.IINEPTAAAIAYGLDKK.V
	TK251102_lung_cytoE16_2_step05.3623.3623.2	3.9711	0.1802	2266.93	1	4290.0%	17	K.GPAVGIDLGTTYSCVGVFQHGK.V
	TK251102_lung_cytoE16_2_step01.3164.3164.2	3.6826	0.5991	1662.39	1	7000.0%	1	R.IINEPTAAAIAYGLDK.K
	TK251102_lung_cytoE16_2_step01.2822.2822.1	1.3265	0.3013	1306.01	5	4500.0%	3	K.NSLESYAFNMK.A
	TK251102_lung_cytoE16_2_step01.1998.1998.1	2.4811	0.3547	1412.96	1	6360.0%	2	R.RFDDAVVQSDMK.H
	TK251102_lung_cytoE16_2_step01.2910.2910.1	1.7697	0.4555	1202.12	1	5000.0%	1	K.DAGTIAGLNVLR.I
	TK251102_lung_cytoE16_2_step01.2970.2970.2	2.3712	0.267	1984.75	3	3240.0%	1	K.TVTNAVVTVPAYFNDSQR.Q
	TK251102_lung_cytoE16_2_step01.3508.3508.1	1.5582	0.104	1084.56	1	6880.0%	1	K.LLQDFFNGK.E
	TK251102_lung_cytoE16_2_step01.0312.0312.1	1.8372	0.2201	993.58	1	6250.0%	1	K.EIAEAYLGK.T
UQ8VCM799.6%393.4%436493915.9(Q8VCM7) Similar to fibrinogen, gamma polypeptide
	TK251102_lung_cytoE16_2_step09.2228.2228.2	3.2423	0.6083	1569.67	1	5360.0%	3	R.LSIGEGQQHHMGGSK.Q
URBB9_MOUSE99.6%398.6%186209126.0(O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein)
*	TK251102_lung_cytoE16_2_step10.3942.3942.2	4.3308	0.6226	1887.08	1	6000.0%	3	R.GHFQNTEFHELISVVK.S
UHS47_MOUSE99.6%101825.9%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6)
	TK251102_lung_cytoE16_2_step04.4567.4567.2	1.5679	0.201	1638.38	5	3750.0%	2	K.LFYADHPFIFLVR.D
*	TK251102_lung_cytoE16_2_step03.4813.4813.2	3.431	0.4587	2580.89	1	3800.0%	3	K.DQAVENILLSPLVVASSLGLVSLGGK.A
*	TK251102_lung_cytoE16_2_step01.1172.1172.3	1.2862	0.013	1701.0	129	2030.0%	1	K.KPLEAAAPGTAEKLSSK.A
*	TK251102_lung_cytoE16_2_step12.1152.1152.2	0.8875	0.1457	1990.2	19	1760.0%	1	K.RSALQSINEWASQTTDGK.L
*	TK251102_lung_cytoE16_2_step01.3842.3842.2	1.7967	0.186	2504.79	1	2500.0%	1	R.SALQSINEWASQTTDGKLPEVTK.D
	TK251102_lung_cytoE16_2_step12.3919.3919.2	3.5623	0.3844	1985.01	1	6560.0%	1	K.LSSLIILMPHHVEPLER.L
*	TK251102_lung_cytoE16_2_step03.3110.3110.2	0.9564	0.0892	1296.5	4	4000.0%	1	K.LQMVEMPLAHK.L
UMKK2_MOUSE99.6%114.4%385439528.7(P49138) MAP kinase-activated protein kinase 2 (EC 2.7.1.-) (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAPK-2) (Fragment)
	TK251102_lung_cytoE16_2_step11.4117.4117.2	3.16	0.5883	1924.45	1	5620.0%	1	K.SIGEAIQYLHSINIAHR.D
URS3A_MOUSE99.6%206226.2%263297549.7(P97351) 40S ribosomal protein S3a
	TK251102_lung_cytoE16_2_step04.1393.1393.2	2.5594	0.4668	1220.46	1	7780.0%	4	K.TSYAQHQQVR.Q
	TK251102_lung_cytoE16_2_step06.2138.2138.1	1.0556	0.1941	921.63	2	6430.0%	2	K.KVVDPFSK.K
	TK251102_lung_cytoE16_2_step03.3086.3086.2	3.5491	0.4118	1580.39	1	7920.0%	1	K.NCLTNFHGMDLTR.D
	TK251102_lung_cytoE16_2_step01.1884.1884.1	1.5479	0.376	1304.51	3	4170.0%	2	K.LMELHGEGGSSGK.A
	TK251102_lung_cytoE16_2_step06.3862.3862.2	1.2779	0.2188	2190.81	74	2350.0%	1	K.DIEKACQSIYPLHDVFVR.K
	TK251102_lung_cytoE16_2_step03.3593.3593.2	1.4063	0.2052	1708.9	1	3460.0%	3	K.ACQSIYPLHDVFVR.K
	TK251102_lung_cytoE16_2_step10.1723.1723.2	2.2676	0.3978	1346.52	1	6500.0%	1	R.KTSYAQHQQVR.Q
	TK251102_lung_cytoE16_2_step05.2087.2087.1	1.4005	0.0812	800.53	3	7000.0%	1	K.RNNQIR.K
UELV1_MOUSE99.6%82212.9%326360699.2(P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG)
	TK251102_lung_cytoE16_2_step07.3668.3668.2	1.2245	0.1323	1784.32	1	3750.0%	2	K.VAGHSLGYGFVNYVTAK.D
	TK251102_lung_cytoE16_2_step12.1455.1455.2	2.3353	0.3452	1234.28	1	7500.0%	1	R.FGGPVHHQAQR.F
*	TK251102_lung_cytoE16_2_step06.3781.3781.2	3.0597	0.4473	1602.91	1	7690.0%	4	K.NMALLSQLYHSPAR.R
UQ8VCI599.6%117.0%299327334.3(Q8VCI5) Peroxisomal farnesylated protein
*	TK251102_lung_cytoE16_2_step11.1361.1361.2	3.7598	0.5546	2088.33	1	5000.0%	1	K.AKPSPEHAPTISAPDASGPQK.R
UTCPB_MOUSE99.6%152713.5%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta)
	TK251102_lung_cytoE16_2_step03.4193.4193.1	1.6719	0.1325	1556.6	1	3850.0%	3	R.SLHDALCVLAQTVK.D
	TK251102_lung_cytoE16_2_step05.2539.2539.2	3.2479	0.6174	1539.08	1	7500.0%	2	R.AAHSEGHITAGLDMK.E
	TK251102_lung_cytoE16_2_step03.3811.3811.2	2.1508	0.2854	2368.55	1	3330.0%	1	R.TVYGGGCSEMLMAHAVTQLANR.T
	TK251102_lung_cytoE16_2_step12.2900.2900.1	2.0448	0.3236	1436.65	1	5000.0%	1	K.KIHPQTIISGWR.E
	TK251102_lung_cytoE16_2_step08.2666.2666.2	2.5228	0.4557	1131.71	1	8750.0%	1	K.HGINCFINR.Q
	TK251102_lung_cytoE16_2_step11.3010.3010.1	1.6355	0.1111	1310.04	1	5500.0%	1	K.IHPQTIISGWR.E
UUNRI_MOUSE99.6%466.8%351385135.1(Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein)
	TK251102_lung_cytoE16_2_step12.1943.1943.1	2.0874	0.5039	1181.64	1	5560.0%	2	K.GHFGPIHCVR.F
*	TK251102_lung_cytoE16_2_step05.3483.3483.2	1.2348	0.0765	1500.09	1	5000.0%	1	R.SIAFHSAVSLEPIK.S
UGR78_MOUSE99.6%234127.6%655724225.2(P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP)
	TK251102_lung_cytoE16_2_step04.2528.2528.2	2.1654	0.1629	1606.27	1	6430.0%	1	K.TKPYIQVDIGGGQTK.T
	TK251102_lung_cytoE16_2_step01.1014.1014.1	0.8335	0.0567	498.57	3	8330.0%	2	K.LIPR.N
	TK251102_lung_cytoE16_2_step10.3297.3297.2	1.5716	0.2278	2018.86	1	3820.0%	3	K.KVTHAVVTVPAYFNDAQR.Q
	TK251102_lung_cytoE16_2_step08.5005.5005.2	1.8036	0.4827	2001.33	1	3820.0%	2	R.GVPQIEVTFEIDVNGILR.V
*	TK251102_lung_cytoE16_2_step07.4546.4546.2	3.072	0.4733	2153.22	1	5000.0%	1	R.IEIESFFEGEDFSETLTR.A
	TK251102_lung_cytoE16_2_step01.4010.4010.1	1.4468	0.143	1538.96	2	3850.0%	1	K.TFAPEEISAMVLTK.M
	TK251102_lung_cytoE16_2_step01.3134.3134.1	2.4086	0.1762	1400.08	1	6360.0%	2	K.ELEEIVQPIISK.L
	TK251102_lung_cytoE16_2_step03.3081.3081.2	3.5072	0.5692	1890.07	1	5940.0%	2	K.VTHAVVTVPAYFNDAQR.Q
	TK251102_lung_cytoE16_2_step01.1548.1548.1	1.5637	0.1743	1191.85	3	5560.0%	1	K.VYEGERPLTK.D
	TK251102_lung_cytoE16_2_step05.1373.1373.1	1.3423	0.1652	998.48	44	3750.0%	2	R.ALSSQHQAR.I
	TK251102_lung_cytoE16_2_step03.2263.2263.3	1.4553	0.0428	2444.94	7	2050.0%	1	K.KEDVGTVVGIDLGTTYSCVGVFK.N
	TK251102_lung_cytoE16_2_step04.2487.2487.1	1.2869	0.0732	903.46	3	5830.0%	1	R.VMEHFIK.L
	TK251102_lung_cytoE16_2_step03.1374.1374.1	1.2955	0.1116	920.63	3	5710.0%	2	R.STMKPVQK.V
	TK251102_lung_cytoE16_2_step01.5919.5919.2	0.8409	0.1489	2780.18	21	1670.0%	1	R.VEIIANDQGNRITPSYVAFTPEGER.L
UTCTP_MOUSE99.6%188221.5%172194624.9(P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein)
*	TK251102_lung_cytoE16_2_step05.1257.1257.2	1.9974	0.1905	1215.24	3	6670.0%	5	K.GKLEEQKPER.V
*	TK251102_lung_cytoE16_2_step01.3814.3814.2	3.8857	0.5495	1696.51	1	6150.0%	1	R.DLISHDELFSDIYK.I
	TK251102_lung_cytoE16_2_step05.2787.2787.2	2.3089	0.2509	1422.66	1	6250.0%	2	R.VKPFMTGAAEQIK.H
UEF2_MOUSE99.6%9240048.1%857951836.8(P58252) Elongation factor 2 (EF-2)
	TK251102_lung_cytoE16_2_step01.4106.4106.1	1.1802	0.1608	1309.06	33	3180.0%	1	K.DSVVAGFQWATK.E
	TK251102_lung_cytoE16_2_step01.1964.1964.1	1.4524	0.2602	1139.86	1	5000.0%	1	K.YEWDVAEAR.K
	TK251102_lung_cytoE16_2_step09.2676.2676.2	3.6796	0.5984	1616.55	1	6540.0%	4	K.TGTITTFEHAHNMR.V
	TK251102_lung_cytoE16_2_step06.2402.2402.1	2.4418	0.4836	1310.51	1	5910.0%	8	R.NMSVIAHVDHGK.S
	TK251102_lung_cytoE16_2_step01.0311.0311.1	1.502	0.0177	1063.66	4	6250.0%	1	K.GVQYLNEIK.D
	TK251102_lung_cytoE16_2_step09.3003.3003.2	1.3372	0.2265	1077.3	3	6250.0%	3	R.IKPVLMMNK.M
	TK251102_lung_cytoE16_2_step11.3161.3161.2	2.9488	0.4971	2118.82	1	5280.0%	1	K.RGHVFEESQVAGTPMFVVK.A
	TK251102_lung_cytoE16_2_step03.4281.4281.2	3.568	0.5547	2235.78	1	4470.0%	1	R.KIWCFGPDGTGPNILTDITK.G
	TK251102_lung_cytoE16_2_step07.1922.1922.1	1.3488	0.0535	881.6	35	5000.0%	2	K.KVEDMMK.K
	TK251102_lung_cytoE16_2_step02.1823.1823.1	1.3695	0.1537	1052.45	2	5000.0%	1	K.KSDPVVSYR.E
	TK251102_lung_cytoE16_2_step12.0252.0252.1	0.2994	0.0076	445.92	4	1670.0%	4	K.SPNK.H
*	TK251102_lung_cytoE16_2_step01.2399.2399.1	1.3799	0.1992	1093.87	2	5500.0%	1	R.VFSGVVSTGLK.V
	TK251102_lung_cytoE16_2_step03.3497.3497.2	4.0674	0.5531	1962.38	1	7350.0%	1	R.GHVFEESQVAGTPMFVVK.A
	TK251102_lung_cytoE16_2_step10.1313.1313.1	0.6499	0.0013	513.93	4	5000.0%	5	K.KLPR.T
	TK251102_lung_cytoE16_2_step12.1692.1692.3	1.1896	0.0851	4780.7	2	1110.0%	2	R.IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLK.Q
	TK251102_lung_cytoE16_2_step04.4743.4743.2	4.4468	0.5697	2604.95	1	4350.0%	8	R.WLPAGDALLQMITIHLPSPVTAQK.Y
	TK251102_lung_cytoE16_2_step04.2967.2967.2	1.4239	0.0413	1506.39	1	5420.0%	1	K.QFAEMYVAKFAAK.G
	TK251102_lung_cytoE16_2_step05.4456.4456.3	1.4291	0.058	2107.57	38	2360.0%	1	K.IWCFGPDGTGPNILTDITK.G
	TK251102_lung_cytoE16_2_step09.5108.5108.3	1.393	0.2509	3352.55	1	1810.0%	1	K.SDPMVQCIIEESGEHIIAGAGELHLEICLK.D
	TK251102_lung_cytoE16_2_step10.3165.3165.3	1.2942	0.011	3150.02	4	1670.0%	1	K.IWCFGPDGTGPNILTDITKGVQYLNEIK.D
	TK251102_lung_cytoE16_2_step02.1909.1909.1	1.1263	0.0408	786.55	2	5830.0%	1	K.EGKPLLK.A
	TK251102_lung_cytoE16_2_step01.4798.4798.1	2.6206	0.3372	1497.9	3	5450.0%	2	R.TFCQLILDPIFK.V
	TK251102_lung_cytoE16_2_step01.4846.4846.2	1.0815	0.1993	2221.37	5	2350.0%	1	R.ALLELQLEPEELYQTFQR.I
	TK251102_lung_cytoE16_2_step03.3483.3483.2	1.2894	0.2546	2146.07	3	2370.0%	3	K.ARPFPDGLAEDIDKGEVSAR.Q
	TK251102_lung_cytoE16_2_step01.4995.4995.2	1.8736	0.5062	2762.69	1	2710.0%	1	R.YVEPIEDVPCGNIVGLVGVDQFLVK.T
*	TK251102_lung_cytoE16_2_step06.4797.4797.2	3.2297	0.5276	2819.23	1	3080.0%	8	K.DGSGFLINLIDSPGHVDFSSEVTAALR.V
	TK251102_lung_cytoE16_2_step01.1311.1311.1	1.4892	0.0843	756.53	6	6670.0%	3	K.NPADLPK.L
	TK251102_lung_cytoE16_2_step04.4725.4725.2	3.7605	0.6004	2206.16	1	5830.0%	5	K.STAISLFYELSENDLNFIK.Q
	TK251102_lung_cytoE16_2_step01.2011.2011.1	1.1097	0.2574	1597.28	2	3460.0%	1	R.ETVSEESNVLCLSK.S
	TK251102_lung_cytoE16_2_step05.2709.2709.1	2.2498	0.3402	1404.7	2	5500.0%	3	K.KEDLYLKPIQR.T
UGELS_MOUSE99.6%5710.0%730807465.8(P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin)
	TK251102_lung_cytoE16_2_step04.2048.2048.1	1.8752	0.3243	1276.68	2	5000.0%	2	K.HVVPNEVVVQR.L
	TK251102_lung_cytoE16_2_step01.5099.5099.3	1.3342	0.0211	4786.14	17	910.0%	1	R.QGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGK.E
*	TK251102_lung_cytoE16_2_step08.2249.2249.1	0.9132	0.0812	941.7	49	2860.0%	1	R.RTPITVVR.Q
	TK251102_lung_cytoE16_2_step06.1884.1884.1	1.9172	0.4444	850.52	1	6880.0%	1	K.KGGVASGFK.H
UCCT1_MOUSE99.6%7718.5%724805668.7(Q9QWV9) Cyclin T1 (Cyclin T) (CycT1)
*	TK251102_lung_cytoE16_2_step02.4135.4135.3	1.0558	0.0269	3980.79	69	900.0%	1	K.STKSSLNFPFPPLPTMTQLPGHSSDTSGLPFSQPSCK.T
*	TK251102_lung_cytoE16_2_step03.3074.3074.3	1.2577	0.0875	2942.72	138	1460.0%	1	R.FYMIQSFTQFHRYSMAPAALFLAAK.V
*	TK251102_lung_cytoE16_2_step12.2137.2137.2	3.6125	0.4672	1372.44	1	7920.0%	1	R.HSHLQLPAGPVSK.R
*	TK251102_lung_cytoE16_2_step08.4795.4795.2	1.3643	0.1368	2741.56	2	2200.0%	1	K.HSSQTSTLAHKTYSLSSTLSSSSSTR.K
	TK251102_lung_cytoE16_2_step08.3990.3990.2	1.2876	0.0684	1971.43	4	3120.0%	1	R.LNVSQLTINTAIVYMHR.F
	TK251102_lung_cytoE16_2_step09.2297.2297.2	2.0922	0.2588	1861.93	1	4670.0%	1	K.VAHTCLHPQESLPDTR.S
UGUAA_HUMAN99.6%112312.8%693767156.9(P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase)
*	TK251102_lung_cytoE16_2_step04.1748.1748.1	1.6806	0.1496	845.49	2	7140.0%	1	K.VFGGTVHK.K
*	TK251102_lung_cytoE16_2_step03.2345.2345.1	1.0076	0.0555	989.41	29	3120.0%	1	K.TVGVQGDCR.S
*	TK251102_lung_cytoE16_2_step11.4164.4164.2	3.5764	0.64	2349.72	1	5000.0%	3	K.ISQMPVILTPLHFDRDPLQK.Q
*	TK251102_lung_cytoE16_2_step07.2151.2151.1	1.7695	0.2982	1237.48	1	5560.0%	3	K.THHNDTELIR.K
*	TK251102_lung_cytoE16_2_step09.2861.2861.2	1.2491	0.0925	1869.62	4	3000.0%	1	R.IMYDLTSKPPGTTEWE.-
*	TK251102_lung_cytoE16_2_step12.1740.1740.1	1.3223	0.2935	993.57	31	4290.0%	1	K.KPHTLLQR.V
*	TK251102_lung_cytoE16_2_step11.4901.4901.2	2.0986	0.2229	2040.11	1	3820.0%	1	K.LMQITSLHSLNAFLLPIK.T
UQ91WK299.6%5714.2%352398326.7(Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD)
	TK251102_lung_cytoE16_2_step10.3318.3318.2	2.1907	0.3921	2078.56	1	4210.0%	2	K.SAVADKHELLSLASSNHLGK.S
*	TK251102_lung_cytoE16_2_step12.1524.1524.2	1.9655	0.3581	1165.06	1	7220.0%	1	K.LFKPHQAPAR.M
*	TK251102_lung_cytoE16_2_step12.2808.2808.2	1.2421	0.0587	1713.63	2	3420.0%	1	R.KEGTGSTATSSGSAGGAVGK.G
UP2G4_MOUSE99.6%92716.5%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4)
	TK251102_lung_cytoE16_2_step09.4021.4021.2	2.1887	0.4018	2349.93	1	3250.0%	4	K.GIAFPTSISVNNCVCHFSPLK.S
	TK251102_lung_cytoE16_2_step07.2355.2355.2	2.8146	0.4754	1929.94	1	5310.0%	3	R.LVKPGNQNTQVTEAWNK.V
	TK251102_lung_cytoE16_2_step09.5313.5313.2	1.0156	0.0747	3074.5	6	1730.0%	1	K.VAHSFNCTPIEGMLSHQLKQHVIDGEK.T
	TK251102_lung_cytoE16_2_step11.3448.3448.2	1.3901	0.2191	2170.93	4	2780.0%	1	K.VAHSFNCTPIEGMLSHQLK.Q
UGBLP_HUMAN99.6%124420.2%317350777.7(P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase)
	TK251102_lung_cytoE16_2_step10.3025.3025.2	3.3354	0.6171	2746.81	1	3080.0%	4	K.TNHIGHTGYLNTVTVSPDGSLCASGGK.D
	TK251102_lung_cytoE16_2_step03.1131.1131.3	1.063	0.1039	2870.98	186	800.0%	1	K.GHNGWVTQIATTPQFPDMILSASRDK.T
	TK251102_lung_cytoE16_2_step01.2656.2656.1	1.0469	0.1319	1265.24	1	5000.0%	1	R.LWDLTTGTTTR.R
	TK251102_lung_cytoE16_2_step10.4431.4431.2	4.8527	0.6813	2631.09	1	4350.0%	5	K.GHNGWVTQIATTPQFPDMILSASR.D
UIMD2_MOUSE99.6%228025.1%514557857.3(P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2)
	TK251102_lung_cytoE16_2_step03.4609.4609.2	1.4091	0.0446	2856.56	5	1730.0%	1	R.VGMGSGSICITQEVLACGRPQATAVYK.V
	TK251102_lung_cytoE16_2_step08.4237.4237.2	3.581	0.0933	1965.46	2	5290.0%	6	K.GKLPIVNENDELVAIIAR.T
	TK251102_lung_cytoE16_2_step04.2841.2841.2	2.6125	0.5258	1431.71	1	6250.0%	2	R.HGFCGIPITDTGR.M
	TK251102_lung_cytoE16_2_step12.3219.3219.2	3.9373	0.4132	2048.94	1	4470.0%	1	R.RFGVPVIADGGIQNVGHIAK.A
	TK251102_lung_cytoE16_2_step10.2035.2035.1	0.9659	0.1228	1158.41	21	3000.0%	1	K.NLIDAGVDALR.V
	TK251102_lung_cytoE16_2_step04.2092.2092.2	3.3904	0.6153	1919.55	1	5290.0%	5	R.TSSAQVEGGVHSLHSYEK.R
	TK251102_lung_cytoE16_2_step04.3593.3593.2	1.7881	0.25	1895.56	1	3890.0%	3	R.FGVPVIADGGIQNVGHIAK.A
	TK251102_lung_cytoE16_2_step03.2243.2243.1	0.723	0.1142	1026.48	49	2220.0%	1	R.GMGSLDAMDK.H
	TK251102_lung_cytoE16_2_step11.2681.2681.1	1.4315	0.1909	1276.75	24	5000.0%	1	R.MGSRLVGIISSR.D
UAATC_MOUSE99.6%3514.6%412461007.2(P05201) Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-1)
*	TK251102_lung_cytoE16_2_step03.4145.4145.2	3.7557	0.5074	1993.94	1	5560.0%	2	-.APPSVFAQVPQAPPVLVFK.L
*	TK251102_lung_cytoE16_2_step11.5145.5145.3	1.1243	0.0602	4637.22	13	1190.0%	1	K.RGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWK.Q
UTRAL_MOUSE99.6%9238.1%706802096.7(Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1)
*	TK251102_lung_cytoE16_2_step10.1586.1586.3	0.8422	0.0151	2129.55	7	1580.0%	2	R.YESSALPAGQLTSLPDYASR.M
	TK251102_lung_cytoE16_2_step07.2567.2567.1	0.8342	0.0688	536.32	17	6250.0%	1	R.AMVGR.L
	TK251102_lung_cytoE16_2_step01.2939.2939.1	1.9756	0.4282	1517.2	1	3850.0%	4	R.GVVDSEDIPLNLSR.E
*	TK251102_lung_cytoE16_2_step10.4657.4657.2	1.0195	0.017	1952.26	7	2350.0%	1	K.IIGQFGVGFYSAFMVADK.V
UMDHC_MOUSE99.6%135515.0%333363466.6(P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37)
	TK251102_lung_cytoE16_2_step03.1705.1705.1	1.3947	0.0469	820.47	11	5830.0%	1	K.ANVKIFK.S
*	TK251102_lung_cytoE16_2_step04.3329.3329.1	0.8744	0.0296	1222.44	78	4000.0%	1	K.IFKSQGTALEK.Y
	TK251102_lung_cytoE16_2_step06.3028.3028.2	4.8665	0.7291	2284.36	1	4740.0%	6	K.NVIIWGNHSSTQYPDVNHAK.V
	TK251102_lung_cytoE16_2_step02.1877.1877.1	1.1926	0.0148	616.49	14	6250.0%	1	R.KDLLK.A
	TK251102_lung_cytoE16_2_step05.1837.1837.1	1.8421	0.3474	995.51	1	5560.0%	4	R.KLSSAMSAAK.A
UPSD1_HUMAN99.6%6129.3%9531058665.4(Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112)
*	TK251102_lung_cytoE16_2_step08.3906.3906.2	1.7123	0.0404	2229.75	4	2780.0%	1	K.QCVENADLPEGEKKPIDQR.L
*	TK251102_lung_cytoE16_2_step10.3486.3486.2	3.3708	0.4716	1470.77	1	7330.0%	3	R.HGGSLGLGLAAMGTAR.Q
*	TK251102_lung_cytoE16_2_step06.1998.1998.1	1.5961	0.2427	935.48	16	5620.0%	1	R.QFAALVASK.V
*	TK251102_lung_cytoE16_2_step06.5008.5008.3	0.8251	0.0408	4743.91	70	680.0%	1	K.DTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVR.H
UPMG1_MOUSE99.6%267062.5%253287017.2(Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1)
	TK251102_lung_cytoE16_2_step03.4721.4721.2	3.8939	0.5563	3024.14	1	4420.0%	1	K.HLEGLSEEAIMELNLPTGIPIVYELDK.N
	TK251102_lung_cytoE16_2_step07.2411.2411.2	2.5632	0.4447	1151.63	1	8000.0%	3	R.VLIAAHGNSLR.G
	TK251102_lung_cytoE16_2_step01.1184.1184.1	1.8899	0.2073	976.41	1	7220.0%	1	K.AMEAVAAQGK.V
	TK251102_lung_cytoE16_2_step06.2305.2305.1	2.4995	0.3097	1061.62	1	6670.0%	5	R.HYGGLTGLNK.A
	TK251102_lung_cytoE16_2_step09.2616.2616.2	1.2033	0.0051	1633.72	1	4000.0%	1	R.HYGGLTGLNKAETAAK.H
	TK251102_lung_cytoE16_2_step02.4833.4833.2	1.1741	0.0976	2160.4	1	3240.0%	3	R.TLWTVLDAIDQMWLPVVR.T
	TK251102_lung_cytoE16_2_step01.4362.4362.2	1.2272	0.0172	1684.8	18	3850.0%	1	R.ALPFWNEEIVPQIK.E
	TK251102_lung_cytoE16_2_step08.3245.3245.2	1.4075	0.0957	2576.68	2	2380.0%	1	R.RSYDVPPPPMEPDHPFYSNISK.D
	TK251102_lung_cytoE16_2_step02.1618.1618.1	2.7488	0.3369	1105.52	1	7000.0%	2	R.KAMEAVAAQGK.V
	TK251102_lung_cytoE16_2_step11.3272.3272.2	2.3234	0.5097	2117.04	1	4710.0%	2	K.NLKPIKPMQFLGDEETVR.K
	TK251102_lung_cytoE16_2_step12.2947.2947.3	1.6	0.2113	2362.57	79	2120.0%	1	R.GGQALRDAGYEFDICFTSVQK.R
UANX4_MOUSE99.6%7913.5%318358595.6(P97429) Annexin A4 (Annexin IV)
	TK251102_lung_cytoE16_2_step11.3414.3414.1	2.0465	0.3895	1416.78	1	6000.0%	2	R.NHLLHVFDEYK.R
	TK251102_lung_cytoE16_2_step11.1256.1256.1	0.3319	0.0493	470.63	1	3330.0%	1	R.SAYK.S
	TK251102_lung_cytoE16_2_step03.4806.4806.2	3.2342	0.5285	3082.79	1	3080.0%	1	K.SELSSNFEQVILGLMTPTVLYDVQELR.R
	TK251102_lung_cytoE16_2_step11.3308.3308.2	1.625	0.0705	1573.49	1	6360.0%	1	R.NHLLHVFDEYKR.I
UPAK2_HUMAN99.6%6186.9%524580056.0(Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase)
*	TK251102_lung_cytoE16_2_step06.2761.2761.2	2.6176	0.498	2061.56	1	4440.0%	3	K.DPLSANHSLKPLPSVPEEK.K
*	TK251102_lung_cytoE16_2_step08.3921.3921.2	3.1119	0.4925	2080.13	1	5620.0%	3	R.ECLQALEFLHANQVIHR.D
UHS74_MOUSE99.6%6126.9%841941335.2(Q61316) Heat shock 70-related protein APG-2
*	TK251102_lung_cytoE16_2_step10.3005.3005.2	1.9765	0.4893	1799.88	1	4330.0%	1	K.ELTSICSPIISKPKPK.V
*	TK251102_lung_cytoE16_2_step09.3733.3733.3	1.2568	0.1467	2373.48	175	1620.0%	1	R.NVVFVDMGHSAYQVSVCAFNK.G
*	TK251102_lung_cytoE16_2_step10.2474.2474.1	1.2365	0.0020	1494.65	79	2500.0%	1	R.CTPACVSFGPKNR.S
	TK251102_lung_cytoE16_2_step06.1836.1836.1	2.0543	0.3974	873.4	4	6430.0%	3	K.NHAAPFSK.V
UNPL1_MOUSE99.6%2111132.0%391453454.5(P28656) Nucleosome assembly protein 1-like 1 (NAP-1 related protein) (Brain protein DN38)
	TK251102_lung_cytoE16_2_step02.1781.1781.1	1.4458	0.0289	754.49	3	8000.0%	1	K.HLKDIK.V
	TK251102_lung_cytoE16_2_step05.5301.5301.3	1.3133	0.0901	4546.66	9	1120.0%	9	K.TVSNDSFFNFFAPPEVPENGDLDDDAEAILAADFEIGHFLR.E
	TK251102_lung_cytoE16_2_step05.3751.3751.2	3.0767	0.4241	1488.76	1	7270.0%	3	R.KYAVLYQPLFDK.R
	TK251102_lung_cytoE16_2_step07.4610.4610.3	1.9746	0.0636	2438.01	60	2000.0%	1	K.ARQLTVQMMQNPQILAALQER.L
	TK251102_lung_cytoE16_2_step01.2215.2215.1	1.334	0.0997	1339.71	17	3890.0%	1	K.FYEEVHDLER.K
	TK251102_lung_cytoE16_2_step04.4627.4627.3	1.3528	0.0156	2097.99	19	2350.0%	1	K.NVDLLSDMVQEHDEPILK.H
	TK251102_lung_cytoE16_2_step01.3666.3666.2	3.2538	0.4957	1818.93	1	5940.0%	1	R.LDGLVDTPTGYIESLPK.V
UQ99KS199.6%1116.0%144165117.8(Q99KS1) Hypothetical 16.5 kDa protein (Fragment)
	TK251102_lung_cytoE16_2_step11.4321.4321.2	3.6807	0.5941	2553.45	1	3860.0%	1	K.NELHNLLDKPQLQGIPVLVLGNK.R
UTPP2_MOUSE99.6%131718.0%12621398786.6(Q64514) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase)
*	TK251102_lung_cytoE16_2_step10.1877.1877.3	1.3172	0.0422	1673.96	10	3460.0%	1	K.AYDYLIQNTSFANR.L
	TK251102_lung_cytoE16_2_step09.1979.1979.1	0.9537	0.0106	652.62	5	7500.0%	1	R.HINIR.V
	TK251102_lung_cytoE16_2_step07.2378.2378.1	1.2646	0.0491	730.54	3	7000.0%	1	K.YHIGIK.N
	TK251102_lung_cytoE16_2_step11.3742.3742.3	1.6278	0.0111	3926.36	1	1580.0%	1	K.LPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLR.G
*	TK251102_lung_cytoE16_2_step06.2176.2176.3	1.4569	0.0010	2176.9	377	1840.0%	1	R.LSNTLSLDIHENHSLALLGK.K
	TK251102_lung_cytoE16_2_step01.2655.2655.1	1.1734	0.0203	1464.69	5	4000.0%	1	K.ENWKNCIQLMK.L
	TK251102_lung_cytoE16_2_step10.3639.3639.2	1.9056	0.3604	1155.64	1	8330.0%	2	K.FVLHAVQLVK.Q
*	TK251102_lung_cytoE16_2_step12.3231.3231.3	1.0639	0.0055	4024.01	7	920.0%	1	R.GTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVR.R
	TK251102_lung_cytoE16_2_step07.4914.4914.2	1.7702	0.2545	2884.84	1	2880.0%	1	R.LNEIVDAANAVISHIDQTALAVYIAMK.T
	TK251102_lung_cytoE16_2_step04.3624.3624.3	1.1801	0.1194	3521.05	23	1140.0%	1	R.YPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPK.I
	TK251102_lung_cytoE16_2_step10.3681.3681.2	4.7508	0.6383	2562.66	1	5240.0%	2	K.VNESSHYDLAFTDVHFKPGQIR.R
UACTA_HUMAN99.6%6373348.0%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2)
	TK251102_lung_cytoE16_2_step01.3199.3199.2	2.8657	0.4852	1792.4	1	6330.0%	2	K.SYELPDGQVITIGNER.F
	TK251102_lung_cytoE16_2_step01.6055.6055.3	0.9857	0.068	3960.94	3	1440.0%	1	R.CPETLFQPSFIGMESAGIHETTYNSIMKCDIDIR.K
	TK251102_lung_cytoE16_2_step02.3454.3454.2	1.5531	0.0131	1962.64	6	3330.0%	1	K.YPIEHGIITNWDDMEK.I
	TK251102_lung_cytoE16_2_step01.3179.3179.1	2.1584	0.3188	1001.02	1	6430.0%	2	R.DLTDYLMK.I
	TK251102_lung_cytoE16_2_step12.2679.2679.2	1.9361	0.3009	1504.34	1	6000.0%	2	K.IWHHSFYNELR.V
	TK251102_lung_cytoE16_2_step08.3547.3547.2	1.3167	0.0437	2276.84	14	2370.0%	1	-.MCEEEDSTALVCDNGSGLCK.A
	TK251102_lung_cytoE16_2_step01.1434.1434.1	0.9763	0.0177	976.65	48	4440.0%	1	K.AGFAGDDAPR.A
	TK251102_lung_cytoE16_2_step01.2098.2098.1	2.6012	0.4401	1163.8	1	6500.0%	4	K.EITALAPSTMK.I
	TK251102_lung_cytoE16_2_step01.1834.1834.1	1.0746	0.0058	644.88	2	6000.0%	5	R.GILTLK.Y
	TK251102_lung_cytoE16_2_step11.2829.2829.2	2.1299	0.435	1200.07	3	5500.0%	2	R.AVFPSIVGRPR.H
	TK251102_lung_cytoE16_2_step01.0530.0530.1	0.934	0.041	515.51	35	6670.0%	1	R.EIVR.D
	TK251102_lung_cytoE16_2_step06.2146.2146.2	2.5939	0.4688	1175.3	1	9000.0%	11	R.HQGVMVGMGQK.D
	TK251102_lung_cytoE16_2_step01.2850.2850.2	1.7923	0.2957	1959.14	6	3240.0%	2	R.VAPEEHPTLLTEAPLNPK.A
	TK251102_lung_cytoE16_2_step01.1206.1206.1	1.2237	0.0241	632.64	9	8750.0%	1	K.ILTER.G
U2AAA_HUMAN99.6%8129.5%588650925.1(P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein)
	TK251102_lung_cytoE16_2_step04.2360.2360.2	1.0757	0.0983	2828.14	41	1300.0%	1	K.DECPEVRLNIISNLDCVNEVIGIR.Q
	TK251102_lung_cytoE16_2_step10.3185.3185.2	1.6699	0.2998	966.84	1	6430.0%	1	K.HMLPTVLR.M
	TK251102_lung_cytoE16_2_step11.3140.3140.2	3.8064	0.619	2217.28	1	4470.0%	2	R.AISHEHSPSDLEAHFVPLVK.R
	TK251102_lung_cytoE16_2_step08.1837.1837.1	0.7541	0.0468	613.61	16	6670.0%	1	R.QYFR.N
UEWS_MOUSE99.6%112.7%655684189.3(Q61545) RNA-binding protein EWS
	TK251102_lung_cytoE16_2_step11.2702.2702.2	3.8148	0.642	2057.53	1	5880.0%	1	R.TGQPMIHIYLDKETGKPK.G
UA2HS_MOUSE99.6%146828.7%345373266.5(P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin)
*	TK251102_lung_cytoE16_2_step06.1709.1709.2	3.2059	0.5857	1970.01	1	6250.0%	1	R.VMHTQCHSTPDSAEDVR.K
*	TK251102_lung_cytoE16_2_step07.3407.3407.3	1.0925	0.0177	3687.88	1	1480.0%	1	R.CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK.L
*	TK251102_lung_cytoE16_2_step06.4884.4884.2	3.6921	0.5858	2546.28	1	4570.0%	7	R.AQNVPLPVSTLVEFVIAATDCTAK.E
*	TK251102_lung_cytoE16_2_step08.3194.3194.2	4.2854	0.632	2142.09	1	6000.0%	4	R.HAFSPVASVESASGETLHSPK.V
*	TK251102_lung_cytoE16_2_step09.2736.2736.1	0.9409	0.1938	544.42	2	6670.0%	1	R.HFKI.-
UIF41_HUMAN99.6%259933.7%406461545.5(P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I)
	TK251102_lung_cytoE16_2_step01.2395.2395.1	1.4372	0.0801	1190.1	7	5000.0%	1	K.KEELTLEGIR.Q
	TK251102_lung_cytoE16_2_step02.3946.3946.2	1.6611	0.2953	2148.36	1	3610.0%	5	R.GIDVQQVSLVINYDLPTNR.E
	TK251102_lung_cytoE16_2_step09.4863.4863.3	3.5419	0.4782	4170.32	1	2360.0%	2	R.SRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLR.G
	TK251102_lung_cytoE16_2_step02.3046.3046.2	2.0889	0.4871	1830.88	1	4330.0%	6	R.GIYAYGFEKPSAIQQR.A
	TK251102_lung_cytoE16_2_step02.2834.2834.1	2.0047	0.1942	1020.41	1	7140.0%	2	R.KVDWLTEK.M
	TK251102_lung_cytoE16_2_step02.1627.1627.1	1.0635	0.1171	832.53	2	7000.0%	1	R.ENYIHR.I
	TK251102_lung_cytoE16_2_step09.1943.1943.1	1.0274	0.0251	581.55	11	8330.0%	1	K.KFMR.D
	TK251102_lung_cytoE16_2_step05.3243.3243.2	2.3481	0.4706	1622.77	1	5000.0%	5	K.LQMEAPHIIVGTPGR.V
	TK251102_lung_cytoE16_2_step01.4354.4354.1	1.442	0.1082	1557.73	1	4580.0%	1	K.MFVLDEADEMLSR.G
	TK251102_lung_cytoE16_2_step01.3094.3094.1	2.0003	0.2473	1170.82	1	6880.0%	1	K.DQIYDIFQK.L
UQ9R0U599.6%61027.1%306341046.9(Q9R0U5) Matrin3
	TK251102_lung_cytoE16_2_step07.5370.5370.3	1.0336	0.2181	3110.65	49	890.0%	1	R.DSQGHGRDLSAAGIGLLAAATQSLSMPASLGR.M
	TK251102_lung_cytoE16_2_step11.2990.2990.2	1.9543	0.2292	1935.83	1	3820.0%	1	K.RGAPPSSNIEDFHGLLPK.G
	TK251102_lung_cytoE16_2_step09.3264.3264.2	3.2543	0.4877	1998.51	1	5940.0%	2	K.GYPHLCSICDLPVHSNK.V
	TK251102_lung_cytoE16_2_step08.2799.2799.2	1.685	0.0477	2002.24	1	4000.0%	2	R.CRDDSFFGETSHNYHK.F
UQ99KQ299.6%258928.3%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment)
	TK251102_lung_cytoE16_2_step07.3618.3618.2	5.4955	0.606	2204.03	1	5790.0%	7	R.LVSNHSLHETSSVFVDSLTK.V
	TK251102_lung_cytoE16_2_step07.3036.3036.2	2.6923	0.302	1381.77	1	7080.0%	3	K.YGGPYHIGGSPFK.A
	TK251102_lung_cytoE16_2_step01.3487.3487.2	1.382	0.1389	2468.9	13	2270.0%	1	K.FNEEHIPDSPFVVPVASPSGDAR.R
	TK251102_lung_cytoE16_2_step02.3005.3005.1	1.2558	0.1955	1303.51	4	4090.0%	1	K.FNGTHIPGSPFK.I
	TK251102_lung_cytoE16_2_step09.4865.4865.3	1.5219	0.0384	3574.17	96	1420.0%	1	K.THEAEIVEGENHTYCIRFVPAEMGMHTVSVK.Y
*	TK251102_lung_cytoE16_2_step04.1589.1589.2	1.3888	0.0013	1819.75	56	2500.0%	3	K.VATVPQHATSGPGPADVSK.V
	TK251102_lung_cytoE16_2_step11.2737.2737.1	2.1581	0.3394	1435.88	1	5770.0%	3	K.AGNNMLLVGVHGPR.T
	TK251102_lung_cytoE16_2_step06.2781.2781.2	2.0403	0.2866	1420.61	1	6250.0%	2	R.RLTVSSLQESGLK.V
U6PGD_MOUSE99.6%92122.6%482531167.2(Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)
	TK251102_lung_cytoE16_2_step07.3771.3771.3	1.664	0.0682	2497.97	2	2270.0%	1	K.WTAISALEYGMPVTLIGEAVFAR.C
	TK251102_lung_cytoE16_2_step03.3035.3035.1	1.7084	0.33	1520.64	1	4170.0%	1	R.HEMLPANLIQAQR.D
	TK251102_lung_cytoE16_2_step12.2845.2845.2	0.7992	0.0635	3192.87	18	1380.0%	1	K.AIFQAIAAKVGTGEPCCDWVGDEGAGHFVK.M
	TK251102_lung_cytoE16_2_step02.2071.2071.1	1.1561	0.1356	878.68	2	5830.0%	1	K.IKDAFER.N
	TK251102_lung_cytoE16_2_step11.4492.4492.3	3.3034	0.5181	3933.31	1	1710.0%	1	R.DYFGAHTYELLTKPGEFIHTNWTGHGGSVSSSSYNA.-
UQ9D90299.6%337.9%292330799.6(Q9D902) C330006J08Rik protein
	TK251102_lung_cytoE16_2_step10.2583.2583.2	2.8818	0.5455	1221.3	1	8500.0%	1	K.THNEHLAGVLK.D
	TK251102_lung_cytoE16_2_step06.1641.1641.2	0.7748	0.0938	1505.99	66	2730.0%	1	K.SCQFSVDEEFQK.L
URIR1_MOUSE99.6%91310.5%792902196.9(P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain)
	TK251102_lung_cytoE16_2_step08.1953.1953.1	0.9286	0.1663	627.42	4	5000.0%	1	-.MHVIK.R
	TK251102_lung_cytoE16_2_step09.3223.3223.2	3.8295	0.4991	1572.24	1	6920.0%	2	R.TRPAANPIQFTLNK.E
	TK251102_lung_cytoE16_2_step03.3773.3773.2	3.5662	0.4498	1695.71	1	7500.0%	2	R.VLSGEFQIVNPHLLK.D
	TK251102_lung_cytoE16_2_step11.1864.1864.2	1.3396	0.1358	1368.77	8	4000.0%	1	K.VAERPQHMLMR.V
*	TK251102_lung_cytoE16_2_step07.3728.3728.2	1.5166	0.3172	2158.2	1	3820.0%	1	K.IIDINYYPIPEAHLSNKR.H
	TK251102_lung_cytoE16_2_step04.2652.2652.1	1.3562	0.2057	1128.57	1	6110.0%	1	K.HPDYAILAAR.I
	TK251102_lung_cytoE16_2_step08.3619.3619.2	1.5798	0.2325	1273.23	3	5000.0%	1	K.LTSMHFYGWK.Q
UNDR2_MOUSE99.6%395.9%371407895.4(Q9QYG0) NDRG2 protein (Ndr2 protein)
*	TK251102_lung_cytoE16_2_step08.4378.4378.2	2.8874	0.5055	2660.03	1	3330.0%	3	R.GIIQHAPNLENIELYWNSYNNR.R
UQ8VH5199.6%599.4%5305949410.1(Q8VH51) Transcription coactivator CAPER
	TK251102_lung_cytoE16_2_step09.0058.0058.2	0.9073	0.0674	1955.74	96	1560.0%	1	-.MADDIDIEAMLEAPYKK.D
	TK251102_lung_cytoE16_2_step05.4396.4396.2	1.9618	0.3909	1910.51	1	4670.0%	2	R.LYVGSLHFNITEDMLR.G
	TK251102_lung_cytoE16_2_step10.4317.4317.2	3.2841	0.5635	1692.8	1	5940.0%	2	K.CPSIAAAIAAVNALHGR.W
UYB1_MOUSE99.6%175122.4%322357309.9(P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB)
	TK251102_lung_cytoE16_2_step01.1196.1196.1	0.9458	0.1089	616.67	70	5000.0%	1	K.VLGTVK.W
	TK251102_lung_cytoE16_2_step07.1367.1367.1	1.1087	0.0319	589.85	3	8330.0%	1	R.NHYR.R
	TK251102_lung_cytoE16_2_step08.2263.2263.3	2.496	0.5004	3227.86	1	1980.0%	2	R.RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.Q
	TK251102_lung_cytoE16_2_step08.1873.1873.1	0.8407	2.0E-4	747.58	20	5000.0%	1	R.RPYRR.R
	TK251102_lung_cytoE16_2_step01.2054.2054.1	1.4078	0.0863	1287.05	2	5000.0%	1	K.EDVFVHQTAIK.K
	TK251102_lung_cytoE16_2_step11.1298.1298.1	1.7335	0.0071	1423.94	1	4090.0%	2	R.RRPENPKPQDGK.E
	TK251102_lung_cytoE16_2_step08.1387.1387.2	2.7756	0.5166	1266.48	1	7000.0%	1	R.RPENPKPQDGK.E
	TK251102_lung_cytoE16_2_step09.1303.1303.1	0.8513	0.0138	591.72	2	6670.0%	6	R.RYPR.R
UR11A_MOUSE99.6%61814.8%216244036.7(Q9JLX1) Ras-related protein Rab-11A
	TK251102_lung_cytoE16_2_step05.3901.3901.2	2.0395	0.3796	1627.53	1	5710.0%	4	R.DHADSNIVIMLVGNK.S
	TK251102_lung_cytoE16_2_step10.4318.4318.2	1.3903	0.0694	2096.83	1	3610.0%	1	R.DHADSNIVIMLVGNKSDLR.H
	TK251102_lung_cytoE16_2_step02.3981.3981.1	1.4265	0.0446	1292.89	2	4170.0%	1	R.GAVGALLVYDIAK.H
UMCM3_MOUSE99.6%256119.8%812915465.6(P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3)
	TK251102_lung_cytoE16_2_step04.4064.4064.3	1.5174	0.0044	3550.45	1	1810.0%	1	K.DEENNPLETEYGLSVYKDHQTITIQEMPEK.A
*	TK251102_lung_cytoE16_2_step01.2919.2919.1	0.6834	0.0015	1029.82	28	2500.0%	1	R.LIVSVNDLR.R
	TK251102_lung_cytoE16_2_step09.2497.2497.1	2.0575	0.4257	1425.73	1	5000.0%	4	R.SLAPSIHGHDYVK.K
	TK251102_lung_cytoE16_2_step08.0861.0861.1	0.8787	0.2727	596.07	18	5000.0%	1	K.HVSPR.T
*	TK251102_lung_cytoE16_2_step12.4845.4845.2	1.8809	0.4574	2925.73	1	2600.0%	2	K.AALLEVFQEAHEQSVGMLHLTESINR.N
	TK251102_lung_cytoE16_2_step04.1429.1429.1	0.974	0.1035	616.54	5	5000.0%	2	K.KVLEK.E
	TK251102_lung_cytoE16_2_step11.1489.1489.1	1.2301	0.0811	858.57	2	5830.0%	1	K.KYIHVAK.I
	TK251102_lung_cytoE16_2_step02.5222.5222.2	0.9503	0.2164	1784.31	18	2000.0%	1	R.TAIHEVMEQGRVTIAK.A
*	TK251102_lung_cytoE16_2_step04.3505.3505.2	4.0451	0.6149	2286.35	1	5260.0%	4	K.IIKPTLTQESAAYIAEEYSR.L
	TK251102_lung_cytoE16_2_step04.1340.1340.1	1.0005	0.0375	711.77	24	5000.0%	1	R.LATAHAK.A
*	TK251102_lung_cytoE16_2_step07.1519.1519.1	0.9643	0.0107	734.7	4	7500.0%	1	R.MHQYR.A
*	TK251102_lung_cytoE16_2_step07.2038.2038.1	1.7361	0.2971	1008.55	1	6880.0%	2	K.HDSLLHGTK.K
	TK251102_lung_cytoE16_2_step03.1561.1561.1	1.4648	0.1854	1062.5	1	6250.0%	1	R.SVHYCPATK.K
UG3P_MOUSE99.6%5026460.5%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH)
*	TK251102_lung_cytoE16_2_step01.1862.1862.1	2.9838	0.52	1371.5	1	5710.0%	3	R.GAAQNIIPASTGAAK.A
	TK251102_lung_cytoE16_2_step11.3490.3490.3	4.4438	0.5956	2370.9	1	4050.0%	1	K.RVIISAPSADAPMFVMGVNHEK.Y
	TK251102_lung_cytoE16_2_step01.2779.2779.3	2.2359	0.0966	2335.91	1	2500.0%	1	K.LTGMAFRVPTPNVSVVDLTCR.L
*	TK251102_lung_cytoE16_2_step02.4269.4269.3	4.4278	0.49	4054.01	1	2300.0%	7	K.GILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVK.L
	TK251102_lung_cytoE16_2_step06.1708.1708.1	0.9191	0.0046	739.64	3	7000.0%	1	K.YDNSLK.I
*	TK251102_lung_cytoE16_2_step01.5614.5614.2	2.9071	0.557	2294.24	1	5250.0%	10	K.WGEAGAEYVVESTGVFTTMEK.A
*	TK251102_lung_cytoE16_2_step10.4913.4913.3	1.5723	0.1156	3325.67	1	1850.0%	1	K.VEIVAINDPFIDLNYMVYMFQYDSTHGK.F
	TK251102_lung_cytoE16_2_step01.2776.2776.1	2.436	0.2545	1559.77	1	5380.0%	1	R.VPTPNVSVVDLTCR.L
*	TK251102_lung_cytoE16_2_step06.3769.3769.2	2.6985	0.4619	1629.88	1	6920.0%	2	K.LVINGKPITIFQER.D
	TK251102_lung_cytoE16_2_step06.0883.0883.1	1.1873	0.0296	598.46	3	6000.0%	5	K.AGAHLK.G
	TK251102_lung_cytoE16_2_step09.4845.4845.2	4.985	0.6539	2599.98	1	5220.0%	6	K.VIHDNFGIVEGLMTTVHAITATQK.T
*	TK251102_lung_cytoE16_2_step10.3839.3839.2	3.2253	0.4015	2299.85	1	3680.0%	4	K.LVINGKPITIFQERDPTNIK.W
UFCL_MOUSE99.6%4616.5%321358786.7(P23591) GDP-fucose synthetase (FX protein) (Red cell NADP(H)-binding protein) (Transplantation antigen P35B) (Tum-P35B antigen) [Includes: GDP-mannose-4-keto-6-D epimerase (EC 5.1.3.-); GDP-4-keto-6-L-galactose reductase (EC 1.-.-.-)]
*	TK251102_lung_cytoE16_2_step12.0437.0437.2	1.1565	0.0423	2927.22	21	1600.0%	1	K.TTYPIDETMIHNGPPHSSNFGYSYAK.R
*	TK251102_lung_cytoE16_2_step07.3620.3620.2	3.4454	0.5427	1993.8	1	5290.0%	2	K.NVHINDNVLHSAFEVGAR.K
*	TK251102_lung_cytoE16_2_step05.1272.1272.1	0.7514	0.2263	999.75	3	3750.0%	1	-.MGEPHGSMR.I
UQ9CV4599.6%398.0%225255225.3(Q9CV45) 2310038O07Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step11.3069.3069.2	2.1747	0.439	1941.67	1	4120.0%	3	R.VALVTFNSAAHNKPSLIR.D
UQ9CV3199.6%51118.0%284321105.0(Q9CV31) 2310014J01Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step05.2985.2985.2	3.8531	0.6276	1568.73	1	7330.0%	3	K.HGGGGIVANLSEQSLK.D
	TK251102_lung_cytoE16_2_step01.1878.1878.1	1.1189	0.044	1335.94	3	4000.0%	1	R.DAEDVDLTHYR.I
*	TK251102_lung_cytoE16_2_step05.2565.2565.3	1.3155	0.0279	2615.04	64	1630.0%	1	R.LAKIEGLQSLVNCGNYTSATMVSR.L
UPUR2_MOUSE99.6%183616.5%10101073376.8(Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)]
	TK251102_lung_cytoE16_2_step09.4163.4163.2	2.8687	0.4398	1498.86	1	7080.0%	3	K.MLNIHPSLLPSFK.G
*	TK251102_lung_cytoE16_2_step03.2287.2287.1	1.754	0.1937	1139.74	1	5620.0%	1	R.HEIPTAQWR.A
	TK251102_lung_cytoE16_2_step05.1724.1724.1	1.0621	0.0808	1044.49	24	4290.0%	1	K.FAKEFMDR.H
*	TK251102_lung_cytoE16_2_step08.3934.3934.2	2.3336	0.3114	1313.19	1	7500.0%	4	R.IYSHSLLPIIR.S
*	TK251102_lung_cytoE16_2_step09.2267.2267.1	1.2522	0.1041	654.48	2	6250.0%	1	K.IHWAK.E
*	TK251102_lung_cytoE16_2_step11.3804.3804.3	0.9399	0.1015	4334.82	24	810.0%	1	K.GSNAHEQVLEAGVTITGCTVHFVAEDVDAGQIILQEAVPVR.R
	TK251102_lung_cytoE16_2_step05.3817.3817.2	3.929	0.5283	1667.65	1	7000.0%	1	K.AFAHITGGGLLENIPR.V
	TK251102_lung_cytoE16_2_step04.3272.3272.2	1.2177	0.0302	2016.67	4	2370.0%	1	R.VAVLISGTGSNLQALIDSTR.D
	TK251102_lung_cytoE16_2_step02.2401.2401.1	1.2595	0.1007	884.45	1	8330.0%	1	R.EHTLAWK.L
	TK251102_lung_cytoE16_2_step07.1938.1938.1	1.1035	0.0972	797.76	18	5000.0%	1	K.KIQPLAK.A
*	TK251102_lung_cytoE16_2_step05.4300.4300.3	1.617	0.1409	3255.76	1	1900.0%	1	K.NTILQRAVDGMQQEGAPYTGILYAGIMLTK.D
UKPY2_MOUSE99.6%8262655.3%530577567.5(P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40)
	TK251102_lung_cytoE16_2_step06.1764.1764.1	1.1076	0.1846	789.54	1	7000.0%	1	R.QAHLYR.G
	TK251102_lung_cytoE16_2_step05.3268.3268.1	1.0811	0.017	1084.66	326	3330.0%	1	K.GPEIRTGLIK.G
	TK251102_lung_cytoE16_2_step11.1946.1946.2	3.1545	0.5376	1887.64	1	5330.0%	10	R.LNFSHGTHEYHAETIK.N
	TK251102_lung_cytoE16_2_step01.0611.0611.1	1.0254	0.0303	462.36	5	8330.0%	2	K.IISK.I
*	TK251102_lung_cytoE16_2_step05.1523.1523.1	1.2644	0.1357	896.73	2	5710.0%	2	K.AADVHEVR.K
	TK251102_lung_cytoE16_2_step01.1282.1282.1	1.343	0.2496	953.52	2	5710.0%	1	K.IENHEGVR.R
	TK251102_lung_cytoE16_2_step01.0283.0283.1	1.0738	0.3077	510.4	1	6250.0%	1	R.VVPVP.-
	TK251102_lung_cytoE16_2_step06.3876.3876.2	1.7777	0.2819	1826.05	8	3000.0%	3	R.RFDEILEASDGIMVAR.G
	TK251102_lung_cytoE16_2_step05.5336.5336.2	1.6327	0.2652	1863.58	1	4000.0%	13	K.FGVEQDVDMVFASFIR.K
*	TK251102_lung_cytoE16_2_step01.2180.2180.1	1.011	0.126	1172.72	9	4000.0%	1	R.LDIDSAPITAR.N
	TK251102_lung_cytoE16_2_step01.2270.2270.1	1.9993	0.3071	1144.01	7	4500.0%	2	R.GDLGIEIPAEK.V
*	TK251102_lung_cytoE16_2_step02.2202.2202.3	1.5631	0.0267	2656.91	2	2270.0%	1	R.AGKPVICSTQMLEIMIKKPRPTR.A
	TK251102_lung_cytoE16_2_step08.2198.2198.2	2.035	0.1618	869.56	2	10000.0%	2	R.MQHLIAR.E
	TK251102_lung_cytoE16_2_step01.0650.0650.1	1.1095	0.0267	717.45	6	5830.0%	1	K.VVEVGSK.I
	TK251102_lung_cytoE16_2_step01.3384.3384.1	1.4499	0.2302	934.47	8	5710.0%	1	R.GIFPVLCK.D
	TK251102_lung_cytoE16_2_step01.4330.4330.2	2.9532	0.4183	2497.49	1	3960.0%	1	R.AEGSDVANAVLDGADCIMLSGETAK.G
	TK251102_lung_cytoE16_2_step01.2020.2020.1	0.9926	0.1473	840.85	7	5000.0%	1	R.APIIAVTR.N
*	TK251102_lung_cytoE16_2_step01.3983.3983.1	0.9848	0.0051	1589.7	9	3080.0%	1	K.DAVLNAWAEDVDLR.V
*	TK251102_lung_cytoE16_2_step05.1521.1521.1	1.7847	0.3563	1026.47	1	6250.0%	2	R.KAADVHEVR.K
	TK251102_lung_cytoE16_2_step04.3131.3131.2	4.3823	0.5714	1768.47	1	6470.0%	5	K.KGVNLPGAAVDLPAVSEK.D
	TK251102_lung_cytoE16_2_step05.4364.4364.2	3.483	0.5094	1936.05	1	6330.0%	16	R.EAEAAIYHLQLFEELR.R
	TK251102_lung_cytoE16_2_step01.0235.0235.1	1.4513	0.0806	704.62	9	8000.0%	1	K.VFLAQK.M
	TK251102_lung_cytoE16_2_step01.3822.3822.1	1.8712	0.2722	1464.88	1	5420.0%	1	K.IYVDDGLISLQVK.E
	TK251102_lung_cytoE16_2_step06.1317.1317.1	1.2277	0.2053	769.56	2	5830.0%	3	R.SAHQVAR.Y
*	TK251102_lung_cytoE16_2_step01.4019.4019.2	2.6497	0.3614	2495.37	1	3860.0%	1	R.EATESFASDPILYRPVAVALDTK.G
	TK251102_lung_cytoE16_2_step03.1549.1549.1	1.5357	0.1286	675.61	4	5000.0%	2	R.KVLGEK.G
ULA_MOUSE99.6%132918.1%415477569.8(P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog)
	TK251102_lung_cytoE16_2_step01.1350.1350.1	1.3056	0.0291	882.46	4	6430.0%	1	K.VLEGHAEK.E
	TK251102_lung_cytoE16_2_step07.1984.1984.1	1.6758	0.2996	946.71	1	5620.0%	2	K.GSHVFTAAR.R
	TK251102_lung_cytoE16_2_step04.2441.2441.2	2.28	0.3751	2078.12	1	3530.0%	2	R.SPSRPLPEVTDEYKNDVK.N
	TK251102_lung_cytoE16_2_step06.1996.1996.1	1.061	0.045	661.56	3	6250.0%	1	K.KVTWK.V
	TK251102_lung_cytoE16_2_step01.4300.4300.1	1.4069	0.1114	1533.18	2	4170.0%	1	K.LDEGWVPLETMIK.F
	TK251102_lung_cytoE16_2_step07.4243.4243.2	3.8634	0.5837	2075.32	1	6330.0%	4	K.ICHQIEYYFGDFNLPR.D
	TK251102_lung_cytoE16_2_step10.2609.2609.2	1.435	0.2254	1775.62	31	3570.0%	1	R.RSPSRPLPEVTDEYK.N
	TK251102_lung_cytoE16_2_step07.1459.1459.1	0.9131	0.0018	546.7	4	8750.0%	1	R.ENGAR.D
UPSDD_MOUSE99.6%4102.4%376428095.7(Q9WVJ2) 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5)
	TK251102_lung_cytoE16_2_step09.2953.2953.1	1.4647	0.1291	1155.63	2	5620.0%	3	R.VHMTWVQPR.V
UQ8QZT199.6%229.7%424448168.5(Q8QZT1) Similar to acetyl-Co A acetyltransferase 1, mitochondrial
*	TK251102_lung_cytoE16_2_step12.2567.2567.2	3.6607	0.6168	1932.14	1	5790.0%	1	K.VNIHGGAVSLGHPIGMSGAR.I
*	TK251102_lung_cytoE16_2_step02.2914.2914.3	1.7295	0.1319	2229.3	5	2380.0%	1	K.FASEITPITISVKGKPDVVVK.E
UHBA_HUMAN99.6%94142.6%141151268.7(P01922) Hemoglobin alpha chain
*	TK251102_lung_cytoE16_2_step06.3072.3072.2	1.0162	0.0635	1836.51	5	3670.0%	2	K.TYFPHFDLSHGSAQVK.G
*	TK251102_lung_cytoE16_2_step02.0046.0046.1	1.2336	0.0217	1532.76	7	2860.0%	6	K.VGAHAGEYGAEALER.M
*	TK251102_lung_cytoE16_2_step12.4469.4469.3	2.3663	0.0774	3000.0	5	1880.0%	1	K.VADALTNAVAHVDDMPNALSALSDLHAHK.L
UPIN1_MOUSE99.6%3527.9%165183708.8(Q9QUR7) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (EC 5.2.1.8) (Rotamase Pin1) (PPIase Pin1)
	TK251102_lung_cytoE16_2_step02.3965.3965.2	2.605	0.5485	2032.65	1	3610.0%	1	R.TGEMSGPVFTDSGIHIILR.T
*	TK251102_lung_cytoE16_2_step08.3401.3401.2	2.479	0.4417	2930.21	1	3080.0%	2	R.VYYFNHITNASQWERPSGGSTVGGSSK.N
UHBB1_MOUSE99.6%262842684.9%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major)
	TK251102_lung_cytoE16_2_step04.2400.2400.2	2.5906	0.5193	1140.31	1	8180.0%	59	K.VVAGVATALAHK.Y
	TK251102_lung_cytoE16_2_step01.3350.3350.2	3.1013	0.5399	1759.42	1	5670.0%	4	K.VITAFNDGLNHLDSLK.G
	TK251102_lung_cytoE16_2_step01.2623.2623.1	1.1355	0.1968	1466.9	1	4580.0%	5	K.GTFASLSELHCDK.L
	TK251102_lung_cytoE16_2_step11.2496.2496.2	3.1202	0.6129	1437.15	1	6920.0%	2	K.VVAGVATALAHKYH.-
*	TK251102_lung_cytoE16_2_step01.1910.1910.1	1.6826	0.1137	994.06	4	5000.0%	8	K.AAVSCLWGK.V
	TK251102_lung_cytoE16_2_step01.1064.1064.2	1.3322	0.2778	1298.36	5	5000.0%	6	K.DFTPAAQAAFQK.V
	TK251102_lung_cytoE16_2_step07.4644.4644.2	2.6645	0.5398	2576.73	1	4050.0%	50	K.GTFASLSELHCDKLHVDPENFR.L
	TK251102_lung_cytoE16_2_step01.1490.1490.1	2.1818	0.3545	914.74	2	6430.0%	6	-.VHLTDAEK.A
	TK251102_lung_cytoE16_2_step05.3664.3664.2	4.3043	0.5593	1888.87	1	5940.0%	27	K.KVITAFNDGLNHLDSLK.G
	TK251102_lung_cytoE16_2_step02.0077.0077.1	1.4501	0.3279	1128.56	1	4380.0%	3	K.LHVDPENFR.L
	TK251102_lung_cytoE16_2_step01.4211.4211.2	3.522	0.5638	1984.91	1	5280.0%	13	R.YFDSFGDLSSASAIMGNAK.V
	TK251102_lung_cytoE16_2_step01.1614.1614.1	1.7288	0.3645	1304.88	1	5420.0%	4	K.VNSDEVGGEALGR.L
	TK251102_lung_cytoE16_2_step02.3833.3833.1	1.2813	0.1836	1276.69	19	4440.0%	1	R.LLVVYPWTQR.Y
UQ91W8399.6%81418.4%309334295.2(Q91W83) Putative TAT protein (Transactivating regulatory protein)
	TK251102_lung_cytoE16_2_step12.3104.3104.2	2.045	0.2013	1275.42	20	4500.0%	1	R.ILRPGGCLFLK.E
	TK251102_lung_cytoE16_2_step04.2179.2179.2	2.8602	0.159	1423.16	1	7500.0%	2	K.KPNFEVGSSSQLK.L
	TK251102_lung_cytoE16_2_step04.2371.2371.3	0.937	0.0258	2804.18	67	830.0%	1	R.LQELTGSEGQVFMENVTQLLQSSHK.E
	TK251102_lung_cytoE16_2_step05.1651.1651.1	1.6679	0.2888	883.56	1	6430.0%	2	K.RPDPASLK.A
UQ9QZE799.6%62013.1%290329266.6(Q9QZE7) Translin associated protein X (Translin-associated factor X)
*	TK251102_lung_cytoE16_2_step07.4658.4658.2	2.6676	0.5462	2271.11	1	3950.0%	4	R.AVTTGLQEYVEAVSFQHFIK.T
*	TK251102_lung_cytoE16_2_step06.3529.3529.2	2.8542	0.4797	2141.44	1	3530.0%	2	K.ILQVAQELSGEDMHQFHR.A
UQ9QZE599.6%353.7%874975135.3(Q9QZE5) Coat protein gamma-cop (Coatomer protein complex, subunit gamma 1)
	TK251102_lung_cytoE16_2_step09.2376.2376.3	1.0115	0.1223	2261.2	76	1500.0%	1	K.ELAPAVSVLQLFCSSPKAALR.Y
	TK251102_lung_cytoE16_2_step07.3198.3198.1	2.3071	0.3194	1205.84	1	7000.0%	2	R.ILHLLGQEGPK.T
UNTF2_HUMAN99.6%82639.4%127144785.4(P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15)
	TK251102_lung_cytoE16_2_step10.4545.4545.2	3.4644	0.5353	3007.28	1	2500.0%	4	K.IQHSITAQDHQPTPDSCIISMVVGQLK.A
	TK251102_lung_cytoE16_2_step05.4147.4147.2	1.1721	0.0113	2618.54	11	1820.0%	1	R.TQLGAIYIDASCLTWEGQQFQGK.A
UPA1B_HUMAN99.6%118.7%229255695.9(Q29459) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit)
*	TK251102_lung_cytoE16_2_step12.4883.4883.2	5.4655	0.5235	2451.27	1	5790.0%	1	K.ICKPLHELIMQLLEETPEEK.Q
UARF1_HUMAN99.6%2635419.4%180205666.8(P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1
	TK251102_lung_cytoE16_2_step10.3867.3867.2	5.1418	0.6278	2156.65	1	6180.0%	18	R.HYFQNTQGLIFVVDSNDR.E
	TK251102_lung_cytoE16_2_step11.2058.2058.1	1.0432	0.0967	795.8	1	6670.0%	1	K.LGLHSLR.H
	TK251102_lung_cytoE16_2_step04.3625.3625.1	1.9614	0.4274	1091.73	1	6670.0%	5	R.DAVLLVFANK.Q
UQ9DBY699.6%2710325.3%407446548.5(Q9DBY6) 1200009K13Rik protein
	TK251102_lung_cytoE16_2_step03.1865.1865.1	2.0934	0.3822	1188.69	1	5450.0%	4	R.GGSGSHNWGTVK.D
	TK251102_lung_cytoE16_2_step02.1443.1443.1	0.7726	0.1956	1243.74	1	2500.0%	2	R.RPDQQLQGDGK.L
	TK251102_lung_cytoE16_2_step03.2205.2205.1	2.3054	0.4513	1114.49	1	6110.0%	4	R.SSFSHYSGLK.H
	TK251102_lung_cytoE16_2_step01.4414.4414.2	1.6757	0.242	1945.28	1	5000.0%	1	R.FDQLFDDESDPFEVLK.A
	TK251102_lung_cytoE16_2_step04.2639.2639.2	3.6887	0.5232	2086.83	1	4740.0%	2	R.GGSGSHNWGTVKDELTESPK.Y
	TK251102_lung_cytoE16_2_step05.2355.2355.1	1.2252	0.0286	700.71	28	6000.0%	1	K.GFVLHK.S
	TK251102_lung_cytoE16_2_step07.2964.2964.2	3.6372	0.5548	2114.15	1	5880.0%	7	K.SKSEEAHAEDSVMDHHFR.K
	TK251102_lung_cytoE16_2_step07.2123.2123.1	1.7747	0.173	1177.7	2	6250.0%	3	R.RFEKPLEEK.G
	TK251102_lung_cytoE16_2_step07.2196.2196.1	1.0466	0.0922	1322.41	4	2920.0%	1	R.KNPLPPSVGVADK.K
UFKB3_MOUSE99.6%5526.3%224251489.3(Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase)
	TK251102_lung_cytoE16_2_step11.0974.0974.1	1.2574	0.0188	827.47	54	4290.0%	1	K.VGVGKVIR.G
*	TK251102_lung_cytoE16_2_step08.3850.3850.2	1.7305	0.2899	3126.55	1	2410.0%	1	K.KGDVVHCWYTGTLPDGTVFDTNIQTSSK.K
*	TK251102_lung_cytoE16_2_step05.3336.3336.2	4.125	0.5188	1687.39	1	6920.0%	1	K.DHLVNAYNHLFESK.R
*	TK251102_lung_cytoE16_2_step11.2950.2950.2	2.3555	0.4757	2103.25	1	4120.0%	1	K.TANKDHLVNAYNHLFESK.R
	TK251102_lung_cytoE16_2_step02.1877.1877.1	1.1926	0.0148	616.49	14	6250.0%	1	K.KDIIK.F
UENOB_HUMAN99.6%5711.3%433468567.7(P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3)
*	TK251102_lung_cytoE16_2_step10.2317.2317.2	1.2065	0.0037	1387.08	13	4090.0%	1	R.HITGEKLGELYK.S
*	TK251102_lung_cytoE16_2_step04.1201.1201.2	1.2844	0.1393	1424.83	39	3750.0%	1	K.SPDDPARHITGEK.L
*	TK251102_lung_cytoE16_2_step02.4381.4381.3	4.821	0.0302	3023.62	1	2930.0%	1	R.HIADLAGNPDLILPVPAFNVINGGSHAGNK.L
UMCM2_MOUSE99.6%141612.2%9041020475.8(P97310) DNA replication licensing factor MCM2
*	TK251102_lung_cytoE16_2_step04.2713.2713.2	0.7777	0.0324	1319.91	302	2500.0%	1	K.LNQMDQDKVAR.M
*	TK251102_lung_cytoE16_2_step03.3461.3461.1	1.0124	0.1409	890.46	1	5830.0%	1	R.KLILQQF.-
	TK251102_lung_cytoE16_2_step03.2274.2274.1	1.0355	0.1834	885.56	14	5000.0%	1	R.HIESMIR.M
	TK251102_lung_cytoE16_2_step03.3623.3623.2	1.4165	0.1604	1306.53	1	6000.0%	1	R.ISHLPLVEELR.S
	TK251102_lung_cytoE16_2_step11.1522.1522.1	1.5736	0.3178	990.77	1	5710.0%	1	R.ITNHIHVR.I
	TK251102_lung_cytoE16_2_step10.1609.1609.1	0.7957	0.0389	558.37	5	6250.0%	1	K.GHSVR.E
	TK251102_lung_cytoE16_2_step06.3532.3532.2	1.2612	0.1814	1918.4	1	3750.0%	2	K.IFASIAPSIYGHEDIKR.G
	TK251102_lung_cytoE16_2_step07.3783.3783.1	0.9756	0.0077	786.73	18	5830.0%	1	R.MAEAHAR.M
	TK251102_lung_cytoE16_2_step08.2234.2234.1	1.3968	0.1389	900.59	22	5710.0%	1	R.FVVGSHVR.H
	TK251102_lung_cytoE16_2_step11.1501.1501.1	2.0433	0.3981	1378.6	1	6360.0%	1	R.THVDSHGHNVFK.E
*	TK251102_lung_cytoE16_2_step12.4705.4705.2	1.7907	0.0514	2026.07	2	3440.0%	1	R.QINIHNLSAFYDSDLFK.F
UQ6081799.6%11736.0%215233844.6(Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein)
	TK251102_lung_cytoE16_2_step05.0086.0086.1	1.8443	0.1612	1552.82	1	4170.0%	3	K.NILFVITKPDVYK.S
UQ91VW399.6%2435.5%93104775.1(Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3
*	TK251102_lung_cytoE16_2_step10.4874.4874.3	3.9966	0.3898	3829.17	1	2270.0%	2	K.ATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLK.L
UQ9DBR199.6%333.8%9511086877.6(Q9DBR1) 5'-3' exoribonuclease 2
	TK251102_lung_cytoE16_2_step11.2074.2074.1	2.3621	0.4404	1469.85	1	6250.0%	1	R.KPATVLKPGDWEK.S
	TK251102_lung_cytoE16_2_step07.2820.2820.3	1.0953	0.0324	1774.43	122	2140.0%	1	R.FERSVGAEPLLPWNR.M
	TK251102_lung_cytoE16_2_step08.1841.1841.1	1.111	0.0481	880.63	1	5000.0%	1	R.TLGHVTPR.G
UQ9QZ8399.6%4165.6%393436015.2(Q9QZ83) Gamma actin-like protein
*	TK251102_lung_cytoE16_2_step03.3355.3355.2	2.4573	0.2064	2346.09	1	3810.0%	4	R.KDLYANTVLSGGTTMYPGLADR.M
UQ9EQR099.6%336310.4%25042724266.6(Q9EQR0) Fatty acid synthase
*	TK251102_lung_cytoE16_2_step05.4004.4004.2	1.9389	0.2287	1313.78	2	5450.0%	1	K.EGGFLLVHTVLK.G
*	TK251102_lung_cytoE16_2_step12.3895.3895.2	1.7875	0.1672	2965.89	2	2000.0%	1	R.IPALLNTQPMLQLEYTATDRHPQALK.D
*	TK251102_lung_cytoE16_2_step04.3433.3433.3	1.537	0.0593	2852.4	3	1900.0%	1	K.EVRTGGLAFHSYFMEGIAPTLLQALK.K
*	TK251102_lung_cytoE16_2_step04.4691.4691.3	1.165	0.081	4195.31	2	1280.0%	1	-.MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDDDR.R
*	TK251102_lung_cytoE16_2_step08.3230.3230.1	2.0663	0.1349	852.86	3	5710.0%	2	K.ALHLVGLK.R
*	TK251102_lung_cytoE16_2_step09.0914.0914.1	0.7903	0.0756	781.56	89	4170.0%	1	R.KEPGGHR.I
*	TK251102_lung_cytoE16_2_step02.2921.2921.2	1.5405	0.2266	1681.75	1	5000.0%	2	K.SNMGHPEPASGLAALTK.V
*	TK251102_lung_cytoE16_2_step09.1553.1553.1	0.8887	0.1828	693.48	58	4000.0%	1	R.HPQALK.D
*	TK251102_lung_cytoE16_2_step02.2666.2666.2	3.0248	0.4209	1469.76	1	7730.0%	2	R.RQQEQLVPTLEK.F
*	TK251102_lung_cytoE16_2_step03.2627.2627.2	3.2589	0.54	1782.14	1	5940.0%	1	R.RVYATILNAGTNTDGSK.E
*	TK251102_lung_cytoE16_2_step01.4482.4482.1	1.179	0.0709	1412.74	1	4550.0%	1	K.DNLEFFLTNLGK.V
*	TK251102_lung_cytoE16_2_step06.2734.2734.2	2.0912	0.3556	1292.6	1	6000.0%	2	R.LQVVDRPLPVR.G
*	TK251102_lung_cytoE16_2_step12.2476.2476.1	1.4787	0.2316	978.78	1	5000.0%	1	R.KALHLVGLK.R
*	TK251102_lung_cytoE16_2_step06.2281.2281.1	1.9919	0.2385	1271.55	1	5560.0%	3	R.HFQLEQDKPK.E
*	TK251102_lung_cytoE16_2_step05.4363.4363.2	1.6621	0.3262	2503.85	2	2270.0%	2	K.VHLTGINVNPNALFPPVEFPAPR.G
*	TK251102_lung_cytoE16_2_step07.2650.2650.1	1.0954	0.1278	1062.7	1	4440.0%	2	R.GTPLISPHIK.W
*	TK251102_lung_cytoE16_2_step01.5284.5284.3	1.1786	0.0727	4629.7	3	1120.0%	1	K.VLLSLEHGVWAPNLHFHNPNPEIPALLDGRLQVVDRPLPVR.G
*	TK251102_lung_cytoE16_2_step11.5013.5013.2	2.929	0.4996	2467.35	1	4090.0%	4	R.TGGLAFHSYFMEGIAPTLLQALK.K
UDP30_MOUSE99.6%3916.2%99112134.9(Q99LT0) Dpy-30-like protein
	TK251102_lung_cytoE16_2_step05.4855.4855.2	3.2041	0.4227	1888.39	1	5670.0%	3	K.ERPPNPIEFLASYLLK.N
US111_MOUSE99.6%2252.0%98110835.5(P50543) Calgizzarin (Endothelial monocyte-activating polypeptide) (EMAP)
	TK251102_lung_cytoE16_2_step02.4738.4738.2	2.6999	0.3789	1850.88	1	6330.0%	1	K.TEFLSFMNTELAAFTK.N
*	TK251102_lung_cytoE16_2_step04.4759.4759.3	3.2692	0.4879	3983.43	1	2060.0%	1	K.LDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQK.R
URS15_HUMAN99.6%91147.9%1441690910.4(P11174) 40S ribosomal protein S15 (RIG protein) (P11174) 40S ribosomal protein S15 (RIG protein)
	TK251102_lung_cytoE16_2_step12.4491.4491.2	1.5655	0.2979	3170.64	1	2310.0%	1	K.TFNQVEIKPEMIGHYLGEFSITYKPVK.H
	TK251102_lung_cytoE16_2_step05.1352.1352.1	1.1549	0.0921	579.5	5	8330.0%	1	K.RTFR.K
	TK251102_lung_cytoE16_2_step12.1420.1420.2	1.2792	0.2249	1333.62	1	4580.0%	1	K.HGRPGIGATHSSR.F
	TK251102_lung_cytoE16_2_step05.2059.2059.2	3.3857	0.5212	1482.55	1	7500.0%	1	K.KEAPPMEKPEVVK.T
	TK251102_lung_cytoE16_2_step08.1961.1961.1	1.0852	0.161	715.61	14	7500.0%	1	R.KFTYR.G
	TK251102_lung_cytoE16_2_step11.1594.1594.1	2.1597	0.2588	855.87	1	6670.0%	2	R.KQHSLLK.R
ULDHA_MOUSE99.6%3015037.8%331363677.7(P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M)
*	TK251102_lung_cytoE16_2_step08.4326.4326.2	1.1893	0.0346	1608.08	22	3460.0%	1	K.GEMMDLQHGSLFLK.T
*	TK251102_lung_cytoE16_2_step01.2156.2156.2	2.0001	0.3903	1834.09	1	4000.0%	1	K.SLNPELGTDADKEQWK.E
*	TK251102_lung_cytoE16_2_step01.5251.5251.2	1.3293	0.2722	2910.79	1	2310.0%	1	K.GLYGINEDVFLSVPCILGQNGISDVVK.V
*	TK251102_lung_cytoE16_2_step12.2068.2068.2	1.8819	0.1765	1182.44	1	7780.0%	1	R.RVHPISTMIK.G
*	TK251102_lung_cytoE16_2_step10.3970.3970.2	1.3217	0.2569	1848.39	1	3670.0%	2	K.LKGEMMDLQHGSLFLK.T
	TK251102_lung_cytoE16_2_step06.4849.4849.2	3.4177	0.5213	1945.92	1	5310.0%	6	K.LLIVSNPVDILTYVAWK.I
*	TK251102_lung_cytoE16_2_step08.2674.2674.1	1.5103	0.0739	1028.39	3	5000.0%	6	R.VHPISTMIK.G
	TK251102_lung_cytoE16_2_step02.4793.4793.2	2.641	0.495	2114.56	1	5260.0%	8	K.GYTSWAIGLSVADLAESIMK.N
	TK251102_lung_cytoE16_2_step01.2330.2330.1	1.788	0.3285	1121.22	1	5000.0%	2	K.SADTLWGIQK.E
*	TK251102_lung_cytoE16_2_step01.3716.3716.1	2.3631	0.1059	1057.85	2	6880.0%	1	K.DQLIVNLLK.E
UQ9D3T699.6%2222.3%179201886.4(Q9D3T6) 4933436C10Rik protein
	TK251102_lung_cytoE16_2_step12.4695.4695.2	1.4286	0.0013	3011.48	9	1880.0%	1	K.HRTYVYVLTVTEILEDWEDSVNIGR.K
	TK251102_lung_cytoE16_2_step11.1728.1728.2	3.0839	0.5472	1852.18	1	6070.0%	1	K.VLQCHKPVHAEYLEK.L
URS1A_HUMAN99.6%2016634.1%1291470810.1(P39027) 40S ribosomal protein S15a
*	TK251102_lung_cytoE16_2_step06.4576.4576.2	3.3865	0.5672	2226.07	1	3680.0%	10	R.QFGFIVLTTSAGIMDHEEAR.R
*	TK251102_lung_cytoE16_2_step10.4607.4607.3	0.8863	0.0254	3334.83	2	800.0%	8	K.WQNNLLPSRQFGFIVLTTSAGIMDHEEAR.R
*	TK251102_lung_cytoE16_2_step01.2832.2832.1	1.6394	0.1224	976.07	2	6880.0%	1	R.MNVLADALK.S
*	TK251102_lung_cytoE16_2_step01.5310.5310.1	0.9744	0.2479	744.83	1	7000.0%	1	K.ILGFFF.-
UQ9BXJ999.6%577.3%8661012727.4(Q9BXJ9) Putative acetyltransferase (Putative N-acetyltransferase)
	TK251102_lung_cytoE16_2_step09.3867.3867.2	3.4632	0.4455	1274.63	1	8000.0%	1	R.RLPLNFLSGEK.F
	TK251102_lung_cytoE16_2_step05.1804.1804.1	1.1555	0.0433	939.46	12	5830.0%	1	K.FKECLDK.F
	TK251102_lung_cytoE16_2_step11.3212.3212.3	1.2614	0.0393	2019.81	6	2350.0%	2	K.EKVAIIEELVVGYETSLK.S
*	TK251102_lung_cytoE16_2_step03.3910.3910.3	1.506	0.0481	3219.87	16	1630.0%	1	R.AFAIDSSHPWLHECMIRLFNTAVCESK.D
UPA1G_MOUSE99.6%132545.3%232258536.9(Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit)
	TK251102_lung_cytoE16_2_step08.1755.1755.1	1.2473	0.1703	918.76	1	6430.0%	3	R.GQHPNPLR.E
	TK251102_lung_cytoE16_2_step05.2391.2391.2	2.5062	0.5129	1436.41	1	5910.0%	1	R.LENGELEHIRPK.I
*	TK251102_lung_cytoE16_2_step03.4689.4689.2	4.1247	0.5318	2695.41	1	4130.0%	2	R.ELFSPLHALNFGIGGDSTQHVLWR.L
*	TK251102_lung_cytoE16_2_step08.3526.3526.2	1.7663	0.2437	2447.45	1	2950.0%	1	K.IVVVWVGTNNHSHTAEQVTGGIK.A
	TK251102_lung_cytoE16_2_step11.3850.3850.3	4.068	0.5705	3456.71	1	3360.0%	1	R.AHFLDADPGFVHSDGTISHHDMYDYLHLSR.L
	TK251102_lung_cytoE16_2_step09.3437.3437.2	2.0091	0.2555	923.34	1	8570.0%	2	R.ALHSLLLR.L
USERA_MOUSE99.6%71313.2%485514496.9(Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment)
	TK251102_lung_cytoE16_2_step01.2496.2496.1	0.7946	0.1527	1100.66	44	2000.0%	1	R.GGIVDEGALLR.A
*	TK251102_lung_cytoE16_2_step04.1889.1889.3	1.4434	0.0605	1585.2	13	3210.0%	1	R.AVTGVDNVDLEPPTR.K
*	TK251102_lung_cytoE16_2_step01.0291.0291.1	1.8773	0.2511	1332.79	1	5420.0%	1	K.GTIQVVTQGTSLK.N
	TK251102_lung_cytoE16_2_step05.2781.2781.2	4.538	0.6328	2051.71	1	5000.0%	3	R.ALVDHENVISCPHLGASTK.E
*	TK251102_lung_cytoE16_2_step08.2258.2258.3	1.1751	0.0315	2234.54	2	2000.0%	1	K.LQVVGRAVTGVDNVDLEPPTR.K
UTCPQ_MOUSE99.6%93914.6%548595565.6(P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta)
*	TK251102_lung_cytoE16_2_step01.5334.5334.3	1.1166	0.1216	4103.06	15	1150.0%	1	K.TVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFK.H
*	TK251102_lung_cytoE16_2_step12.3645.3645.1	1.4738	0.0088	1518.4	3	3750.0%	1	K.NLRDVDEVSSLLR.T
*	TK251102_lung_cytoE16_2_step06.4206.4206.2	3.8477	0.6836	1897.58	1	4710.0%	6	K.ILGSGIYSSSVLHGMVFK.K
	TK251102_lung_cytoE16_2_step03.3207.3207.2	2.3876	0.4458	1280.03	1	7500.0%	1	K.KFAEAFEAIPR.A
UO5518199.6%2512122.9%280318898.4(O55181) RBP associated molecule RAM14-1
*	TK251102_lung_cytoE16_2_step03.2333.2333.2	1.206	0.3416	1198.36	1	5000.0%	1	R.YWHDNCFR.C
*	TK251102_lung_cytoE16_2_step06.2681.2681.3	1.7946	0.1402	2113.38	73	2060.0%	1	K.FCANTCVDCRKPISADAK.E
*	TK251102_lung_cytoE16_2_step05.2913.2913.1	2.5326	0.4902	1491.89	1	5000.0%	5	K.CLHPLASETFVSK.D
*	TK251102_lung_cytoE16_2_step06.1478.1478.1	1.0837	0.0369	719.5	5	6250.0%	2	R.HCCLK.C
	TK251102_lung_cytoE16_2_step07.3123.3123.2	2.9518	0.5217	2419.43	1	4210.0%	4	K.GSSVVAYEGQSWHDYCFHCK.K
*	TK251102_lung_cytoE16_2_step04.1345.1345.1	1.0285	0.1259	831.69	71	5000.0%	8	R.KPISADAK.E
UALFA_MOUSE99.6%133119.8%363392258.1(P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase)
	TK251102_lung_cytoE16_2_step01.1907.1907.1	1.266	0.1654	763.91	2	5830.0%	1	K.VLAAVYK.A
	TK251102_lung_cytoE16_2_step07.4206.4206.2	2.6617	0.4035	2091.64	1	4120.0%	1	R.VNPCIGGVILFHETLYQK.A
	TK251102_lung_cytoE16_2_step02.4045.4045.2	3.2576	0.6197	2107.76	1	6050.0%	1	K.IGEHTPSALAIMENANVLAR.Y
	TK251102_lung_cytoE16_2_step05.1960.1960.1	1.6563	0.2211	1070.7	3	5000.0%	2	K.KELSDIAHR.I
*	TK251102_lung_cytoE16_2_step10.2371.2371.2	2.1291	0.4286	1379.12	1	5000.0%	2	-.PHPYPALTPEQK.K
	TK251102_lung_cytoE16_2_step01.0678.0678.1	1.3844	0.1655	586.42	5	7000.0%	2	R.IVAPGK.G
UQ91VL399.6%9920.4%9201028045.6(Q91VL3) Similar to Rho guanine nucleotide exchange factor (GEF) 1
	TK251102_lung_cytoE16_2_step10.2346.2346.2	1.4414	0.3171	1316.53	1	7000.0%	1	R.EILHHVNQAVR.D
	TK251102_lung_cytoE16_2_step09.1851.1851.1	1.2633	0.1231	581.62	10	7500.0%	1	R.HLGVR.T
*	TK251102_lung_cytoE16_2_step06.4349.4349.2	1.108	0.195	2264.43	63	1580.0%	1	K.YPLLLQSIGQNTEESTERGK.V
*	TK251102_lung_cytoE16_2_step07.4524.4524.2	1.3487	0.1664	1845.43	37	2670.0%	1	R.RFIQEVVQSQQAAVSR.Q
*	TK251102_lung_cytoE16_2_step12.4233.4233.2	1.2884	0.037	1982.84	2	3330.0%	1	K.EPRFCAFVQEAESRPR.C
*	TK251102_lung_cytoE16_2_step12.3821.3821.2	2.5914	0.5447	2203.97	1	3750.0%	1	R.LRPLLSQLGGTLSPNLAAPER.S
*	TK251102_lung_cytoE16_2_step07.5294.5294.3	1.3551	0.0907	4791.58	11	1000.0%	1	R.VLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDR.L
*	TK251102_lung_cytoE16_2_step03.4749.4749.3	1.3761	0.0106	4271.02	49	1010.0%	1	R.SGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKR.R
*	TK251102_lung_cytoE16_2_step04.3233.3233.3	1.5301	0.1105	2359.48	60	1970.0%	1	R.LMGMTPWEQELSLLEPWIGK.D
URS23_HUMAN99.6%184032.9%1431580810.5(P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23
	TK251102_lung_cytoE16_2_step11.1666.1666.1	2.4329	0.2889	1208.04	1	5450.0%	2	R.KGHAVGDIPGVR.F
	TK251102_lung_cytoE16_2_step02.2189.2189.1	1.0687	0.0078	914.68	43	5000.0%	1	K.QPNSAIRK.C
	TK251102_lung_cytoE16_2_step06.1993.1993.1	1.4047	0.1475	812.58	17	4290.0%	2	K.AHLGTALK.A
	TK251102_lung_cytoE16_2_step05.2000.2000.1	2.0533	0.244	1058.5	1	5000.0%	4	K.ANPFGGASHAK.G
	TK251102_lung_cytoE16_2_step12.1632.1632.1	0.6783	0.0477	1007.45	11	5000.0%	1	K.WHDKQYK.K
	TK251102_lung_cytoE16_2_step11.1540.1540.1	2.5157	0.3725	940.66	1	6250.0%	2	K.KAHLGTALK.A
	TK251102_lung_cytoE16_2_step04.2119.2119.1	1.6573	0.2645	1078.5	2	4500.0%	2	K.GHAVGDIPGVR.F
UQ9QYF499.6%578.4%561625447.6(Q9QYF4) SYNCRIP protein
	TK251102_lung_cytoE16_2_step01.4978.4978.1	2.7541	0.4291	1597.72	1	5000.0%	1	R.DLFEDELVPLFEK.A
	TK251102_lung_cytoE16_2_step04.1759.1759.1	1.2688	0.1402	1061.26	3	5000.0%	2	K.LYNNHEIR.S
	TK251102_lung_cytoE16_2_step03.1250.1250.3	1.3183	0.0717	2069.81	10	2210.0%	1	K.VTEGLTDVILYHQPDDKK.K
	TK251102_lung_cytoE16_2_step10.3390.3390.2	1.1948	0.038	1886.29	7	3330.0%	1	K.EAAQEAVKLYNNHEIR.S
UQ91VL299.6%7916.5%382443189.6(Q91VL2) Unknown (Protein for IMAGE:3669867) (Fragment)
	TK251102_lung_cytoE16_2_step08.2925.2925.2	1.398	0.2765	1530.65	1	5000.0%	2	R.SIFQHIQSAQSQR.S
*	TK251102_lung_cytoE16_2_step10.2426.2426.1	0.8809	0.0165	828.56	5	5830.0%	1	K.RSESGHR.G
	TK251102_lung_cytoE16_2_step09.3992.3992.3	1.1374	0.0079	2282.48	5	2370.0%	1	R.MDSFDEDLARPSGLLAQERK.L
*	TK251102_lung_cytoE16_2_step09.1532.1532.1	0.6637	0.028	1005.57	45	1880.0%	1	K.RGNEQEAAK.N
	TK251102_lung_cytoE16_2_step11.1749.1749.2	1.8559	0.3616	1625.75	1	5000.0%	1	K.EHHFGSSGMTLHER.F
UQ925K499.6%393.5%454499475.7(Q925K4) Copine 1 protein (Fragment)
	TK251102_lung_cytoE16_2_step10.3906.3906.2	2.8457	0.5335	1784.69	1	5000.0%	3	R.LYGPTNFAPIINHVAR.F
URHOA_MOUSE99.6%81232.1%193217826.1(Q9QUI0) Transforming protein RhoA
	TK251102_lung_cytoE16_2_step05.1300.1300.2	0.6778	0.013	1431.3	11	2270.0%	2	K.MKQEPVKPEEGR.D
	TK251102_lung_cytoE16_2_step04.3452.3452.1	0.8355	0.0124	1595.91	6	3080.0%	1	R.EVFEMATRAALQAR.R
	TK251102_lung_cytoE16_2_step11.3321.3321.2	1.0016	0.0169	1922.4	4	3440.0%	1	R.DMANRIGAFGYMECSAK.T
	TK251102_lung_cytoE16_2_step01.1091.1091.1	1.1593	0.0495	561.41	1	8750.0%	1	-.MAAIR.K
	TK251102_lung_cytoE16_2_step05.3713.3713.2	1.5635	0.2388	1610.37	1	5000.0%	2	K.HFCPNVPIILVGNK.K
UGTP1_MOUSE99.6%103022.0%209234067.8(P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi)
	TK251102_lung_cytoE16_2_step07.2643.2643.2	1.4475	0.1384	1940.49	3	3530.0%	2	K.AFLSSPEHVNRPINGNGK.Q
	TK251102_lung_cytoE16_2_step03.2482.2482.2	1.2728	0.0647	2067.96	1	3890.0%	3	K.AFLSSPEHVNRPINGNGKQ.-
	TK251102_lung_cytoE16_2_step12.3505.3505.2	3.4807	0.3158	2139.44	1	5260.0%	4	K.ALPGHLKPFETLLSQNQGGK.A
	TK251102_lung_cytoE16_2_step02.2134.2134.1	0.5888	0.0962	735.09	22	3330.0%	1	R.SLGLYGK.N
UQ91VC399.6%6145.8%411468406.7(Q91VC3) Unknown (Protein for MGC:6715) (Hypothetical 46.8 kDa protein)
	TK251102_lung_cytoE16_2_step07.2926.2926.1	1.7562	0.2747	975.65	1	5620.0%	2	R.KGVAINFVK.N
	TK251102_lung_cytoE16_2_step08.2219.2219.2	3.2235	0.4417	1599.04	1	6430.0%	3	R.KLDYGQHVVAGTPGR.V
UKINH_MOUSE99.6%142011.6%9631095496.3(Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC)
	TK251102_lung_cytoE16_2_step10.4563.4563.3	1.3421	0.0996	2678.84	89	1700.0%	1	K.EVLQALEELAVNYDQKSQEVEDK.T
	TK251102_lung_cytoE16_2_step04.2168.2168.2	2.6774	0.3184	1361.87	1	7000.0%	2	R.FRPLNESEVNR.G
	TK251102_lung_cytoE16_2_step08.1854.1854.2	3.3073	0.5265	1482.49	1	8750.0%	2	R.HVAVTNMNEHSSR.S
	TK251102_lung_cytoE16_2_step06.2666.2666.2	0.8743	0.0528	1862.01	30	2330.0%	1	K.EVLQALEELAVNYDQK.S
	TK251102_lung_cytoE16_2_step02.2735.2735.2	1.0967	0.0704	1333.76	139	3500.0%	1	R.DNADLRCELPK.L
	TK251102_lung_cytoE16_2_step12.1107.1107.1	0.7056	0.113	960.35	60	2860.0%	1	K.ELAACQLR.I
	TK251102_lung_cytoE16_2_step09.3059.3059.3	1.2303	0.0061	3293.41	56	1170.0%	1	K.DLAEIGIAVGNNDVKQPEGTGMIDEEFTVAR.L
	TK251102_lung_cytoE16_2_step11.2042.2042.1	1.5874	0.1811	1370.94	1	4500.0%	2	R.KLHELTVMQDR.R
	TK251102_lung_cytoE16_2_step08.2541.2541.1	0.7191	0.0308	463.3	6	5000.0%	1	K.SEVK.T
UQ91V8699.6%222229.5%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence)
*	TK251102_lung_cytoE16_2_step03.2607.2607.2	3.058	0.5788	1110.08	1	8640.0%	11	K.VVAGVAAALAHK.Y
*	TK251102_lung_cytoE16_2_step11.2704.2704.2	2.8587	0.5156	1407.26	1	6920.0%	1	K.VVAGVAAALAHKYH.-
UO7014099.6%138118.6%247283187.8(O70140) Calcyclin binding protein (Fragment)
*	TK251102_lung_cytoE16_2_step05.3263.3263.2	5.4191	0.661	2442.76	1	5230.0%	4	K.KPELDNEKPAAVVAPLTTGYTVK.I
	TK251102_lung_cytoE16_2_step10.3930.3930.2	3.6256	0.5708	2685.44	1	4090.0%	8	K.IYITLTGVHQVPTENVQVHFTER.S
USYR_MOUSE99.6%6610.5%660756747.6(Q9D0I9) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA ligase) (ArgRS)
	TK251102_lung_cytoE16_2_step11.1584.1584.1	1.5804	0.2369	978.5	1	6430.0%	1	K.EMHVGHLR.S
*	TK251102_lung_cytoE16_2_step04.3239.3239.2	0.9167	0.1054	2471.42	70	1360.0%	1	K.DFVSEQLTSLLVNGVQLPVLGDK.E
	TK251102_lung_cytoE16_2_step10.1282.1282.1	0.3435	0.0193	447.36	4	1670.0%	1	R.SIAR.L
*	TK251102_lung_cytoE16_2_step11.3721.3721.2	3.663	0.5834	2043.76	1	5880.0%	1	K.YIDKVEIAGPGFINVHLR.K
*	TK251102_lung_cytoE16_2_step09.3893.3893.3	1.3399	0.0993	1570.48	120	1920.0%	1	R.LANIDEAMLQRAAR.E
*	TK251102_lung_cytoE16_2_step08.2322.2322.3	1.4385	0.0476	2730.74	18	1670.0%	1	K.DFVSEQLTSLLVNGVQLPVLGDKEK.V
UVTDB_MOUSE99.6%3311.9%472530865.3(P21614) Vitamin D-binding protein precursor (DBP) (Group-specific component) (GC-globulin) (VDB) (Fragment)
*	TK251102_lung_cytoE16_2_step03.3245.3245.2	3.3016	0.5473	1742.59	1	6430.0%	1	R.KFSSSTFEQVNQLVK.E
*	TK251102_lung_cytoE16_2_step05.1536.1536.3	1.4556	0.0878	3614.8	10	1470.0%	1	K.LCMAALSHQPQEFPTYVEPTNDEICEAFRR.D
*	TK251102_lung_cytoE16_2_step08.3414.3414.2	1.7456	0.1842	1274.2	1	6500.0%	1	K.HLSLLTTMSNR.V
UQ9D7P799.6%246.8%207235516.5(Q9D7P7) 2300003G24Rik protein
*	TK251102_lung_cytoE16_2_step06.2718.2718.2	3.48	0.6029	1627.09	1	6920.0%	2	R.APLDHELAQEPHLR.E
UPDI_MOUSE99.6%87188331.4%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59)
	TK251102_lung_cytoE16_2_step01.4315.4315.1	1.4337	0.2277	966.88	3	5710.0%	1	R.ILEFFGLK.K
	TK251102_lung_cytoE16_2_step01.3654.3654.1	1.5736	0.1332	1204.16	1	5560.0%	1	R.EADDIVNWLK.K
	TK251102_lung_cytoE16_2_step05.1701.1701.1	0.6439	0.1524	697.02	41	5000.0%	1	K.EYTAGR.E
	TK251102_lung_cytoE16_2_step08.4817.4817.2	4.5139	0.7252	2989.17	1	4310.0%	8	R.TGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK251102_lung_cytoE16_2_step11.2494.2494.2	2.9234	0.5166	2406.07	1	3950.0%	1	K.IKPHLMSQEVPEDWDKQPVK.V
	TK251102_lung_cytoE16_2_step04.4043.4043.2	3.4391	0.5296	1968.58	1	6560.0%	12	K.HNQLPLVIEFTEQTAPK.I
	TK251102_lung_cytoE16_2_step01.3351.3351.1	1.2213	0.0056	750.82	19	6000.0%	1	K.LLDFIK.H
	TK251102_lung_cytoE16_2_step11.3901.3901.1	1.8143	0.1193	1084.25	1	5620.0%	4	K.THILLFLPK.S
	TK251102_lung_cytoE16_2_step08.2657.2657.1	2.2277	0.3725	930.59	1	7860.0%	3	K.VHSFPTLK.F
	TK251102_lung_cytoE16_2_step08.4357.4357.2	3.7243	0.439	1837.98	1	7500.0%	40	K.ILFIFIDSDHTDNQR.I
	TK251102_lung_cytoE16_2_step05.2592.2592.1	2.519	0.3482	1346.59	1	5910.0%	3	K.KSNFEEALAAHK.Y
	TK251102_lung_cytoE16_2_step03.1787.1787.1	1.0093	0.0534	962.44	147	4170.0%	1	K.ITEFCHR.F
	TK251102_lung_cytoE16_2_step10.3211.3211.2	2.9304	0.363	1956.12	1	5670.0%	5	K.IKPHLMSQEVPEDWDK.Q
	TK251102_lung_cytoE16_2_step01.1523.1523.1	1.5196	0.2577	1410.12	1	5000.0%	1	K.YKPESDELTAEK.I
UQ8R01699.6%183824.2%455525116.5(Q8R016) Similar to bleomycin hydrolase
	TK251102_lung_cytoE16_2_step02.1831.1831.2	1.517	0.1311	1396.26	2	5450.0%	1	R.VENSWGEDHGHK.G
*	TK251102_lung_cytoE16_2_step11.2450.2450.2	3.1443	0.5728	2731.38	1	3750.0%	3	R.ATVQGAQHVFQHVVPQEGKPVTNQK.S
*	TK251102_lung_cytoE16_2_step02.4426.4426.2	1.2923	0.2982	2238.35	2	2630.0%	2	K.LGLSDMNVYDHELVFGVSLK.N
	TK251102_lung_cytoE16_2_step05.1663.1663.2	1.203	0.0987	927.82	2	5620.0%	1	R.NLVHSGATK.G
	TK251102_lung_cytoE16_2_step06.3037.3037.1	1.3388	0.1268	1488.66	1	4090.0%	2	K.EHVKPLFNMEDK.I
*	TK251102_lung_cytoE16_2_step04.4317.4317.2	1.3744	0.0917	2174.41	1	2630.0%	3	R.LAFGESLMTHAMTFTAVSEK.D
*	TK251102_lung_cytoE16_2_step10.2546.2546.2	2.1749	0.3555	1512.25	1	5910.0%	1	K.ICFVNDPRPQHK.Y
UHMG2_MOUSE99.6%71513.9%209240317.3(P30681) High mobility group protein 2 (HMG-2)
*	TK251102_lung_cytoE16_2_step08.2949.2949.2	3.0635	0.5428	1580.66	1	7140.0%	3	K.IKIEHPGLSIGDTAK.K
	TK251102_lung_cytoE16_2_step08.2971.2971.2	1.8234	0.1402	1594.27	1	4230.0%	1	K.KHPDSSVNFAEFSK.K
UQ9CYG699.6%397.7%222249486.0(Q9CYG6) 5730478E03Rik protein
	TK251102_lung_cytoE16_2_step05.4009.4009.2	4.2139	0.5945	1833.96	1	6880.0%	3	R.ATAAFILANEHNVALFK.H
UQ9CTB999.6%41015.4%195224399.6(Q9CTB9) 1110030K07Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step08.2835.2835.2	3.4865	0.5749	1864.89	1	7330.0%	3	R.TQIALSPNNHEVHIYK.K
	TK251102_lung_cytoE16_2_step07.3047.3047.2	1.4599	0.1112	1575.19	12	3850.0%	1	K.EHNGHITGIDWAPK.S
UQ9CZU399.6%686.5%10401176366.4(Q9CZU3) 2610528A15Rik protein
	TK251102_lung_cytoE16_2_step05.2937.2937.1	1.4179	0.0207	1541.79	27	3330.0%	1	K.LPQVEHVLPLLKR.G
	TK251102_lung_cytoE16_2_step02.4614.4614.2	1.1519	0.1477	2928.45	1	1800.0%	1	K.QLLKGSADPLNSAFHLTYNMVLNLLR.V
	TK251102_lung_cytoE16_2_step07.2234.2234.2	1.2643	0.0349	1771.41	19	2670.0%	1	K.NEGDDFGWGVVVNFSK.K
	TK251102_lung_cytoE16_2_step07.4031.4031.2	3.3291	0.5121	1386.5	1	7730.0%	2	K.LPQVEHVLPLLK.R
	TK251102_lung_cytoE16_2_step11.3356.3356.1	0.6009	0.0654	1593.32	13	1670.0%	1	K.YCLPFLQPGRLVK.V
UPUR9_MOUSE99.6%102012.2%592641576.8(Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)]
*	TK251102_lung_cytoE16_2_step01.4515.4515.2	1.3868	0.0502	2581.83	1	3040.0%	1	K.RAEISNAIDQYVTGTIGEGEDLVK.W
*	TK251102_lung_cytoE16_2_step01.2188.2188.1	0.7985	0.0481	1146.76	22	2270.0%	1	R.GAVDIPAAASFK.H
*	TK251102_lung_cytoE16_2_step07.2048.2048.1	1.2809	0.0466	583.49	1	7500.0%	2	R.HLALK.A
	TK251102_lung_cytoE16_2_step12.2379.2379.1	1.7467	0.2991	1357.88	1	5420.0%	3	K.TLHPAVHAGILAR.N
*	TK251102_lung_cytoE16_2_step02.3531.3531.2	0.8734	0.1084	2090.02	16	1760.0%	1	R.YGMNPHQTPAQLYTLKPK.L
USPCN_HUMAN99.6%12204.6%24722842815.3(Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
*	TK251102_lung_cytoE16_2_step10.3950.3950.2	4.0522	0.5561	2179.25	1	5260.0%	1	K.KHEALMSDLSAYGSSIQALR.E
	TK251102_lung_cytoE16_2_step10.2911.2911.2	1.4757	0.3826	1764.87	5	3570.0%	1	K.KHQLLEADISAHEDR.L
	TK251102_lung_cytoE16_2_step10.2995.2995.1	0.9531	0.1303	847.7	11	5000.0%	1	R.LHQFFR.D
*	TK251102_lung_cytoE16_2_step03.3610.3610.2	2.6314	0.4658	1417.85	1	6670.0%	1	K.KGDILTLLNSTNK.D
	TK251102_lung_cytoE16_2_step02.2013.2013.2	0.9634	0.0174	1525.62	49	2730.0%	1	R.DMDDEESWIKEK.K
*	TK251102_lung_cytoE16_2_step06.3941.3941.3	1.7705	0.2122	2912.83	1	2100.0%	1	K.HEALMSDLSAYGSSIQALREQAQSCR.Q
*	TK251102_lung_cytoE16_2_step09.2449.2449.2	2.5785	0.4508	1558.33	1	5380.0%	2	K.HQALQAEIAGHEPR.I
	TK251102_lung_cytoE16_2_step10.4819.4819.2	2.4922	0.3931	2878.79	1	3000.0%	3	R.AGTFQAFEQFGQQLLAHGHYASPEIK.Q
UADHA_MOUSE99.6%4342729.9%374396408.1(P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2)
	TK251102_lung_cytoE16_2_step01.2344.2344.1	1.4459	0.2201	896.8	14	5000.0%	2	K.LVADFMAK.K
*	TK251102_lung_cytoE16_2_step01.3368.3368.1	1.8124	0.1118	1092.78	5	5620.0%	2	K.INEAFDLLR.S
	TK251102_lung_cytoE16_2_step01.2816.2816.1	1.4534	0.0359	796.83	1	7140.0%	2	K.GAIFGGFK.S
*	TK251102_lung_cytoE16_2_step03.0080.0080.2	1.045	0.0975	1966.42	79	2670.0%	1	K.VIPLFSPQCGECRICK.H
*	TK251102_lung_cytoE16_2_step04.1523.1523.1	1.2403	0.2287	1135.61	1	4380.0%	3	K.HPESNFCSR.S
*	TK251102_lung_cytoE16_2_step02.4690.4690.2	4.3045	0.5917	1766.74	1	7500.0%	1	K.FPLDPLITHVLPFEK.I
*	TK251102_lung_cytoE16_2_step05.4423.4423.2	3.4566	0.4415	2507.55	1	3570.0%	13	K.AAVLWELHKPFTIEDIEVAPPK.A
*	TK251102_lung_cytoE16_2_step11.4865.4865.2	2.734	0.4493	1898.11	1	6330.0%	15	K.KFPLDPLITHVLPFEK.I
*	TK251102_lung_cytoE16_2_step09.4184.4184.2	3.186	0.5709	2687.77	1	3480.0%	3	K.QIHNFISTSTFSQYTVVDDIAVAK.I
UQ91V4199.6%92336.7%215238976.2(Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512)
	TK251102_lung_cytoE16_2_step08.3801.3801.2	1.2317	0.2271	1625.14	2	3930.0%	4	R.NLTNPNTVIILIGNK.A
	TK251102_lung_cytoE16_2_step02.2947.2947.1	1.3595	0.1287	1262.58	2	5560.0%	1	K.SCLLHQFTEK.K
	TK251102_lung_cytoE16_2_step04.2727.2727.3	3.8675	0.6068	3153.22	1	2930.0%	1	K.IYQNIQDGSLDLNAAESGVQHKPSAPQGGR.L
*	TK251102_lung_cytoE16_2_step09.4259.4259.3	1.5377	0.0098	2715.5	5	2070.0%	1	-.MATAPYNYSYIFKYIIIGDMGVGK.S
UVIME_MOUSE99.6%101621.9%465535575.1(P20152) Vimentin
	TK251102_lung_cytoE16_2_step01.4050.4050.1	2.2191	0.0934	1171.97	6	6110.0%	1	K.ILLAELEQLK.G
*	TK251102_lung_cytoE16_2_step10.4330.4330.3	3.3678	0.5853	4042.33	1	1910.0%	2	K.KLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALR.D
	TK251102_lung_cytoE16_2_step01.1963.1963.1	1.2551	0.1594	1257.13	7	4440.0%	1	R.LGDLYEEEMR.E
	TK251102_lung_cytoE16_2_step08.3107.3107.3	1.2548	0.0428	2399.49	5	2110.0%	1	R.EYQDLLNVKMALDIEIATYR.K
	TK251102_lung_cytoE16_2_step05.3893.3893.2	1.4465	0.2585	1535.92	1	5000.0%	2	R.KVESLQEEIAFLK.K
	TK251102_lung_cytoE16_2_step03.2641.2641.2	1.3402	0.0848	1499.52	2	4620.0%	1	R.TYSLGSALRPSTSR.S
UCDK4_MOUSE99.6%91729.4%303337516.6(P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3)
*	TK251102_lung_cytoE16_2_step06.4000.4000.3	1.3686	0.0232	2345.25	7	2140.0%	1	-.MAATRYEPVAEIGVGAYGTVYK.A
*	TK251102_lung_cytoE16_2_step06.2041.2041.2	2.7299	0.4354	1757.23	1	5710.0%	1	R.ALQHSYLHKEESDAE.-
	TK251102_lung_cytoE16_2_step10.2973.2973.2	3.6616	0.5925	1470.67	1	7270.0%	2	R.RLEAFEHPNVVR.L
	TK251102_lung_cytoE16_2_step11.2909.2909.3	1.0758	0.0311	3377.96	6	1520.0%	1	R.APEVLLQSTYATPVDMWSVGCIFAEMFRR.K
	TK251102_lung_cytoE16_2_step09.2451.2451.1	1.77	0.3967	1209.53	1	6000.0%	3	R.DPHSGHFVALK.S
UTRFE_MOUSE99.6%6731732.7%697767247.2(Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin)
*	TK251102_lung_cytoE16_2_step02.1854.1854.1	1.6168	0.088	1112.5	1	5620.0%	1	K.KTSYPDCIK.A
*	TK251102_lung_cytoE16_2_step02.2750.2750.2	1.9399	0.3267	1478.03	1	6250.0%	1	K.KGTDFQLNQLEGK.K
*	TK251102_lung_cytoE16_2_step01.1672.1672.1	1.2212	0.2713	816.17	1	5830.0%	1	K.NPAEWAK.N
*	TK251102_lung_cytoE16_2_step04.2840.2840.1	1.7869	0.3363	1173.65	1	5000.0%	2	K.WCALSHLER.T
*	TK251102_lung_cytoE16_2_step10.2322.2322.2	1.0082	0.0583	2299.37	43	2000.0%	1	K.GYYAVAVVKASDTSITWNNLK.G
	TK251102_lung_cytoE16_2_step07.1536.1536.1	0.9191	0.0166	889.48	21	4290.0%	3	K.SCHTGLGR.S
*	TK251102_lung_cytoE16_2_step01.3764.3764.1	2.6534	0.4844	1242.01	1	6500.0%	2	K.DFQLFSSPLGK.D
*	TK251102_lung_cytoE16_2_step11.4628.4628.2	0.9987	0.0021	3182.3	78	1670.0%	1	R.DQYELLCLDNTRKPVDQYEDCYLAR.I
*	TK251102_lung_cytoE16_2_step08.2581.2581.2	3.9657	0.4767	2009.76	1	6180.0%	4	K.DFASCHLAQAPNHVVVSR.K
	TK251102_lung_cytoE16_2_step01.1938.1938.1	1.1323	0.0784	738.04	29	5830.0%	1	G.GDVAFVK.H
*	TK251102_lung_cytoE16_2_step03.2593.2593.2	4.5219	0.6197	2040.5	1	5880.0%	5	K.HQTVLDNTEGKNPAEWAK.N
*	TK251102_lung_cytoE16_2_step01.0679.0679.1	1.044	0.1585	590.28	14	7500.0%	1	R.LACVK.K
*	TK251102_lung_cytoE16_2_step05.3241.3241.1	1.0117	0.1201	1422.67	1	5000.0%	9	R.LYLGHNYVTAIR.N
*	TK251102_lung_cytoE16_2_step03.3562.3562.2	3.5192	0.5678	1454.9	1	7500.0%	1	K.SKDFQLFSSPLGK.D
	TK251102_lung_cytoE16_2_step01.2766.2766.1	1.2251	0.1781	663.71	3	7500.0%	1	K.DLLFR.D
	TK251102_lung_cytoE16_2_step02.1662.1662.2	1.8196	0.285	915.86	1	7860.0%	1	K.VAQEHFGK.G
*	TK251102_lung_cytoE16_2_step10.1818.1818.2	2.1208	0.4347	951.12	1	8750.0%	3	R.IPSHAVVAR.K
*	TK251102_lung_cytoE16_2_step01.4459.4459.1	1.2493	0.2288	1573.71	21	2920.0%	1	K.NNGKEDLIWEILK.V
	TK251102_lung_cytoE16_2_step11.1386.1386.1	1.4109	0.0785	1016.44	1	6250.0%	1	K.KSCHTGLGR.S
*	TK251102_lung_cytoE16_2_step02.3463.3463.2	1.9354	0.3883	1314.35	1	6500.0%	1	K.HTTIFEVLPEK.A
*	TK251102_lung_cytoE16_2_step01.2836.2836.1	1.6457	0.2436	879.97	2	6430.0%	2	K.DSAFGLLR.V
*	TK251102_lung_cytoE16_2_step10.2530.2530.1	1.1846	0.1598	1257.62	1	4440.0%	2	R.LLEACTFHKH.-
*	TK251102_lung_cytoE16_2_step01.1540.1540.1	2.3149	0.4415	1243.7	1	6500.0%	2	K.HQTVLDNTEGK.N
	TK251102_lung_cytoE16_2_step01.2348.2348.1	1.4363	0.0359	635.65	1	7500.0%	1	K.DLLFK.D
*	TK251102_lung_cytoE16_2_step12.1541.1541.1	0.9115	0.2496	1349.71	4	2270.0%	1	K.GTDFQLNQLEGK.K
UCAP1_MOUSE99.6%112315.8%474515757.5(P40124) Adenylyl cyclase-associated protein 1 (CAP 1)
	TK251102_lung_cytoE16_2_step05.5337.5337.2	0.6956	0.0521	2744.87	46	1460.0%	1	R.SALFAQINQGESITHALKHVSDDMK.T
	TK251102_lung_cytoE16_2_step04.3528.3528.2	2.0305	0.2438	1931.09	2	3530.0%	3	R.SALFAQINQGESITHALK.H
*	TK251102_lung_cytoE16_2_step11.2876.2876.1	0.7005	0.0337	1194.95	65	2500.0%	1	K.MSKEIGGDVQK.H
	TK251102_lung_cytoE16_2_step11.1362.1362.1	1.4364	0.1535	910.77	5	5000.0%	1	K.THKNPALK.A
*	TK251102_lung_cytoE16_2_step12.2405.2405.3	1.945	0.1706	2433.73	3	2250.0%	1	K.LSDLLAPISEQIQEVITFREK.N
	TK251102_lung_cytoE16_2_step08.2150.2150.1	2.395	0.4726	1124.47	1	6110.0%	3	K.HAEMVHTGLK.L
UQ91V3199.6%2216.9%295328384.9(Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence)
	TK251102_lung_cytoE16_2_step02.4070.4070.2	3.4497	0.5398	2618.99	1	3860.0%	1	K.FLAAGTHLGGTNLDFQMEQYIYK.R
	TK251102_lung_cytoE16_2_step01.3915.3915.2	2.313	0.4632	3000.72	1	3080.0%	1	R.ADHQPLTEASYVNLPTIALCNTDSPLR.Y
UPTPA_MOUSE99.6%101631.6%323367106.4(P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA)
	TK251102_lung_cytoE16_2_step06.1992.1992.1	1.9102	0.3822	1254.63	1	7000.0%	1	K.KEIHTVPDMGK.W
	TK251102_lung_cytoE16_2_step03.4014.4014.2	3.2737	0.5444	2458.75	1	4760.0%	1	K.TGPFAEHSNQLWNISAVPSWSK.V
*	TK251102_lung_cytoE16_2_step11.0560.0560.2	1.046	0.0535	2648.54	198	1360.0%	1	K.LVALLDTLDRWIDETPPVDQPSR.F
*	TK251102_lung_cytoE16_2_step06.3024.3024.2	1.2734	0.2126	2323.91	1	2750.0%	1	R.QPPPDSSEETPPTTQNFIIPK.K
*	TK251102_lung_cytoE16_2_step03.2505.2505.1	1.0666	0.0121	914.67	5	5000.0%	1	K.KLTFDYK.V
	TK251102_lung_cytoE16_2_step10.3151.3151.1	1.9083	0.3734	1017.71	1	5710.0%	3	K.FPVIQHFK.F
*	TK251102_lung_cytoE16_2_step12.2403.2403.2	1.3372	0.161	1329.08	9	4440.0%	1	K.VFDRYLEVMR.K
UTCPD_MOUSE99.6%133112.8%539580668.0(P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45)
	TK251102_lung_cytoE16_2_step03.3050.3050.1	1.4067	0.2633	1183.5	1	5560.0%	1	R.SIHDALCVIR.C
	TK251102_lung_cytoE16_2_step05.3141.3141.1	2.8571	0.4555	1458.56	1	5420.0%	4	K.GIHPTIISESFQK.A
	TK251102_lung_cytoE16_2_step06.5294.5294.2	0.9098	0.0879	1347.36	34	2270.0%	1	K.IGLIQFCLSAPK.T
*	TK251102_lung_cytoE16_2_step03.3763.3763.1	0.7594	0.0403	903.63	12	5000.0%	1	-.MPENVASR.S
*	TK251102_lung_cytoE16_2_step02.3119.3119.2	0.92	0.0978	1550.09	248	2330.0%	1	R.ALIAGGGAPEIELALR.L
	TK251102_lung_cytoE16_2_step06.2206.2206.2	1.2804	0.1894	1151.13	2	6670.0%	1	K.QMQVLHPAAR.M
UK22E_HUMAN99.6%92114.7%645658658.0(P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e)
*	TK251102_lung_cytoE16_2_step01.5143.5143.2	0.9638	0.1262	2259.72	11	1850.0%	1	R.QSGSRGGSGGGGSISGGGYGSGGGSGGR.Y
*	TK251102_lung_cytoE16_2_step08.4814.4814.2	1.7016	0.1231	2653.56	10	1830.0%	1	R.SLVGLGGTKSISISVAGGGGGFGAAGGFGGR.G
*	TK251102_lung_cytoE16_2_step01.1080.1080.1	1.1021	0.0152	715.41	11	5710.0%	1	R.YGSGGGSK.G
*	TK251102_lung_cytoE16_2_step03.1894.1894.1	2.1022	0.3241	1391.57	1	5910.0%	1	R.SKEEAEALYHSK.Y
*	TK251102_lung_cytoE16_2_step09.2316.2316.1	1.7195	0.3152	1322.68	1	4330.0%	4	R.HGGGGGGFGGGGFGSR.S
UU5S1_MOUSE99.6%5510.8%9711093615.0(O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa)
	TK251102_lung_cytoE16_2_step03.0103.0103.3	1.0406	0.0533	2662.81	93	1550.0%	1	R.YDQDLCYTDILFTEQERGVGIK.S
	TK251102_lung_cytoE16_2_step08.4733.4733.3	1.411	0.1563	3242.69	52	1200.0%	1	-.MDTDLYDEFGNYIGPELDSDEDDDELGR.E
	TK251102_lung_cytoE16_2_step03.3142.3142.3	1.6212	0.0596	2456.9	58	1790.0%	1	K.GLSEDVSISKFFDDPMLLELAK.Q
	TK251102_lung_cytoE16_2_step03.3094.3094.2	3.2612	0.3092	1895.99	1	5290.0%	1	R.GHVTQDAPIPGSPLYTIK.A
	TK251102_lung_cytoE16_2_step09.1904.1904.2	1.1844	0.1577	1737.96	19	2860.0%	1	K.FKILDAVVAQEPLHR.G
UAPA4_MOUSE99.6%112914.4%395450295.6(P06728) Apolipoprotein A-IV precursor (Apo-AIV)
*	TK251102_lung_cytoE16_2_step03.4663.4663.3	2.3894	0.0134	2935.57	17	1760.0%	1	K.LGDASTYADGVHNKLVPFVVQLSGHLAK.E
	TK251102_lung_cytoE16_2_step06.1462.1462.1	1.2725	0.0019	647.44	4	7500.0%	1	K.EEIKK.E
*	TK251102_lung_cytoE16_2_step05.3265.3265.1	2.5633	0.457	1548.72	1	5830.0%	3	K.LNHQMEGLAFQMK.K
*	TK251102_lung_cytoE16_2_step05.4581.4581.2	3.3948	0.6194	2026.6	1	5590.0%	4	K.LVPFVVQLSGHLAKETER.V
*	TK251102_lung_cytoE16_2_step07.1524.1524.1	0.9774	2.0E-4	828.26	2	5830.0%	1	R.MMPHANK.V
UQ91V1299.6%4615.7%338375557.5(Q91V12) Acyl-CoA hydrolase (Hypothetical 37.6 kDa protein)
	TK251102_lung_cytoE16_2_step08.2879.2879.3	1.5677	0.0806	2081.48	1	2890.0%	1	R.IMRPDDANVAGNVHGGTILK.M
*	TK251102_lung_cytoE16_2_step12.2192.2192.3	1.2189	0.0232	3744.3	5	1330.0%	1	R.YRAASAFFTYVSLNQEGKPMPVPQLVPETEDEK.K
URL12_MOUSE99.6%72718.8%165177919.4(P35979) 60S ribosomal protein L12
	TK251102_lung_cytoE16_2_step09.4029.4029.2	1.8717	0.2493	1688.52	1	5360.0%	5	K.HSGNITFDEIVNIAR.Q
	TK251102_lung_cytoE16_2_step02.2777.2777.1	1.2591	0.0808	883.69	66	4380.0%	1	K.IGPLGLSPK.K
	TK251102_lung_cytoE16_2_step05.1535.1535.1	0.9832	0.0812	810.55	49	4170.0%	1	K.ALKEPPR.D
UQ9CT2799.6%4413.9%295330128.8(Q9CT27) 2610015J01Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step10.1610.1610.1	1.1684	0.2072	794.47	3	5000.0%	1	R.KDHPGLK.L
	TK251102_lung_cytoE16_2_step06.1616.1616.2	1.254	0.0542	1489.58	2	4580.0%	1	R.DQMIKGAIEVLIR.E
	TK251102_lung_cytoE16_2_step08.2133.2133.1	1.3255	0.0239	760.67	3	5000.0%	1	K.RDLISR.E
	TK251102_lung_cytoE16_2_step12.4435.4435.2	3.3188	0.4297	1727.02	1	5360.0%	1	R.RFPVAPLIPYPLITK.E
UQ9CT1799.6%5915.6%3653983311.8(Q9CT17) 2610019N13Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step09.0070.0070.3	1.3369	0.1622	4026.56	22	1130.0%	1	-.MSSTAVVPSAPGPGPGPSGGPGGGTEVIQVTNVSPSASSEQMR.T
	TK251102_lung_cytoE16_2_step09.2997.2997.2	2.8961	0.4266	1408.27	1	6150.0%	2	K.LNHVAAGLVSPSLK.S
UQ6241899.6%113.7%433484284.9(Q62418) Drebrin-like SH3 domain-containing protein SH3P7
*	TK251102_lung_cytoE16_2_step10.2083.2083.2	3.8339	0.5547	1879.21	1	6330.0%	1	R.TRQEWESAGQQAPHPR.E
UQ8R34699.6%51710.1%367393188.2(Q8R346) Similar to alanyl-tRNA synthetase (H. sapiens)
*	TK251102_lung_cytoE16_2_step02.3153.3153.2	2.4003	0.4994	2034.09	1	4720.0%	1	K.THSPQTSAMLFTVDNEAGK.I
	TK251102_lung_cytoE16_2_step06.3754.3754.2	2.6837	0.5104	1845.29	1	4710.0%	4	R.NSSHAGAFVIVTEEAIAK.G
UIF4G_HUMAN99.6%11238.2%13951533615.2(Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220)
	TK251102_lung_cytoE16_2_step02.1610.1610.2	2.5114	0.4343	1479.58	1	7920.0%	1	K.IHNAENIQPGEQK.Y
	TK251102_lung_cytoE16_2_step05.2763.2763.2	3.4025	0.5409	1976.08	1	4720.0%	4	K.ITKPGSIDSNNQLFAPGGR.L
	TK251102_lung_cytoE16_2_step09.4439.4439.2	1.479	0.0676	2224.2	39	2250.0%	1	R.EAALPPVSPLKAALSEEELEK.K
*	TK251102_lung_cytoE16_2_step06.0002.0002.3	2.0	0.141	4317.05	9	1280.0%	1	R.AHQSAAAHARAVTSVGAVLQALPSAVDFPLWMMVADTVPISK.G
	TK251102_lung_cytoE16_2_step04.1844.1844.2	1.0572	0.1302	1032.06	5	5620.0%	1	R.ALPSEELNR.Q
	TK251102_lung_cytoE16_2_step11.2536.2536.1	0.7158	0.0432	1248.53	9	2780.0%	1	R.FMLQDVLDLR.G
URS16_MOUSE99.6%3313.2%1441622510.2(P14131) 40S ribosomal protein S16
	TK251102_lung_cytoE16_2_step01.2931.2931.1	1.1315	0.2937	1188.14	1	5000.0%	1	K.GPLQSVQVFGR.K
	TK251102_lung_cytoE16_2_step11.1400.1400.1	1.1246	0.1155	789.66	13	5000.0%	1	K.KFGGPGAR.A
UFKB1_MOUSE99.6%128621.5%107117918.2(P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12)
	TK251102_lung_cytoE16_2_step09.2929.2929.2	3.3445	0.5363	1955.06	1	5620.0%	9	K.RGQTCVVHYTGMLEDGK.K
	TK251102_lung_cytoE16_2_step03.2651.2651.2	2.4397	0.3887	1925.33	1	4690.0%	2	R.GQTCVVHYTGMLEDGKK.F
	TK251102_lung_cytoE16_2_step06.2562.2562.1	0.8256	0.0126	634.6	49	5000.0%	1	R.NKPFK.F
UQ924D299.6%8106.8%15611699007.9(Q924D2) Myosin light chain kinase (Fragment)
*	TK251102_lung_cytoE16_2_step05.0023.0023.2	1.6799	0.0559	1920.34	8	2810.0%	2	R.FESQPQSQEVTEGQTVK.F
*	TK251102_lung_cytoE16_2_step05.2553.2553.3	1.6671	0.1793	2784.48	4	1880.0%	1	K.LLLQCQVISDPPATVTWSLNGKTLK.T
*	TK251102_lung_cytoE16_2_step10.3987.3987.2	1.2548	0.1838	2143.59	2	2890.0%	1	K.VPQSSILQKSTSTITLQALK.V
*	TK251102_lung_cytoE16_2_step05.2061.2061.2	2.2438	0.3662	1303.55	1	7270.0%	1	K.RPESQGSAPVFK.E
	TK251102_lung_cytoE16_2_step05.2097.2097.2	1.7538	0.2954	1213.27	1	5000.0%	1	K.VHSPQQVDFR.S
*	TK251102_lung_cytoE16_2_step09.2467.2467.2	0.7524	0.0484	2115.6	40	1670.0%	1	R.EPASCEGLCGGGGVGAHGDGDR.H
UCDC2_MOUSE99.6%175727.6%297341078.4(P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1)
	TK251102_lung_cytoE16_2_step10.4133.4133.2	1.4604	0.311	1803.37	4	3210.0%	5	K.KPLFHGDSEIDQLFR.I
	TK251102_lung_cytoE16_2_step04.4780.4780.2	3.3449	0.4768	2214.21	1	5260.0%	4	R.YSTPVDIWSIGTIFAELATK.K
	TK251102_lung_cytoE16_2_step09.3853.3853.2	1.9512	0.3002	1567.34	1	5000.0%	2	R.VYTHEVVTLWYR.S
	TK251102_lung_cytoE16_2_step05.3291.3291.3	1.7536	0.1746	2202.1	1	2890.0%	1	R.LESEEEGVPSTAIREISLLK.E
	TK251102_lung_cytoE16_2_step03.5357.5357.1	0.2146	0.0031	401.55	1	3330.0%	1	R.ISGK.M
	TK251102_lung_cytoE16_2_step12.2015.2015.1	1.6676	0.2921	1211.62	1	6500.0%	3	K.WKPGSLASHVK.N
UPDA4_MOUSE99.6%162813.8%638719735.3(P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72)
*	TK251102_lung_cytoE16_2_step11.2089.2089.1	2.973	0.4249	1316.74	1	7000.0%	2	K.FHHTFSPEIAK.F
	TK251102_lung_cytoE16_2_step03.2894.2894.2	0.8157	0.088	1687.3	16	3080.0%	1	K.FAMEPEEFDSDTLR.E
	TK251102_lung_cytoE16_2_step02.2223.2223.1	1.3007	0.2896	823.18	1	6430.0%	1	R.SPPIPLAK.V
	TK251102_lung_cytoE16_2_step09.2117.2117.1	1.4629	0.0565	698.53	4	7000.0%	1	K.LKPVIK.S
	TK251102_lung_cytoE16_2_step03.2799.2799.1	1.3299	0.0209	1283.88	30	5000.0%	1	K.RFDVSGYPTLK.I
	TK251102_lung_cytoE16_2_step02.1815.1815.1	1.2107	0.1678	979.51	7	5000.0%	2	K.KLAPEYEK.A
*	TK251102_lung_cytoE16_2_step12.2109.2109.1	1.628	0.2809	1000.86	4	5620.0%	2	K.HALPLVGHR.K
	TK251102_lung_cytoE16_2_step02.3389.3389.2	1.0062	0.0292	1996.26	1	3670.0%	1	K.DTVLLEFYAPWCGHCK.Q
*	TK251102_lung_cytoE16_2_step06.1557.1557.1	1.0917	0.0141	601.44	11	6250.0%	3	K.KNPIK.F
UTSN_MOUSE99.6%82016.2%228262016.4(Q62348) Translin
	TK251102_lung_cytoE16_2_step11.1568.1568.1	1.4147	0.0128	911.5	1	8000.0%	1	R.FHEHWR.F
*	TK251102_lung_cytoE16_2_step05.3315.3315.2	1.9255	0.0221	1383.22	50	3750.0%	1	R.GFNKETAAACGEK.-
	TK251102_lung_cytoE16_2_step08.1899.1899.2	1.2612	0.0769	1262.2	16	5500.0%	1	R.KVVQSLEQTAR.E
	TK251102_lung_cytoE16_2_step05.2016.2016.1	1.8659	0.4789	801.34	1	6670.0%	4	K.THLTSLK.T
UPDX5_MOUSE99.6%82211.0%210218978.9(P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV)
	TK251102_lung_cytoE16_2_step06.3885.3885.1	1.6895	0.28	1063.75	2	5620.0%	1	K.KVNLAELFK.G
	TK251102_lung_cytoE16_2_step04.3161.3161.1	2.5605	0.3056	1469.5	1	5380.0%	4	K.THLPGFVEQAGALK.A
UQ99KP699.6%4417.3%504552396.6(Q99KP6) Hypothetical 55.2 kDa protein (Putative nuclear matrix protein SNEV)
*	TK251102_lung_cytoE16_2_step10.3871.3871.2	3.7787	0.602	2617.52	1	4130.0%	1	K.KVTSVVFHPSQELVFSASPDATIR.I
*	TK251102_lung_cytoE16_2_step09.4255.4255.2	1.3798	0.1345	2487.52	2	2730.0%	1	K.VTSVVFHPSQELVFSASPDATIR.I
	TK251102_lung_cytoE16_2_step11.4145.4145.3	1.5956	0.0312	2900.59	25	1940.0%	1	R.QVASHVGLHSASIPGILALDLCPSDTNK.I
	TK251102_lung_cytoE16_2_step05.3300.3300.3	0.9837	0.091	3601.21	13	880.0%	1	R.TNVANFPGHSGPITSIAFSENGYYLATAADDSSVK.L
UQ9QXD899.6%4611.5%668714216.4(Q9QXD8) LIM domains containing protein 1
*	TK251102_lung_cytoE16_2_step12.1869.1869.2	0.8452	0.0074	2899.98	20	1250.0%	1	K.SYLSVSAPLSSTAGKDSTQPGMTTGLDPK.F
	TK251102_lung_cytoE16_2_step01.4826.4826.3	1.274	0.0982	3614.25	98	800.0%	1	R.VVSMDRDYHVECYHCEDCGLELNDEDGHR.C
*	TK251102_lung_cytoE16_2_step07.2966.2966.2	5.0438	0.5219	2330.86	1	6110.0%	2	K.IHLQQQQQQQLLQEEALPR.A
URL15_MOUSE99.6%186641.6%2142466811.1(Q9CZM2) 60S ribosomal protein L15
	TK251102_lung_cytoE16_2_step09.2644.2644.2	1.9085	0.3393	1564.35	1	4580.0%	1	R.NPDTQWITKPVHK.H
	TK251102_lung_cytoE16_2_step12.1469.1469.2	2.5219	0.4745	1707.94	1	4670.0%	1	K.GATYGKPVHHGVNQLK.F
	TK251102_lung_cytoE16_2_step08.1538.1538.1	0.8016	0.0286	713.45	93	5000.0%	1	R.HCGALR.V
	TK251102_lung_cytoE16_2_step12.1975.1975.2	1.9389	0.2288	1722.09	1	4230.0%	2	R.RNPDTQWITKPVHK.H
*	TK251102_lung_cytoE16_2_step10.0115.0115.2	0.9653	0.0303	3169.08	14	1170.0%	1	K.GHKFHHTIGVPAVQPGEGAILSSSTVTANTR.D
*	TK251102_lung_cytoE16_2_step08.2751.2751.1	0.9351	0.1844	510.57	3	6670.0%	2	K.IHIQ.-
	TK251102_lung_cytoE16_2_step10.1539.1539.1	0.7319	0.0858	725.1	7	5000.0%	1	R.KRPVPK.G
	TK251102_lung_cytoE16_2_step09.4716.4716.2	1.3364	0.2402	1506.2	1	5450.0%	7	K.FFEVILIDPFHK.A
UQ99K3599.6%119.2%315362694.8(Q99K35) Similar to hypothetical protein LOC57333 (Fragment)
*	TK251102_lung_cytoE16_2_step12.2532.2532.3	4.5729	0.5842	3256.35	1	3300.0%	1	R.VHHGTPLSEAPHDDAHGNFQYDHEAFLGR.D
URAC1_HUMAN99.6%72115.1%192214508.5(P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25)
	TK251102_lung_cytoE16_2_step10.3397.3397.2	3.3593	0.361	1634.13	1	6790.0%	4	K.KLTPITYPQGLAMAK.E
	TK251102_lung_cytoE16_2_step12.2547.2547.1	2.7234	0.4538	1588.77	1	5380.0%	2	R.HHCPNTPIILVGTK.L
UO0051299.6%223.2%13941459709.0(O00512) B-cell CLL/lymphoma 9
*	TK251102_lung_cytoE16_2_step03.4359.4359.3	1.3455	0.0207	2979.03	2	1940.0%	1	K.FAMPSSTPLYHDAIKTVASSDDDSPPAR.S
*	TK251102_lung_cytoE16_2_step09.2905.2905.2	2.38	0.5921	1533.21	1	6330.0%	1	K.SPPVLGSAAASPVHLK.S
UQ9CSH099.6%6811.4%588633916.9(Q9CSH0) 2810036L13Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step07.1755.1755.1	1.0109	0.1732	871.29	15	5000.0%	1	K.YKVFDAK.A
	TK251102_lung_cytoE16_2_step12.2719.2719.2	3.3044	0.602	1706.87	1	7000.0%	2	R.HDGYGSHGPLLPLPSR.Y
	TK251102_lung_cytoE16_2_step07.1976.1976.1	1.5931	0.2603	1425.64	4	3850.0%	1	R.SMPLSTEGGGSHHK.V
	TK251102_lung_cytoE16_2_step01.6071.6071.2	0.8215	0.2424	2356.76	60	1000.0%	1	K.FMKTIPGTALVEMGDEYAVER.A
	TK251102_lung_cytoE16_2_step04.1660.1660.1	1.4502	0.2066	995.55	2	5620.0%	1	R.AVTHLNNVK.L
USODC_MOUSE99.6%144230.1%153158116.5(P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1)
*	TK251102_lung_cytoE16_2_step02.1661.1661.1	1.4503	0.0922	843.63	12	5830.0%	1	R.TMVVHEK.Q
*	TK251102_lung_cytoE16_2_step01.2064.2064.1	1.6058	0.2705	1515.74	1	4230.0%	2	K.GDGPVQGTIHFEQK.A
*	TK251102_lung_cytoE16_2_step04.2939.2939.1	1.3218	0.0375	1370.59	3	3750.0%	4	R.VISLSGEHSIIGR.T
*	TK251102_lung_cytoE16_2_step02.1979.1979.1	3.2692	0.5848	1169.68	1	7270.0%	2	R.HVGDLGNVTAGK.D
UQ9UM0699.6%572.8%11811290537.2(Q9UM06) ABP125
	TK251102_lung_cytoE16_2_step06.2176.2176.2	1.7161	0.3044	1451.6	1	5770.0%	2	R.QVQHILASASPSGR.A
	TK251102_lung_cytoE16_2_step03.1411.1411.1	0.9381	0.0832	838.49	240	3330.0%	1	R.VLENHAR.G
	TK251102_lung_cytoE16_2_step10.2918.2918.2	3.4837	0.4614	1210.66	1	8640.0%	1	R.RPVGASFSFGGK.L
UCALM_HUMAN99.6%1111.5%148167064.2(P02593) Calmodulin (P02593) Calmodulin
	TK251102_lung_cytoE16_2_step01.3118.3118.2	2.9584	0.535	1846.42	1	5000.0%	1	K.EAFSLFDKDGDGTITTK.E
UPSD7_MOUSE99.6%144215.0%321365406.8(P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein)
	TK251102_lung_cytoE16_2_step04.1737.1737.1	1.5798	0.2321	1011.68	1	5620.0%	2	R.ITNQVHGLK.G
	TK251102_lung_cytoE16_2_step09.2909.2909.2	1.9049	0.2848	1160.37	1	6670.0%	2	R.IVGWYHTGPK.L
	TK251102_lung_cytoE16_2_step04.3021.3021.2	3.1967	0.4584	1322.48	1	7730.0%	1	R.SVVALHNLINNK.I
	TK251102_lung_cytoE16_2_step12.5083.5083.2	1.4116	0.0915	1946.32	1	3440.0%	4	K.VVVHPLVLLSVVDHFNR.I
USBP1_MOUSE99.6%133514.0%472523526.4(P17563) Selenium-binding protein 1 (56 kDa selenium-binding protein) (SP56)
	TK251102_lung_cytoE16_2_step11.3249.3249.2	2.4147	0.5328	1710.47	1	5000.0%	2	K.RIPGGPQMIQLSLDGK.R
	TK251102_lung_cytoE16_2_step06.1906.1906.2	1.5585	0.4802	1217.98	1	7220.0%	3	K.SPQYSQVIHR.L
	TK251102_lung_cytoE16_2_step05.4664.4664.2	1.8734	0.3135	1668.44	1	5000.0%	1	R.FLYFSNWLHGDIR.Q
	TK251102_lung_cytoE16_2_step05.3724.3724.2	1.6473	0.0139	1833.31	7	3330.0%	2	R.HNVMVSTEWAAPNVFK.D
	TK251102_lung_cytoE16_2_step01.3974.3974.2	0.9437	0.0294	2996.43	88	1300.0%	1	R.FLYFSNWLHGDIRQYDISNPQKPR.L
UDYJ2_HUMAN99.6%4413.2%492540996.4(O43237) Dynein light intermediate chain 2, cytosolic (LIC53/55) (LIC-2)
	TK251102_lung_cytoE16_2_step07.4091.4091.3	1.0501	0.0259	1417.1	114	1170.0%	1	R.GGPASVPSSSPGTSVK.K
	TK251102_lung_cytoE16_2_step10.1625.1625.1	1.067	0.1733	739.57	3	6000.0%	1	R.KLVHDK.E
	TK251102_lung_cytoE16_2_step10.4318.4318.3	4.5245	0.6152	3144.74	1	2880.0%	1	K.IAILHENFTTVKPEDAYEDFIVKPPVR.K
	TK251102_lung_cytoE16_2_step09.2421.2421.2	1.3043	0.0232	1925.72	20	3000.0%	1	K.GRGLEYLYLSVHDEDR.D
UQ8VC3099.6%4418.0%578596916.9(Q8VC30) Similar to DKFZP586B1621 protein
	TK251102_lung_cytoE16_2_step11.2692.2692.2	3.8813	0.541	1963.86	1	5250.0%	1	R.VALLSGGGSGHEPAHAGFIGK.G
*	TK251102_lung_cytoE16_2_step11.2989.2989.3	0.8313	0.0666	3592.31	27	760.0%	1	K.MVNSVEGCADDALAGLVASNPDLQLLQGHRVALR.S
*	TK251102_lung_cytoE16_2_step08.3926.3926.2	0.9132	0.0504	3066.34	1	1540.0%	1	K.IAPVDQIVTLMLDHMTNTSNIFHVPVR.S
*	TK251102_lung_cytoE16_2_step05.4563.4563.2	0.9651	0.0948	2364.39	9	2140.0%	1	K.EGPSLTSPAQVLSRLSVLLLER.M
UMPRI_MOUSE99.6%13437.2%24832738145.7(Q07113) Cation-independent mannose-6-phosphate receptor precursor (CI Man-6-P receptor) (CI-MPR) (Insulin-like growth factor II receptor) (300 kDa mannose 6-phosphate receptor) (MPR 300) (MPR300)
*	TK251102_lung_cytoE16_2_step03.5546.5546.3	0.9917	0.0333	4451.19	68	810.0%	1	K.QTCTLFFSWHTPLACEQATECTVRNGSSIIDLSPLIHR.T
*	TK251102_lung_cytoE16_2_step07.3808.3808.3	0.9011	0.0705	4211.98	9	1000.0%	1	R.FTCSDNQVNSRPLFISAVQDCEYTFSWPTPSACPVK.S
*	TK251102_lung_cytoE16_2_step10.3999.3999.3	1.4328	0.0306	2427.27	83	1900.0%	1	R.YSDGDLTLIYSGGDECSSGFQR.M
*	TK251102_lung_cytoE16_2_step01.3183.3183.3	1.4517	0.0842	3808.5	6	1480.0%	1	R.HQDEAVILSYVNGDPCPPETDDGEPCVFPFIYK.G
*	TK251102_lung_cytoE16_2_step03.2299.2299.1	2.0036	0.4254	1423.59	1	5000.0%	1	R.KPWTAVDTSAYGK.R
*	TK251102_lung_cytoE16_2_step05.2439.2439.3	1.2546	0.052	2409.46	35	2370.0%	1	R.EYTFFINVCGDTKVSLCNNK.E
*	TK251102_lung_cytoE16_2_step06.1454.1454.1	1.3189	0.0607	714.67	3	5000.0%	6	R.KPTAPAK.L
*	TK251102_lung_cytoE16_2_step11.1161.1161.1	0.2924	0.0052	1096.0	9	1110.0%	1	K.SWNLGLSSTK.L
UWDR1_MOUSE99.6%163618.3%606664076.6(O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1)
	TK251102_lung_cytoE16_2_step02.2047.2047.1	1.3244	0.1547	934.63	43	4290.0%	1	K.FTIGDHSR.F
*	TK251102_lung_cytoE16_2_step09.4580.4580.2	1.9066	0.4304	1955.2	1	3440.0%	2	K.DHLLSISLSGYINYLDK.N
	TK251102_lung_cytoE16_2_step03.4853.4853.3	2.1473	0.3077	3579.29	20	1330.0%	1	R.LHHVSSLAWLDEHTLVTTSHDASVKEWTITY.-
	TK251102_lung_cytoE16_2_step07.2974.2974.2	2.6268	0.3821	1276.4	1	8500.0%	3	K.KVFASLPQVER.G
*	TK251102_lung_cytoE16_2_step05.1483.1483.1	1.4103	0.1893	925.54	4	6430.0%	1	K.NNPSKPLR.V
	TK251102_lung_cytoE16_2_step03.1833.1833.1	1.2352	0.1069	639.53	8	6250.0%	1	K.EHLLK.Y
*	TK251102_lung_cytoE16_2_step01.1967.1967.1	1.1638	0.2357	1153.86	7	3330.0%	1	K.GDHFLYTNGK.C
*	TK251102_lung_cytoE16_2_step07.4411.4411.2	3.041	0.5787	2226.03	1	3500.0%	3	K.FGAVFLWDTGSSVGEITGHNK.V
URL2B_HUMAN99.6%93122.4%1561769510.4(P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a
	TK251102_lung_cytoE16_2_step06.2088.2088.2	1.4607	0.0101	1371.93	39	3640.0%	2	K.VNTLIRPDGEKK.A
	TK251102_lung_cytoE16_2_step08.4318.4318.2	1.5043	0.0581	1749.13	4	3570.0%	5	K.KIEDNNTLVFIVDVK.A
	TK251102_lung_cytoE16_2_step02.2466.2466.1	1.5927	0.0279	974.57	1	6430.0%	1	K.LDHYAIIK.F
UK6PL_MOUSE99.6%121421.3%780853017.1(P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B)
	TK251102_lung_cytoE16_2_step02.3419.3419.2	0.9632	0.0859	2215.94	9	2050.0%	1	K.AIGVLTSGGDAQGMNAAVRAVTR.M
	TK251102_lung_cytoE16_2_step05.3205.3205.2	4.2157	0.5769	1909.06	1	6760.0%	2	R.TNVLGHLQQGGAPTPFDR.N
*	TK251102_lung_cytoE16_2_step12.3375.3375.2	1.7967	0.2326	1731.64	1	5710.0%	1	R.TLPKPHLEAIVENLR.T
*	TK251102_lung_cytoE16_2_step04.2208.2208.1	1.1364	0.0557	820.58	3	6430.0%	1	K.LRMSGAGK.A
	TK251102_lung_cytoE16_2_step04.1856.1856.1	0.989	8.0E-4	678.63	17	5000.0%	1	K.QSASGTK.R
*	TK251102_lung_cytoE16_2_step02.1951.1951.1	0.9929	0.0756	1062.53	12	5710.0%	1	K.KETDFEHR.M
	TK251102_lung_cytoE16_2_step11.5028.5028.3	1.4454	0.1378	4510.53	3	1310.0%	1	R.YEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDR.I
	TK251102_lung_cytoE16_2_step03.4102.4102.3	1.8403	0.0234	2947.95	1	1900.0%	1	R.IMEVIDAITTTAQSHQRTFVLEVMGR.H
	TK251102_lung_cytoE16_2_step06.1633.1633.1	0.9813	0.0394	709.44	6	7000.0%	1	K.LLAHQK.V
*	TK251102_lung_cytoE16_2_step04.3157.3157.1	2.5923	0.3345	1320.48	1	5910.0%	1	K.KVVAFSPVTELK.K
	TK251102_lung_cytoE16_2_step01.5460.5460.3	1.1686	0.0378	4751.86	20	950.0%	1	R.YEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIK.Q
UIF36_HUMAN99.6%579.0%445522216.0(Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6) (Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6)
	TK251102_lung_cytoE16_2_step05.2696.2696.1	1.775	0.2572	873.62	2	6670.0%	2	R.IAHFLDR.H
	TK251102_lung_cytoE16_2_step06.4856.4856.2	3.1296	0.5345	1542.92	1	7080.0%	1	R.HLVFPLLEFLSVK.E
	TK251102_lung_cytoE16_2_step05.3064.3064.2	1.6859	0.0804	2183.89	1	3420.0%	1	K.LGHVVMGNNAVSPYQQVIEK.T
UFETA_MOUSE99.6%111117349.1%605673375.9(P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein)
*	TK251102_lung_cytoE16_2_step01.3510.3510.1	1.2007	0.0365	1072.0	10	5000.0%	1	K.QELLINLVK.Q
*	TK251102_lung_cytoE16_2_step05.3441.3441.2	3.1636	0.4839	1687.71	1	6000.0%	16	R.KAPQLTSAELIDLTGK.M
*	TK251102_lung_cytoE16_2_step07.4778.4778.3	1.9313	0.1545	3655.76	2	1480.0%	1	K.LPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDR.N
*	TK251102_lung_cytoE16_2_step09.1628.1628.1	1.2487	0.0588	594.57	11	7500.0%	1	R.KFGSR.N
*	TK251102_lung_cytoE16_2_step01.5226.5226.2	1.7618	0.3524	3083.65	2	1920.0%	1	K.NSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK251102_lung_cytoE16_2_step09.3731.3731.1	1.5984	0.2429	1347.9	9	4090.0%	9	R.THPNLPVSVILR.I
*	TK251102_lung_cytoE16_2_step01.0199.0199.1	0.9069	0.0289	691.61	1	6000.0%	2	K.ALQTMK.Q
*	TK251102_lung_cytoE16_2_step09.4603.4603.2	3.5863	0.5693	1633.4	1	7080.0%	3	K.IMFMASFLHEYSR.T
*	TK251102_lung_cytoE16_2_step01.1715.1715.1	2.0025	0.4316	1497.85	1	5420.0%	3	R.DETYAPPPFSEDK.F
*	TK251102_lung_cytoE16_2_step08.5398.5398.2	0.676	0.0133	1367.57	4	3000.0%	1	K.ADNKEECFQTK.R
*	TK251102_lung_cytoE16_2_step01.5203.5203.2	3.4079	0.5234	2015.18	1	7060.0%	1	R.NPFMYAPAILSLAAQYDK.V
*	TK251102_lung_cytoE16_2_step07.2639.2639.3	1.9203	0.101	3569.26	9	1370.0%	2	K.QELLINLVKQKPELTEEQLAAVTADFSGLLEK.C
*	TK251102_lung_cytoE16_2_step07.2135.2135.2	1.7203	0.1972	898.52	1	10000.0%	3	R.HQCLLAR.K
*	TK251102_lung_cytoE16_2_step01.2166.2166.1	1.4107	0.2736	1068.8	5	5000.0%	3	K.MTSDVLAAMK.K
*	TK251102_lung_cytoE16_2_step01.2200.2200.1	1.2236	0.014	914.77	32	5000.0%	2	R.FIYEVSR.R
*	TK251102_lung_cytoE16_2_step01.3214.3214.1	1.7916	0.2436	1559.07	1	3570.0%	1	K.APQLTSAELIDLTGK.M
*	TK251102_lung_cytoE16_2_step05.3456.3456.2	3.698	0.5773	2192.39	1	5530.0%	8	K.KTAPASVPPFQFPEPAESCK.A
*	TK251102_lung_cytoE16_2_step01.0278.0278.1	2.1335	0.1723	1186.57	1	7220.0%	1	R.NFAQFSSEEK.I
*	TK251102_lung_cytoE16_2_step05.5063.5063.2	1.9506	0.4449	2684.97	1	2830.0%	23	K.NVLSIATITFTQFVPEATEEEVNK.M
*	TK251102_lung_cytoE16_2_step02.4578.4578.2	1.6237	0.4498	2519.49	1	2730.0%	4	K.QKPELTEEQLAAVTADFSGLLEK.C
*	TK251102_lung_cytoE16_2_step07.4639.4639.2	1.7082	0.2523	2181.29	1	3060.0%	2	K.WSGCGEGMADIFIGHLCIR.N
*	TK251102_lung_cytoE16_2_step01.1447.1447.1	2.1657	0.2283	1143.77	1	6110.0%	2	K.HIEESQALSK.Q
	TK251102_lung_cytoE16_2_step01.0611.0611.1	1.0254	0.0303	462.36	5	8330.0%	2	K.LISK.T
	TK251102_lung_cytoE16_2_step01.0574.0574.1	0.7852	0.0236	466.44	2	8330.0%	1	K.FGSR.N
UPYR5_MOUSE99.6%4424.5%481522926.6(P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)]
*	TK251102_lung_cytoE16_2_step08.3831.3831.3	1.5498	0.1338	3131.58	67	1540.0%	1	R.LHAVCTLSQMLEILQQQEKIDADMVGR.V
*	TK251102_lung_cytoE16_2_step06.3570.3570.3	1.6468	0.1388	3819.15	1	1540.0%	1	K.NAGISFDSVCGVPYTALPLATVICSANHIPMLIRR.K
*	TK251102_lung_cytoE16_2_step11.3650.3650.3	5.266	0.6094	3937.97	1	2360.0%	1	R.VSMKPEFLHLTPGVQLETGGDHLGQQYNSPQEVIGK.R
*	TK251102_lung_cytoE16_2_step03.3958.3958.2	1.5398	0.2769	2019.72	1	3420.0%	1	K.IASWADIVNAHVVPGSGVVK.G
UPRS4_HUMAN99.6%111720.0%440491856.2(Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4)
	TK251102_lung_cytoE16_2_step07.2684.2684.1	0.9167	0.0080	772.56	24	5000.0%	1	K.LLKLER.I
	TK251102_lung_cytoE16_2_step07.2522.2522.1	1.4287	0.1174	1001.72	1	5710.0%	1	R.IFQIHTSR.M
	TK251102_lung_cytoE16_2_step01.5155.5155.2	1.5368	0.2748	1754.94	1	5360.0%	1	R.TMLELLNQLDGFDSR.G
	TK251102_lung_cytoE16_2_step07.4675.4675.2	3.9874	0.6266	2154.33	1	5790.0%	3	K.VHAVIGVLMDDTDPLVTVMK.V
	TK251102_lung_cytoE16_2_step11.2086.2086.1	1.5012	0.3355	1323.79	1	5000.0%	1	K.LPLVTPHTQCR.L
	TK251102_lung_cytoE16_2_step08.1325.1325.1	0.7741	0.0	615.34	4	5000.0%	1	R.LKLLK.L
	TK251102_lung_cytoE16_2_step07.4286.4286.2	1.055	0.0577	1700.23	4	4170.0%	1	R.IKDYLLMEEEFIR.N
	TK251102_lung_cytoE16_2_step01.3459.3459.1	1.1151	0.0618	1512.81	50	2500.0%	1	R.YDSNSGGEREIQR.T
UQOR_MOUSE99.6%224.2%331352698.1(P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin)
*	TK251102_lung_cytoE16_2_step04.1749.1749.2	3.4073	0.4152	1434.64	1	6540.0%	1	K.AAQAHEDIIHGSGK.T
UANX5_MOUSE99.6%6818.8%319357525.0(P48036) Annexin V (Lipocortin V) (Endonexin II) (Calphobindin I) (CBP-I) (Placental anticoagulant protein I) (PAP-I) (PP4) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) (Anchorin CII)
*	TK251102_lung_cytoE16_2_step04.3440.3440.3	1.8181	0.1382	2677.85	3	2190.0%	1	R.DPDTAIDDAQVELDAQALFQAGELK.W
	TK251102_lung_cytoE16_2_step06.1398.1398.1	0.8863	0.0503	468.52	1	8330.0%	1	K.HALK.G
*	TK251102_lung_cytoE16_2_step01.2524.2524.1	1.099	0.1254	1269.53	13	3180.0%	1	R.GTVTDFPGFDGR.A
*	TK251102_lung_cytoE16_2_step01.4675.4675.2	3.675	0.3787	1704.99	1	7000.0%	1	K.GLGTDEDSILNLLTSR.S
	TK251102_lung_cytoE16_2_step01.1338.1338.1	0.5593	0.0776	451.41	2	7500.0%	2	K.EFR.K
UDD15_MOUSE99.6%6612.4%758866117.2(O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15)
	TK251102_lung_cytoE16_2_step06.2442.2442.2	1.7605	0.2019	1488.65	1	5420.0%	1	R.HRLDLGEDYPSGK.K
	TK251102_lung_cytoE16_2_step04.2657.2657.1	2.2667	0.4312	1445.58	1	5000.0%	1	R.HQSFVLVGETGSGK.T
	TK251102_lung_cytoE16_2_step09.5343.5343.3	0.8738	0.0998	4469.41	95	1000.0%	1	R.FAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYR.S
	TK251102_lung_cytoE16_2_step04.2060.2060.1	1.4841	0.2788	919.56	3	5710.0%	1	R.TGHYLTVK.D
	TK251102_lung_cytoE16_2_step07.4338.4338.2	3.3593	0.5973	1736.27	1	6070.0%	1	K.ALVTGYFMQVAHLER.T
	TK251102_lung_cytoE16_2_step10.2591.2591.1	1.1285	0.0122	923.48	21	5710.0%	1	R.IFEPPPPK.K
UQ9CRY599.6%71335.5%251294695.2(Q9CRY5) 3010001M15Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step12.2855.2855.3	2.3053	0.2654	3494.67	3	1720.0%	1	-.ESSQLYLETCLPALGDVFCIAQSYRAEQSR.T
	TK251102_lung_cytoE16_2_step02.2769.2769.2	1.368	0.1132	1637.05	4	3930.0%	1	K.YGTCPHGGYGLGLER.F
	TK251102_lung_cytoE16_2_step03.2043.2043.1	0.9883	0.1755	924.5	6	6670.0%	1	R.DVCLYPR.F
*	TK251102_lung_cytoE16_2_step06.4121.4121.2	3.0168	0.5153	2002.65	1	5000.0%	3	K.SPVASIVYELNPNFKPPK.R
*	TK251102_lung_cytoE16_2_step08.3014.3014.3	1.5937	0.0722	2214.51	80	1810.0%	1	K.KEDGTFYEFGDDIPEAPER.L
UQ8VEJ999.6%4415.6%437489077.8(Q8VEJ9) Vacuolar sorting protein 4
	TK251102_lung_cytoE16_2_step12.1948.1948.2	1.2625	0.0075	1273.47	29	4000.0%	1	R.IYIPLPEEAAR.A
	TK251102_lung_cytoE16_2_step04.3201.3201.3	1.4026	0.1132	3101.03	20	1110.0%	1	K.LQEQLMGAVVMEKPNIRWNDVAGLEGAK.E
	TK251102_lung_cytoE16_2_step12.2695.2695.2	4.0296	0.6884	2209.74	1	6320.0%	1	R.LHLGSTPHNLTDANIHELAR.K
	TK251102_lung_cytoE16_2_step06.2626.2626.1	0.7451	0.0324	1049.55	27	4380.0%	1	K.YEAHSDKAK.E
UMPK1_MOUSE99.6%4613.3%392433436.7(P31938) Dual specificity mitogen-activated protein kinase kinase 1 (EC 2.7.1.-) (MAP kinase kinase 1) (MAPKK 1) (ERK activator kinase 1) (MAPK/ERK kinase 1) (MEK1)
	TK251102_lung_cytoE16_2_step08.4261.4261.2	1.3729	0.168	1344.03	57	4090.0%	2	R.DVKPSNILVNSR.G
	TK251102_lung_cytoE16_2_step11.2489.2489.3	5.5683	0.3947	3279.07	1	3710.0%	1	K.KKPTPIQLNPAPDGSAVNGTSSAETNLEALQK.K
	TK251102_lung_cytoE16_2_step07.2088.2088.1	0.7825	5.0E-4	981.1	105	3570.0%	1	K.GLTYLREK.H
URL23_HUMAN99.6%207264.3%1401486510.5(P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17)
	TK251102_lung_cytoE16_2_step04.5241.5241.2	1.4406	0.0428	2017.11	3	3530.0%	1	K.DGVFLYFEDNAGVIVNNK.G
	TK251102_lung_cytoE16_2_step01.3754.3754.2	2.6669	0.5781	1971.42	1	4470.0%	1	R.ISLGLPVGAVINCADNTGAK.N
	TK251102_lung_cytoE16_2_step02.3225.3225.1	1.4325	0.0395	951.5	14	6430.0%	1	K.NLYIISVK.G
	TK251102_lung_cytoE16_2_step09.2419.2419.1	0.8945	0.0499	830.57	4	5830.0%	3	K.KGKPELR.K
	TK251102_lung_cytoE16_2_step05.3880.3880.2	2.1883	0.407	1844.41	1	4410.0%	1	R.LNRLPAAGVGDMVMATVK.K
	TK251102_lung_cytoE16_2_step12.1624.1624.2	2.2276	0.3372	1021.05	1	7500.0%	1	K.KVHPAVVIR.Q
	TK251102_lung_cytoE16_2_step01.1491.1491.1	1.1872	0.278	901.89	1	5000.0%	1	K.GSAITGPVAK.E
	TK251102_lung_cytoE16_2_step09.2337.2337.1	1.3352	0.1484	892.61	8	5710.0%	7	K.VHPAVVIR.Q
UROA1_MOUSE99.6%3815032.0%319340659.2(P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed)
	TK251102_lung_cytoE16_2_step06.2284.2284.2	2.3492	0.3962	1629.88	1	6000.0%	3	R.SSGPYGGGGQYFAKPR.N
	TK251102_lung_cytoE16_2_step07.4156.4156.2	2.859	0.4652	1915.8	1	6250.0%	6	R.KLFIGGLSFETTDESLR.S
	TK251102_lung_cytoE16_2_step01.4598.4598.2	2.7467	0.4559	1786.4	1	5670.0%	1	K.LFIGGLSFETTDESLR.S
	TK251102_lung_cytoE16_2_step01.2466.2466.1	1.7771	0.0721	735.14	5	6670.0%	1	K.IFVGGIK.E
	TK251102_lung_cytoE16_2_step01.1427.1427.1	1.246	0.1616	1300.65	7	4500.0%	1	K.SESPKEPEQLR.K
	TK251102_lung_cytoE16_2_step03.3675.3675.2	1.8621	0.3395	1967.75	1	4670.0%	1	R.SHFEQWGTLTDCVVMR.D
	TK251102_lung_cytoE16_2_step05.1903.1903.1	1.6237	0.2709	1439.81	1	4170.0%	5	R.EDSQRPGAHLTVK.K
	TK251102_lung_cytoE16_2_step09.2836.2836.1	1.7961	0.181	863.64	1	6430.0%	5	K.KIFVGGIK.E
	TK251102_lung_cytoE16_2_step09.3195.3195.2	2.7382	0.4795	1880.74	1	5000.0%	4	K.IFVGGIKEDTEEHHLR.D
	TK251102_lung_cytoE16_2_step05.1704.1704.1	1.5779	0.0938	1488.61	1	4550.0%	4	K.YHTVNGHNCEVR.K
UACTB_HUMAN99.6%97233723.7%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin)
	TK251102_lung_cytoE16_2_step03.3355.3355.2	2.4573	0.2064	2346.09	1	3810.0%	4	R.KDLYANTVLSGGTTMYPGIADR.M
	TK251102_lung_cytoE16_2_step09.4607.4607.2	2.6176	0.4555	2811.59	1	2710.0%	5	K.EKLCYVALDFEQEMATAASSSSLEK.S
	TK251102_lung_cytoE16_2_step11.5370.5370.2	2.5766	0.4946	1519.41	1	6500.0%	23	K.IWHHTFYNELR.V
	TK251102_lung_cytoE16_2_step01.1751.1751.2	2.0962	0.2588	1519.66	1	6250.0%	1	K.QEYDESGPSIVHR.K
	TK251102_lung_cytoE16_2_step02.0022.0022.2	2.8866	0.5079	1958.24	1	4710.0%	5	R.VAPEEHPVLLTEAPLNPK.A
	TK251102_lung_cytoE16_2_step03.4379.4379.2	5.0584	0.6901	2554.57	1	5680.0%	30	K.LCYVALDFEQEMATAASSSSLEK.S
UQ9JM1499.6%396.5%200230765.5(Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C)
	TK251102_lung_cytoE16_2_step10.3013.3013.2	2.8353	0.2921	1636.02	1	5420.0%	3	R.RFPEEPHVPLEQR.R
UDHAM_MOUSE99.6%4411.6%519565387.6(P47738) Aldehyde dehydrogenase, mitochondrial precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI) (ALDH-E2)
	TK251102_lung_cytoE16_2_step05.3177.3177.3	1.2946	0.0384	2724.56	8	1930.0%	1	R.HEPVGVCGQIIPWNFPLLMQAWK.L
*	TK251102_lung_cytoE16_2_step03.4150.4150.2	3.5159	0.5558	2289.42	1	4320.0%	1	K.VAFTGSTEVGHLIQVAAGSSNLK.R
*	TK251102_lung_cytoE16_2_step12.1964.1964.1	0.8214	0.0056	850.41	3	5000.0%	1	R.RMDASDR.G
*	TK251102_lung_cytoE16_2_step07.1847.1847.1	0.4701	0.0014	736.69	3	5000.0%	1	K.DGMTIAK.E
USBP2_MOUSE99.6%71912.1%472526286.2(Q63836) Selenium-binding protein 2 (56 kDa acetaminophen-binding protein) (AP56)
*	TK251102_lung_cytoE16_2_step12.2989.2989.1	1.0681	0.1426	1420.91	15	3330.0%	1	K.CGPGYPTPLEAMK.G
	TK251102_lung_cytoE16_2_step11.4557.4557.2	1.37	0.0461	2550.32	1	2730.0%	1	K.LNPNFLVDFGKEPLGPALAHELR.Y
	TK251102_lung_cytoE16_2_step03.3047.3047.1	1.8669	0.294	1303.68	2	5000.0%	1	K.EPLGPALAHELR.Y
*	TK251102_lung_cytoE16_2_step02.4857.4857.2	2.3415	0.3862	2388.32	1	5250.0%	4	K.GWMLPEMPGLITDILLSLDDR.F
UQ8VEH599.6%71313.2%606700965.9(Q8VEH5) Similar to KIAA0766 gene product
	TK251102_lung_cytoE16_2_step09.3897.3897.2	3.9913	0.6305	2250.41	1	5280.0%	3	R.NQHTLSQPLTDEHLQALFR.V
*	TK251102_lung_cytoE16_2_step12.1060.1060.3	1.3808	0.0348	1640.2	14	2920.0%	1	K.IFDPDRYQMVISR.L
*	TK251102_lung_cytoE16_2_step05.3692.3692.3	1.3084	0.0396	2572.05	20	2050.0%	1	R.EVLPDHVGVLEGIDLSPEITRQR.I
*	TK251102_lung_cytoE16_2_step03.3661.3661.1	1.0303	0.0277	804.57	18	6670.0%	1	R.FLALKGR.G
*	TK251102_lung_cytoE16_2_step05.3180.3180.2	2.6388	0.4554	2142.29	1	4410.0%	1	R.RPEFQPLLTESESEHGER.V
UCH60_MOUSE99.6%468.4%573609566.2(P19226) 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65)
	TK251102_lung_cytoE16_2_step06.1962.1962.1	1.3041	0.1489	744.67	2	6670.0%	2	R.KGVITVK.D
	TK251102_lung_cytoE16_2_step10.4791.4791.2	2.3932	0.5482	2367.8	1	3570.0%	1	R.KPLVIIAEDVDGEALSTLVLNR.L
*	TK251102_lung_cytoE16_2_step11.3504.3504.2	3.2511	0.5152	2036.94	1	4720.0%	1	K.KISSVQSIVPALEIANAHR.K
UO8873899.6%13135.8%48455284296.1(O88738) Ubiquitin-conjugating enzyme
*	TK251102_lung_cytoE16_2_step03.3683.3683.2	0.8415	0.1654	2216.34	11	1940.0%	1	R.LQVHLSSTCPQIFSELLLK.L
	TK251102_lung_cytoE16_2_step06.2382.2382.2	2.0648	0.082	1914.45	1	3820.0%	1	K.KINQNVAALPVASSVMDR.L
	TK251102_lung_cytoE16_2_step04.4832.4832.2	0.9451	0.0512	3162.87	31	1400.0%	1	R.FETLTPRFSATVPPCWVEVQQEQQQR.R
*	TK251102_lung_cytoE16_2_step03.4123.4123.3	1.134	0.0248	2836.13	95	1110.0%	1	K.GEHTQNVPLSVTLATSPAQLPSADGADR.I
	TK251102_lung_cytoE16_2_step01.1354.1354.1	1.1867	0.1739	687.58	11	6000.0%	1	R.IQALLK.W
*	TK251102_lung_cytoE16_2_step04.3588.3588.3	1.8504	0.1755	2569.8	6	2250.0%	1	R.ELFELLFNWSMSLPCNVVLKK.A
*	TK251102_lung_cytoE16_2_step06.2586.2586.3	1.3337	0.086	2620.98	26	2020.0%	1	K.KPLNGNQWSFINNNLHTQNLNR.S
	TK251102_lung_cytoE16_2_step12.3345.3345.2	1.4597	0.2122	2296.28	1	2630.0%	1	K.EGTEEQDTFVSVIYCSGTDR.L
	TK251102_lung_cytoE16_2_step09.4789.4789.3	1.615	0.0992	3930.55	4	1440.0%	1	R.IANATRPTIHLCEIVNEPQLERLLLLLVGTDFNR.G
	TK251102_lung_cytoE16_2_step12.5196.5196.3	1.2753	0.0337	2658.42	17	1900.0%	1	K.LVLFLLSMDFTCHADLLLFVCK.V
*	TK251102_lung_cytoE16_2_step12.2396.2396.2	2.6255	0.5385	1945.64	1	3820.0%	1	R.INATSHVIQHPMFGAGHK.F
*	TK251102_lung_cytoE16_2_step11.5425.5425.3	1.7727	0.1149	4497.06	2	1540.0%	1	R.TIVRYLLDTLLSLLHSSNGHSVPAVLQSTFHAQACEELFK.H
	TK251102_lung_cytoE16_2_step06.1472.1472.1	1.0811	0.1129	626.62	4	6250.0%	1	K.EVIHK.H
UANX1_MOUSE99.6%72714.5%345386037.4(P10107) Annexin I (Lipocortin I) (Calpactin II) (Chromobindin 9) (P35) (Phospholipase A2 inhibitory protein)
*	TK251102_lung_cytoE16_2_step12.3751.3751.2	1.467	0.1226	2316.16	23	2110.0%	1	R.QQIKAAYLQENGKPLDEVLR.K
*	TK251102_lung_cytoE16_2_step08.0075.0075.2	1.2105	0.1395	1626.58	1	4290.0%	1	K.ALTGHLEEVVLAMLK.T
*	TK251102_lung_cytoE16_2_step08.4213.4213.2	3.2522	0.5053	1653.72	1	6430.0%	5	R.KGTDVNVFTTILTSR.S
UQ9305299.6%81210.0%612657467.4(Q93052) LIPOMA PREFERRED partner (LPP)
*	TK251102_lung_cytoE16_2_step03.1883.1883.2	1.6427	0.0927	1224.23	2	5000.0%	1	K.STGEPLGHVPAR.M
*	TK251102_lung_cytoE16_2_step06.2530.2530.2	3.7384	0.6468	2403.05	1	4760.0%	1	R.METTHSFGNPSISVSTQQPPKK.F
*	TK251102_lung_cytoE16_2_step09.2172.2172.2	1.742	0.2464	1135.28	1	7140.0%	1	R.DFHVHCYR.C
*	TK251102_lung_cytoE16_2_step06.2806.2806.2	3.4718	0.5864	2084.77	1	5830.0%	2	K.KTYITDPVSAPCAPPLQPK.G
UQ9DAB499.6%105218.7%391428906.7(Q9DAB4) 1700015E05Rik protein
	TK251102_lung_cytoE16_2_step01.5260.5260.2	2.1214	0.3433	2641.45	1	3480.0%	1	R.ALDLFSDNAPPPELLEIINEDIAK.K
	TK251102_lung_cytoE16_2_step09.3307.3307.2	2.4993	0.357	1820.42	1	4380.0%	7	K.HQSLGGQYGVQGFPTIK.I
	TK251102_lung_cytoE16_2_step10.3365.3365.2	4.5366	0.6496	2572.52	1	4580.0%	1	K.VGAVNADKHQSLGGQYGVQGFPTIK.I
	TK251102_lung_cytoE16_2_step06.2034.2034.3	1.615	0.1254	2534.79	105	1850.0%	1	K.NKPEDYQGGRTGEAIVDAALSALR.Q
UQ9D1P499.6%71320.8%331373517.9(Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene)
	TK251102_lung_cytoE16_2_step11.2465.2465.2	4.0606	0.5087	1851.78	1	7000.0%	3	K.FQEHIIQAPKPVEAIK.R
*	TK251102_lung_cytoE16_2_step10.3149.3149.3	2.1814	0.2573	2774.08	3	1740.0%	1	K.ELSELKPKFQEHIIQAPKPVEAIK.R
	TK251102_lung_cytoE16_2_step11.1329.1329.2	2.5901	0.5407	1715.64	1	4640.0%	1	R.HNSEKPPEPVKPEVK.T
*	TK251102_lung_cytoE16_2_step04.3592.3592.2	2.4843	0.3921	1832.28	1	5000.0%	1	R.KAEPMQWASLELPTTK.K
	TK251102_lung_cytoE16_2_step02.2863.2863.2	2.099	0.2338	1627.61	1	5380.0%	1	K.RPSPDEPMTNLELK.I
UQ9D81999.6%103220.1%289326675.6(Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene)
	TK251102_lung_cytoE16_2_step01.1047.1047.3	0.9357	0.0087	1788.84	279	1830.0%	1	K.VLGILAMIDEGETDWK.V
	TK251102_lung_cytoE16_2_step09.4141.4141.2	1.2722	0.1168	2229.13	8	2220.0%	1	R.YKVPDGKPENEFAFNAEFK.N
	TK251102_lung_cytoE16_2_step08.4423.4423.2	3.0452	0.6407	1696.69	1	6920.0%	5	R.LKPGYLEATVDWFR.R
*	TK251102_lung_cytoE16_2_step02.2111.2111.1	1.2618	0.0577	937.51	2	5830.0%	2	K.STHDYWK.A
*	TK251102_lung_cytoE16_2_step09.2881.2881.3	1.5879	0.1493	2016.96	55	2350.0%	1	R.VKVLGILAMIDEGETDWK.V
UHNT1_MOUSE99.6%81473.6%125136466.9(P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)
*	TK251102_lung_cytoE16_2_step08.2790.2790.1	0.9682	0.1535	978.49	7	3750.0%	1	K.KCAADLGLK.R
*	TK251102_lung_cytoE16_2_step01.0347.0347.1	1.5674	0.375	1389.78	2	3850.0%	1	K.AQVAQPGGDTIFGK.I
	TK251102_lung_cytoE16_2_step12.3756.3756.3	4.7092	0.5335	2294.39	1	4080.0%	1	R.CLAFHDISPQAPTHFLVIPK.K
*	TK251102_lung_cytoE16_2_step11.4144.4144.2	3.655	0.5888	2722.14	1	4580.0%	1	K.KHISQISVADDDDESLLGHLMIVGK.K
*	TK251102_lung_cytoE16_2_step12.3287.3287.2	3.9667	0.6255	2549.19	1	3910.0%	3	R.MVVNEGADGGQSVYHIHLHVLGGR.Q
UFKB4_MOUSE99.6%287439.4%457514415.7(P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59)
	TK251102_lung_cytoE16_2_step11.2758.2758.1	2.4331	0.3378	1508.72	1	5830.0%	1	R.LASHLNLAMCHLK.L
*	TK251102_lung_cytoE16_2_step09.1683.1683.1	1.2039	0.1	596.6	15	6250.0%	3	K.VHALR.L
	TK251102_lung_cytoE16_2_step09.2377.2377.3	1.7068	0.1764	1993.94	1	3280.0%	1	K.IPPNATLVFEVELFEFK.G
*	TK251102_lung_cytoE16_2_step01.3059.3059.1	1.1338	0.0854	1108.06	14	4440.0%	1	K.AWDIAVATMK.V
	TK251102_lung_cytoE16_2_step09.3585.3585.2	3.4605	0.502	2042.73	1	5560.0%	5	K.GEHSIVYLKPSYAFGSVGK.E
	TK251102_lung_cytoE16_2_step05.4083.4083.3	1.9191	0.084	2455.37	3	2380.0%	1	R.VFVHYTGWLLDGTKFDSSLDR.K
*	TK251102_lung_cytoE16_2_step07.3200.3200.2	2.6768	0.4603	1685.22	1	7500.0%	2	R.RGEAHLAVNDFDLAR.A
*	TK251102_lung_cytoE16_2_step06.1908.1908.2	1.1962	0.0739	1183.44	78	3890.0%	1	K.ESWEMSSAEK.L
	TK251102_lung_cytoE16_2_step05.4083.4083.2	3.0203	0.3244	1637.25	1	7690.0%	4	R.VFVHYTGWLLDGTK.F
*	TK251102_lung_cytoE16_2_step06.2758.2758.2	1.9183	0.2646	1208.2	2	6670.0%	1	R.FQIPPHAELR.Y
*	TK251102_lung_cytoE16_2_step06.2465.2465.2	4.0547	0.5715	2494.76	1	4320.0%	3	K.VGEVCHITCKPEYAYGAAGSPPK.I
*	TK251102_lung_cytoE16_2_step08.4047.4047.2	2.7308	0.5341	2279.33	1	4440.0%	1	K.KIVSWLEYESSFSGEEMQK.V
	TK251102_lung_cytoE16_2_step05.1423.1423.2	1.1241	0.02	1044.19	98	3570.0%	1	K.LYANMFER.L
	TK251102_lung_cytoE16_2_step05.1447.1447.1	1.2206	0.0265	1129.55	152	3890.0%	1	K.QDEGVLKVIK.R
URL4_MOUSE99.6%214724.8%4194715411.0(Q9D8E6) 60S ribosomal protein L4 (L1)
	TK251102_lung_cytoE16_2_step07.0028.0028.2	1.021	0.096	1853.54	47	2190.0%	1	R.NIPGITLLNVSKLNILK.L
	TK251102_lung_cytoE16_2_step03.3002.3002.2	2.1102	0.2338	1764.63	1	5000.0%	4	R.RGPCIIYNEDNGIIK.A
	TK251102_lung_cytoE16_2_step04.1981.1981.1	1.9151	0.2115	1105.5	2	6250.0%	1	K.SNYNLPMHK.M
	TK251102_lung_cytoE16_2_step07.1348.1348.1	1.5196	0.1812	601.18	1	7000.0%	1	K.KPAVGK.K
	TK251102_lung_cytoE16_2_step02.0095.0095.1	0.7799	0.0054	1188.56	55	2270.0%	3	K.KLEAAATALATK.S
	TK251102_lung_cytoE16_2_step05.1431.1431.1	1.2936	0.1681	1071.59	1	5000.0%	1	K.GTADKKPAVGK.K
	TK251102_lung_cytoE16_2_step06.3668.3668.2	1.1493	0.0331	1990.49	155	2190.0%	1	K.APIRPDIVNFVHTNLRK.N
	TK251102_lung_cytoE16_2_step08.1557.1557.1	1.0939	0.0246	863.5	24	4380.0%	1	K.LAPGGHVGR.F
	TK251102_lung_cytoE16_2_step06.1557.1557.1	1.0917	0.0141	601.44	11	6250.0%	3	K.KNPLK.N
	TK251102_lung_cytoE16_2_step01.3550.3550.1	1.9447	0.3034	1271.01	1	5450.0%	1	R.NIPGITLLNVSK.L
	TK251102_lung_cytoE16_2_step01.3096.3096.1	1.058	0.1446	989.04	1	6880.0%	1	K.NVTLPAVFK.A
	TK251102_lung_cytoE16_2_step11.3298.3298.2	2.5596	0.2428	1864.47	1	4670.0%	2	K.APIRPDIVNFVHTNLR.K
UA1T1_MOUSE99.6%9239.2%413460035.7(P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT)
	TK251102_lung_cytoE16_2_step10.3085.3085.2	2.5681	0.3519	982.07	1	9290.0%	1	R.LAQIHFPR.L
	TK251102_lung_cytoE16_2_step02.2086.2086.2	1.833	0.0882	1214.77	3	5560.0%	1	K.MQHLEQTLSK.E
	TK251102_lung_cytoE16_2_step10.3515.3515.2	3.532	0.5369	2201.42	1	4720.0%	4	K.NHYQAEVFSVNFAESEEAK.K
	TK251102_lung_cytoE16_2_step08.3483.3483.2	3.0047	0.3771	2329.52	1	4740.0%	2	K.NHYQAEVFSVNFAESEEAKK.V
UK6A1_MOUSE99.6%7715.5%724815958.1(P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1)
	TK251102_lung_cytoE16_2_step08.1714.1714.1	1.0975	0.165	560.6	3	7500.0%	1	K.KATLK.V
*	TK251102_lung_cytoE16_2_step11.2636.2636.2	3.379	0.6024	1744.81	1	5670.0%	1	R.TTQAPLHSVVQQLHGK.N
	TK251102_lung_cytoE16_2_step05.4061.4061.2	1.9829	0.0734	1975.67	1	4060.0%	1	K.HVYLVTELMRGGELLDK.I
	TK251102_lung_cytoE16_2_step10.4673.4673.2	0.6885	0.141	3048.44	42	1200.0%	1	R.EIKPPFKPAVAQPDDTFYFDTEFTSR.T
	TK251102_lung_cytoE16_2_step07.2627.2627.2	1.0067	0.1175	1701.49	2	3210.0%	1	K.LTDFGLSKEAIDHEK.K
	TK251102_lung_cytoE16_2_step03.2673.2673.2	2.1352	0.3298	1978.69	1	4690.0%	1	K.DKLPQSQLSHQDLQLVK.G
	TK251102_lung_cytoE16_2_step07.3591.3591.2	1.5304	0.0697	1884.3	8	3000.0%	1	K.MERDILADVNHPFVVK.L
UQ9D8S999.6%82849.6%137143798.8(Q9D8S9) 1810037G04Rik protein
*	TK251102_lung_cytoE16_2_step07.4082.4082.2	2.3947	0.4112	2300.45	1	3570.0%	5	R.LVHEALSEELAGPVHALAIQAK.T
*	TK251102_lung_cytoE16_2_step12.3744.3744.2	1.0118	0.0287	2455.05	9	2140.0%	1	K.TPAQWRENPQLDISPPCLGGSK.K
*	TK251102_lung_cytoE16_2_step05.1941.1941.2	1.5964	0.2582	1754.16	1	4690.0%	1	R.NESGGHAVPAGSETHFR.V
	TK251102_lung_cytoE16_2_step01.0795.0795.1	0.9436	0.0485	718.21	34	4170.0%	1	R.VAVVSSR.F
UCOF1_MOUSE99.6%59205350.0%166185608.1(P18760) Cofilin, non-muscle isoform
	TK251102_lung_cytoE16_2_step01.1612.1612.1	1.4294	0.1437	753.69	5	8000.0%	1	K.VFNDMK.V
*	TK251102_lung_cytoE16_2_step10.0051.0051.2	4.467	0.6101	2021.13	1	6250.0%	45	K.KEDLVFIFWAPENAPLK.S
	TK251102_lung_cytoE16_2_step01.1423.1423.1	1.5738	0.16	1034.73	3	5710.0%	1	K.MLPDKDCR.Y
	TK251102_lung_cytoE16_2_step07.1878.1878.1	1.3212	0.0109	659.6	10	6000.0%	3	K.KLTGIK.H
*	TK251102_lung_cytoE16_2_step01.3732.3732.2	4.0012	0.4383	2199.17	1	5260.0%	1	K.EILVGDVGQTVDDPYTTFVK.M
	TK251102_lung_cytoE16_2_step05.5177.5177.1	0.3349	0.0133	453.11	2	5000.0%	1	K.DCR.Y
	TK251102_lung_cytoE16_2_step01.0387.0387.1	1.3278	0.0551	800.66	22	5830.0%	2	K.MIYASSK.D
*	TK251102_lung_cytoE16_2_step01.4671.4671.2	1.6115	0.3267	3096.25	1	2040.0%	1	K.NIILEEGKEILVGDVGQTVDDPYTTFVK.M
	TK251102_lung_cytoE16_2_step01.1615.1615.1	2.5989	0.4202	1340.64	1	5500.0%	3	R.YALYDATYETK.E
	TK251102_lung_cytoE16_2_step01.1156.1156.1	1.0007	0.1222	529.44	1	7500.0%	1	K.LTGIK.H
UTERA_MOUSE99.6%3811426.2%806893085.3(Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
	TK251102_lung_cytoE16_2_step01.4479.4479.3	2.81	0.4454	3675.23	1	1760.0%	1	K.LADDVDLEQVANETHGHVGADLAALCSEAALQAIR.K
	TK251102_lung_cytoE16_2_step01.2871.2871.1	1.5637	0.2726	1174.71	3	4090.0%	2	R.GILLYGPPGTGK.T
	TK251102_lung_cytoE16_2_step06.2021.2021.1	1.7648	0.3261	1192.6	4	4380.0%	4	R.RDHFEEAMR.F
	TK251102_lung_cytoE16_2_step04.1333.1333.3	2.1318	0.1256	1803.88	5	2860.0%	1	R.LDQLIYIPLPDEKSR.V
	TK251102_lung_cytoE16_2_step01.2607.2607.2	1.3963	0.2666	1826.59	7	3570.0%	1	R.ELQELVQYPVEHPDK.F
	TK251102_lung_cytoE16_2_step04.3075.3075.1	2.6915	0.2856	1096.67	1	7500.0%	4	R.LEILQIHTK.N
	TK251102_lung_cytoE16_2_step01.2718.2718.1	1.1837	0.2846	1251.96	1	3640.0%	1	K.GVLFYGPPGCGK.T
	TK251102_lung_cytoE16_2_step04.3041.3041.1	1.5513	0.1409	949.5	3	5710.0%	2	R.KGDIFLVR.G
	TK251102_lung_cytoE16_2_step05.1817.1817.1	1.6746	0.1741	828.62	2	5830.0%	2	R.KQLAQIK.E
	TK251102_lung_cytoE16_2_step10.2574.2574.1	1.3231	0.1445	714.64	4	7000.0%	7	R.HPALFK.A
	TK251102_lung_cytoE16_2_step10.1925.1925.2	2.0475	0.1402	838.34	3	5710.0%	1	K.AIGVKPPR.G
	TK251102_lung_cytoE16_2_step12.3927.3927.2	1.7628	0.3629	2522.27	6	2050.0%	1	K.NVFIIGATNRPDIIDPAILRPGR.L
	TK251102_lung_cytoE16_2_step01.1522.1522.1	1.0467	0.0943	472.73	5	8330.0%	1	K.LAIR.E
	TK251102_lung_cytoE16_2_step03.2941.2941.2	2.5265	0.0501	1630.33	1	7080.0%	1	R.KYEMFAQTLQQSR.G
	TK251102_lung_cytoE16_2_step01.5142.5142.1	2.2812	0.3459	1432.83	1	5830.0%	2	R.IVSQLLTLMDGLK.Q
	TK251102_lung_cytoE16_2_step01.3492.3492.2	0.6587	0.0829	2500.13	44	950.0%	1	R.ETVVEVPQVTWEDIGGLEDVKR.E
UQ9ERD399.6%3926.4%159175434.2(Q9ERD3) Telokin
*	TK251102_lung_cytoE16_2_step12.3817.3817.3	1.6481	0.1443	4552.21	1	1400.0%	3	K.SSTGSPTSPINAEKLESEDDVSQAFLEAVAEEKPHVKPYFSK.T
UO3573799.6%91316.5%449491996.3(O35737) Heterogeneous nuclear ribonucleoprotein H
	TK251102_lung_cytoE16_2_step08.2267.2267.2	2.572	0.4849	2098.68	1	3890.0%	2	R.YGDGGSTFQSTTGHCVHMR.G
	TK251102_lung_cytoE16_2_step06.1761.1761.1	1.1534	0.0801	572.55	4	7500.0%	1	K.LALKK.D
	TK251102_lung_cytoE16_2_step03.2282.2282.1	2.1818	0.3802	1094.55	1	6110.0%	2	R.VHIEIGPDGR.V
	TK251102_lung_cytoE16_2_step03.1379.1379.2	1.3833	0.2398	888.79	9	6670.0%	1	R.THYDPPR.K
	TK251102_lung_cytoE16_2_step02.2025.2025.2	2.1886	0.3507	1685.4	1	5000.0%	1	K.HTGPNSPDTANDGFVR.L
	TK251102_lung_cytoE16_2_step01.4522.4522.2	4.7418	0.5222	1998.08	1	6250.0%	1	R.ATENDIYNFFSPLNPVR.V
UCYPH_MOUSE99.6%4639455.8%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18)
*	TK251102_lung_cytoE16_2_step01.4623.4623.2	2.2997	0.494	2008.57	1	4120.0%	6	-.VNPTVFFDITADDEPLGR.V
	TK251102_lung_cytoE16_2_step03.3759.3759.2	2.9565	0.507	2795.66	1	3850.0%	15	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
	TK251102_lung_cytoE16_2_step05.1487.1487.1	0.8343	0.1979	690.54	92	4000.0%	1	K.GSSFHR.I
	TK251102_lung_cytoE16_2_step06.2093.2093.1	1.7331	0.3676	688.68	1	7000.0%	9	K.HVVFGK.V
	TK251102_lung_cytoE16_2_step02.3669.3669.2	1.415	0.0267	1382.15	77	3640.0%	2	R.VSFELFADKVPK.T
	TK251102_lung_cytoE16_2_step01.3468.3468.2	3.7782	0.5801	1833.18	1	6790.0%	1	R.SIYGEKFEDENFILK.H
	TK251102_lung_cytoE16_2_step01.0308.0308.1	1.4549	0.043	848.66	12	5830.0%	1	K.TEWLDGK.H
	TK251102_lung_cytoE16_2_step01.3554.3554.1	1.7332	0.2315	1058.06	3	5620.0%	4	R.VSFELFADK.V
URFA2_MOUSE99.6%599.6%270297186.1(Q62193) Replication protein A 32 kDa subunit (RP-A) (RF-A) (Replication factor-A protein 2)
*	TK251102_lung_cytoE16_2_step03.3030.3030.2	2.1135	0.1013	1673.51	1	4620.0%	1	K.ACPRPEGLNFQDLR.S
*	TK251102_lung_cytoE16_2_step07.2859.2859.2	3.043	0.3787	1365.61	1	6360.0%	2	R.SQLQHMPVPSIK.Q
UANX2_MOUSE99.6%177513.3%338385457.7(P07356) Annexin II (Lipocortin II) (Calpactin I heavy chain) (Chromobindin 8) (P36) (Protein I) (Placental anticoagulant protein IV) (PAP-IV)
	TK251102_lung_cytoE16_2_step07.4336.4336.2	2.6792	0.3786	1545.44	1	6150.0%	3	K.GVDEVTIVNILTNR.S
	TK251102_lung_cytoE16_2_step07.2830.2830.1	1.5269	0.1898	873.58	1	6430.0%	2	R.KLMVALAK.G
	TK251102_lung_cytoE16_2_step10.4875.4875.2	4.5608	0.5844	1654.87	1	7000.0%	7	K.SALSGHLETVILGLLK.T
*	TK251102_lung_cytoE16_2_step04.1448.1448.1	1.334	0.0315	873.36	9	5000.0%	3	R.SVCHLQK.V
USYS_MOUSE99.6%466.3%511582586.3(P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS)
	TK251102_lung_cytoE16_2_step10.3235.3235.2	0.5677	0.0101	1133.74	52	3750.0%	1	R.IWGDCTVRK.K
	TK251102_lung_cytoE16_2_step05.1577.1577.1	1.3043	0.0087	787.54	1	7000.0%	2	R.VHQFEK.I
	TK251102_lung_cytoE16_2_step07.4196.4196.2	3.1945	0.5199	1926.28	1	5000.0%	1	K.YSHVDLVVMVDGFEGEK.G
UQ9D1L099.6%1115.7%153156619.6(Q9D1L0) Ethanol induced 6
*	TK251102_lung_cytoE16_2_step12.1445.1445.2	3.912	0.6198	2153.84	1	5000.0%	1	R.RAPAAQPPAAAAPSAVGSPAAAPR.Q
UARF4_MOUSE99.6%127215.6%179202657.2(P36403) ADP-ribosylation factor 4
*	TK251102_lung_cytoE16_2_step08.4878.4878.2	5.2545	0.4991	2077.12	1	7060.0%	6	K.MLLEDELQDAVLLLFANK.Q
*	TK251102_lung_cytoE16_2_step08.4878.4878.3	3.4164	0.5227	3115.17	1	2220.0%	6	R.IQEGAAVLQKMLLEDELQDAVLLLFANK.Q
UQ9CRK799.6%1116.1%118128626.8(Q9CRK7) 9430095H01Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step11.2917.2917.2	3.8337	0.6337	2079.3	1	5000.0%	1	K.TITGFQTHTTPVLLAHGER.A
URET1_MOUSE99.6%71523.9%134157155.2(Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI)
	TK251102_lung_cytoE16_2_step03.2406.2406.1	1.2254	0.0193	1013.66	3	5000.0%	2	K.IANLLKPDK.E
	TK251102_lung_cytoE16_2_step05.4447.4447.2	2.7706	0.5307	2002.43	1	4670.0%	3	R.GWTQWIEGDELHLEMR.A
*	TK251102_lung_cytoE16_2_step06.3304.3304.3	1.8418	0.0393	2761.97	5	2160.0%	1	R.GWTQWIEGDELHLEMRAEGVICK.Q
USYG_MOUSE99.6%10207.3%729818786.7(Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS)
	TK251102_lung_cytoE16_2_step07.1667.1667.1	0.6563	0.0048	896.54	10	3570.0%	2	K.TPHTATLR.D
	TK251102_lung_cytoE16_2_step11.1909.1909.1	2.5145	0.2936	1450.31	1	4580.0%	3	K.VPLVAEKPLKEPK.T
	TK251102_lung_cytoE16_2_step05.2484.2484.1	1.3805	0.2103	1095.38	2	5000.0%	1	K.VPLVAEKPLK.E
*	TK251102_lung_cytoE16_2_step01.1598.1598.1	1.0811	0.0149	1015.74	25	5000.0%	1	K.NNIIQAWR.Q
	TK251102_lung_cytoE16_2_step12.3747.3747.2	0.9848	0.0064	2912.34	52	1740.0%	1	R.QHFIQEEQILEIDCTMLTPEPVLK.T
UQ9CRI099.6%103621.6%139160025.7(Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment)
	TK251102_lung_cytoE16_2_step05.4112.4112.2	3.5851	0.5587	1900.42	1	6880.0%	4	R.KLFIGGLSFETTDDSLR.E
	TK251102_lung_cytoE16_2_step04.1919.1919.1	2.0573	0.279	1382.63	1	5420.0%	4	R.EDSVKPGAHLTVK.K
UMK01_MOUSE99.6%6629.3%358412767.0(P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1)
	TK251102_lung_cytoE16_2_step11.3384.3384.2	3.8426	0.3791	1712.43	1	7690.0%	1	R.FRHENIIGINDIIR.A
	TK251102_lung_cytoE16_2_step05.2627.2627.1	1.3992	0.0231	987.48	3	5710.0%	1	K.MLTFNPHK.R
	TK251102_lung_cytoE16_2_step11.2465.2465.3	1.9511	0.0686	2777.17	1	1960.0%	1	R.DLKPSNLLLNTTCDLKICDFGLAR.V
	TK251102_lung_cytoE16_2_step09.3436.3436.3	1.5932	0.2267	2748.03	1	2610.0%	1	R.APTIEQMKDVYIVQDLMETDLYK.L
	TK251102_lung_cytoE16_2_step11.5297.5297.2	1.1668	0.1847	2961.02	7	1800.0%	1	R.YTNLSYIGEGAYGMVCSAYDNLNKVR.V
	TK251102_lung_cytoE16_2_step11.1842.1842.2	2.8778	0.39	1211.24	1	8890.0%	1	K.YIHSANVLHR.D
UPSA2_MOUSE99.6%5727.5%233257948.3(P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3)
	TK251102_lung_cytoE16_2_step08.3797.3797.2	3.4241	0.4794	2650.55	1	3810.0%	2	R.KLAQQYYLVYQEPIPTAQLVQR.V
	TK251102_lung_cytoE16_2_step01.5744.5744.2	0.6899	0.0206	3083.51	13	970.0%	1	K.LVQIEYALAAVAGGAPSVGIKAANGVVLATEK.K
	TK251102_lung_cytoE16_2_step07.4651.4651.2	2.4958	0.2177	2029.1	1	3500.0%	1	K.LVQIEYALAAVAGGAPSVGIK.A
	TK251102_lung_cytoE16_2_step09.1985.1985.2	1.8322	0.2858	1139.44	1	6670.0%	1	R.SVHKVEPITK.H
UCABA_MOUSE99.6%269432.6%285308317.9(Q99020) CARG-binding factor-A (CBF-A)
*	TK251102_lung_cytoE16_2_step06.4158.4158.2	2.2594	0.4525	1658.37	1	5380.0%	4	R.GFVFITFKEEDPVK.K
	TK251102_lung_cytoE16_2_step01.2402.2402.1	1.3041	0.0925	1503.94	1	4620.0%	1	K.IFVGGLNPEATEEK.I
*	TK251102_lung_cytoE16_2_step05.2747.2747.2	1.097	0.0264	1496.57	58	2670.0%	1	R.GNRGSGGGQGSTNYGK.S
	TK251102_lung_cytoE16_2_step11.1440.1440.1	2.4478	0.433	990.54	1	6880.0%	1	K.KFHTVSGSK.C
	TK251102_lung_cytoE16_2_step01.1784.1784.1	1.489	0.1301	1168.92	1	5000.0%	1	K.FGEVVDCTIK.M
	TK251102_lung_cytoE16_2_step05.1755.1755.1	1.4131	0.3367	1177.48	1	6110.0%	1	R.GGHQNNYKPY.-
	TK251102_lung_cytoE16_2_step02.4401.4401.1	1.781	0.1813	930.39	1	6430.0%	3	R.GFGFILFK.D
*	TK251102_lung_cytoE16_2_step06.1426.1426.1	0.9818	0.0020	717.42	9	7000.0%	1	K.EEDPVK.K
	TK251102_lung_cytoE16_2_step04.4099.4099.1	1.4318	0.1045	961.75	2	5710.0%	6	R.GFVFITFK.E
	TK251102_lung_cytoE16_2_step07.1615.1615.1	1.8105	0.2068	865.44	1	6430.0%	5	K.FHTVSGSK.C
	TK251102_lung_cytoE16_2_step05.1236.1236.2	0.8851	0.0012	1325.78	40	3180.0%	1	K.MFVGGLSWDTSK.K
UPGK1_MOUSE99.6%2710537.5%416444057.6(P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3)
	TK251102_lung_cytoE16_2_step03.4225.4225.2	1.9831	0.1269	1770.87	4	3750.0%	4	K.ALESPERPFLAILGGAK.V
*	TK251102_lung_cytoE16_2_step01.3334.3334.1	1.201	0.1188	1084.88	1	5500.0%	1	K.VLPGVDALSNV.-
*	TK251102_lung_cytoE16_2_step01.4583.4583.2	1.0501	0.1095	2785.17	1	2800.0%	1	K.DCVGPEVENACANPAAGTVILLENLR.F
	TK251102_lung_cytoE16_2_step06.2445.2445.1	2.2319	0.2604	1371.53	1	5420.0%	8	R.AHSSMVGVNLPQK.A
	TK251102_lung_cytoE16_2_step02.2438.2438.1	1.2606	0.1867	1012.61	2	5710.0%	1	K.KELNYFAK.A
*	TK251102_lung_cytoE16_2_step06.3480.3480.1	1.141	0.1181	1221.75	3	4500.0%	1	K.YSLEPVAAELK.S
*	TK251102_lung_cytoE16_2_step03.1491.1491.1	1.1768	0.1591	893.56	3	5710.0%	1	K.KYAEAVGR.A
	TK251102_lung_cytoE16_2_step01.4768.4768.2	0.9707	0.0815	2914.63	6	1400.0%	1	K.IQLINNMLDKVNEMIIGGGMAFTFLK.V
	TK251102_lung_cytoE16_2_step01.3900.3900.2	2.899	0.5486	2026.13	1	3820.0%	1	K.ITLPVDFVTADKFDENAK.T
	TK251102_lung_cytoE16_2_step01.3151.3151.1	1.1574	0.1132	1203.55	1	5560.0%	1	K.IQLINNMLDK.V
	TK251102_lung_cytoE16_2_step03.3079.3079.2	1.7445	0.3107	1743.8	2	3530.0%	2	K.VSHVSTGGGASLELLEGK.V
UQ9DAJ699.6%83218.4%152171826.0(Q9DAJ6) 1500026J17Rik protein
	TK251102_lung_cytoE16_2_step02.3853.3853.2	3.8121	0.521	2198.04	1	5530.0%	4	R.YFHVVIAGPQDSPFEGGTFK.L
	TK251102_lung_cytoE16_2_step04.1644.1644.1	1.7214	0.238	987.62	2	6430.0%	4	K.IYHPNVDK.L
URB1A_HUMAN99.6%3910.2%205226786.2(P11476) Ras-related protein Rab-1A (YPT1-related protein) (P11476) Ras-related protein Rab-1A (YPT1-related protein)
	TK251102_lung_cytoE16_2_step08.3631.3631.2	2.5405	0.4813	2308.32	1	4000.0%	3	R.GAHGIIVVYDVTDQESFNNVK.Q
UHBAZ_MOUSE99.6%2417856.7%141161047.6(P06467) Hemoglobin zeta chain
*	TK251102_lung_cytoE16_2_step01.0254.0254.1	1.1619	0.0074	1004.54	3	5000.0%	1	K.IMTAVGDAVK.S
*	TK251102_lung_cytoE16_2_step10.3853.3853.2	2.5444	0.554	1486.57	1	6250.0%	2	K.LLSHCLLVTMAAR.F
*	TK251102_lung_cytoE16_2_step01.3611.3611.1	1.3924	0.0799	1110.17	1	5620.0%	1	R.AIIMSMWEK.M
*	TK251102_lung_cytoE16_2_step11.3148.3148.2	2.1472	0.4401	1986.87	1	4670.0%	11	K.TYFPHFDLHHGSQQLR.A
*	TK251102_lung_cytoE16_2_step08.1347.1347.1	0.9822	0.3382	561.07	3	5000.0%	7	R.AHGFK.I
*	TK251102_lung_cytoE16_2_step07.4992.4992.3	3.4938	0.4517	3141.16	1	2980.0%	1	R.FPADFTPEVHEAWDKFMSILSSILTEK.Y
*	TK251102_lung_cytoE16_2_step06.4049.4049.2	1.2983	0.0143	1790.34	4	3210.0%	1	R.FPADFTPEVHEAWDK.F
UTCPE_MOUSE99.6%2413421.6%541596246.0(P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon)
	TK251102_lung_cytoE16_2_step04.4844.4844.2	2.9499	0.4474	3117.96	1	3100.0%	10	K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
*	TK251102_lung_cytoE16_2_step01.4094.4094.2	1.3922	0.1079	1935.68	84	3440.0%	1	K.GSNDMQYQHVIETLIGK.K
	TK251102_lung_cytoE16_2_step03.3050.3050.1	1.4067	0.2633	1183.5	1	5560.0%	1	R.SLHDALCVIR.N
*	TK251102_lung_cytoE16_2_step02.2129.2129.1	1.483	0.2599	939.44	2	5710.0%	1	R.IAIQHLDK.I
	TK251102_lung_cytoE16_2_step05.2799.2799.2	3.3154	0.57	1698.33	1	6070.0%	2	K.GVIVDKDFSHPQMPK.K
*	TK251102_lung_cytoE16_2_step01.3216.3216.2	1.0723	0.0306	1766.74	2	3670.0%	1	K.VLVDINNPEPLIQTAK.T
	TK251102_lung_cytoE16_2_step05.1691.1691.1	1.6001	0.1377	759.5	1	6670.0%	3	K.SHIMAAK.A
	TK251102_lung_cytoE16_2_step07.3635.3635.2	1.4421	0.3095	1613.23	1	3850.0%	4	K.IAILTCPFEPPKPK.T
UO0042999.6%8206.5%736818916.8(O00429) Dynamin-like protein
	TK251102_lung_cytoE16_2_step11.2113.2113.1	1.8053	0.3953	1395.19	1	6250.0%	1	K.SKPIPIMPASPQK.G
	TK251102_lung_cytoE16_2_step12.2911.2911.3	1.2948	0.0153	2130.12	27	1710.0%	1	K.EAADMLKALQGASQIIAEIR.E
	TK251102_lung_cytoE16_2_step08.3779.3779.2	2.1876	0.434	1558.66	1	4640.0%	4	K.GHAVNLLDVPVPVAR.K
UR37A_HUMAN99.6%207830.8%911014410.4(P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a
	TK251102_lung_cytoE16_2_step08.1922.1922.1	2.6719	0.3641	1055.59	1	7500.0%	5	K.KIEISQHAK.Y
	TK251102_lung_cytoE16_2_step09.1981.1981.1	1.5198	0.1046	926.72	2	6430.0%	2	K.IEISQHAK.Y
	TK251102_lung_cytoE16_2_step06.2777.2777.1	2.4165	0.4579	1407.51	1	5000.0%	5	R.AVGIWHCGSCMK.T
	TK251102_lung_cytoE16_2_step06.1888.1888.1	1.739	0.0633	701.56	2	6670.0%	2	K.KVGIVGK.Y
USPCO_MOUSE99.6%223810.6%23632744216.0(Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain)
	TK251102_lung_cytoE16_2_step10.3562.3562.2	2.4184	0.5319	1985.12	1	4380.0%	4	R.MHTTFEHDIQALGTQVR.Q
	TK251102_lung_cytoE16_2_step10.5449.5449.3	1.9261	0.1197	3774.8	1	1540.0%	1	R.DTGNIGQERVDTVNNMADELINSGHSDAATIAEWK.D
*	TK251102_lung_cytoE16_2_step04.3527.3527.2	0.9505	0.0921	1914.75	165	2350.0%	1	R.MAGTMETSEMVNGAAEQR.T
	TK251102_lung_cytoE16_2_step05.1859.1859.1	1.0058	0.0798	825.54	16	6000.0%	1	R.FREFAR.D
	TK251102_lung_cytoE16_2_step07.4751.4751.3	1.0732	0.0128	2633.01	9	2260.0%	1	K.YESLASDLLEWIEQTIIILNNR.K
	TK251102_lung_cytoE16_2_step01.1020.1020.1	1.4541	0.0572	560.33	1	8750.0%	1	K.SLLAR.K
	TK251102_lung_cytoE16_2_step05.3552.3552.2	2.7001	0.3621	1832.9	1	5360.0%	1	R.QNLLSQSHAYQQFLR.D
	TK251102_lung_cytoE16_2_step11.1290.1290.3	0.9635	0.0433	1980.25	11	1720.0%	1	K.TAGYPNVNIHNFTTSWR.D
	TK251102_lung_cytoE16_2_step12.0400.0400.3	1.275	0.0272	4727.58	1	950.0%	1	R.VDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTR.T
	TK251102_lung_cytoE16_2_step01.0611.0611.1	1.0254	0.0303	462.36	5	8330.0%	2	R.LLSK.H
	TK251102_lung_cytoE16_2_step01.2062.2062.1	0.6733	0.0103	1061.92	4	2860.0%	1	K.EWLDKIEK.E
	TK251102_lung_cytoE16_2_step03.1697.1697.1	1.2613	0.1652	943.57	5	5830.0%	1	K.EIHQFNR.D
	TK251102_lung_cytoE16_2_step06.5418.5418.2	0.9646	0.0621	2861.87	14	1520.0%	1	K.DALLSALSIQNYHLECNETKSWIR.E
	TK251102_lung_cytoE16_2_step02.3150.3150.2	0.8672	0.0153	1674.17	66	2310.0%	1	R.QLMHNGHPSEKEIR.A
	TK251102_lung_cytoE16_2_step10.1583.1583.1	1.1823	0.0549	685.41	2	7000.0%	1	R.LPKPTK.G
*	TK251102_lung_cytoE16_2_step04.3780.3780.3	1.1141	0.0233	4014.81	79	860.0%	1	K.HKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVK.G
UILK_MOUSE99.6%6129.1%452513478.1(O55222) Integrin-linked protein kinase (EC 2.7.1.-)
	TK251102_lung_cytoE16_2_step07.4590.4590.2	2.8868	0.3338	1596.44	1	5770.0%	3	R.GMAFLHTLEPLIPR.H
	TK251102_lung_cytoE16_2_step11.1890.1890.2	1.2269	0.0263	1584.83	1	5000.0%	1	R.GDDTPLHLAASHGHR.D
	TK251102_lung_cytoE16_2_step09.1575.1575.2	1.2841	0.1062	1461.85	1	5000.0%	1	K.ICMNEDPAKRPK.F
ULKHA_MOUSE99.6%174120.7%610688906.4(P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase)
	TK251102_lung_cytoE16_2_step09.4403.4403.2	3.5177	0.5521	2408.12	1	4520.0%	3	K.SLSNVIAHEISHSWTGNLVTNK.T
	TK251102_lung_cytoE16_2_step11.2280.2280.1	1.5229	0.375	947.61	25	4380.0%	1	K.APLPLGHIK.R
*	TK251102_lung_cytoE16_2_step08.1638.1638.1	2.4209	0.2113	1581.61	1	5420.0%	4	K.SHDQAVHTYQEHK.A
	TK251102_lung_cytoE16_2_step08.4186.4186.2	1.9687	0.2875	2207.18	3	3750.0%	1	K.TWDHFWLNEGHTVYLER.H
*	TK251102_lung_cytoE16_2_step06.3217.3217.1	1.0888	0.0467	1372.71	16	2500.0%	3	K.ASMHPVTAMLVGR.D
*	TK251102_lung_cytoE16_2_step12.3403.3403.2	3.1054	0.5631	1808.72	1	6000.0%	1	R.HFHALGGWGELQNTIK.T
	TK251102_lung_cytoE16_2_step11.1577.1577.1	1.3161	0.1283	904.61	17	6670.0%	1	R.TQHLHLR.C
	TK251102_lung_cytoE16_2_step03.3482.3482.2	1.0598	0.0060	2102.06	72	1880.0%	1	K.RMQEVYNFNAINNSEIR.F
	TK251102_lung_cytoE16_2_step02.1313.1313.2	0.8564	0.0606	1328.12	17	3180.0%	1	R.AILPCQDTPSVK.L
UCRP1_MOUSE99.6%5559.2%7684198.6(P04006) Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
	TK251102_lung_cytoE16_2_step11.1714.1714.2	1.3245	0.0175	1112.14	2	6430.0%	1	K.DWHRPCLK.C
*	TK251102_lung_cytoE16_2_step12.2480.2480.2	2.9228	0.5323	3136.59	1	2220.0%	1	K.TLTSGGHAEHEGKPYCNHPCYSAMFGPK.G
	TK251102_lung_cytoE16_2_step01.0642.0642.1	1.4654	0.2383	604.46	1	8000.0%	1	R.VTSLGK.D
*	TK251102_lung_cytoE16_2_step07.4511.4511.3	1.1541	0.01	3478.18	34	1250.0%	1	K.CGKTLTSGGHAEHEGKPYCNHPCYSAMFGPK.G
UFBL1_MOUSE99.6%5510.4%705780575.2(Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90)
*	TK251102_lung_cytoE16_2_step11.3549.3549.2	3.0322	0.6113	1907.24	1	5620.0%	1	R.DPVHTVSHTVISLPTFR.E
	TK251102_lung_cytoE16_2_step06.1446.1446.1	0.9658	0.0289	839.5	3	5830.0%	1	R.DSFDIIK.R
*	TK251102_lung_cytoE16_2_step04.1148.1148.2	0.9799	0.0974	1226.58	6	4000.0%	1	R.YEDGMTVGVVR.Q
*	TK251102_lung_cytoE16_2_step05.4312.4312.2	1.2919	0.082	1891.43	1	3530.0%	1	R.LVPLPLLLLSSLSLLAAR.A
*	TK251102_lung_cytoE16_2_step12.4509.4509.2	0.8079	0.1067	2135.5	5	2370.0%	1	K.ARENSDFVQGNGADLQDPAK.I
UEZRI_MOUSE99.6%255320.7%585692156.1(P26040) Ezrin (p81) (Cytovillin) (Villin 2)
	TK251102_lung_cytoE16_2_step05.3739.3739.2	1.4388	0.0951	1781.0	1	4620.0%	1	R.ILQLCMGNHELYMR.R
	TK251102_lung_cytoE16_2_step05.3461.3461.2	2.9852	0.5696	1313.57	1	6500.0%	1	K.KAPDFVFYAPR.L
	TK251102_lung_cytoE16_2_step11.1866.1866.1	1.7685	0.1411	1177.94	8	5000.0%	3	R.IQVWHAEHR.G
	TK251102_lung_cytoE16_2_step08.3303.3303.1	1.1958	0.0039	1557.69	14	3640.0%	1	K.EDEVEEWQHRAK.E
	TK251102_lung_cytoE16_2_step01.1091.1091.1	1.1593	0.0495	561.41	1	8750.0%	1	R.MAALR.A
	TK251102_lung_cytoE16_2_step08.3867.3867.3	1.3472	0.0043	2545.86	23	2270.0%	1	K.SQEQLAAELAEYTAKIALLEEAR.R
	TK251102_lung_cytoE16_2_step06.2018.2018.2	3.6197	0.5416	1497.0	1	8180.0%	1	R.THNDIIHNENMR.Q
	TK251102_lung_cytoE16_2_step03.2633.2633.1	2.077	0.1788	961.65	1	6430.0%	2	K.FVIKPIDK.K
	TK251102_lung_cytoE16_2_step09.2189.2189.2	2.1	0.4421	1476.5	1	5910.0%	4	R.RKPDTIEVQQMK.A
	TK251102_lung_cytoE16_2_step02.4002.4002.1	1.7385	0.0972	896.75	22	5830.0%	1	K.LFFLQVK.D
*	TK251102_lung_cytoE16_2_step04.1880.1880.1	1.4732	0.1591	991.51	9	5710.0%	1	R.KENPVQFK.F
	TK251102_lung_cytoE16_2_step10.2775.2775.2	2.4547	0.3257	1088.67	1	6880.0%	1	K.FVIKPIDKK.A
UPGK1_HUMAN99.6%4104.6%417445978.1(P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2)
*	TK251102_lung_cytoE16_2_step10.3447.3447.2	3.2428	0.5717	2038.46	1	4720.0%	3	K.SVVLMSHLGRPDGVPMPDK.Y
UQ8R08199.6%138520.0%555601237.1(Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L
*	TK251102_lung_cytoE16_2_step11.0656.0656.3	1.6663	0.2075	4448.15	12	1090.0%	1	R.YGPQYGHPPPPPPPPDYGPHADSPVLMVYGLDQSKMNCDR.V
	TK251102_lung_cytoE16_2_step10.2339.2339.2	2.8531	0.3963	1077.12	1	8890.0%	1	K.TPASPVVHIR.G
	TK251102_lung_cytoE16_2_step04.4812.4812.2	3.5929	0.4587	3092.03	1	2860.0%	9	R.GLIDGVVEADLVEALQEFGPISYVVVMPK.K
*	TK251102_lung_cytoE16_2_step06.3180.3180.3	2.0088	0.083	2842.98	15	1610.0%	1	K.TENAGDQHGGGGGGGSGAAGGGGGENYDDPHK.T
UQ9CR8699.6%95117.6%148160628.2(Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene)
	TK251102_lung_cytoE16_2_step09.2455.2455.1	0.8884	0.0545	832.53	75	5000.0%	1	K.MCSIPPK.N
	TK251102_lung_cytoE16_2_step09.4056.4056.2	3.3843	0.5122	1678.56	1	5330.0%	7	K.LQAVEVVITHLAPGTK.H
	TK251102_lung_cytoE16_2_step08.3610.3610.3	1.31	3.0E-4	2047.31	22	2080.0%	1	K.NEKLQAVEVVITHLAPGTK.H
UG6PI_MOUSE99.6%184619.2%557626377.9(P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK)
	TK251102_lung_cytoE16_2_step11.3874.3874.3	4.012	0.5404	3318.96	1	2760.0%	3	R.VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK.M
	TK251102_lung_cytoE16_2_step11.0968.0968.1	0.6833	0.0161	591.32	13	5000.0%	1	K.GLHHK.I
	TK251102_lung_cytoE16_2_step09.2877.2877.2	2.2619	0.4013	879.62	1	7860.0%	3	R.AVLHVALR.N
	TK251102_lung_cytoE16_2_step02.2861.2861.2	2.435	0.3018	1709.97	1	3930.0%	3	K.VFEGNRPTNSIVFTK.L
	TK251102_lung_cytoE16_2_step04.2291.2291.1	2.9872	0.5167	1190.64	1	7500.0%	3	K.HFVALSTNTAK.V
	TK251102_lung_cytoE16_2_step12.4375.4375.3	1.2275	0.1716	4538.06	18	1010.0%	1	K.TPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHR.F
UTAL1_MOUSE99.6%122019.3%337373877.0(Q93092) Transaldolase (EC 2.2.1.2)
	TK251102_lung_cytoE16_2_step04.2871.2871.2	3.3161	0.491	1441.67	1	7270.0%	2	R.ILDWHVANTDKK.S
*	TK251102_lung_cytoE16_2_step03.2034.2034.1	1.9518	0.0727	865.62	1	8570.0%	2	R.KFAADAIK.L
	TK251102_lung_cytoE16_2_step01.0603.0603.3	1.3939	0.1753	1622.87	32	2500.0%	1	K.TIVMGASFRNTGEIK.A
	TK251102_lung_cytoE16_2_step01.2635.2635.1	1.0892	0.0505	1313.81	9	4500.0%	1	R.ILDWHVANTDK.K
*	TK251102_lung_cytoE16_2_step03.1775.1775.2	1.4989	0.1122	1228.16	3	5500.0%	1	K.KLGGPQEEQIK.N
	TK251102_lung_cytoE16_2_step07.2856.2856.1	1.3897	0.0687	1253.65	1	5000.0%	1	R.LSFDKDAMVAR.A
*	TK251102_lung_cytoE16_2_step01.1966.1966.1	1.1509	0.0649	798.87	10	5710.0%	2	K.LAPALSVK.A
UMCA1_MOUSE99.6%81631.6%310339978.4(P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)]
	TK251102_lung_cytoE16_2_step05.3493.3493.2	1.272	0.1738	2023.14	1	3530.0%	2	R.TVVSGLVNHVPLEQMQNR.M
*	TK251102_lung_cytoE16_2_step08.3605.3605.2	2.7721	0.3212	1386.86	1	7270.0%	3	R.MVVLLCNLKPAK.M
*	TK251102_lung_cytoE16_2_step04.3937.3937.2	0.9881	0.0085	3198.55	2	1670.0%	1	R.GVLSQAMVMCASSPEKVEILAPPNGSVPGDR.I
	TK251102_lung_cytoE16_2_step03.4165.4165.2	0.9913	0.1202	1847.01	13	3000.0%	1	R.LEQKGAEADQIIEYLK.Q
*	TK251102_lung_cytoE16_2_step05.3053.3053.2	1.5983	0.2208	2299.98	4	3000.0%	1	K.KHPDADSLYVEEVDVGEAAPR.T
UQ9JJH099.6%575.3%359399947.1(Q9JJH0) N-acetylneuraminic acid 9-phosphate synthetase
	TK251102_lung_cytoE16_2_step06.2389.2389.2	2.2688	0.4188	1304.69	1	7780.0%	1	R.HLEFSHDQYK.E
	TK251102_lung_cytoE16_2_step02.2506.2506.2	1.7761	0.198	1143.7	1	5620.0%	1	R.HITLDKTWK.G
	TK251102_lung_cytoE16_2_step04.1784.1784.1	1.2641	0.1676	727.55	1	7000.0%	1	R.HITLDK.T
UCGC8_MOUSE99.6%1111.0%163176675.0(Q9D187) Hypothetical protein CGI-128 homolog
	TK251102_lung_cytoE16_2_step10.2406.2406.2	3.4646	0.5733	1944.28	1	6180.0%	1	K.MDVHITPGTHASEHAVNK.Q
UMCM6_MOUSE99.6%184221.8%821928675.5(P97311) DNA replication licensing factor MCM6 (Mis5 homolog)
*	TK251102_lung_cytoE16_2_step11.3024.3024.2	3.1714	0.4953	1597.12	1	5770.0%	3	R.LVFLACHVAPTNPR.F
*	TK251102_lung_cytoE16_2_step03.4121.4121.3	1.4153	0.0374	2807.63	39	1730.0%	1	R.AEAVESAQAGDRCDFTGALIVVPDVSK.L
	TK251102_lung_cytoE16_2_step07.4184.4184.2	2.7632	0.5258	2473.74	1	3250.0%	4	K.NLYHNLCTSLFPTIHGNDEVK.R
	TK251102_lung_cytoE16_2_step12.2695.2695.3	2.3016	0.2612	3314.11	5	1880.0%	1	R.DEESHEFVIEAGALMLADNGVCCIDEFDK.M
*	TK251102_lung_cytoE16_2_step08.3557.3557.2	1.1487	0.0043	2039.38	2	2780.0%	1	R.FNGSSEDASQETVSKPSLR.L
	TK251102_lung_cytoE16_2_step11.4706.4706.2	1.1232	0.0567	2040.53	1	3240.0%	1	R.DQVAIHEAMEQQTISITK.A
	TK251102_lung_cytoE16_2_step11.3848.3848.2	1.1193	0.0723	1954.84	17	2810.0%	3	R.LTHYDHVLIELTQAGLK.G
	TK251102_lung_cytoE16_2_step11.0984.0984.3	0.9425	0.0366	1695.35	326	1070.0%	1	R.IQETQAELPRGSIPR.S
	TK251102_lung_cytoE16_2_step08.4854.4854.2	1.3666	0.0207	2627.54	66	1670.0%	1	K.NLYHNLCTSLFPTIHGNDEVKR.G
	TK251102_lung_cytoE16_2_step08.1647.1647.1	0.8915	0.0288	648.92	12	5000.0%	1	R.QFKPK.I
*	TK251102_lung_cytoE16_2_step07.3382.3382.2	0.7421	0.0051	1662.82	157	2500.0%	1	K.YLQFAEELIRPER.N
UDPP3_MOUSE99.6%5710.8%738829115.3(Q99KK7) Dipeptidyl-peptidase III (EC 3.4.14.4) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III)
	TK251102_lung_cytoE16_2_step01.1363.1363.1	1.6258	0.1274	940.5	12	6430.0%	1	K.AMSAKFER.L
	TK251102_lung_cytoE16_2_step09.4291.4291.2	3.2051	0.513	2035.81	1	4740.0%	2	K.GPSFDVQVGLHELLGHGSGK.L
	TK251102_lung_cytoE16_2_step02.4323.4323.2	1.0163	0.0164	2775.07	4	1960.0%	1	-.MADTQYILPNDIGVSSLDCREAFR.L
*	TK251102_lung_cytoE16_2_step01.5451.5451.2	0.7581	0.0695	3057.69	110	1300.0%	1	K.LIVQPNTRLEGSEVQLVEYEASAAGLIR.S
ULGUL_MOUSE99.6%399.3%183206785.5(Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase)
	TK251102_lung_cytoE16_2_step05.3655.3655.2	2.039	0.1506	1792.82	15	3120.0%	3	R.GFGHIGIAVPDVYSACK.R
UQ99LT199.6%4811.5%358391765.8(Q99LT1) Hypothetical 39.2 kDa protein (Fragment)
*	TK251102_lung_cytoE16_2_step08.4591.4591.2	2.2907	0.4167	2127.36	1	3820.0%	2	R.YLNNVIESHTDFIFATIK.A
*	TK251102_lung_cytoE16_2_step04.3413.3413.2	2.0247	0.3638	2595.84	1	3180.0%	2	K.APLKPYPVPTSDNILIQEQTQLK.G
UQ923D899.6%113.2%439504256.4(Q923D8) Similar to Rho GTPase activating protein 1
	TK251102_lung_cytoE16_2_step03.2118.2118.2	3.4439	0.314	1588.03	1	7310.0%	1	R.HQIVEVAGDDKYGR.K
UDPY3_MOUSE99.6%4414.6%570619366.5(Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein)
	TK251102_lung_cytoE16_2_step11.3584.3584.2	3.0005	0.5785	2071.69	1	4710.0%	1	K.MVIPGGIDVHTHFQMPYK.G
	TK251102_lung_cytoE16_2_step04.2881.2881.2	0.9895	0.0053	2022.1	1	3420.0%	1	K.QIGDNLIVPGGVKTIEANGK.M
*	TK251102_lung_cytoE16_2_step07.4604.4604.2	1.1713	0.12	1966.05	46	2110.0%	1	K.GGTPAGSTRGSPTRPNPPVR.N
	TK251102_lung_cytoE16_2_step01.4719.4719.3	1.3836	0.0441	3010.54	61	1770.0%	1	R.EWADGKSCCDYALHVDITHWNDSVK.Q
UCRTC_MOUSE99.6%205832.0%416479954.5(P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60)
*	TK251102_lung_cytoE16_2_step08.4826.4826.3	5.0205	0.6122	4141.33	1	2210.0%	4	K.GTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVK.S
*	TK251102_lung_cytoE16_2_step03.2109.2109.2	1.5241	0.271	1788.34	14	3930.0%	1	K.IKDPDAAKPEDWDER.A
	TK251102_lung_cytoE16_2_step01.2175.2175.2	2.2337	0.3762	2763.04	1	3040.0%	1	K.IDDPTDSKPEDWDKPEHIPDPDAK.K
	TK251102_lung_cytoE16_2_step11.2606.2606.1	1.8103	0.3533	1150.59	1	6250.0%	3	K.KVHVIFNYK.G
*	TK251102_lung_cytoE16_2_step01.2630.2630.1	0.7951	0.0307	1451.86	19	2730.0%	1	K.EQFLDGDAWTNR.W
	TK251102_lung_cytoE16_2_step08.2807.2807.3	1.6804	0.1408	2964.55	2	1960.0%	2	K.KPEDWDEEMDGEWEPPVIQNPEYK.G
	TK251102_lung_cytoE16_2_step01.1488.1488.1	2.5041	0.3967	1477.67	1	6670.0%	1	K.HEQNIDCGGGYVK.L
	TK251102_lung_cytoE16_2_step08.3091.3091.1	2.4605	0.3818	1021.53	1	7140.0%	4	K.VHVIFNYK.G
UAPA1_MOUSE99.6%122222.7%264305875.9(Q00623) Apolipoprotein A-I precursor (Apo-AI)
*	TK251102_lung_cytoE16_2_step02.1801.1801.2	2.7584	0.4363	1332.3	1	6500.0%	1	K.SNPTLNEYHTR.A
*	TK251102_lung_cytoE16_2_step02.1785.1785.1	2.0165	0.3649	1299.58	1	5000.0%	3	R.TQLAPHSEQMR.E
*	TK251102_lung_cytoE16_2_step03.1566.1566.1	1.5706	0.2174	828.52	3	6670.0%	2	R.THVDSLR.T
*	TK251102_lung_cytoE16_2_step03.3855.3855.2	2.5222	0.49	1301.11	1	6500.0%	1	R.HSLMPMLETLK.T
*	TK251102_lung_cytoE16_2_step04.2308.2308.2	1.9814	0.2074	1041.19	10	6880.0%	1	K.ARPALEDLR.H
*	TK251102_lung_cytoE16_2_step01.2631.2631.1	2.7934	0.4232	1243.04	1	7000.0%	1	K.DFANVYVDAVK.D
UQ9WU7899.6%61212.8%869961516.7(Q9WU78) ALG-2 interacting protein AIP1
	TK251102_lung_cytoE16_2_step12.0660.0660.3	1.0302	0.0261	4106.48	108	1080.0%	1	K.DTVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLK.A
	TK251102_lung_cytoE16_2_step12.1873.1873.2	0.8231	0.0087	2893.81	1	2070.0%	1	R.EPSAPSIPPPAYQSSPAAGHAAAPPTPAPR.T
	TK251102_lung_cytoE16_2_step08.4870.4870.3	1.4755	0.1801	2951.16	4	1830.0%	1	K.SCVLFNCAALASQIAAEQNLDNDEGLK.T
	TK251102_lung_cytoE16_2_step06.2421.2421.2	2.5134	0.5508	1679.59	1	5000.0%	3	K.ATLVKPTPVNVPVSQK.F
UP9731599.6%62611.9%193205838.6(P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein)
	TK251102_lung_cytoE16_2_step11.1048.1048.2	1.9281	0.3327	1846.06	1	4380.0%	5	K.HEEAPGHRPTTNPNASK.F
	TK251102_lung_cytoE16_2_step01.0578.0578.1	1.1155	0.1863	544.5	1	7000.0%	1	K.VIGAGK.S
UNUCL_MOUSE99.6%184012.6%706765924.8(P09405) Nucleolin (Protein C23)
*	TK251102_lung_cytoE16_2_step08.2761.2761.2	1.8365	0.1104	1674.5	15	3210.0%	2	K.GIAYIEFKSEADAEK.N
*	TK251102_lung_cytoE16_2_step09.3199.3199.1	0.8951	0.0316	871.73	6	3890.0%	1	K.GAATPAKGAK.N
*	TK251102_lung_cytoE16_2_step12.1176.1176.1	2.133	0.3672	1103.61	1	7780.0%	3	K.VPQNPHGKPK.G
	TK251102_lung_cytoE16_2_step01.3403.3403.1	1.5059	0.1657	1564.12	2	3850.0%	1	K.GFGFVDFNSEEDAK.A
*	TK251102_lung_cytoE16_2_step06.1528.1528.1	1.5022	0.2801	882.54	5	5000.0%	1	K.KAAVPTPAK.K
*	TK251102_lung_cytoE16_2_step04.1383.1383.1	1.9022	0.3376	889.84	1	7140.0%	2	K.KVVVSQTK.K
*	TK251102_lung_cytoE16_2_step06.2050.2050.1	1.0443	0.0653	911.73	10	5000.0%	1	K.ALVPTPGKK.G
	TK251102_lung_cytoE16_2_step06.4284.4284.1	1.2792	0.138	1597.15	1	4620.0%	4	K.GYAFIEFASFEDAK.E
*	TK251102_lung_cytoE16_2_step01.0864.0864.1	0.7062	0.0953	755.51	83	3570.0%	1	K.AAVPTPAK.K
UQ8VDW099.6%14486.8%427490675.7(Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family
	TK251102_lung_cytoE16_2_step06.3394.3394.1	2.377	0.5148	1465.89	1	5000.0%	5	K.LTLHGLQQYYVK.L
	TK251102_lung_cytoE16_2_step01.1112.1112.1	1.0207	0.0387	713.38	2	7500.0%	1	R.YQQFK.D
	TK251102_lung_cytoE16_2_step03.2347.2347.2	1.7703	0.4748	1298.84	1	6360.0%	3	K.GSYVSIHSSGFR.D
UQ9CQU099.6%248.8%170190495.3(Q9CQU0) 0610040B21Rik protein (RIKEN cDNA 0610040B21 gene)
*	TK251102_lung_cytoE16_2_step03.2181.2181.2	3.1835	0.5239	1704.54	1	6430.0%	2	K.VRPEIINESGNPSYK.Y
UQ921M399.6%445.3%12171355505.3(Q921M3) Similar to splicing factor 3b, subunit 3, 130kD
	TK251102_lung_cytoE16_2_step03.1721.1721.1	1.5894	0.2195	959.47	1	6430.0%	1	K.IHQETFGK.S
	TK251102_lung_cytoE16_2_step01.2424.2424.1	1.1075	0.1266	920.79	4	6430.0%	1	R.YLGSRPVK.L
	TK251102_lung_cytoE16_2_step11.3078.3078.2	3.2133	0.5311	1681.45	1	7140.0%	1	K.HIANYISGIQTIGHR.V
	TK251102_lung_cytoE16_2_step12.5543.5543.3	1.5101	0.1095	3890.98	1	1440.0%	1	K.CAVNQRQVVIALTGGELVYFEMDPSGQLNEYTER.K
UCLH1_HUMAN99.6%325816.9%16751916135.7(Q00610) Clathrin heavy chain 1 (CLH-17)
*	TK251102_lung_cytoE16_2_step10.5425.5425.3	1.1174	0.0443	2001.93	7	1880.0%	1	R.KDPELWGSVLLESNPYR.R
*	TK251102_lung_cytoE16_2_step02.3266.3266.1	0.8811	0.0288	826.49	12	5000.0%	1	K.NLILVVR.G
*	TK251102_lung_cytoE16_2_step05.3157.3157.2	4.0231	0.4636	1759.86	1	6670.0%	1	R.KFNALFAQGNYSEAAK.V
	TK251102_lung_cytoE16_2_step04.1877.1877.1	2.5611	0.3471	1071.58	1	6250.0%	1	R.AHIAQLCEK.A
	TK251102_lung_cytoE16_2_step03.1671.1671.1	0.9511	0.0313	758.68	15	5000.0%	1	R.KQLLEK.W
*	TK251102_lung_cytoE16_2_step03.1906.1906.2	2.6609	0.5518	1778.61	1	5670.0%	2	R.IHEGCEEPATHNALAK.I
*	TK251102_lung_cytoE16_2_step09.3325.3325.3	1.7896	0.0124	2485.49	28	1850.0%	1	R.ISGETIFVTAPHEATAGIIGVNRK.G
*	TK251102_lung_cytoE16_2_step01.2723.2723.2	0.9653	0.2295	2084.17	3	1840.0%	1	R.RPISADSAIMNPASKVIALK.A
*	TK251102_lung_cytoE16_2_step05.1809.1809.1	1.3137	0.0625	1370.69	16	4090.0%	2	K.NNRPSEGPLQTR.L
	TK251102_lung_cytoE16_2_step11.2837.2837.2	0.861	0.0736	1453.4	43	3180.0%	1	K.TLQIFNIEMKSK.M
*	TK251102_lung_cytoE16_2_step11.4882.4882.2	4.0508	0.636	2370.46	1	5000.0%	3	R.KFDVNTSAVQVLIEHIGNLDR.A
*	TK251102_lung_cytoE16_2_step03.3157.3157.3	1.8335	0.1312	2359.77	9	2140.0%	2	K.MEGNAEESTLFCFAVRGQAGGK.L
*	TK251102_lung_cytoE16_2_step11.3012.3012.2	3.3483	0.5191	1946.23	1	5290.0%	4	K.LHIIEVGTPPTGNQPFPK.K
*	TK251102_lung_cytoE16_2_step08.4319.4319.2	0.8214	0.0038	2194.33	2	2220.0%	1	K.VIQCFAETGQVQKIVLYAK.K
*	TK251102_lung_cytoE16_2_step01.5432.5432.2	0.7206	0.1334	2467.7	228	710.0%	1	R.LAELEEFINGPNNAHIQQVGDR.C
*	TK251102_lung_cytoE16_2_step01.3391.3391.1	1.8734	0.2108	1467.81	1	5000.0%	1	R.ALEHFTDLYDIK.R
*	TK251102_lung_cytoE16_2_step05.2357.2357.1	2.1375	0.4453	1558.81	1	4640.0%	1	R.RPISADSAIMNPASK.V
*	TK251102_lung_cytoE16_2_step05.2729.2729.1	1.1071	0.0076	1520.95	1	4580.0%	2	R.HSSLAGCQIINYR.T
*	TK251102_lung_cytoE16_2_step10.3057.3057.2	2.6691	0.554	1845.5	1	5310.0%	1	R.KVSQPIEGHAASFAQFK.M
UO3569199.6%225.4%725823486.9(O35691) Pinin
	TK251102_lung_cytoE16_2_step06.1892.1892.1	2.2302	0.5871	1317.54	1	4170.0%	1	K.KPALQSSVVATSK.E
*	TK251102_lung_cytoE16_2_step12.5317.5317.2	0.9192	0.0546	2960.66	1	2000.0%	1	K.HVIAEQEVMETNQVESIEPSENETSK.E
UQ9CR1699.6%12485.9%370407437.4(Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D)
	TK251102_lung_cytoE16_2_step07.3062.3062.1	2.1745	0.4333	1028.6	1	6880.0%	6	K.HVVFGQVIK.G
*	TK251102_lung_cytoE16_2_step10.2331.2331.2	2.5692	0.3891	1332.78	1	5420.0%	2	K.GTGSTTGKPLHFK.G
UO1525099.6%71111.6%623698595.6(O15250) Aminopeptidase P-like (EC 3.4.11.9) (XAA-PRO aminopeptidase) (X-PRO aminopeptidase) (Proline aminopeptidase) (Aminoacylproline aminopeptidase) (Soluble aminopeptidase P)
*	TK251102_lung_cytoE16_2_step05.2965.2965.2	2.2479	0.5383	1456.75	1	5710.0%	2	K.GHIAVSAAVFPTGTK.G
*	TK251102_lung_cytoE16_2_step06.1714.1714.1	1.13	0.0735	803.56	46	5000.0%	1	R.ETQPISK.Q
*	TK251102_lung_cytoE16_2_step08.4322.4322.3	1.6156	0.313	4273.83	1	1450.0%	1	K.TFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVK.T
*	TK251102_lung_cytoE16_2_step05.0051.0051.1	0.8356	0.0834	1166.63	25	2000.0%	1	K.ASYAVSETIPK.D
UATOX_MOUSE99.6%1127.9%6873386.5(O08997) Copper transport protein ATOX1 (Metal transport protein ATX1)
*	TK251102_lung_cytoE16_2_step03.3251.3251.2	3.2553	0.4495	2131.92	1	4440.0%	1	K.KVCIDSEHSSDTLLATLNK.T
UAAC4_MOUSE99.6%307017.8%9121049775.4(P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein)
	TK251102_lung_cytoE16_2_step06.2006.2006.1	1.6802	0.3141	1327.81	8	4000.0%	2	K.RDHALLEEQSK.Q
	TK251102_lung_cytoE16_2_step11.2346.2346.1	1.3314	0.248	1569.06	3	3640.0%	1	R.HRPELIEYDKLR.K
	TK251102_lung_cytoE16_2_step09.3599.3599.2	2.7602	0.4344	1487.2	1	7270.0%	4	K.NVNVQNFHISWK.D
*	TK251102_lung_cytoE16_2_step12.5421.5421.3	1.4758	0.0845	4274.43	2	1190.0%	2	-.MVDYHAANQAYQYGPNSGGGNGAGGGGSMGDYMAQEDDWDR.D
	TK251102_lung_cytoE16_2_step07.2615.2615.2	1.6828	0.3021	1464.09	16	4170.0%	3	R.LSNRPAFMPSEGR.M
	TK251102_lung_cytoE16_2_step08.3138.3138.2	2.9746	0.4676	2204.89	1	5530.0%	3	R.ASFNHFDKDHGGALGPEEFK.A
	TK251102_lung_cytoE16_2_step12.0470.0470.1	1.1044	0.327	705.78	1	4000.0%	1	R.VHKPPK.V
	TK251102_lung_cytoE16_2_step09.2777.2777.2	2.0414	0.2891	1301.9	1	6670.0%	2	R.HRPELIEYDK.L
	TK251102_lung_cytoE16_2_step02.2414.2414.1	0.7381	0.056	894.8	1	5000.0%	1	R.EAILAIHK.E
	TK251102_lung_cytoE16_2_step01.4555.4555.1	1.7362	0.2856	1218.02	2	6110.0%	1	R.LASDLLEWIR.R
	TK251102_lung_cytoE16_2_step10.1049.1049.3	0.9773	0.0983	1225.91	74	2250.0%	1	K.DGLAFNALIHR.H
	TK251102_lung_cytoE16_2_step08.4707.4707.2	2.8059	0.4958	2008.91	1	4410.0%	2	K.AIMTYVSSFYHAFSGAQK.A
UUBP5_MOUSE99.6%8167.7%858958335.0(P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T)
	TK251102_lung_cytoE16_2_step04.1623.1623.1	1.2124	0.2382	1044.57	1	5000.0%	1	K.GHPEFSTNR.Q
	TK251102_lung_cytoE16_2_step10.1870.1870.1	0.886	0.0086	501.58	2	8330.0%	1	K.KPTR.L
*	TK251102_lung_cytoE16_2_step04.3020.3020.2	2.6177	0.5333	2826.7	1	3270.0%	3	K.LGHGLLSGEYSKPALESGDGEQVPEQK.E
	TK251102_lung_cytoE16_2_step05.2116.2116.2	3.0036	0.4755	1824.79	1	6330.0%	2	R.YFDGSGGNNHAVEHYR.E
*	TK251102_lung_cytoE16_2_step08.3258.3258.1	1.0264	0.0871	1174.73	13	5000.0%	1	R.QVSKHAFNLK.Q
UO0030199.6%13339.1%711731617.3(O00301) KSRP
*	TK251102_lung_cytoE16_2_step04.3280.3280.2	1.8457	0.2956	2099.41	1	3420.0%	2	R.GQGNWGPPGGEMTFSIPTHK.C
*	TK251102_lung_cytoE16_2_step07.1634.1634.2	3.029	0.4832	2109.66	1	5000.0%	1	K.KIGQQPQQPGAPPQQDYTK.A
*	TK251102_lung_cytoE16_2_step07.2282.2282.1	1.2938	0.0949	923.57	3	5620.0%	3	R.HSVGVVIGR.S
*	TK251102_lung_cytoE16_2_step08.2098.2098.1	0.9913	0.0276	806.33	221	5000.0%	1	R.IIGDPYK.V
*	TK251102_lung_cytoE16_2_step08.2362.2362.1	2.7054	0.4381	1108.63	1	7220.0%	3	K.IAHIMGPPDR.C
UQ9WTQ599.6%11552.9%16841806944.4(Q9WTQ5) SSECKS (PKC binding protein SSECKS)
*	TK251102_lung_cytoE16_2_step07.3667.3667.2	3.4073	0.5515	1571.01	1	7500.0%	7	K.TLVHTVSVAVIDGTR.A
*	TK251102_lung_cytoE16_2_step11.1342.1342.2	1.5139	0.1157	2003.63	52	2630.0%	1	K.AEADASGNLTKESPDTNGPK.L
*	TK251102_lung_cytoE16_2_step05.1528.1528.1	1.119	0.2312	1489.6	1	4230.0%	1	K.EHAADGPQHQSLAK.A
URL8_HUMAN99.6%112133.1%2572802511.0(P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8
	TK251102_lung_cytoE16_2_step03.1967.1967.1	1.4993	0.047	828.52	2	6670.0%	2	R.IDKPILK.A
	TK251102_lung_cytoE16_2_step06.1694.1694.1	1.3331	0.0561	619.62	4	7500.0%	3	R.HGYIK.G
	TK251102_lung_cytoE16_2_step08.4270.4270.3	3.7428	0.5765	3396.68	1	2750.0%	1	K.KAQLNIGNVLPVGTMPEGTIVCCLEEKPGDR.G
	TK251102_lung_cytoE16_2_step01.0607.0607.1	0.8184	0.0152	556.39	12	5000.0%	1	R.GAPLAK.V
	TK251102_lung_cytoE16_2_step05.1465.1465.1	1.6602	0.2014	874.59	2	7140.0%	1	K.KVISSANR.A
	TK251102_lung_cytoE16_2_step08.2103.2103.1	0.7982	0.0144	821.66	14	5000.0%	2	R.KGAGSVFR.A
	TK251102_lung_cytoE16_2_step10.3955.3955.2	1.3388	0.2524	2243.61	8	2370.0%	1	R.TELFIAAEGIHTGQFVYCGK.K
UBTF3_MOUSE99.6%4416.7%204220119.4(Q64152) Transcription factor BTF3 (RNA polymerase B transcription factor 3)
	TK251102_lung_cytoE16_2_step11.3933.3933.3	2.1141	0.2699	3219.24	1	1960.0%	1	K.KLGVNNISGIEEVNMFTNQGTVIHFNNPK.V
	TK251102_lung_cytoE16_2_step02.1455.1455.1	0.8605	0.0228	639.55	18	6250.0%	1	K.KVVHR.T
	TK251102_lung_cytoE16_2_step07.4248.4248.3	4.2324	0.6104	3091.35	1	3150.0%	1	K.LGVNNISGIEEVNMFTNQGTVIHFNNPK.V
UPCNA_MOUSE99.6%4624.1%261287854.8(P17918) Proliferating cell nuclear antigen (PCNA) (Cyclin)
	TK251102_lung_cytoE16_2_step01.2811.2811.1	1.9442	0.4593	1588.01	1	4640.0%	2	R.DLSHIGDAVVISCAK.N
	TK251102_lung_cytoE16_2_step11.5636.5636.3	1.3141	0.032	4588.63	282	750.0%	1	K.DLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYR.C
	TK251102_lung_cytoE16_2_step01.3282.3282.1	1.2517	0.1631	933.97	22	5830.0%	1	R.YLNFFTK.A
UDYNA_MOUSE99.6%122014.2%12811417276.0(O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued)
	TK251102_lung_cytoE16_2_step05.0010.0010.3	1.3358	0.1351	4572.22	35	1090.0%	3	R.QMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPR.L
*	TK251102_lung_cytoE16_2_step11.2937.2937.3	1.5157	0.078	2892.75	1	1940.0%	1	R.MPGTDAPGIPAALAFGSQVSDTLLDCRK.H
	TK251102_lung_cytoE16_2_step08.1651.1651.1	1.2441	0.044	844.46	60	5000.0%	1	K.RTIEGLR.G
*	TK251102_lung_cytoE16_2_step10.3005.3005.3	1.7627	0.1438	2699.32	1	2290.0%	1	K.ETVTQRPGATVPTDFATFPSSAFLR.A
	TK251102_lung_cytoE16_2_step08.4710.4710.2	1.1137	0.1177	2088.69	15	2780.0%	1	R.LRAFLQGGQEATDIALLLR.D
*	TK251102_lung_cytoE16_2_step09.3631.3631.2	1.2063	0.1687	2018.94	85	2110.0%	1	K.LSLPPHEGPGGNLVAGALYR.K
*	TK251102_lung_cytoE16_2_step11.2654.2654.2	3.6026	0.582	1689.25	1	7310.0%	1	R.LHISQLQHENSILR.G
	TK251102_lung_cytoE16_2_step10.2877.2877.2	3.8111	0.5243	1702.64	1	6150.0%	1	R.LVLTQEQLHQLHSR.L
*	TK251102_lung_cytoE16_2_step10.2777.2777.2	3.6095	0.52	1734.76	1	6070.0%	2	K.LNQLSTHTHVVDITR.S
UAMP2_MOUSE99.6%225.9%478529225.8(O08663) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2) (Peptidase M 2) (Initiation factor 2 associated 67 kDa glycoprotein) (p67) (p67eIF2)
	TK251102_lung_cytoE16_2_step10.3649.3649.2	3.3267	0.6267	2123.03	1	4410.0%	1	K.GSYTAQFEHTILLRPTCK.E
	TK251102_lung_cytoE16_2_step02.2789.2789.2	1.4125	0.1726	1153.09	7	5560.0%	1	K.NFDVGHVPIR.L
UTCPY_MOUSE99.6%61214.1%531581847.7(Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2)
*	TK251102_lung_cytoE16_2_step02.3529.3529.3	1.7825	0.236	2954.88	3	1630.0%	1	K.ELLGIDLNTGEPMAAAEAGIWDNYCVK.K
*	TK251102_lung_cytoE16_2_step06.3750.3750.2	3.3039	0.5033	2316.67	1	4000.0%	3	K.DGNVLLHEMQIQHPTASIIAK.V
*	TK251102_lung_cytoE16_2_step08.4603.4603.3	1.7696	0.155	2730.54	1	2400.0%	1	K.NAIEDGCVVPGAGAVEVAIAEALVNYK.H
UTALI_MOUSE99.6%5713324.2%25412698316.1(P26039) Talin
	TK251102_lung_cytoE16_2_step01.0579.0579.1	1.5028	0.0442	940.38	2	6250.0%	1	R.AEASQLGHK.V
	TK251102_lung_cytoE16_2_step06.1968.1968.1	1.5568	0.2156	730.55	1	6670.0%	1	R.KLLSAAK.I
*	TK251102_lung_cytoE16_2_step02.2361.2361.2	2.6003	0.4895	1965.76	1	3250.0%	2	K.QAAASATQTIAAAQHAASAPK.A
	TK251102_lung_cytoE16_2_step07.1735.1735.1	0.9523	9.0E-4	717.52	13	5000.0%	2	R.ALHYGR.E
*	TK251102_lung_cytoE16_2_step12.2592.2592.3	1.4231	0.0327	3856.01	58	1250.0%	1	R.QLETVRELLENPVQPINDMSYFGCLDSVMENSK.V
*	TK251102_lung_cytoE16_2_step11.2829.2829.3	1.536	0.1219	1799.6	1	3670.0%	1	R.ACKEAAFHPEVAPDVR.L
	TK251102_lung_cytoE16_2_step01.0494.0494.1	1.0145	0.2275	799.17	2	4290.0%	1	K.GISMSSSK.L
	TK251102_lung_cytoE16_2_step06.1736.1736.1	1.168	0.1256	743.66	32	6000.0%	1	K.IFQAHK.N
	TK251102_lung_cytoE16_2_step04.2221.2221.1	2.1442	0.3827	1244.71	1	5000.0%	3	K.LKPLPGETMEK.C
	TK251102_lung_cytoE16_2_step10.3278.3278.3	1.2171	0.1504	3087.42	33	1610.0%	1	R.ASGRFGQDFSTFLEAGVEMAGQAPSQEDR.A
	TK251102_lung_cytoE16_2_step08.2955.2955.2	4.5691	0.5155	1336.77	1	7920.0%	3	K.VSHVLAALQAGNR.G
	TK251102_lung_cytoE16_2_step11.3125.3125.2	1.0372	0.0071	1859.95	74	2670.0%	1	R.CVSCLPGQRDVDNALR.A
	TK251102_lung_cytoE16_2_step11.1754.1754.1	0.9732	0.0199	643.44	61	5000.0%	1	K.QRPLK.I
*	TK251102_lung_cytoE16_2_step06.4245.4245.3	1.5061	0.0414	2977.75	175	1570.0%	1	R.VQELGHGCSALVTKAGALQCSPSDVYTK.K
	TK251102_lung_cytoE16_2_step02.0423.0423.2	0.8446	0.0718	3154.61	2	1500.0%	1	R.MVAAATNNLCEAANAAVQGHASQEKLISSAK.Q
*	TK251102_lung_cytoE16_2_step03.4833.4833.2	1.0754	0.028	2454.91	64	1590.0%	1	R.IPEALAGPPNDFGLFLSDDDPKK.G
*	TK251102_lung_cytoE16_2_step05.2633.2633.2	1.4119	0.0302	2436.02	1	2390.0%	1	R.GVKLLAALLEDEGGNGRPLLQAAK.G
	TK251102_lung_cytoE16_2_step03.1329.1329.1	0.7766	0.0065	804.43	17	5000.0%	1	K.VLVEDTK.V
	TK251102_lung_cytoE16_2_step02.1494.1494.1	0.979	0.0634	484.56	6	6670.0%	1	R.DPPR.W
*	TK251102_lung_cytoE16_2_step05.5524.5524.3	1.4654	0.0953	3777.5	7	1410.0%	2	R.ECANGYLELLDHVLLTLQKPNPDLKQQLTGHSK.R
*	TK251102_lung_cytoE16_2_step07.4855.4855.2	2.695	0.4895	2968.43	1	2880.0%	1	R.YDQATDTILTVTENIFSSMGDAGEMVR.Q
	TK251102_lung_cytoE16_2_step12.4923.4923.2	0.993	0.1047	3184.05	27	1330.0%	1	K.GTEWVDPEDPTVIAENELLGAAAAIEAAAKK.L
	TK251102_lung_cytoE16_2_step11.3473.3473.3	1.8495	0.0571	3923.88	47	1220.0%	1	K.ALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFAR.A
*	TK251102_lung_cytoE16_2_step05.2637.2637.2	3.295	0.4608	2222.11	1	5240.0%	2	R.LASQAKPAAVAAENEEIGAHIK.H
	TK251102_lung_cytoE16_2_step10.2025.2025.3	1.2727	0.0383	1681.84	12	2500.0%	1	K.GITMATAKAVAAGNSCR.Q
*	TK251102_lung_cytoE16_2_step01.2923.2923.1	0.936	0.0585	1449.69	2	3080.0%	1	K.TMLESAGGLIQTAR.A
	TK251102_lung_cytoE16_2_step11.4206.4206.3	1.1592	0.1638	2832.66	46	1630.0%	1	R.ILAQATSDLVNAIKADAEGESDLENSR.K
	TK251102_lung_cytoE16_2_step10.2923.2923.3	1.3993	0.0767	3840.15	1	1500.0%	1	K.APGQLECETAIAALNSCLRDLDQASLAAVSQQLAPR.E
	TK251102_lung_cytoE16_2_step03.2709.2709.2	3.3684	0.3773	1712.83	1	6070.0%	1	K.TLSHPQQMALLDQTK.T
	TK251102_lung_cytoE16_2_step11.2584.2584.3	0.8555	0.0060	3875.73	181	430.0%	1	K.VSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTK.T
	TK251102_lung_cytoE16_2_step06.4841.4841.2	4.0315	0.5523	2094.53	1	5000.0%	6	R.GVGAAATAVTQALNELLQHVK.A
	TK251102_lung_cytoE16_2_step01.0615.0615.1	1.0258	0.081	484.6	3	8330.0%	2	K.LVPR.L
	TK251102_lung_cytoE16_2_step05.3333.3333.1	1.4158	0.2968	1380.76	19	3330.0%	3	K.VEHGSVALPAIMR.S
UHS9B_MOUSE99.6%7472027.2%723831945.0(P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA)
	TK251102_lung_cytoE16_2_step05.3517.3517.2	3.9841	0.497	1786.86	1	7500.0%	20	K.HLEINPDHPIVETLR.Q
	TK251102_lung_cytoE16_2_step03.2518.2518.1	1.3409	0.0024	1020.46	1	6430.0%	1	K.KFYEAFSK.N
	TK251102_lung_cytoE16_2_step11.2576.2576.2	3.501	0.4901	1912.68	1	5330.0%	2	K.KHLEINPDHPIVETLR.Q
	TK251102_lung_cytoE16_2_step06.2816.2816.3	1.506	0.1141	2378.65	1	2920.0%	1	R.VFIMDSCDELIPEYLNFIR.G
	TK251102_lung_cytoE16_2_step07.4886.4886.2	2.2942	0.3045	2989.97	1	2690.0%	1	K.DLVVLLFETALLSSGFSLEDPQTHSNR.I
	TK251102_lung_cytoE16_2_step07.3080.3080.2	3.0068	0.6416	2180.11	1	5000.0%	3	R.YHTSQSGDEMTSLSEYVSR.M
	TK251102_lung_cytoE16_2_step06.2896.2896.2	2.544	0.1335	887.15	14	8330.0%	2	R.RLSELLR.Y
	TK251102_lung_cytoE16_2_step01.0127.0127.1	1.1073	0.0336	474.02	5	6670.0%	2	K.NIVK.K
	TK251102_lung_cytoE16_2_step06.4346.4346.2	4.4311	0.6416	1813.03	1	7860.0%	15	K.HSQFIGYPITLYLEK.E
	TK251102_lung_cytoE16_2_step12.3957.3957.2	3.4503	0.5815	1937.66	1	5670.0%	1	K.KHSQFIGYPITLYLEK.E
	TK251102_lung_cytoE16_2_step01.0212.0212.1	1.5096	0.0983	658.84	1	7000.0%	2	K.VVVITK.H
	TK251102_lung_cytoE16_2_step01.2928.2928.1	1.3948	0.0984	1530.04	22	2920.0%	1	K.SLTNDWEDHLAVK.H
	TK251102_lung_cytoE16_2_step01.0222.0222.1	1.3334	0.252	733.77	1	6670.0%	1	K.SLVSVTK.E
	TK251102_lung_cytoE16_2_step01.1568.1568.1	2.0365	0.2584	1277.91	1	6360.0%	4	R.ELISNASDALDK.I
	TK251102_lung_cytoE16_2_step03.3605.3605.1	1.8715	0.2012	1238.64	3	5000.0%	3	R.RAPFDLFENK.K
	TK251102_lung_cytoE16_2_step03.1919.1919.1	1.2891	0.0389	1011.6	4	5000.0%	3	K.AKFENLCK.L
	TK251102_lung_cytoE16_2_step09.2811.2811.3	1.1084	0.0302	2129.9	22	2080.0%	1	K.SLVSVTKEGLELPEDEEEK.K
	TK251102_lung_cytoE16_2_step01.3066.3066.1	2.2819	0.4138	1351.96	1	5000.0%	4	R.TLTLVDTGIGMTK.A
UP7033399.6%114.2%449492806.3(P70333) Heterogeneous nuclear ribonucleoprotein H' (hnRNP H') (FTP-3)
	TK251102_lung_cytoE16_2_step07.2232.2232.2	3.0069	0.5335	2085.85	1	4440.0%	1	R.YGDGGSSFQSTTGHCVHMR.G
UTF1B_MOUSE99.6%193323.6%834888475.8(Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1)
	TK251102_lung_cytoE16_2_step07.3164.3164.1	1.6448	0.062	873.69	2	5710.0%	3	R.KLLASLVK.R
	TK251102_lung_cytoE16_2_step05.1471.1471.1	1.389	0.0862	697.51	1	8000.0%	2	K.HATLQK.N
*	TK251102_lung_cytoE16_2_step03.3213.3213.2	1.2905	0.2929	2570.32	2	2240.0%	1	R.GAAAAAAGQAGTVPPGAPGAPPLPGMAIVK.E
*	TK251102_lung_cytoE16_2_step10.1378.1378.2	0.8201	0.031	1346.75	134	2080.0%	1	R.SRSGEGEVSGLLR.K
*	TK251102_lung_cytoE16_2_step11.1541.1541.2	2.4682	0.4923	2006.79	1	4740.0%	1	K.IVAERPGTNSTGPGPMAPPR.A
	TK251102_lung_cytoE16_2_step05.3727.3727.2	1.6623	0.1776	1956.89	15	3440.0%	2	K.VFPGSTTEDYNLIVIER.G
	TK251102_lung_cytoE16_2_step11.1465.1465.1	0.9787	0.0488	934.67	19	4170.0%	2	K.HQEHILR.F
	TK251102_lung_cytoE16_2_step06.2081.2081.1	1.1013	0.18	931.45	1	6670.0%	1	R.QHWTMTK.I
	TK251102_lung_cytoE16_2_step02.1574.1574.1	0.7168	0.1598	669.45	7	4170.0%	1	R.APGPLSK.Q
*	TK251102_lung_cytoE16_2_step09.3007.3007.3	6.8124	0.6856	3326.37	1	3380.0%	2	K.RPAASSAAAASAAASSPAGGGGEAQELLEHCGVCR.E
*	TK251102_lung_cytoE16_2_step11.0099.0099.3	0.8489	0.033	3911.52	13	860.0%	1	R.MNDAFGDTKFSAVLVEPPPLNLPSAGLSSQELSGPGDGP.-
*	TK251102_lung_cytoE16_2_step07.5250.5250.3	1.5466	0.0448	4504.67	4	1250.0%	1	K.VFPGSTTEDYNLIVIERGAAAAAAGQAGTVPPGAPGAPPLPGMAIVK.E
	TK251102_lung_cytoE16_2_step02.1567.1567.1	1.4692	0.0624	1022.46	19	5000.0%	1	R.TVYCNVHK.H
UQ9CQM999.6%127014.5%337377785.6(Q9CQM9) Thioredoxin-like 2
	TK251102_lung_cytoE16_2_step01.1706.1706.1	1.0517	0.0886	1151.89	1	4500.0%	1	R.LDGAHAPELTK.K
	TK251102_lung_cytoE16_2_step01.4976.4976.1	0.9598	0.1667	1580.46	4	2500.0%	1	K.YEISSVPTFLFFK.N
*	TK251102_lung_cytoE16_2_step10.2578.2578.1	1.7093	0.384	1081.52	1	5000.0%	2	K.EHPHVSFVK.L
*	TK251102_lung_cytoE16_2_step10.2478.2478.2	3.0513	0.6161	1709.53	1	5330.0%	8	R.HVSSGAFPPSTNEHLK.E
UQ9D0K499.6%5732.0%241255707.8(Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase)
*	TK251102_lung_cytoE16_2_step02.2371.2371.3	1.304	0.0217	2598.17	11	1960.0%	1	K.MTDSFTEQADQVTADVGKLLGDQK.V
*	TK251102_lung_cytoE16_2_step02.3290.3290.2	1.0219	0.0191	1679.9	12	2500.0%	1	K.QSMWTSTISSHLATK.H
*	TK251102_lung_cytoE16_2_step11.0885.0885.3	1.1521	0.0409	4359.61	45	1030.0%	1	R.NWWVASIDVVENEEASASVVVKMTDSFTEQADQVTADVGK.L
*	TK251102_lung_cytoE16_2_step07.3118.3118.2	2.5223	0.5153	1673.04	1	4670.0%	2	K.RPNSGSLIQVVTTDGK.T
UQ9D7G099.6%61824.2%318348487.0(Q9D7G0) 2310010D17Rik protein
	TK251102_lung_cytoE16_2_step10.4409.4409.2	1.443	0.2843	1944.56	15	3120.0%	1	R.RTHNGESVSYLFSHVPL.-
	TK251102_lung_cytoE16_2_step11.3690.3690.3	0.8687	0.1181	4643.17	1	890.0%	1	K.LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLK.W
	TK251102_lung_cytoE16_2_step09.4179.4179.2	4.5187	0.6012	1805.48	1	6880.0%	4	R.VYAILTHGIFSGPAISR.I
UQ9CY4099.6%3845226.2%122131848.8(Q9CY40) Hemoglobin, beta adult major chain
	TK251102_lung_cytoE16_2_step10.4465.4465.3	3.3101	0.3501	2995.24	1	2500.0%	5	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK251102_lung_cytoE16_2_step04.3820.3820.2	0.7504	0.0083	3132.55	110	1000.0%	1	K.VADALANAAGHLDDLPGALSALSDLHAHKLR.V
	TK251102_lung_cytoE16_2_step05.0026.0026.3	6.1573	0.673	2868.14	1	3660.0%	11	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UPAB1_MOUSE99.6%3010425.6%636706439.5(P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1)
	TK251102_lung_cytoE16_2_step05.2017.2017.1	1.4495	0.2504	1391.61	2	4500.0%	2	R.QAHLTNQYMQR.M
*	TK251102_lung_cytoE16_2_step10.4434.4434.2	3.7241	0.5231	1626.72	1	6790.0%	6	R.LFPLIQAMHPSLAGK.I
	TK251102_lung_cytoE16_2_step01.2219.2219.1	0.957	0.0153	818.88	20	5710.0%	1	K.FGPALSVK.V
	TK251102_lung_cytoE16_2_step02.3282.3282.2	2.1295	0.2717	1416.45	1	5830.0%	3	R.KEFSPFGTITSAK.V
	TK251102_lung_cytoE16_2_step05.3037.3037.2	2.6906	0.4352	1695.79	1	5670.0%	5	R.SKVDEAVAVLQAHQAK.E
	TK251102_lung_cytoE16_2_step02.4739.4739.2	1.7604	0.3764	2742.94	1	3040.0%	1	K.ITGMLLEIDNSELLHMLESPESLR.S
	TK251102_lung_cytoE16_2_step12.2796.2796.3	4.263	0.6382	4458.53	1	2120.0%	1	R.NPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQK.Q
	TK251102_lung_cytoE16_2_step09.3509.3509.2	2.3056	0.4554	1544.61	1	6540.0%	4	R.IVATKPLYVALAQR.K
	TK251102_lung_cytoE16_2_step03.1679.1679.1	1.4766	0.0936	810.8	1	8000.0%	1	R.KFEQMK.Q
	TK251102_lung_cytoE16_2_step02.3206.3206.2	2.4465	0.2599	1741.56	1	4290.0%	1	K.GYGFVHFETQEAAER.A
UTCPZ_MOUSE99.6%143017.5%531580047.1(P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1)
	TK251102_lung_cytoE16_2_step06.2085.2085.2	1.5468	0.4289	1289.88	1	5500.0%	1	K.HKSETDTSLIR.G
	TK251102_lung_cytoE16_2_step02.2279.2279.2	2.1074	0.3439	937.84	1	8120.0%	1	R.GLVLDHGAR.H
*	TK251102_lung_cytoE16_2_step10.4954.4954.2	1.7625	0.4216	2236.45	1	4250.0%	3	K.VHAELADVLTEAVVDSILAIR.K
	TK251102_lung_cytoE16_2_step05.1963.1963.1	1.5735	0.2903	840.61	1	6670.0%	2	K.HTLTQIK.D
*	TK251102_lung_cytoE16_2_step07.4518.4518.2	1.3717	0.0232	2202.66	3	2940.0%	1	K.RVENAYILTCNVSLEYEK.T
	TK251102_lung_cytoE16_2_step06.3750.3750.2	3.3039	0.5033	2316.67	1	4000.0%	3	K.DGNVLLHEMQIQHPTASLIAK.V
	TK251102_lung_cytoE16_2_step07.2682.2682.1	1.7594	0.0212	744.62	9	6000.0%	1	K.KIIELK.K
URS7_HUMAN99.6%133329.9%1942212710.1(P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8)
	TK251102_lung_cytoE16_2_step04.4448.4448.1	2.4396	0.2416	1339.92	1	6360.0%	2	K.AIIIFVPVPQLK.S
	TK251102_lung_cytoE16_2_step09.2695.2695.1	1.4241	0.1424	971.61	6	5000.0%	3	K.HVVFIAQR.R
	TK251102_lung_cytoE16_2_step02.4713.4713.2	4.1001	0.6506	2368.83	1	5480.0%	1	R.TLTAVHDAILEDLVFPSEIVGK.R
	TK251102_lung_cytoE16_2_step01.4923.4923.1	2.2728	0.4333	1386.76	1	5500.0%	1	K.DVNFEFPEFQL.-
	TK251102_lung_cytoE16_2_step03.1345.1345.1	1.3956	0.2305	611.16	3	7500.0%	1	K.VHLDK.A
UALBU_MOUSE99.6%122102244.4%608686936.1(P07724) Serum albumin precursor
*	TK251102_lung_cytoE16_2_step01.3042.3042.2	2.4076	0.4143	1682.71	1	6070.0%	1	R.LSQTFPNADFAEITK.L
	TK251102_lung_cytoE16_2_step01.0127.0127.1	1.1073	0.0336	474.02	5	6670.0%	2	K.NLVK.T
*	TK251102_lung_cytoE16_2_step01.2072.2072.2	2.8152	0.5278	1984.8	1	6180.0%	1	K.AADKDTCFSTEGPNLVTR.C
*	TK251102_lung_cytoE16_2_step11.4092.4092.2	1.3953	0.1927	1887.15	1	3670.0%	1	K.DTCFSTEGPNLVTRCK.D
*	TK251102_lung_cytoE16_2_step12.0062.0062.1	1.652	0.2455	1482.0	1	5000.0%	5	K.GLVLIAFSQYLQK.C
*	TK251102_lung_cytoE16_2_step02.2237.2237.2	2.8528	0.3038	1376.64	1	7000.0%	1	K.LQTCCDKPLLK.K
*	TK251102_lung_cytoE16_2_step01.3183.3183.2	1.0093	0.0504	2539.33	3	2620.0%	1	K.DDNPSLPPFERPEAEAMCTSFK.E
*	TK251102_lung_cytoE16_2_step01.2050.2050.1	2.1356	0.4161	1151.91	2	5560.0%	3	K.LVQEVTDFAK.T
	TK251102_lung_cytoE16_2_step11.0805.0805.1	0.8274	0.2074	509.39	4	6670.0%	1	K.HKPK.A
*	TK251102_lung_cytoE16_2_step01.1782.1782.1	2.1203	0.3377	1252.94	1	6110.0%	3	R.YNDLGEQHFK.G
*	TK251102_lung_cytoE16_2_step05.2260.2260.1	1.4751	0.029	901.37	28	5830.0%	3	R.VCLLHEK.T
*	TK251102_lung_cytoE16_2_step01.5067.5067.2	3.8309	0.6295	1663.64	1	7690.0%	1	R.LPCVEDYLSAILNR.V
*	TK251102_lung_cytoE16_2_step12.3015.3015.2	2.2967	0.4566	1458.08	1	5910.0%	5	R.RHPDYSVSLLLR.L
*	TK251102_lung_cytoE16_2_step08.4939.4939.2	0.7498	0.1166	1878.51	21	2000.0%	1	R.VCLLHEKTPVSEHVTK.C
*	TK251102_lung_cytoE16_2_step01.1534.1534.1	1.3516	0.2264	761.84	1	7500.0%	2	K.LATDLTK.V
*	TK251102_lung_cytoE16_2_step06.3808.3808.2	3.0796	0.4633	1905.98	1	5670.0%	24	K.ENPTTFMGHYLHEVAR.R
*	TK251102_lung_cytoE16_2_step04.3555.3555.1	1.8513	0.4021	1301.47	1	6000.0%	4	R.HPDYSVSLLLR.L
*	TK251102_lung_cytoE16_2_step08.4669.4669.2	3.5887	0.5772	1613.38	1	7500.0%	5	K.DVFLGTFLYEYSR.R
*	TK251102_lung_cytoE16_2_step02.3283.3283.2	1.4554	0.2826	2153.96	1	3820.0%	1	K.AETFTFHSDICTLPEKEK.Q
	TK251102_lung_cytoE16_2_step04.3032.3032.1	1.7844	0.3018	1019.52	1	6250.0%	7	K.SLHTLFGDK.L
*	TK251102_lung_cytoE16_2_step08.3411.3411.2	3.2123	0.4349	1886.43	1	4670.0%	8	R.RPCFSALTVDETYVPK.E
*	TK251102_lung_cytoE16_2_step05.2941.2941.1	2.0278	0.3791	1102.69	1	6110.0%	6	K.KQTALAELVK.H
*	TK251102_lung_cytoE16_2_step02.1761.1761.1	1.6776	0.0732	982.74	2	6430.0%	3	K.KYEATLEK.C
*	TK251102_lung_cytoE16_2_step01.2102.2102.1	1.0842	0.2399	1443.31	2	3460.0%	4	K.APQVSTPTLVEAAR.N
*	TK251102_lung_cytoE16_2_step01.2398.2398.1	1.2465	0.0213	957.68	13	5710.0%	1	K.LCAIPNLR.E
*	TK251102_lung_cytoE16_2_step01.1403.1403.1	1.1801	0.1102	1000.57	22	3750.0%	5	K.TPVSEHVTK.C
UTGT_MOUSE99.6%2213.7%387425687.7(Q9JMA2) Queuine tRNA-ribosyltransferase (EC 2.4.2.29) (tRNA-guanine transglycosylase) (Guanine insertion enzyme)
*	TK251102_lung_cytoE16_2_step07.4466.4466.3	1.4874	0.1109	3614.54	24	1210.0%	1	K.GITTEQLDSLGCRICLGNTYHLGLRPGPELIR.K
*	TK251102_lung_cytoE16_2_step12.3239.3239.2	2.9217	0.5439	2185.46	1	3750.0%	1	R.LPHGTVATPVFMPVGTQATMK.G
UPIMT_MOUSE99.6%61028.8%226245037.6(P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase)
	TK251102_lung_cytoE16_2_step06.3988.3988.3	1.3291	0.0289	3509.72	7	1360.0%	1	R.MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR.L
	TK251102_lung_cytoE16_2_step09.1687.1687.3	1.4418	0.0457	1964.66	16	2030.0%	1	K.MKPLMGVIYVPLTDKEK.Q
	TK251102_lung_cytoE16_2_step09.2624.2624.2	3.284	0.4813	1478.82	1	6540.0%	2	K.SGGASHSELIHNLR.K
UITH2_MOUSE99.6%7117.2%9461059287.3(Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2)
*	TK251102_lung_cytoE16_2_step05.4029.4029.3	1.3449	0.0083	3022.96	37	1570.0%	1	R.VATTTIQSKLVNNSPLPQSVVFDVQIPK.G
*	TK251102_lung_cytoE16_2_step07.5450.5450.3	1.2159	0.1933	2096.39	14	1530.0%	1	K.LVNNSPLPQSVVFDVQIPK.G
*	TK251102_lung_cytoE16_2_step11.3838.3838.2	4.0778	0.5842	2258.37	1	5790.0%	2	R.FLHVPDTFEGHFQGVPVISK.G
	TK251102_lung_cytoE16_2_step11.1785.1785.2	2.7658	0.5976	1470.48	1	6250.0%	1	K.AHVSFKPTVAQQR.K
*	TK251102_lung_cytoE16_2_step08.1898.1898.1	0.9932	0.1418	792.78	3	5830.0%	2	K.IHLQPGK.L
UQ9D0E199.6%92113.2%729776498.6(Q9D0E1) 2610023M21Rik protein
	TK251102_lung_cytoE16_2_step04.1941.1941.1	1.8292	0.4412	1103.49	1	6000.0%	1	R.MGAGLGHGMDR.V
	TK251102_lung_cytoE16_2_step10.1811.1811.3	1.141	0.0293	2042.44	45	2330.0%	1	K.ACQIFVRNLPFDFTWK.M
*	TK251102_lung_cytoE16_2_step01.5278.5278.2	0.8416	0.1826	3138.36	7	1210.0%	1	K.MEEESGAPCVPSGNGAPGPKGEERPTQNEK.R
	TK251102_lung_cytoE16_2_step07.3152.3152.2	3.3495	0.659	2037.74	1	4770.0%	4	R.GNFGGSFAGSFGGAGGHAPGVAR.K
	TK251102_lung_cytoE16_2_step11.2017.2017.2	1.2698	0.1399	1752.26	28	3000.0%	1	K.VGEVTYVELLMDAEGK.S
UG25B_HUMAN99.6%94112.6%191213116.0(P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog)
	TK251102_lung_cytoE16_2_step03.4201.4201.2	2.2312	0.1577	1474.26	3	5420.0%	6	K.TPFLLVGTQIDLR.D
	TK251102_lung_cytoE16_2_step11.2156.2156.1	1.8374	0.3967	1405.76	1	4500.0%	2	K.WVPEITHHCPK.T
UENOA_MOUSE99.6%5920559.6%433470106.8(P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1)
*	TK251102_lung_cytoE16_2_step01.4778.4778.2	2.898	0.3971	2971.52	1	3120.0%	1	K.SFVQNYPVVSIEDPFDQDDWGAWQK.F
	TK251102_lung_cytoE16_2_step01.2719.2719.2	2.0821	0.286	1961.25	1	3890.0%	1	K.DATNVGDEGGFAPNILENK.E
	TK251102_lung_cytoE16_2_step01.0259.0259.1	1.4199	0.2011	901.65	1	5620.0%	2	K.TIAPALVSK.K
*	TK251102_lung_cytoE16_2_step09.4480.4480.2	2.5807	0.4447	2194.75	1	3680.0%	5	K.AGYTDQVVIGMDVAASEFYR.S
	TK251102_lung_cytoE16_2_step01.2254.2254.1	1.8921	0.2009	1408.85	2	5420.0%	2	R.GNPTVEVDLYTAK.G
*	TK251102_lung_cytoE16_2_step02.4237.4237.2	4.1965	0.0375	3025.6	1	3970.0%	6	R.HIADLAGNPEVILPVPAFNVINGGSHAGNK.L
*	TK251102_lung_cytoE16_2_step02.1659.1659.1	1.2905	0.0642	944.74	9	5710.0%	1	K.VNVVEQEK.I
*	TK251102_lung_cytoE16_2_step01.0230.0230.1	1.0483	0.0858	806.61	15	6000.0%	2	K.YNQILR.I
*	TK251102_lung_cytoE16_2_step01.1770.1770.1	1.9824	0.3017	1183.95	1	5000.0%	4	K.GVSQAVEHINK.T
	TK251102_lung_cytoE16_2_step01.5631.5631.2	1.31	0.1679	2036.2	1	3420.0%	6	K.FTASAGIQVVGDDLTVTNPK.R
	TK251102_lung_cytoE16_2_step01.0722.0722.1	1.1874	0.1283	542.61	1	7500.0%	2	R.NPLAK.-
	TK251102_lung_cytoE16_2_step03.2166.2166.1	1.7897	0.2201	1145.55	21	3890.0%	3	R.IGAEVYHNLK.N
	TK251102_lung_cytoE16_2_step01.4419.4419.2	0.7394	0.0153	1808.23	9	2650.0%	2	R.AAVPSGASTGIYEALELR.D
	TK251102_lung_cytoE16_2_step05.5387.5387.2	1.739	0.3808	1523.29	1	3930.0%	1	K.FGANAILGVSLAVCK.A
*	TK251102_lung_cytoE16_2_step01.3442.3442.1	2.5637	0.4672	1442.82	1	5000.0%	3	R.YITPDQLADLYK.S
	TK251102_lung_cytoE16_2_step06.4808.4808.2	4.1266	0.6353	2355.23	1	4760.0%	5	R.SGETEDTFIADLVVGLCTGQIK.T
*	TK251102_lung_cytoE16_2_step02.1645.1645.2	2.5531	0.2492	1073.02	1	8750.0%	1	K.KVNVVEQEK.I
	TK251102_lung_cytoE16_2_step03.2877.2877.2	2.7613	0.3488	1544.64	1	7310.0%	3	K.LAQSNGWGVMVSHR.S
UQ922Y799.6%304583.2%464510285.3(Q922Y7) Unknown (Protein for MGC:6388)
	TK251102_lung_cytoE16_2_step11.3938.3938.1	1.8078	0.2571	1522.06	1	3570.0%	17	R.LLIHQSLAGGIIGVK.G
UAAC2_MOUSE99.6%205218.1%8941036535.5(Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein)
	TK251102_lung_cytoE16_2_step05.2963.2963.2	1.3665	0.0823	2779.89	29	1670.0%	1	R.AIMTYVSCFYHAFAGAEQAETAANR.I
	TK251102_lung_cytoE16_2_step08.2274.2274.1	1.8751	0.1438	1303.68	1	5560.0%	3	K.HTNYTMEHIR.V
	TK251102_lung_cytoE16_2_step08.2367.2367.2	2.9107	0.608	1755.57	1	6070.0%	5	R.KHEAFESDLAAHQDR.V
	TK251102_lung_cytoE16_2_step06.3108.3108.3	1.5054	0.0908	2842.19	94	1670.0%	1	R.VEQIAAIAQELNELDYHDAVNVNDR.C
	TK251102_lung_cytoE16_2_step06.2952.2952.2	2.312	0.444	1394.3	1	6500.0%	3	K.TFTAWCNSHLR.K
	TK251102_lung_cytoE16_2_step01.4235.4235.1	1.1272	0.1661	1423.85	9	3000.0%	1	K.GYEEWLLNEIR.R
	TK251102_lung_cytoE16_2_step01.3566.3566.1	1.3043	0.1131	1200.95	1	6110.0%	1	R.DLLLDPAWEK.Q
	TK251102_lung_cytoE16_2_step03.2041.2041.1	1.308	0.1338	994.56	2	5710.0%	1	R.ASFNHFDR.R
	TK251102_lung_cytoE16_2_step12.2085.2085.3	1.4748	0.0339	3104.44	18	1900.0%	1	K.RMPPYSGPGSVPGALDYTAFSSALYGESDL.-
	TK251102_lung_cytoE16_2_step08.4035.4035.3	1.7588	0.0277	2078.49	1	2810.0%	1	K.TAPYRNVNIQNFHTSWK.D
UKPY1_HUMAN99.6%10669.2%530578067.8(P14618) Pyruvate kinase, M1 isozyme (EC 2.7.1.40) (Pyruvate kinase muscle isozyme) (Cytosolic thyroid hormone-binding protein) (CTHBP) (THBP1)
	TK251102_lung_cytoE16_2_step08.4586.4586.2	3.1353	0.5602	1881.2	1	5620.0%	8	R.AGKPVICATQMLESMIK.K
	TK251102_lung_cytoE16_2_step11.0566.0566.2	1.0951	0.0761	2463.94	31	1590.0%	1	R.TATESFASDPILYRPVAVALDTK.G
	TK251102_lung_cytoE16_2_step04.2312.2312.1	0.9202	0.0198	1042.65	37	3750.0%	1	R.KASDVHEVR.K
UCRKL_MOUSE99.6%91913.2%303338176.7(P47941) Crk-like protein
	TK251102_lung_cytoE16_2_step06.2820.2820.2	3.2296	0.5097	1413.54	1	6820.0%	1	R.VSHYIINSLPNR.R
*	TK251102_lung_cytoE16_2_step11.4228.4228.2	1.6219	0.2536	2311.68	2	2500.0%	1	K.KGELLVIIEKPEEQWWSAR.T
	TK251102_lung_cytoE16_2_step07.3868.3868.2	1.809	0.3274	1047.34	1	6250.0%	3	K.GLFPFTHVK.I
UMDHM_MOUSE99.6%71913.6%338355968.6(P08249) Malate dehydrogenase, mitochondrial precursor (EC 1.1.1.37)
	TK251102_lung_cytoE16_2_step06.1524.1524.1	2.0742	0.1974	928.55	5	7140.0%	1	K.HGVYNPNK.I
	TK251102_lung_cytoE16_2_step06.2534.2534.1	2.3834	0.4737	1149.6	1	6820.0%	4	R.VNVPVIGGHAGK.T
	TK251102_lung_cytoE16_2_step06.3894.3894.2	1.2175	0.0274	2547.51	1	2600.0%	1	K.VAVLGASGGIGQPLSLLLKNSPLVSR.L
UUBA1_MOUSE99.6%4413427.2%10581178095.7(Q02053) Ubiquitin-activating enzyme E1 1
*	TK251102_lung_cytoE16_2_step01.5202.5202.2	1.4094	0.3404	2616.44	3	2500.0%	1	R.IYDDDFFQNLDGVANALDNIDAR.M
	TK251102_lung_cytoE16_2_step04.2007.2007.3	1.3377	0.0296	2734.93	20	1630.0%	1	R.KLAYVAAGDLAPINAFIGGLAAQEVMK.A
	TK251102_lung_cytoE16_2_step08.4223.4223.2	1.2864	0.0070	2527.75	8	2270.0%	3	R.QLLHNFPPDQLTSSGAPFWSGPK.R
	TK251102_lung_cytoE16_2_step01.1546.1546.1	1.2057	0.2462	788.28	3	5710.0%	1	R.GGIVSQVK.V
*	TK251102_lung_cytoE16_2_step01.1582.1582.1	1.2036	0.2962	1556.73	2	2690.0%	1	K.NGSEADIDESLYSR.Q
	TK251102_lung_cytoE16_2_step04.4472.4472.2	2.0129	0.3175	3093.69	1	2400.0%	2	K.MYPIDFEKDDDSNFHMDFIVAASNLR.A
	TK251102_lung_cytoE16_2_step03.3039.3039.1	1.5469	0.2691	1372.66	4	4170.0%	3	K.ATLPSPDKLPGFK.M
	TK251102_lung_cytoE16_2_step08.2165.2165.1	1.5629	0.0892	622.68	1	7500.0%	2	K.KISFK.S
	TK251102_lung_cytoE16_2_step01.3714.3714.2	2.485	0.4563	1624.5	1	6070.0%	1	R.LAGTQPLEVLEAVQR.S
	TK251102_lung_cytoE16_2_step01.4219.4219.2	1.1489	0.0819	1886.6	3	2940.0%	1	R.AAVASLLQSVQVPEFTPK.S
	TK251102_lung_cytoE16_2_step01.0508.0508.1	1.4963	0.1548	813.66	3	6430.0%	2	K.NIILGGVK.A
	TK251102_lung_cytoE16_2_step05.2624.2624.1	2.0242	0.1213	1246.64	1	5450.0%	6	R.KPLLESGTLGTK.G
*	TK251102_lung_cytoE16_2_step09.4935.4935.3	5.2172	0.6244	4382.46	1	2370.0%	4	R.LAELNSYVPVTAYTGPLVEDFLSSFQVVVLTNSPLEAQLR.V
*	TK251102_lung_cytoE16_2_step03.1651.1651.1	1.1316	0.0419	991.43	3	5000.0%	1	R.VGEFCHSR.G
	TK251102_lung_cytoE16_2_step04.3977.3977.1	1.1837	0.0574	1437.85	2	3500.0%	1	R.QFLFRPWDVTK.L
	TK251102_lung_cytoE16_2_step03.3938.3938.2	1.7576	0.184	1698.87	1	5380.0%	5	K.NFPNAIEHTLQWAR.D
	TK251102_lung_cytoE16_2_step03.3630.3630.3	1.5422	0.1593	3749.82	131	1180.0%	1	R.KPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEK.S
UQ9CQ9999.6%3539.1%115116514.5(Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene)
	TK251102_lung_cytoE16_2_step01.2022.2022.2	2.9969	0.5698	2777.37	1	2810.0%	1	K.LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK.K
*	TK251102_lung_cytoE16_2_step01.3132.3132.1	1.0626	0.1917	1243.05	1	4550.0%	2	K.NIEDVIAQGVGK.L
UHMG1_MOUSE99.6%2512317.3%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30)
	TK251102_lung_cytoE16_2_step03.1441.1441.1	1.3083	0.133	916.64	3	6430.0%	1	K.FKDPNAPK.R
	TK251102_lung_cytoE16_2_step01.2150.2150.1	2.0675	0.4545	1281.0	1	5420.0%	2	K.GEHPGLSIGDVAK.K
	TK251102_lung_cytoE16_2_step10.2837.2837.1	2.2857	0.4593	1523.84	1	4640.0%	7	K.IKGEHPGLSIGDVAK.K
	TK251102_lung_cytoE16_2_step08.2845.2845.1	3.0628	0.3876	1595.67	1	5770.0%	6	K.KHPDASVNFSEFSK.K
UQ6200999.6%81016.0%811902557.3(Q62009) Osteoblast specific factor 2 precursor (OSF-2)
*	TK251102_lung_cytoE16_2_step07.2871.2871.2	2.7327	0.535	1943.77	1	4120.0%	1	R.VIHGNQIATNGVVHVIDR.V
*	TK251102_lung_cytoE16_2_step08.3181.3181.2	1.1055	0.0174	1725.97	7	3210.0%	1	R.TAICIENSCMVRGSK.Q
*	TK251102_lung_cytoE16_2_step01.4042.4042.3	1.0798	0.1301	4021.18	12	1180.0%	2	-.MVPLLPLYALLLLFLCDINPANANSYYDKVLAHSR.I
	TK251102_lung_cytoE16_2_step11.1382.1382.2	1.3131	0.0799	1447.81	1	4090.0%	1	R.LLKLILQNHILK.V
*	TK251102_lung_cytoE16_2_step12.4671.4671.3	1.155	0.1105	4511.45	2	1190.0%	1	R.VIHGNQIATNGVVHVIDRVLTQIGTSIQDFLEAEDDLSSFR.A
*	TK251102_lung_cytoE16_2_step05.3144.3144.2	1.634	0.0528	2254.44	1	2630.0%	1	K.DLLTQPGDWTLFAPTNDAFK.G
*	TK251102_lung_cytoE16_2_step03.1685.1685.1	1.0202	0.0077	786.55	144	4170.0%	1	R.ELLIGDK.N
UIRE1_MOUSE99.6%555.5%889981407.5(P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase)
	TK251102_lung_cytoE16_2_step11.3084.3084.2	3.0358	0.5893	1933.6	1	5290.0%	1	K.NPFAHLAEPLDAAQPGKR.F
	TK251102_lung_cytoE16_2_step01.2974.2974.1	0.8242	0.1721	1107.82	53	3330.0%	1	K.TVVPCCSGPK.R
	TK251102_lung_cytoE16_2_step04.1675.1675.1	1.2942	0.2449	1003.48	12	3750.0%	1	R.RGNDAIMAR.G
	TK251102_lung_cytoE16_2_step09.0878.0878.1	0.7489	0.178	425.55	1	7500.0%	1	R.IHR.S
	TK251102_lung_cytoE16_2_step09.3097.3097.1	1.0512	0.1063	1057.5	9	3750.0%	1	R.QHVIPGMFK.E
UTRXB_MOUSE99.6%164413.2%499544976.3(Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR)
*	TK251102_lung_cytoE16_2_step10.3449.3449.2	2.3598	0.4488	1394.92	1	6670.0%	2	K.LMHQAALLGQALK.D
	TK251102_lung_cytoE16_2_step12.2803.2803.3	2.0274	0.0209	2285.12	8	2270.0%	1	R.VVGFHVLGPNAGEVTQGFAAALK.C
	TK251102_lung_cytoE16_2_step04.1964.1964.2	1.5718	0.0381	1279.66	1	6500.0%	1	K.IGEHMEEHGIK.F
*	TK251102_lung_cytoE16_2_step05.2829.2829.2	2.027	0.3202	1160.72	2	6110.0%	1	R.FLIATGERPR.Y
*	TK251102_lung_cytoE16_2_step12.2803.2803.2	3.3268	0.4848	1523.75	1	7310.0%	1	K.KLMHQAALLGQALK.D
	TK251102_lung_cytoE16_2_step10.2622.2622.1	1.2665	0.1244	862.59	11	6430.0%	1	R.YLGIPGDK.E
UQ9CQ6099.6%113733.9%257272545.8(Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene)
*	TK251102_lung_cytoE16_2_step01.4391.4391.2	1.3899	0.036	2808.41	1	2400.0%	1	K.LPIPDSQVLTINPALPVEDAAEDYAR.K
*	TK251102_lung_cytoE16_2_step06.4870.4870.2	1.8783	0.3149	2343.68	1	2730.0%	5	R.VTLTLPVLNAAQSIIFVATGEGK.A
*	TK251102_lung_cytoE16_2_step07.2842.2842.2	1.6832	0.201	1850.69	21	2810.0%	1	R.ILEDKEGTLPAALVQPR.T
	TK251102_lung_cytoE16_2_step08.2149.2149.2	2.7545	0.6036	1603.14	1	6430.0%	3	K.IVAPISDSPKPPPQR.V
*	TK251102_lung_cytoE16_2_step06.1928.1928.1	1.2771	0.2412	698.56	1	7000.0%	1	R.THLLSK.L
UCAH2_MOUSE99.6%207416.2%259289607.0(P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II)
	TK251102_lung_cytoE16_2_step10.1913.1913.2	1.701	0.2495	1121.25	1	7500.0%	2	K.HNGPENWHK.D
	TK251102_lung_cytoE16_2_step02.2773.2773.1	1.6736	0.2726	1011.54	1	5620.0%	3	K.VLEALHSIK.T
	TK251102_lung_cytoE16_2_step10.3567.3567.1	2.2514	0.4382	1583.7	1	5420.0%	5	K.YAAELHLVHWNTK.Y
	TK251102_lung_cytoE16_2_step12.2948.2948.2	1.9604	0.5656	1711.99	1	5380.0%	1	K.KYAAELHLVHWNTK.Y
	TK251102_lung_cytoE16_2_step01.1502.1502.1	1.5209	0.2905	998.92	1	6110.0%	1	K.IGPASQGLQK.V
UDHCA_MOUSE99.6%5915.2%276305977.8(P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1)
*	TK251102_lung_cytoE16_2_step02.2847.2847.2	3.3207	0.4778	1584.74	1	6250.0%	2	R.FHQLDIDNPQSIR.A
*	TK251102_lung_cytoE16_2_step03.3383.3383.2	1.9775	0.1946	1265.45	1	5500.0%	1	K.ELLPLIKPQGR.V
*	TK251102_lung_cytoE16_2_step08.2763.2763.2	4.1255	0.5544	1933.8	1	5000.0%	2	K.KGVHAEEGWPNSAYGVTK.I
UPDX2_MOUSE99.6%2111953.5%198217795.4(Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA)
*	TK251102_lung_cytoE16_2_step01.0275.0275.1	1.6485	0.0713	1108.88	2	6670.0%	1	K.SLSQNYGVLK.N
*	TK251102_lung_cytoE16_2_step01.4868.4868.2	2.4178	0.4767	1709.25	1	4690.0%	1	K.EGGLGPLNIPLLADVTK.S
*	TK251102_lung_cytoE16_2_step04.3187.3187.3	1.6044	0.108	3660.31	11	1470.0%	1	K.YVVLFFYPLDFTFVCPTEIIAFSDHAEDFR.K
	TK251102_lung_cytoE16_2_step07.4544.4544.2	1.8717	0.0441	2703.94	2	2610.0%	5	K.LGCEVLGVSVDSQFTHLAWINTPR.K
*	TK251102_lung_cytoE16_2_step01.4543.4543.1	1.0123	0.1061	1599.05	1	3330.0%	3	K.SAPDFTATAVVDGAFK.E
*	TK251102_lung_cytoE16_2_step02.4501.4501.2	4.2477	0.6529	1839.12	1	6470.0%	9	R.KEGGLGPLNIPLLADVTK.S
*	TK251102_lung_cytoE16_2_step01.3363.3363.1	1.6413	0.0234	877.72	7	6430.0%	1	R.GLFIIDAK.G
UQ99K5199.6%166616.7%630707425.6(Q99K51) Hypothetical 70.7 kDa protein
	TK251102_lung_cytoE16_2_step07.3846.3846.1	2.3974	0.3773	1416.88	1	6820.0%	6	K.AYFHLLNQIAPK.G
	TK251102_lung_cytoE16_2_step11.0020.0020.2	0.978	0.0304	3006.84	37	1460.0%	1	K.YPALTKPENQDIDWTLLEGETREER.T
	TK251102_lung_cytoE16_2_step03.2557.2557.3	1.4462	0.0014	2714.13	154	1700.0%	1	K.ALENDPDCRHVIPMNPNTDDLFK.A
*	TK251102_lung_cytoE16_2_step11.5746.5746.2	0.9091	0.0461	3013.52	8	1670.0%	1	K.FSLVGIGGQDLNDGNPTLTLAVVWQLMR.R
	TK251102_lung_cytoE16_2_step06.1361.1361.1	0.8893	0.0221	583.83	4	6250.0%	1	K.HNNAK.Y
*	TK251102_lung_cytoE16_2_step10.1797.1797.2	0.922	0.0117	1420.44	26	3640.0%	1	R.EIIQKLMVDGDR.N
UPCB1_HUMAN99.6%51315.7%356375267.1(Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3)
*	TK251102_lung_cytoE16_2_step11.4985.4985.3	4.1448	0.6209	3380.49	1	2920.0%	2	K.AFAMIIDKLEEDINSSMTNSTAASRPPVTLR.L
*	TK251102_lung_cytoE16_2_step10.3366.3366.2	2.417	0.3676	2610.31	1	3330.0%	3	R.QQSHFAMMHGGTGFAGIDSSSPEVK.G
UO8856899.6%122212.4%798878926.3(O88568) Heterogenous nuclear ribonucleoprotein U
	TK251102_lung_cytoE16_2_step01.1835.1835.1	1.4229	0.2888	997.97	1	5710.0%	1	K.DIDIHEVR.I
*	TK251102_lung_cytoE16_2_step03.4490.4490.2	0.9606	0.0497	2035.24	2	3000.0%	1	R.GNMPQRGGGGGSGGIGYPYPR.G
	TK251102_lung_cytoE16_2_step01.1822.1822.1	1.8152	0.0301	1075.88	18	5000.0%	1	K.VSELKEELK.K
	TK251102_lung_cytoE16_2_step05.1675.1675.1	1.2314	0.097	663.42	2	6250.0%	3	R.HLYTK.D
	TK251102_lung_cytoE16_2_step01.1916.1916.1	1.978	0.0088	1024.16	5	5620.0%	2	K.DLPEHAVLK.M
	TK251102_lung_cytoE16_2_step01.1275.1275.1	1.5042	0.0512	820.41	8	7500.0%	2	K.FIEIAAR.K
	TK251102_lung_cytoE16_2_step05.3703.3703.2	3.6208	0.5725	1706.78	1	5330.0%	1	K.KDCEVVMMIGLPGAGK.T
	TK251102_lung_cytoE16_2_step02.3935.3935.3	1.1638	0.0325	2860.49	56	1410.0%	1	K.MKGNFTLPEVAECFDEITYVELQK.E
URS3_MOUSE99.6%3213038.3%243266749.7(P17073) 40S ribosomal protein S3
	TK251102_lung_cytoE16_2_step02.2233.2233.1	2.2527	0.3894	1575.65	1	4000.0%	3	K.GGKPEPPAMPQPVPTA.-
	TK251102_lung_cytoE16_2_step01.2031.2031.1	1.3216	0.0964	1470.89	1	5000.0%	1	K.DEILPTTPISEQK.G
	TK251102_lung_cytoE16_2_step01.2828.2828.1	1.5386	0.0981	897.86	1	6430.0%	1	K.FVADGIFK.A
	TK251102_lung_cytoE16_2_step01.0614.0614.1	0.8977	0.0647	414.38	3	6670.0%	1	K.IGPK.K
	TK251102_lung_cytoE16_2_step08.2309.2309.1	1.4032	0.1547	637.58	2	7500.0%	1	R.HVLLR.Q
	TK251102_lung_cytoE16_2_step01.2604.2604.1	1.0986	0.0223	1094.62	2	4380.0%	1	K.AELNEFLTR.E
	TK251102_lung_cytoE16_2_step01.0224.0224.1	1.1765	0.0189	887.62	40	5710.0%	1	R.ELTAVVQK.R
	TK251102_lung_cytoE16_2_step09.2761.2761.1	1.0563	0.0966	714.59	54	4170.0%	1	R.QGVLGIK.V
	TK251102_lung_cytoE16_2_step05.3324.3324.1	1.0948	0.0018	1030.79	4	5620.0%	2	R.TEIIILATR.T
	TK251102_lung_cytoE16_2_step03.3149.3149.1	2.2835	0.4458	1026.51	1	5620.0%	4	R.KFVADGIFK.A
	TK251102_lung_cytoE16_2_step10.2781.2781.2	2.7435	0.4619	1462.72	1	7080.0%	5	K.KPLPDHVSIVEPK.D
UQ8VDM699.6%101613.9%859960026.6(Q8VDM6) Similar to E1B-55 kDa-associated protein 5
	TK251102_lung_cytoE16_2_step08.3078.3078.2	2.5371	0.2438	1168.63	1	7500.0%	1	K.MRPFEGFQR.K
	TK251102_lung_cytoE16_2_step05.4875.4875.2	2.5691	0.5714	2553.48	1	3810.0%	1	K.ANFTLPDVGDFLDEVLFIELQR.E
	TK251102_lung_cytoE16_2_step01.3367.3367.1	0.8704	0.0040	1483.99	33	3330.0%	1	K.KYNILGTNAIMDK.M
*	TK251102_lung_cytoE16_2_step07.2882.2882.2	3.279	0.5786	2111.73	1	4690.0%	3	R.RPLDMEPQQQVYHPELK.T
	TK251102_lung_cytoE16_2_step07.2211.2211.2	0.9236	0.0823	1485.12	4	2920.0%	1	K.HLPSTEPDPHVVR.I
	TK251102_lung_cytoE16_2_step10.0088.0088.2	0.9784	0.1291	2708.0	3	1670.0%	1	R.SSGYPLTIEGFAYLWSGARASYGVR.R
*	TK251102_lung_cytoE16_2_step03.3883.3883.2	0.9344	0.0399	2476.86	4	1580.0%	1	R.QNQFYETPVIKQENESSYDR.R
UQ8VDM499.6%215716.4%9081002035.2(Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2)
	TK251102_lung_cytoE16_2_step10.3061.3061.1	0.9118	0.0955	843.64	11	5830.0%	2	R.TFGHLLR.Y
	TK251102_lung_cytoE16_2_step11.4352.4352.1	2.0244	0.4348	1419.98	1	5830.0%	1	R.WLPLGLGLNHLGK.G
*	TK251102_lung_cytoE16_2_step02.3398.3398.1	0.9101	0.0791	1268.46	1	5000.0%	1	K.AQREPLLTLVK.E
	TK251102_lung_cytoE16_2_step05.2384.2384.2	2.6419	0.3885	1038.42	1	7780.0%	1	R.LAQGLTHLGK.G
	TK251102_lung_cytoE16_2_step02.2210.2210.2	1.1748	0.1512	1464.22	1	4620.0%	1	R.SSTTSMTSVPKPLK.F
	TK251102_lung_cytoE16_2_step06.3017.3017.2	1.7446	0.3035	1841.88	1	3570.0%	2	K.VQQLLHICSEHFDSK.E
	TK251102_lung_cytoE16_2_step02.1689.1689.1	1.2186	0.2163	824.55	2	5710.0%	1	R.HLAGEVAK.E
	TK251102_lung_cytoE16_2_step12.1792.1792.1	1.2667	0.0854	1018.73	116	5000.0%	1	K.FLRPHYGK.L
	TK251102_lung_cytoE16_2_step06.3337.3337.3	1.488	0.0085	3401.03	71	1250.0%	1	K.VCLYLTSCVNYVPEPENSALLRCALGVFR.K
	TK251102_lung_cytoE16_2_step05.4923.4923.2	3.6707	0.4615	2016.25	1	5280.0%	6	K.GEAIEAILAALEVVSEPFR.S
	TK251102_lung_cytoE16_2_step03.4538.4538.2	1.6882	0.1827	1523.61	1	4640.0%	1	R.AVPLALALISVSNPR.L
UHDGF_MOUSE99.6%135920.3%237262694.8(P51859) Hepatoma-derived growth factor (HDGF)
	TK251102_lung_cytoE16_2_step07.4463.4463.2	4.0088	0.5437	1992.52	1	6560.0%	7	K.YQVFFFGTHETAFLGPK.D
	TK251102_lung_cytoE16_2_step04.3541.3541.2	1.6006	0.3346	1950.41	3	3440.0%	2	R.KGFSEGLWEIENNPTVK.A
	TK251102_lung_cytoE16_2_step07.2603.2603.2	1.0791	0.127	985.24	26	5000.0%	1	K.GYPHWPAR.I
	TK251102_lung_cytoE16_2_step07.1522.1522.1	1.3111	0.0074	690.57	9	6000.0%	1	K.FGKPNK.R
UUBC7_HUMAN99.6%6831.8%154178628.5(P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC)
	TK251102_lung_cytoE16_2_step11.3333.3333.3	1.2952	0.1918	4464.91	79	830.0%	1	K.GQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLR.A
	TK251102_lung_cytoE16_2_step03.4693.4693.2	3.5343	0.546	2484.66	1	4050.0%	1	K.TDQVIQSLIALVNDPQPEHPLR.A
	TK251102_lung_cytoE16_2_step02.2034.2034.1	2.2065	0.2745	1130.55	1	6880.0%	2	K.IYHPNIDEK.G
	TK251102_lung_cytoE16_2_step03.3513.3513.2	3.1836	0.4823	1999.66	1	4710.0%	1	K.GQVCLPVISAENWKPATK.T
UFUMH_MOUSE99.6%353.7%507543719.0(P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3)
*	TK251102_lung_cytoE16_2_step02.1833.1833.1	1.39	0.1778	854.63	1	7140.0%	2	K.LHDALSAK.S
*	TK251102_lung_cytoE16_2_step12.1297.1297.1	2.6657	0.5096	1285.77	1	6000.0%	1	K.KPVHPNDHVNK.S
UU186_MOUSE99.6%82625.6%86101196.4(Q923D4) Hypothetical protein MGC11596
	TK251102_lung_cytoE16_2_step07.2762.2762.1	2.2754	0.2402	1585.61	1	5000.0%	4	R.YTIHSQLEHLQSK.Y
	TK251102_lung_cytoE16_2_step05.3571.3571.2	1.6743	0.1309	1270.31	1	6880.0%	1	K.WEWLVNQHR.D
UO6070599.6%112.2%596640288.2(O60705) LIM protein
*	TK251102_lung_cytoE16_2_step06.2601.2601.2	2.7157	0.5723	1702.74	1	5830.0%	1	K.SWHPEEFNCAHCK.N
UQ9CPS199.6%247.9%329355607.9(Q9CPS1) 2510002C21Rik protein
*	TK251102_lung_cytoE16_2_step04.4805.4805.2	1.8987	0.4117	2934.28	1	3200.0%	2	K.TTELPPLNNGEVLLEALFLSVDPYMR.V
UCOPB_MOUSE99.6%111116.6%9531070666.0(Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP)
	TK251102_lung_cytoE16_2_step01.1522.1522.1	1.0467	0.0943	472.73	5	8330.0%	1	K.IALR.Y
	TK251102_lung_cytoE16_2_step07.1368.1368.1	0.6579	0.099	431.54	4	5000.0%	1	K.ANVK.V
	TK251102_lung_cytoE16_2_step10.1998.1998.3	1.7424	0.0269	2540.51	15	2170.0%	1	R.GFLLDGDFFVAASLATTLTKIALR.Y
*	TK251102_lung_cytoE16_2_step06.4160.4160.3	1.2356	0.0381	4081.76	1	1460.0%	1	R.FPDMAANVIPVLMEFLSDSNEAAAADVLEFVREAIQR.F
	TK251102_lung_cytoE16_2_step10.2130.2130.2	1.5168	0.0201	1451.91	1	5450.0%	1	R.RNAVLAIYTIYR.N
	TK251102_lung_cytoE16_2_step11.3210.3210.2	3.4014	0.5303	2092.27	1	4170.0%	1	K.LVEKPSPLTLAPHDFANIK.A
*	TK251102_lung_cytoE16_2_step10.3962.3962.3	4.4944	0.6539	3132.93	1	3280.0%	1	R.SIFGEDALANVSIEKPVHQGPDAAVTGHIR.I
*	TK251102_lung_cytoE16_2_step11.0886.0886.3	1.2305	0.0486	4422.84	108	830.0%	1	R.TLHSCSVRFPDMAANVIPVLMEFLSDSNEAAAADVLEFVR.E
	TK251102_lung_cytoE16_2_step01.3683.3683.1	0.9096	0.1229	1071.27	3	3750.0%	1	K.VCHANPSER.A
	TK251102_lung_cytoE16_2_step09.2075.2075.3	1.5974	0.1265	1689.12	87	2500.0%	1	K.SSLPKKPITDDDVDR.I
UARP2_HUMAN99.6%5915.2%394447616.7(O15142) Actin-like protein 2 (Actin-related protein 2)
*	TK251102_lung_cytoE16_2_step08.4854.4854.3	4.4572	0.5338	3940.8	1	2570.0%	2	R.FEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTR.S
*	TK251102_lung_cytoE16_2_step08.3207.3207.2	3.6399	0.6482	1772.95	1	6880.0%	2	K.HIVLSGGSTMYPGLPSR.L
*	TK251102_lung_cytoE16_2_step04.1967.1967.1	1.6725	0.2235	801.68	4	6670.0%	1	R.RLDIAGR.D
UIF32_MOUSE99.6%358.3%325364615.6(Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1)
	TK251102_lung_cytoE16_2_step11.2429.2429.1	1.5848	0.1333	1321.89	3	5500.0%	1	-.MKPILLQGHER.S
	TK251102_lung_cytoE16_2_step12.2712.2712.2	2.0746	0.2859	1682.36	1	5000.0%	2	K.GHFGPINSVAFHPDGK.S
URL7A_MOUSE99.6%235724.2%2652984510.6(P12970) 60S ribosomal protein L7a (Surfeit locus protein 3)
	TK251102_lung_cytoE16_2_step10.4193.4193.2	2.3402	0.4559	1813.67	1	4670.0%	1	R.LKVPPAINQFTQALDR.Q
	TK251102_lung_cytoE16_2_step12.2148.2148.2	3.1027	0.5578	1221.97	1	8500.0%	1	R.RHWGGNVLGPK.S
	TK251102_lung_cytoE16_2_step06.1389.1389.1	1.1026	0.0457	458.38	5	6250.0%	1	K.GALAK.L
	TK251102_lung_cytoE16_2_step07.1842.1842.1	1.6176	0.263	979.57	1	5560.0%	1	K.KVAPAPAVVK.K
	TK251102_lung_cytoE16_2_step01.1479.1479.1	1.6872	0.2574	853.63	2	5000.0%	2	K.VAPAPAVVK.K
	TK251102_lung_cytoE16_2_step12.1467.1467.1	0.8257	0.1232	737.68	7	5000.0%	1	K.RPPVLR.A
	TK251102_lung_cytoE16_2_step06.2977.2977.1	2.9587	0.4302	1075.65	1	6880.0%	2	K.KVVNPLFEK.R
	TK251102_lung_cytoE16_2_step12.1565.1565.1	1.3708	0.0714	833.12	1	5000.0%	2	R.LGHLVHR.K
	TK251102_lung_cytoE16_2_step08.2702.2702.1	2.4815	0.2909	1066.56	1	7220.0%	5	R.HWGGNVLGPK.S
URS29_HUMAN99.6%3332.7%55654610.1(P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29
	TK251102_lung_cytoE16_2_step09.1560.1560.1	0.9853	0.1404	779.57	12	5000.0%	1	R.KFGQGSR.S
	TK251102_lung_cytoE16_2_step11.2044.2044.1	1.6367	0.3384	1410.04	3	4500.0%	1	-.GHQQLYWSHPR.K
UO8854399.6%115.9%423478326.7(O88543) COP9 complex subunit 3
	TK251102_lung_cytoE16_2_step11.4012.4012.2	3.3492	0.4905	2894.3	1	3120.0%	1	R.FIKPLSNAYHELAQVYSTNNPSELR.N
UPEBP_MOUSE99.6%112128.9%187208605.4(P70296) Phosphatidylethanolamine-binding protein (PEBP)
	TK251102_lung_cytoE16_2_step11.3417.3417.1	2.4315	0.4266	1441.87	1	7000.0%	3	R.EWHHFLVVNMK.G
*	TK251102_lung_cytoE16_2_step04.3244.3244.3	1.0347	0.0549	2500.67	34	1250.0%	1	K.VLTPTQVMNRPSSISWDGLDPGK.L
*	TK251102_lung_cytoE16_2_step05.2677.2677.1	1.1214	0.1292	927.54	3	6670.0%	2	K.FKVETFR.K
*	TK251102_lung_cytoE16_2_step01.2307.2307.1	1.8243	0.3638	1367.79	1	5420.0%	1	R.VDYAGVTVDELGK.V
USRC8_MOUSE99.6%337.0%546612605.4(Q60598) Src substrate cortactin
	TK251102_lung_cytoE16_2_step11.1401.1401.2	3.681	0.5063	1685.69	1	6790.0%	1	K.TVQGSGHQEHINIHK.L
	TK251102_lung_cytoE16_2_step01.4222.4222.1	1.0195	3.0E-4	1446.97	78	3330.0%	1	Q.SAVGFEYQGKTEK.H
	TK251102_lung_cytoE16_2_step01.1372.1372.1	1.2916	0.169	1105.64	1	5560.0%	1	R.SAVGHEYQSK.L
UU2AF_MOUSE99.6%116.9%475535179.1(P26369) Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (U2 snRNP auxiliary factor large subunit)
	TK251102_lung_cytoE16_2_step12.3477.3477.3	4.7151	0.6415	3563.4	1	3280.0%	1	R.RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK.L
UCNBP_MOUSE99.6%5919.4%170187427.7(P53996) Cellular nucleic acid binding protein (CNBP)
	TK251102_lung_cytoE16_2_step09.1805.1805.2	2.8457	0.6122	1851.44	1	5360.0%	2	R.EQCCYNCGKPGHLAR.D
	TK251102_lung_cytoE16_2_step09.1749.1749.1	1.003	0.0689	713.64	156	4000.0%	2	R.SGHWAR.E
	TK251102_lung_cytoE16_2_step02.2250.2250.2	1.9749	0.3117	1487.72	1	5910.0%	1	K.CYSCGEFGHIQK.D
UY310_HUMAN99.6%333.9%14331557686.0(O15027) Hypothetical protein KIAA0310 (Fragment)
	TK251102_lung_cytoE16_2_step04.2265.2265.1	0.7861	0.1238	1050.77	57	2500.0%	1	K.FATNEAIQR.T
	TK251102_lung_cytoE16_2_step01.5828.5828.3	1.1132	0.1149	3291.3	17	1090.0%	1	K.APPPPPTSMPKTVQAAPPALPGPPGAPVNMYSR.R
	TK251102_lung_cytoE16_2_step10.2118.2118.2	3.3302	0.6098	1617.71	1	7690.0%	1	R.SSLSSHSHQSQIYR.S
UQ9Y6Y899.6%557.3%10001110765.5(Q9Y6Y8) Phospholipase
*	TK251102_lung_cytoE16_2_step12.1696.1696.1	1.2106	0.1674	929.84	6	5000.0%	1	K.QLHFQEK.Q
*	TK251102_lung_cytoE16_2_step10.3437.3437.2	3.5184	0.4022	1856.18	1	6000.0%	1	R.RLEFPSGETIVMHNPK.V
*	TK251102_lung_cytoE16_2_step07.2231.2231.1	0.9339	0.0654	878.68	67	3750.0%	1	K.KAVAATSTK.G
*	TK251102_lung_cytoE16_2_step10.4697.4697.2	0.9979	0.1701	2981.96	65	1250.0%	1	K.GGVSVAGHSLGSLILFDILSNQKDLNLSK.C
*	TK251102_lung_cytoE16_2_step07.2915.2915.2	0.8699	0.0438	1554.88	12	3180.0%	1	R.FRSIIECVDDFR.V
UHBA_MOUSE99.6%155988170.2%141149548.2(P01942) Hemoglobin alpha chain
	TK251102_lung_cytoE16_2_step02.3342.3342.2	2.9858	0.3952	1253.92	1	8180.0%	5	K.FLASVSTVLTSK.Y
*	TK251102_lung_cytoE16_2_step12.4036.4036.2	0.9107	0.0291	3106.84	1	1500.0%	1	K.VADALASAAGHLDDLPGALSALSDLHAHKLR.V
	TK251102_lung_cytoE16_2_step01.0091.0091.1	0.8676	0.0903	532.4	16	5000.0%	4	K.AAWGK.I
	TK251102_lung_cytoE16_2_step01.2550.2550.1	1.5874	0.3868	1031.76	1	6250.0%	8	R.MFASFPTTK.T
	TK251102_lung_cytoE16_2_step01.0256.0256.1	1.3092	0.1932	820.99	29	5000.0%	2	R.VDPVNFK.L
	TK251102_lung_cytoE16_2_step05.2816.2816.1	1.3704	0.0666	1089.67	20	5000.0%	2	K.LRVDPVNFK.L
	TK251102_lung_cytoE16_2_step06.3136.3136.2	1.0058	0.0884	1823.98	4	3670.0%	97	K.TYFPHFDVSHGSAQVK.G
	TK251102_lung_cytoE16_2_step02.2331.2331.1	1.61	0.1237	1533.61	1	4640.0%	13	K.IGGHGAEYGAEALER.M
	TK251102_lung_cytoE16_2_step11.2793.2793.2	2.1172	0.4885	2199.41	1	3950.0%	1	K.TYFPHFDVSHGSAQVKGHGK.K
UCPSM_HUMAN99.6%443.1%15001649396.7(P31327) Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSASE I)
*	TK251102_lung_cytoE16_2_step09.1485.1485.2	1.1231	0.0969	1219.5	326	3330.0%	1	K.SLGQWLQEEK.V
*	TK251102_lung_cytoE16_2_step05.3297.3297.2	3.2238	0.2385	1590.7	1	5710.0%	1	K.IAPSFAVESIEDALK.A
*	TK251102_lung_cytoE16_2_step12.3185.3185.2	0.7801	0.02	1723.23	13	2190.0%	1	K.ATTITSVLPKPALVASR.V
*	TK251102_lung_cytoE16_2_step06.1401.1401.1	0.7617	0.0037	518.59	2	6250.0%	1	K.GNPTK.V
UDYHC_MOUSE99.6%344410.4%46445320306.4(Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain)
	TK251102_lung_cytoE16_2_step06.2542.2542.2	2.4461	0.4054	1599.05	1	6250.0%	1	K.KVMSQEIQEQLHK.Q
	TK251102_lung_cytoE16_2_step09.3308.3308.2	1.316	0.0336	2296.5	1	2630.0%	2	R.EAIVNSCVFVHQTLHQANAR.L
	TK251102_lung_cytoE16_2_step06.1462.1462.1	1.2725	0.0019	647.44	4	7500.0%	1	R.EELKK.V
	TK251102_lung_cytoE16_2_step10.0455.0455.2	0.656	0.0029	2674.35	3	1140.0%	1	R.VTFVNFTVTRSSLQSQCLNEVLK.A
	TK251102_lung_cytoE16_2_step08.2019.2019.1	1.0723	0.0332	807.66	28	6000.0%	1	K.QVELYR.N
	TK251102_lung_cytoE16_2_step08.4566.4566.3	2.5055	0.3027	3245.52	1	2050.0%	2	K.SRQELEQHSVDTASTSDAVTFITYVQSLK.R
	TK251102_lung_cytoE16_2_step07.3819.3819.2	1.2518	0.1395	1886.04	2	3210.0%	1	K.DYIPVDQEELRDYVK.A
	TK251102_lung_cytoE16_2_step02.2797.2797.2	1.1622	0.0448	1225.97	14	4380.0%	1	K.DPLFRFFER.E
*	TK251102_lung_cytoE16_2_step08.2359.2359.1	1.3215	0.2083	1128.53	1	5620.0%	1	K.HFPNIDKEK.A
	TK251102_lung_cytoE16_2_step03.3510.3510.2	1.3541	0.0993	1397.26	11	4090.0%	1	R.TFSSIPVSRICK.S
*	TK251102_lung_cytoE16_2_step02.3555.3555.2	0.8833	0.0601	1984.52	23	2810.0%	1	R.YLVYAILWSLSGDSRLK.M
	TK251102_lung_cytoE16_2_step02.4858.4858.2	2.2555	0.3543	2788.45	1	2950.0%	1	K.VFYEEELDVPLVLFNEVLDHVLR.I
*	TK251102_lung_cytoE16_2_step07.3887.3887.3	0.9906	0.0175	3149.28	30	1210.0%	1	K.LVPLLLEDGGDAPAALEAALEEKSALEQMR.K
*	TK251102_lung_cytoE16_2_step04.2227.2227.2	3.6262	0.4079	2635.14	1	4570.0%	1	R.VLRPQVTAVAQQNQGEAPEPQDMK.V
*	TK251102_lung_cytoE16_2_step01.4996.4996.2	1.2528	0.2144	2989.28	1	2080.0%	1	R.CGMVWFSEDVLSTDMILNNFLARLR.S
	TK251102_lung_cytoE16_2_step11.1537.1537.1	1.3923	0.1637	1008.59	6	5710.0%	1	K.KQHLVEVR.S
	TK251102_lung_cytoE16_2_step12.5305.5305.2	0.7992	0.0507	2424.3	218	1670.0%	1	K.QIREVWNTYELDLVNYQNK.C
	TK251102_lung_cytoE16_2_step06.1292.1292.1	0.7356	0.1479	553.53	4	5000.0%	1	K.GILPR.S
*	TK251102_lung_cytoE16_2_step09.2535.2535.2	2.7897	0.476	1752.56	1	5330.0%	1	K.RAPVIDADKPVSSQLR.V
*	TK251102_lung_cytoE16_2_step12.0064.0064.2	1.0521	0.1851	2790.44	1	2730.0%	1	K.IVPFFKLCDEQLSSQSHYDFGLR.A
	TK251102_lung_cytoE16_2_step06.1886.1886.2	0.9371	0.0345	1783.47	208	2860.0%	1	R.SELEEQQMHLNVGLR.K
	TK251102_lung_cytoE16_2_step10.4094.4094.2	1.6443	0.3523	2529.77	1	3180.0%	3	K.TKPVTGNLRPEEALQALTIYEGK.F
*	TK251102_lung_cytoE16_2_step10.3313.3313.2	2.2337	0.4202	1768.96	1	5360.0%	1	R.KFLSDPQVHTVLVER.S
	TK251102_lung_cytoE16_2_step09.1404.1404.1	0.7866	0.0381	593.68	4	6670.0%	1	K.RFNR.Y
	TK251102_lung_cytoE16_2_step09.2367.2367.3	1.656	0.014	2418.72	1	2750.0%	1	R.WQASSLPADDLCTENAIMLKR.F
*	TK251102_lung_cytoE16_2_step07.3940.3940.2	0.8564	0.0261	1925.92	157	2000.0%	1	K.EFISYNINIDIHYGVK.S
*	TK251102_lung_cytoE16_2_step04.1196.1196.1	0.9508	0.0657	757.75	8	7500.0%	1	K.QCYER.G
	TK251102_lung_cytoE16_2_step09.2952.2952.3	1.2194	0.1131	2591.08	4	2140.0%	1	R.LHVNWVVSELTLGQIWDVDLQK.N
	TK251102_lung_cytoE16_2_step04.2637.2637.3	1.5799	0.0784	2430.69	68	2110.0%	1	K.MDLEKPNYIVPDYMPVVYDK.L
	TK251102_lung_cytoE16_2_step11.4018.4018.2	2.8292	0.5104	1637.89	1	6150.0%	1	K.NVHLAPGWLMQLEK.K
UO8911299.6%3315.5%399453417.8(O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1)
*	TK251102_lung_cytoE16_2_step11.2826.2826.2	2.9275	0.4444	1660.58	1	6150.0%	1	K.LHSLVKPSVDFVCR.L
*	TK251102_lung_cytoE16_2_step05.3915.3915.2	3.9711	0.6166	2538.47	1	5000.0%	1	K.IPQSHIQQICENILTSGENLSR.K
*	TK251102_lung_cytoE16_2_step06.4556.4556.3	1.5407	0.0328	2795.05	3	2300.0%	1	R.SITFLCGDAGPLAVAAVLYHKMNSEK.Q
UQ9DBT299.6%51110.8%675757035.1(Q9DBT2) 1200014H24Rik protein
	TK251102_lung_cytoE16_2_step04.3288.3288.2	3.3995	0.5226	2378.67	1	4090.0%	3	K.ASKPLPPAPAPDEYLVSPITGEK.I
	TK251102_lung_cytoE16_2_step04.4776.4776.3	0.9612	0.0235	3519.46	67	970.0%	1	K.VTWDGHSGSMARTQQAAQANITLQEQIEAIHK.A
	TK251102_lung_cytoE16_2_step11.2564.2564.2	1.3612	0.0341	1967.38	9	3240.0%	1	K.QSDDEVYAPGLDIESSLK.Q
UIQG1_MOUSE99.6%172113.6%16571887556.5(Q9JKF1) Ras GTPase-activating-like protein IQGAP1
*	TK251102_lung_cytoE16_2_step04.2456.2456.2	1.2137	0.0259	1194.35	15	4500.0%	1	R.RVAADTFTALK.N
	TK251102_lung_cytoE16_2_step05.1505.1505.1	1.483	0.1906	999.4	2	5620.0%	1	K.MLQHAASNK.M
	TK251102_lung_cytoE16_2_step08.3382.3382.3	1.5436	0.0591	2957.9	15	1700.0%	1	K.IGGILANELSVDEAALHAAVIAINEAIDR.R
	TK251102_lung_cytoE16_2_step03.1562.1562.1	0.8407	0.0223	687.6	16	5000.0%	1	R.KAELVK.L
*	TK251102_lung_cytoE16_2_step11.4030.4030.3	1.3356	0.1227	2703.9	36	1460.0%	1	-.MSAAEEVDGLGVVRPHYGSVLDNER.L
	TK251102_lung_cytoE16_2_step07.1664.1664.1	1.5013	0.1119	944.6	62	5000.0%	1	R.GARGQNALR.Q
	TK251102_lung_cytoE16_2_step09.2885.2885.2	1.5054	0.1624	1585.87	2	4580.0%	1	K.NKEQLSDMMMINK.Q
	TK251102_lung_cytoE16_2_step08.2699.2699.2	1.1314	0.0473	1087.79	39	3750.0%	1	K.YTAARLHEK.G
*	TK251102_lung_cytoE16_2_step10.3863.3863.3	3.1901	0.2621	3522.73	1	2250.0%	2	K.GGYHYYHNLETQAGGWAEPPDFVQNSVQLSR.E
*	TK251102_lung_cytoE16_2_step11.1720.1720.1	2.6305	0.4677	1540.74	1	5000.0%	2	R.LAYLHSHKDEVVK.I
	TK251102_lung_cytoE16_2_step07.1966.1966.1	1.2111	0.0249	588.54	1	7500.0%	1	K.KISLK.Y
	TK251102_lung_cytoE16_2_step10.3282.3282.3	1.5262	0.0029	3707.21	41	1250.0%	1	R.HTDNVIQWLNAMDEIGLPKIFYPETTDIYDR.K
*	TK251102_lung_cytoE16_2_step10.4423.4423.2	0.7977	0.0136	2698.81	360	1250.0%	1	R.SPDVGLYGVIPECGETYQSDLAEAK.K
	TK251102_lung_cytoE16_2_step09.3533.3533.2	1.7682	0.0889	1259.68	1	6670.0%	1	K.MREEVITLIR.S
ULDHL_HUMAN99.6%6364.5%381419438.6(Q9BYZ2) L-lactate dehydrogenase A-like (EC 1.1.1.27)
*	TK251102_lung_cytoE16_2_step06.4849.4849.2	3.4177	0.5213	1945.92	1	5310.0%	6	K.LIIVSNPVDILTYVAWK.L
UP2CA_MOUSE99.6%3311.8%382424335.4(P49443) Protein phosphatase 2C alpha isoform (EC 3.1.3.16) (PP2C-alpha) (IA) (Protein phosphatase 1A)
	TK251102_lung_cytoE16_2_step12.2597.2597.2	3.5111	0.626	1926.29	1	5330.0%	1	K.VHFFTQDHKPSNPLEK.E
	TK251102_lung_cytoE16_2_step11.1233.1233.1	0.9745	0.0037	681.65	1	7000.0%	1	K.KHGADR.S
	TK251102_lung_cytoE16_2_step03.3758.3758.2	1.1808	0.2825	2615.88	1	2950.0%	1	K.CVHGKGPTEQLVSPEPEVHDIER.S
UQ9Z2X199.6%5717.6%415457305.5(Q9Z2X1) Ribonucleoprotein F
	TK251102_lung_cytoE16_2_step05.2619.2619.2	3.7189	0.6317	2213.27	1	5280.0%	2	R.YGDSEFTVQSTTGHCVHMR.G
*	TK251102_lung_cytoE16_2_step05.4287.4287.3	1.3027	0.1407	2210.25	28	1970.0%	1	R.QSGEAFVELESEDDVKLALK.K
	TK251102_lung_cytoE16_2_step12.1895.1895.2	1.3116	0.1925	1936.08	6	2810.0%	1	K.FMSVQRPGPYDRPGTAR.R
	TK251102_lung_cytoE16_2_step02.4161.4161.2	3.0477	0.3175	1868.22	1	5620.0%	1	K.ITGEAFVQFASQELAEK.A
UQ9UEV999.6%15278.5%26022781905.7(Q9UEV9) Actin-binding protein homolog ABP-278
	TK251102_lung_cytoE16_2_step01.4490.4490.2	0.8989	0.16	2314.65	4	2000.0%	1	K.AIKHTIAVVWGGVNIPHSPYR.V
	TK251102_lung_cytoE16_2_step10.4371.4371.3	1.5737	0.0057	4003.91	15	1320.0%	1	K.FIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSK.V
	TK251102_lung_cytoE16_2_step09.3492.3492.2	3.4862	0.6411	2197.02	1	4050.0%	4	K.AHGPGLEGGLVGKPAEFTIDTK.G
	TK251102_lung_cytoE16_2_step02.1147.1147.1	0.6284	0.0338	1246.7	112	1360.0%	1	K.AKLKPGAPLKPK.L
	TK251102_lung_cytoE16_2_step09.2093.2093.3	1.1857	0.1974	1631.79	5	2500.0%	1	R.GAGIGGLGITVEGPSESK.I
	TK251102_lung_cytoE16_2_step08.2525.2525.2	0.7349	0.0813	1468.3	58	1920.0%	1	R.KGEITGEVHMPSGK.T
	TK251102_lung_cytoE16_2_step02.1741.1741.1	0.9983	0.1439	1150.69	1	4090.0%	1	K.VVASGPGLEHGK.V
	TK251102_lung_cytoE16_2_step04.1491.1491.1	1.444	0.1558	1164.86	1	6000.0%	1	R.VNIGQGSHPQK.V
	TK251102_lung_cytoE16_2_step12.1500.1500.1	1.5024	0.2425	1048.71	7	4440.0%	1	K.LKPGAPLKPK.L
	TK251102_lung_cytoE16_2_step12.5503.5503.3	1.3333	0.0022	4502.95	4	1090.0%	1	K.IECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFK.A
	TK251102_lung_cytoE16_2_step08.2881.2881.3	1.236	0.0423	2118.0	17	2370.0%	1	R.VLQSFTVDSSKAGLAPLEVR.V
	TK251102_lung_cytoE16_2_step11.2697.2697.1	1.8551	0.2921	1278.71	1	5000.0%	1	R.AWGPGLHGGIVGR.S
UPCB2_MOUSE99.6%4425.1%362382226.8(Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP)
	TK251102_lung_cytoE16_2_step12.4888.4888.3	4.1649	0.5218	3353.81	1	2420.0%	1	K.AFAMIIDKLEEDISSSMTNSTAASRPPVTLR.L
	TK251102_lung_cytoE16_2_step12.2921.2921.3	5.913	0.6673	3382.77	1	3080.0%	1	K.LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK.G
	TK251102_lung_cytoE16_2_step12.2863.2863.2	1.2139	0.0859	2429.41	2	2730.0%	1	K.GVTIPYRPKPSSSPVIFAGGQDR.Y
	TK251102_lung_cytoE16_2_step08.2059.2059.1	1.37	0.0835	698.5	22	7000.0%	1	R.LLMHGK.E
UQ91ZP199.6%71526.7%236270548.1(Q91ZP1) Fibrinogen B-beta-chain (Fragment)
*	TK251102_lung_cytoE16_2_step02.2243.2243.1	2.549	0.4169	1511.64	1	4620.0%	2	K.AHYGGFTVQNEASK.Y
*	TK251102_lung_cytoE16_2_step08.4726.4726.3	1.3205	0.0417	2635.43	25	1900.0%	1	R.CHAANPNGRYYWGGLYSWDMSK.H
*	TK251102_lung_cytoE16_2_step05.3345.3345.2	3.3267	0.5465	2414.24	1	4250.0%	3	R.KGGETSEMYLIQPDTSIKPYR.V
	TK251102_lung_cytoE16_2_step04.2032.2032.1	1.3621	0.1663	836.53	4	7000.0%	1	R.KWDPYK.K
UCNE3_HUMAN99.6%71912.1%537601315.8(O75131) Copine III
*	TK251102_lung_cytoE16_2_step10.4269.4269.3	1.3174	0.0144	2715.12	177	1410.0%	1	K.TIELSDDDFLGECECTLGQIVSSK.K
*	TK251102_lung_cytoE16_2_step09.1732.1732.3	1.3734	0.0012	1881.06	40	2500.0%	1	K.EASRSSPVEFECINEK.K
*	TK251102_lung_cytoE16_2_step11.3369.3369.2	1.8683	0.4684	1800.59	1	4000.0%	4	K.LYGPTNFSPIINHVAR.F
*	TK251102_lung_cytoE16_2_step03.2211.2211.1	0.9496	0.1102	1086.53	55	3750.0%	1	K.KLTRPLVMK.T
UPDA3_MOUSE99.6%214329.2%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57)
	TK251102_lung_cytoE16_2_step02.1873.1873.1	1.2135	0.0641	788.42	1	6670.0%	1	K.FLDAGHK.L
*	TK251102_lung_cytoE16_2_step05.3996.3996.2	1.95	0.1904	2281.54	1	3890.0%	2	K.KFIQDSIFGLCPHMTEDNK.D
	TK251102_lung_cytoE16_2_step01.2030.2030.1	1.3518	0.2295	1040.9	1	5560.0%	1	R.TADGIVSHLK.K
*	TK251102_lung_cytoE16_2_step01.5000.5000.2	3.8561	0.4933	1816.83	1	6430.0%	1	K.ALEQFLQEYFDGNLK.R
	TK251102_lung_cytoE16_2_step03.1747.1747.1	1.3984	0.0275	738.67	4	8000.0%	1	K.KFISDK.D
	TK251102_lung_cytoE16_2_step08.2182.2182.1	1.9996	0.1911	917.64	1	5710.0%	3	K.KFLDAGHK.L
	TK251102_lung_cytoE16_2_step02.2251.2251.2	1.986	0.2303	1199.61	1	7000.0%	1	K.LSKDPNIVIAK.M
*	TK251102_lung_cytoE16_2_step01.3195.3195.1	2.093	0.4057	1397.97	1	5450.0%	2	R.DLFSDGHSEFLK.A
*	TK251102_lung_cytoE16_2_step08.4066.4066.2	1.0976	0.1649	2159.64	59	2110.0%	1	-.MRFSCLALLPGVALLLASAR.L
*	TK251102_lung_cytoE16_2_step03.2963.2963.2	2.4534	0.3528	1260.78	1	8500.0%	3	R.FAHTNIESLVK.E
	TK251102_lung_cytoE16_2_step09.2075.2075.2	2.1155	0.1541	1126.42	1	8000.0%	1	K.KQAGPASVPLR.T
*	TK251102_lung_cytoE16_2_step07.3586.3586.3	1.4612	0.0289	2729.46	72	1520.0%	1	R.VSDTGSAGLMLVEFFAPWCGHCKR.L
UPDX4_MOUSE99.6%91723.0%274310537.2(O08807) Peroxiredoxin 4 (EC 1.11.1.-) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372)
	TK251102_lung_cytoE16_2_step09.2539.2539.1	1.2119	0.0032	954.58	161	3750.0%	1	R.RQGGLGPIR.I
	TK251102_lung_cytoE16_2_step07.2386.2386.2	2.0945	0.4275	1295.05	1	5450.0%	2	R.VSVADHSLHLSK.A
	TK251102_lung_cytoE16_2_step04.3132.3132.2	2.8136	0.5264	2405.84	1	4320.0%	1	K.HGEVCPAGWKPGSETIIPDPAGK.L
*	TK251102_lung_cytoE16_2_step03.3581.3581.2	2.5099	0.3948	1478.57	1	6250.0%	1	R.IPLLSDLNHQISK.D
	TK251102_lung_cytoE16_2_step01.0390.0390.1	1.1421	0.0122	816.47	41	6000.0%	1	K.LKYFDK.L
UFUS_MOUSE99.6%81219.5%518526739.4(P56959) RNA-binding protein FUS (Pigpen protein)
	TK251102_lung_cytoE16_2_step10.0075.0075.2	0.7032	0.016	3185.92	8	1330.0%	1	R.NECNQCKAPKPDGPGGGPGGSHMGGNYGDDR.R
	TK251102_lung_cytoE16_2_step04.2787.2787.2	2.0975	0.4138	1537.6	1	5830.0%	1	K.KTGQPMINLYTDR.E
	TK251102_lung_cytoE16_2_step01.3146.3146.1	0.8968	0.0498	1023.62	2	5000.0%	1	K.AAIDWFDGK.E
	TK251102_lung_cytoE16_2_step08.4659.4659.3	5.888	0.6017	3587.62	1	2900.0%	2	R.HDSEQDNSDNNTIFVQGLGENVTIESVADYFK.Q
	TK251102_lung_cytoE16_2_step11.1314.1314.2	3.8179	0.5874	2256.88	1	5000.0%	2	K.APKPDGPGGGPGGSHMGGNYGDDR.R
*	TK251102_lung_cytoE16_2_step12.2943.2943.1	1.2748	0.0639	1573.88	7	3330.0%	1	R.GGGGGYNRSSGGYEPR.G
UQ91ZJ599.6%466.5%508569797.6(Q91ZJ5) Uridindiphosphoglucosepyrophosphorylase 2
*	TK251102_lung_cytoE16_2_step05.2540.2540.1	2.1642	0.3247	1586.62	1	4620.0%	2	K.ILTTAASHEFEHTK.K
*	TK251102_lung_cytoE16_2_step10.2745.2745.2	1.8244	0.295	1713.56	1	4640.0%	1	K.ILTTAASHEFEHTKK.D
	TK251102_lung_cytoE16_2_step01.4608.4608.2	0.8352	0.0696	2159.09	19	1760.0%	1	R.NENTFLDLTVQQIEHLNK.T
UIF6_MOUSE99.6%3519.6%245265114.7(O55135) Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP))
	TK251102_lung_cytoE16_2_step09.3227.3227.2	2.7723	0.5458	2086.12	1	6180.0%	2	R.HGLLVPNNTTDQELQHIR.N
	TK251102_lung_cytoE16_2_step09.4303.4303.3	1.3612	0.0085	3336.43	14	1470.0%	1	K.VEVFRQTVADQVLVGSYCVFSNQGGLVHPK.T
UO0881799.6%81611.5%653704088.8(O08817) CW17 protein
	TK251102_lung_cytoE16_2_step11.4000.4000.2	4.0741	0.6018	2927.02	1	3800.0%	2	R.HTLITEMVALNPDFKPPADYKPPATR.V
	TK251102_lung_cytoE16_2_step02.1603.1603.2	1.602	0.3138	1475.06	9	4580.0%	1	K.FQRPGDPQSAQDK.A
	TK251102_lung_cytoE16_2_step01.3240.3240.3	1.4521	0.038	2712.1	5	1980.0%	1	K.DGQMLPGEDEPLHALVTANTMENVK.K
	TK251102_lung_cytoE16_2_step08.2743.2743.2	2.1127	0.4028	1374.0	1	6500.0%	3	R.ILRPWQSSETR.S
UHBB2_MOUSE99.6%3521339.7%146157478.1(P02089) Hemoglobin beta-2 chain (B2) (Minor)
*	TK251102_lung_cytoE16_2_step04.2703.2703.2	2.0323	0.441	1223.24	1	6000.0%	6	K.KVITAFNEGLK.N
*	TK251102_lung_cytoE16_2_step01.2570.2570.1	1.6207	0.177	1023.66	1	5620.0%	2	K.SAVSCLWAK.V
	TK251102_lung_cytoE16_2_step01.1499.1499.1	1.5769	0.0809	717.91	1	7000.0%	2	K.NLDNLK.G
*	TK251102_lung_cytoE16_2_step01.1823.1823.1	1.8384	0.2899	1315.0	2	5420.0%	4	K.VNPDEVGGEALGR.L
*	TK251102_lung_cytoE16_2_step01.1775.1775.1	1.1485	0.1375	1094.1	18	3890.0%	8	K.VITAFNEGLK.N
*	TK251102_lung_cytoE16_2_step01.3839.3839.2	4.3925	0.6167	2008.42	1	6940.0%	5	R.YFDSFGDLSSASAIMGNPK.V
UTKT_MOUSE99.6%4313535.6%623676317.5(P40142) Transketolase (EC 2.2.1.1) (TK) (P68)
	TK251102_lung_cytoE16_2_step03.2094.2094.1	1.3675	0.0175	944.58	1	5620.0%	4	R.SGKPAELLK.M
	TK251102_lung_cytoE16_2_step02.3198.3198.3	1.1301	0.1833	2432.8	9	1620.0%	1	R.FIECYIAEQNMVSIAVGCATR.D
	TK251102_lung_cytoE16_2_step05.1979.1979.1	1.6033	0.2218	980.71	2	5000.0%	5	K.HQPTAIIAK.T
	TK251102_lung_cytoE16_2_step01.2934.2934.2	2.5803	0.4823	2022.72	1	5280.0%	1	K.ILATPPQEDAPSVDIANIR.M
*	TK251102_lung_cytoE16_2_step01.2299.2299.1	0.9126	0.1106	861.04	184	4170.0%	1	R.YKALDPR.N
	TK251102_lung_cytoE16_2_step04.1247.1247.1	1.2785	0.0295	755.67	2	5830.0%	1	K.LGHASDR.I
	TK251102_lung_cytoE16_2_step07.2050.2050.2	1.8326	0.3559	1395.88	1	5830.0%	2	R.KISSDLDGHPVPK.Q
*	TK251102_lung_cytoE16_2_step01.5099.5099.2	1.0303	0.1082	3191.09	1	2000.0%	2	R.ILTVEDHYYEGGIGEAVSAAVVGEPGVTVTR.L
*	TK251102_lung_cytoE16_2_step03.4615.4615.2	1.5372	0.1985	2626.49	1	3000.0%	4	K.SKDDQVTVIGAGVTLHEALAAAESLK.K
*	TK251102_lung_cytoE16_2_step01.5255.5255.2	3.9536	0.464	2008.81	1	6250.0%	1	K.NMAEQIIQEIYSQVQSK.K
*	TK251102_lung_cytoE16_2_step11.1521.1521.1	2.0561	0.1854	1164.72	1	6670.0%	5	K.EAWHGKPLPK.N
	TK251102_lung_cytoE16_2_step05.2499.2499.1	1.4064	0.0296	917.54	7	5710.0%	3	R.KLILDSAR.A
	TK251102_lung_cytoE16_2_step09.1377.1377.1	1.0074	0.1073	653.64	8	6250.0%	1	K.EHPDR.F
	TK251102_lung_cytoE16_2_step01.1652.1652.1	1.6025	0.1607	1266.21	1	5910.0%	1	K.ISSDLDGHPVPK.Q
*	TK251102_lung_cytoE16_2_step12.4935.4935.2	4.7626	0.606	2824.02	1	4200.0%	1	K.GHAAPILYAVWAEAGFLPEAELLNLR.K
*	TK251102_lung_cytoE16_2_step01.3528.3528.1	2.0784	0.414	1537.75	1	3460.0%	2	K.MFGIDKDAIVQAVK.G
UTPIS_MOUSE99.6%2612841.9%248265817.3(P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM)
	TK251102_lung_cytoE16_2_step01.0535.0535.2	1.566	0.3011	1467.4	1	5830.0%	1	K.TATPQQAQEVHEK.L
*	TK251102_lung_cytoE16_2_step02.3547.3547.1	1.5992	0.12	1540.7	3	3460.0%	1	K.DLGATWVVLGHSER.R
	TK251102_lung_cytoE16_2_step01.1023.1023.1	1.6061	0.2489	760.34	3	6670.0%	2	K.VIADNVK.D
	TK251102_lung_cytoE16_2_step01.2436.2436.1	1.9147	0.2197	1458.96	1	5420.0%	1	R.HVFGESDELIGQK.V
	TK251102_lung_cytoE16_2_step09.2927.2927.2	2.5418	0.3481	1615.91	1	6920.0%	5	R.RHVFGESDELIGQK.V
	TK251102_lung_cytoE16_2_step01.4703.4703.2	1.1768	0.1768	3030.76	1	2140.0%	1	K.ELASQPDVDGFLVGGASLKPEFVDIINAK.Q
	TK251102_lung_cytoE16_2_step09.3381.3381.2	1.6848	0.12	1083.96	1	6880.0%	2	R.KFFVGGNWK.M
*	TK251102_lung_cytoE16_2_step05.4081.4081.2	3.3883	0.5064	1828.07	1	5290.0%	9	K.VSHALAEGLGVIACIGEK.L
UO3549999.6%132517.7%773839544.4(O35499) Nuclear autoantigenic sperm protein
	TK251102_lung_cytoE16_2_step04.2780.2780.2	1.2656	0.0813	1101.92	19	5620.0%	1	R.KPEEESPRK.D
	TK251102_lung_cytoE16_2_step02.3951.3951.2	1.1817	0.1615	3152.3	1	2780.0%	2	R.LLAETHYQLGLAYGYNSQYDEAVAQFGK.S
	TK251102_lung_cytoE16_2_step01.2382.2382.1	1.0885	0.0125	728.75	4	5830.0%	1	K.LLGLGQK.H
	TK251102_lung_cytoE16_2_step02.4746.4746.2	3.8576	0.5543	2353.01	1	5230.0%	1	K.HLVMGDIPAAVNAFQEAASLLGK.K
	TK251102_lung_cytoE16_2_step02.2310.2310.1	2.0478	0.2172	1088.57	1	5000.0%	2	R.MAVLHEQMK.E
	TK251102_lung_cytoE16_2_step05.2980.2980.2	4.2197	0.5648	2148.24	1	5260.0%	3	R.KPTDGASSSNCVTDISHLVR.K
*	TK251102_lung_cytoE16_2_step05.3652.3652.3	1.4631	0.1315	4429.74	7	1350.0%	1	R.MENGVLGNALEGVHVEEEEGEKTEDESLVENNDNVDEEAR.E
	TK251102_lung_cytoE16_2_step08.2698.2698.1	1.8523	0.1876	858.58	3	5000.0%	2	K.KLLGLGQK.H
UPPS1_MOUSE99.6%91714.1%624707946.8(Q60967) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1 (PAPS synthethase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (Sulfate adenylate transferase) (SAT) (ATP-sulfurylase); Adenylylsulfate kinase (EC 2.7.1.25) (Adenylylsulfate 3'-phosphotransferase) (APS kinase) (Adenosine-5'-phosphosulfate 3'-phosphotransferase) (3'-phosphoadenosine-5'-phosphosulfate synthetase)]
*	TK251102_lung_cytoE16_2_step06.5488.5488.3	1.4128	0.1235	4543.88	4	1220.0%	1	R.MKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCR.A
	TK251102_lung_cytoE16_2_step09.3105.3105.3	1.2443	0.1055	1586.14	1	2880.0%	1	R.RPVLLLHPLGGWTK.D
	TK251102_lung_cytoE16_2_step10.1806.1806.2	2.0253	0.046	1486.66	3	4580.0%	1	R.ATNVTYQAHHVSR.N
	TK251102_lung_cytoE16_2_step11.2048.2048.2	3.616	0.5203	1813.31	1	6670.0%	3	R.NPVHNGHALLMQDTHK.Q
	TK251102_lung_cytoE16_2_step08.1919.1919.1	1.5653	0.1097	581.54	5	7500.0%	2	K.LHLAK.T
UIF3A_MOUSE99.6%183211.2%13441619506.8(P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin)
*	TK251102_lung_cytoE16_2_step11.2978.2978.2	3.3812	0.3714	1620.68	1	6920.0%	3	K.AIEVIRPAHILQEK.E
	TK251102_lung_cytoE16_2_step11.2646.2646.1	1.0934	0.1123	1005.81	2	4380.0%	3	R.ANEFLEVGK.K
	TK251102_lung_cytoE16_2_step11.2342.2342.2	2.3874	0.4022	1411.64	1	5830.0%	1	K.SGNALFHASTLHR.L
	TK251102_lung_cytoE16_2_step04.1796.1796.1	1.6194	0.291	1261.79	2	5000.0%	1	R.RGPAEESSSWR.D
	TK251102_lung_cytoE16_2_step11.2132.2132.2	3.202	0.4845	2658.86	1	4320.0%	1	R.HHNQSTAINLNNPESQSMHLETR.L
	TK251102_lung_cytoE16_2_step04.1185.1185.1	0.6242	0.0145	708.59	14	5000.0%	1	K.QFEER.L
	TK251102_lung_cytoE16_2_step08.2197.2197.1	1.1835	0.0115	1012.64	19	5000.0%	2	R.MHLSQIQR.H
	TK251102_lung_cytoE16_2_step05.1441.1441.1	1.0007	0.0472	1017.54	42	4380.0%	1	R.TADEDRGPR.R
	TK251102_lung_cytoE16_2_step05.2820.2820.1	1.5217	0.3032	980.53	1	6430.0%	1	K.IHEPIMLK.Y
	TK251102_lung_cytoE16_2_step02.5175.5175.3	0.9019	0.0557	4751.89	4	880.0%	1	R.HHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFK.A
*	TK251102_lung_cytoE16_2_step05.1976.1976.1	2.0767	0.4062	1360.96	1	6000.0%	1	R.RGTDDDRPSWR.N
*	TK251102_lung_cytoE16_2_step07.3335.3335.1	1.2863	0.0405	1408.71	2	4090.0%	1	R.FSVLQYVVPEVK.D
	TK251102_lung_cytoE16_2_step03.3285.3285.1	1.0187	0.0822	1111.62	97	4380.0%	1	K.RLEEIPLIK.S
UQ8VBT999.6%3314.4%550597967.0(Q8VBT9) RIKEN cDNA 1190006K01 gene (Similar to alveolar soft part sarcoma chromosome region, candidate 1)
*	TK251102_lung_cytoE16_2_step10.2667.2667.2	3.4496	0.6157	1927.52	1	4210.0%	1	R.LGGPSASLRPLTSPSANSSK.S
*	TK251102_lung_cytoE16_2_step08.4886.4886.2	1.1695	0.2204	3078.83	25	1330.0%	1	R.SKAPGSPVSSLSADQASSSTLLPLNSGEFSR.G
*	TK251102_lung_cytoE16_2_step03.4898.4898.2	0.7443	8.0E-4	2771.82	2	1480.0%	1	R.GDLNHEGDANTSGTGLEGGPKPTDAQTK.Q
ULDHB_MOUSE99.6%71915.0%333364416.1(P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H)
	TK251102_lung_cytoE16_2_step06.4909.4909.2	2.8378	0.4413	2184.3	1	5000.0%	1	K.GYTNWAIGLSVADLIESMLK.N
	TK251102_lung_cytoE16_2_step10.3914.3914.2	3.3734	0.4732	2174.62	1	4170.0%	1	K.LKGEMMDLQHGSLFLQTPK.I
	TK251102_lung_cytoE16_2_step07.2274.2274.1	1.3996	0.2516	1013.64	18	3750.0%	4	R.IHPVSTMVK.G
	TK251102_lung_cytoE16_2_step01.2879.2879.2	0.9642	0.0303	2423.23	33	1670.0%	1	K.LKGYTNWAIGLSVADLIESMLK.N
URL21_MOUSE99.6%72719.5%1591843110.5(O09167) 60S ribosomal protein L21
	TK251102_lung_cytoE16_2_step01.3043.3043.1	0.774	0.08	1105.91	10	3570.0%	1	R.YMFSRPFR.K
	TK251102_lung_cytoE16_2_step01.1874.1874.1	1.2444	0.0516	887.9	7	5710.0%	1	K.KGDIVDIK.G
*	TK251102_lung_cytoE16_2_step05.3123.3123.2	4.4338	0.6101	1656.47	1	7500.0%	5	R.VYNVTQHAVGIIVNK.Q
UPE15_MOUSE99.6%92746.9%130150545.0(Q62048) Astrocytic phosphoprotein PEA-15
	TK251102_lung_cytoE16_2_step11.2546.2546.3	1.1652	0.2657	3212.02	20	1200.0%	1	-.MAEYGTLLQDLTNNITLEDLEQLKSACK.E
	TK251102_lung_cytoE16_2_step07.4292.4292.2	2.1354	0.3848	1479.61	1	5450.0%	4	R.RPDLLTMVVDYR.T
	TK251102_lung_cytoE16_2_step10.2682.2682.2	1.0048	0.0891	1734.1	1	3460.0%	1	R.RPDLLTMVVDYRTR.V
	TK251102_lung_cytoE16_2_step08.4354.4354.2	2.6623	0.392	2171.44	1	5000.0%	3	K.SEEITTGSAWFSFLESHNK.L
UDDX5_HUMAN99.6%4104.9%614691488.9(P17844) Probable RNA-dependent helicase p68 (DEAD-box protein p68) (DEAD-box protein 5)
*	TK251102_lung_cytoE16_2_step12.4580.4580.2	3.0178	0.6289	2365.73	1	3950.0%	3	K.TLSYLLPAIVHINHQPFLER.G
*	TK251102_lung_cytoE16_2_step09.2519.2519.1	1.2239	0.1232	1255.65	17	3890.0%	1	R.TAQEVETYRR.S
UQ9Z1R299.6%6103.9%11541210375.7(Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3)
	TK251102_lung_cytoE16_2_step06.2493.2493.1	1.0825	0.023	865.67	17	5830.0%	2	K.VIHLVER.A
	TK251102_lung_cytoE16_2_step12.2445.2445.2	2.2872	0.4639	2028.72	1	3890.0%	1	R.KVKPQPPLSDAYLSGMPAK.R
	TK251102_lung_cytoE16_2_step11.2824.2824.2	3.6355	0.5126	2216.71	1	5830.0%	1	R.SFFHQHYLGGQEPTPSNIR.M
	TK251102_lung_cytoE16_2_step07.3090.3090.2	2.2629	0.3293	1900.21	1	4120.0%	2	K.VKPQPPLSDAYLSGMPAK.R
UQ9Z1N599.6%123413.3%428490355.7(Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1)
	TK251102_lung_cytoE16_2_step04.2349.2349.3	1.0807	0.055	1965.28	212	2030.0%	1	R.MTPHEKQVMMFSATLSK.E
	TK251102_lung_cytoE16_2_step07.2130.2130.1	1.5455	0.2837	1308.66	4	4550.0%	5	K.NCPHIVVGTPGR.I
	TK251102_lung_cytoE16_2_step12.1597.1597.2	2.5292	0.4545	1435.8	1	6670.0%	1	K.KNCPHIVVGTPGR.I
	TK251102_lung_cytoE16_2_step12.3652.3652.2	0.7311	0.0061	2155.42	17	1760.0%	1	K.QVMMFSATLSKEIRPVCR.K
	TK251102_lung_cytoE16_2_step08.4777.4777.2	2.6222	0.5898	2279.88	1	4210.0%	1	R.CIALAQLLVEQNFPAIAIHR.G
UO5478999.6%51710.6%199223987.4(O54789) Protein L (Fragment)
	TK251102_lung_cytoE16_2_step08.3435.3435.2	3.2293	0.4585	1636.63	1	7690.0%	4	R.AITHLNNNFMFGQK.M
	TK251102_lung_cytoE16_2_step08.3435.3435.3	1.9575	0.2193	2454.43	2	2620.0%	1	R.AITHLNNNFMFGQKMNVCVSK.Q
URAN_HUMAN99.6%249840.3%216244237.5(P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24)
	TK251102_lung_cytoE16_2_step02.1985.1985.1	1.1422	0.0626	549.53	3	8750.0%	1	K.FGGLR.D
	TK251102_lung_cytoE16_2_step06.2073.2073.1	2.2679	0.2092	1090.51	1	6250.0%	2	R.HLTGEFEKK.Y
	TK251102_lung_cytoE16_2_step11.3728.3728.2	3.8745	0.627	2054.07	1	5590.0%	6	K.YVATLGVEVHPLVFHTNR.G
	TK251102_lung_cytoE16_2_step03.2003.2003.1	1.4149	0.143	961.53	1	6430.0%	1	R.HLTGEFEK.K
	TK251102_lung_cytoE16_2_step12.3421.3421.2	0.7239	0.0787	2181.8	5	1670.0%	1	K.KYVATLGVEVHPLVFHTNR.G
	TK251102_lung_cytoE16_2_step01.0339.0339.1	1.5629	0.1553	1214.86	1	6110.0%	1	K.NLQYYDISAK.S
	TK251102_lung_cytoE16_2_step06.3156.3156.3	1.2253	0.0288	2334.12	1	2160.0%	1	-.MAAQGEPQVQFKLVLVGDGGTGK.T
	TK251102_lung_cytoE16_2_step07.2350.2350.1	1.1903	0.0707	760.6	4	6000.0%	1	K.SIVFHR.K
	TK251102_lung_cytoE16_2_step01.0316.0316.1	1.1876	0.256	1015.56	1	6000.0%	1	K.LVLVGDGGTGK.T
	TK251102_lung_cytoE16_2_step06.4505.4505.2	3.0343	0.5546	1788.54	1	5770.0%	7	K.SNYNFEKPFLWLAR.K
	TK251102_lung_cytoE16_2_step10.2395.2395.2	1.6997	0.2821	1119.7	1	7500.0%	1	K.RHLTGEFEK.K
	TK251102_lung_cytoE16_2_step02.2363.2363.2	2.3356	0.2916	1344.05	1	6000.0%	1	K.KNLQYYDISAK.S
UQ91YL699.6%356.7%300340484.8(Q91YL6) Hypothetical 34.0 kDa protein
*	TK251102_lung_cytoE16_2_step08.2933.2933.2	2.1182	0.4626	2261.23	1	3680.0%	2	R.LAAAEQYHQILCPGPSHDPR.H
UP2AA_MOUSE99.6%51119.7%309356085.5(P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha)
	TK251102_lung_cytoE16_2_step08.3197.3197.2	4.2391	0.5658	1917.12	1	7140.0%	3	R.AHQLVMEGYNWCHDR.N
	TK251102_lung_cytoE16_2_step06.2274.2274.1	1.1791	0.1037	1079.49	1	7500.0%	1	R.KYGNANVWK.Y
	TK251102_lung_cytoE16_2_step03.4718.4718.3	1.1965	0.0275	4227.18	9	1250.0%	1	K.YFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIR.A
UGRBA_MOUSE99.6%4410.8%621704729.0(Q60760) Growth factor receptor-bound protein 10 (GRB10 adaptor protein)
	TK251102_lung_cytoE16_2_step11.2026.2026.1	1.7906	0.0826	1068.81	1	6430.0%	1	R.TQHWFHGR.I
	TK251102_lung_cytoE16_2_step12.3423.3423.2	2.6487	0.5821	2317.55	1	4000.0%	1	R.MNILSSQSPLHPSTLNAVIHR.T
	TK251102_lung_cytoE16_2_step12.4372.4372.3	1.1723	0.0593	4503.75	71	950.0%	1	K.NFQILPCEDDGQTFFTLDDGNTKFSDLIQLVDFYQLNK.G
UP2CG_MOUSE99.6%5717.9%542587284.4(Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13)
	TK251102_lung_cytoE16_2_step01.1000.1000.3	1.5528	0.0867	1330.83	8	3120.0%	1	R.GKQLIVANAGDSR.C
*	TK251102_lung_cytoE16_2_step06.2428.2428.3	5.3681	0.6219	4060.33	1	2120.0%	2	K.GHTGFSSNSEHGTEAGQISEPGTATGEAGPSCSSASDKLPR.V
*	TK251102_lung_cytoE16_2_step08.1343.1343.1	0.8592	0.2016	678.43	1	5000.0%	1	K.VPPHTK.S
*	TK251102_lung_cytoE16_2_step09.4252.4252.3	1.6941	0.1685	4161.31	5	1250.0%	1	R.VSMEDAHNCIPELDNETAMFSVYDGHGGEEVALYCAK.Y
USPS1_HUMAN99.6%7929.0%383422686.4(P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1)
	TK251102_lung_cytoE16_2_step06.4006.4006.2	3.6992	0.4447	1703.28	1	6790.0%	1	K.YGEGHQAWIIGIVEK.G
	TK251102_lung_cytoE16_2_step01.4084.4084.3	1.3448	0.239	3306.41	12	1210.0%	1	R.IACANVLSDLYAMGVTECDNMLMLLGVSNK.M
	TK251102_lung_cytoE16_2_step03.4247.4247.2	2.2791	0.4454	1681.35	1	5000.0%	2	R.NEVSFVIHNLPVLAK.M
	TK251102_lung_cytoE16_2_step09.1897.1897.1	0.9922	0.1298	1431.54	32	3750.0%	1	K.GTGCKVPQDVLQK.L
	TK251102_lung_cytoE16_2_step06.4254.4254.3	1.0298	0.1879	4269.84	8	810.0%	1	R.LGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGR.I
	TK251102_lung_cytoE16_2_step04.2369.2369.3	1.4402	0.0321	2843.36	45	1560.0%	1	R.HGGLSLVQTTDYIYPIVDDPYMMGR.I
UQ9Z1F999.6%5510.0%638705695.2(Q9Z1F9) ARX
	TK251102_lung_cytoE16_2_step12.3411.3411.3	1.9407	0.1187	2794.48	3	2500.0%	1	K.GVTECYECHPKPTQRTFPGCTIR.N
	TK251102_lung_cytoE16_2_step06.1808.1808.2	2.8544	0.3572	1862.36	1	5000.0%	1	K.GVTECYECHPKPTQR.T
*	TK251102_lung_cytoE16_2_step05.2928.2928.1	1.2318	0.1514	936.63	2	6430.0%	1	K.KLSDFGIR.N
	TK251102_lung_cytoE16_2_step04.1531.1531.1	1.5174	0.0775	696.47	5	7000.0%	1	R.VHLAEK.G
	TK251102_lung_cytoE16_2_step07.4912.4912.2	3.2486	0.4553	2652.57	1	3270.0%	1	K.SMAGNIIPAIATTNAVIAGLIVLEGLK.I
URL30_HUMAN99.6%62627.2%114126539.6(P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30
	TK251102_lung_cytoE16_2_step03.3263.3263.1	1.7367	0.1427	1446.06	2	5000.0%	1	R.KSEIEYYAMLAK.T
	TK251102_lung_cytoE16_2_step09.2415.2415.2	4.7082	0.5978	2018.74	1	5830.0%	5	K.TGVHHYSGNNIELGTACGK.Y
UPYRG_MOUSE99.6%102011.0%591667116.6(P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase)
	TK251102_lung_cytoE16_2_step10.3519.3519.2	3.4908	0.556	1627.08	1	6670.0%	1	K.LCSAHGVLVPGGFGVR.G
	TK251102_lung_cytoE16_2_step03.2875.2875.1	1.6935	0.1926	1011.64	2	6430.0%	1	R.RLDLPIER.Q
*	TK251102_lung_cytoE16_2_step10.2394.2394.1	1.3581	0.0989	898.63	1	6670.0%	2	R.LPHYLQK.G
*	TK251102_lung_cytoE16_2_step09.3025.3025.2	3.7475	0.5001	2393.28	1	4520.0%	3	K.TSHPVVIDMPEHNPGQMGGTMR.L
	TK251102_lung_cytoE16_2_step08.2355.2355.1	1.7502	0.2621	1305.68	1	4550.0%	2	K.ALEHSALAINHK.L
UP9782599.6%61816.2%154160815.3(P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1)
*	TK251102_lung_cytoE16_2_step07.3584.3584.2	2.809	0.4953	2528.26	1	3260.0%	4	R.VLRPPGGGSNFSLGFDEPAEQPVR.K
*	TK251102_lung_cytoE16_2_step12.2984.2984.3	4.2715	0.6135	2656.67	1	3540.0%	1	R.VLRPPGGGSNFSLGFDEPAEQPVRK.N
UO0913299.6%7118.0%350401656.8(O09132) A6 gene product
	TK251102_lung_cytoE16_2_step07.3168.3168.1	1.5647	0.1892	1454.76	14	2920.0%	2	K.HQTLQGVAFPISR.D
	TK251102_lung_cytoE16_2_step10.3811.3811.1	1.5412	0.2845	1019.58	1	5830.0%	1	R.YHFFLYK.H
	TK251102_lung_cytoE16_2_step01.5651.5651.1	0.6973	0.053	842.64	17	4290.0%	1	K.EFGGGHIK.D
UQ9CXY699.6%355.9%390430625.3(Q9CXY6) 6230405A16Rik protein (Interleukin enhancer binding factor 2) (Similar to interleukin enhancer binding factor 2, 45kD)
	TK251102_lung_cytoE16_2_step08.4033.4033.2	3.5928	0.5717	1769.63	1	6250.0%	2	K.GTMTTGHNVADLVVILK.I
	TK251102_lung_cytoE16_2_step04.1405.1405.1	1.3183	0.0013	681.6	6	7000.0%	1	R.QVGSYK.K
UQ9DCJ099.6%114.3%304349236.0(Q9DCJ0) 0610033N24Rik protein
	TK251102_lung_cytoE16_2_step07.2818.2818.2	3.8319	0.6005	1613.39	1	7500.0%	1	R.IHQESELHSYLTR.L
UADA_MOUSE99.6%3314.8%352399925.7(P03958) Adenosine deaminase (EC 3.5.4.4) (Adenosine aminohydrolase)
*	TK251102_lung_cytoE16_2_step07.2850.2850.2	3.3158	0.5549	1875.36	1	5330.0%	1	R.VGHGYHTIEDEALYNR.L
*	TK251102_lung_cytoE16_2_step12.2161.2161.2	1.0066	0.1749	1364.1	1	4500.0%	1	K.KDMGFTEEEFK.R
*	TK251102_lung_cytoE16_2_step12.1735.1735.2	0.871	0.0481	2898.36	7	1460.0%	1	K.ANYSLNTDDPLIFKSTLDTDYQMTK.K
UCO3_MOUSE99.6%131511.7%16631864826.8(P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin]
	TK251102_lung_cytoE16_2_step01.0378.0378.1	0.7999	0.0772	1345.78	74	2270.0%	1	R.EVVADSVWVDVK.D
*	TK251102_lung_cytoE16_2_step09.3655.3655.2	2.8753	0.6076	1787.72	1	6000.0%	1	K.VHQYFNVGLIQPGSVK.V
*	TK251102_lung_cytoE16_2_step06.2589.2589.1	1.1362	0.0222	997.72	153	3750.0%	1	K.ISLAHSLTR.V
*	TK251102_lung_cytoE16_2_step11.0906.0906.3	1.3036	0.0751	4061.76	5	1180.0%	1	K.SLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTK.T
*	TK251102_lung_cytoE16_2_step07.3583.3583.2	1.4512	0.1989	1900.48	14	3330.0%	1	R.MELKPGDNLNVNFHLR.T
*	TK251102_lung_cytoE16_2_step05.2233.2233.2	2.336	0.2242	1113.14	1	6500.0%	1	K.TVLTGASGHLR.S
*	TK251102_lung_cytoE16_2_step09.2525.2525.3	1.302	0.1031	1754.65	2	3460.0%	1	R.NEQVEIRAVLFNYR.E
*	TK251102_lung_cytoE16_2_step09.3743.3743.2	2.1934	0.4364	1753.62	1	4000.0%	2	K.TVVILIETPDGIPVKR.D
*	TK251102_lung_cytoE16_2_step05.2477.2477.1	1.0851	0.2171	873.67	8	5000.0%	1	R.KFISHIK.C
*	TK251102_lung_cytoE16_2_step03.4642.4642.3	1.3727	0.0184	2631.55	16	1960.0%	1	K.NYAGVFMDAGLAFKTSQGLQTEQR.A
*	TK251102_lung_cytoE16_2_step08.3018.3018.2	2.082	0.2277	1884.22	1	3530.0%	1	R.KVLMEGVRPSNADALVGK.S
*	TK251102_lung_cytoE16_2_step06.3905.3905.2	1.0642	0.0195	1489.14	3	3850.0%	1	R.GTLSVVAVYHAKLK.S
UROK_MOUSE99.6%214922.8%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein)
	TK251102_lung_cytoE16_2_step01.3272.3272.2	2.5212	0.4736	1918.96	1	4440.0%	1	R.GSYGDLGGPIITTQVTIPK.D
	TK251102_lung_cytoE16_2_step01.4320.4320.1	1.8751	0.1652	1342.86	1	6820.0%	1	K.IILDLISESPIK.G
	TK251102_lung_cytoE16_2_step04.2191.2191.1	1.9714	0.2523	1054.72	6	5560.0%	2	R.VVLIGGKPDR.V
	TK251102_lung_cytoE16_2_step11.2250.2250.2	1.608	0.2525	1197.34	1	5000.0%	3	R.NLPLPPPPPPR.G
	TK251102_lung_cytoE16_2_step04.2088.2088.2	3.1554	0.5092	1737.64	1	5770.0%	2	K.RPAEDMEEEQAFKR.S
	TK251102_lung_cytoE16_2_step06.4818.4818.2	2.8343	0.5378	1844.61	1	4060.0%	1	R.ILSISADIETIGEILKK.I
	TK251102_lung_cytoE16_2_step01.1918.1918.1	1.4123	0.0815	701.92	18	7000.0%	1	R.ILLQSK.N
	TK251102_lung_cytoE16_2_step01.1111.1111.1	1.5919	0.2082	731.42	2	6430.0%	4	K.NAGAVIGK.G
	TK251102_lung_cytoE16_2_step01.2404.2404.1	1.0997	0.0483	874.95	1	6880.0%	2	K.DLAGSIIGK.G
UQ9JHQ599.6%488.4%299347735.2(Q9JHQ5) Leucine zipper transcription factor-like 1
*	TK251102_lung_cytoE16_2_step04.4455.4455.1	0.9111	0.1406	1154.4	4	5000.0%	2	K.KPIIDITKPK.L
*	TK251102_lung_cytoE16_2_step02.3901.3901.3	1.2557	0.0349	2734.94	128	1150.0%	2	K.KPIIDITKPKLVPINEGGTTELLNK.E
UO8830699.6%72915.6%173183526.3(O88306) DJ-1
	TK251102_lung_cytoE16_2_step05.1669.1669.1	1.9631	0.1911	868.63	1	6430.0%	5	K.VTTHPLAK.D
	TK251102_lung_cytoE16_2_step07.4908.4908.2	3.4659	0.6158	1907.64	1	4720.0%	2	R.GPGTSFEFALAIVEALVGK.D
URL9_MOUSE99.6%103224.5%1922188110.0(P51410) 60S ribosomal protein L9
	TK251102_lung_cytoE16_2_step07.4407.4407.2	3.2307	0.474	2488.21	1	4520.0%	5	R.SVYAHFPINVVIQENGSLVEIR.N
	TK251102_lung_cytoE16_2_step04.2537.2537.1	1.9419	0.1484	1331.59	1	6000.0%	2	R.TICSHVQNMIK.G
	TK251102_lung_cytoE16_2_step02.3890.3890.2	2.0851	0.3305	1599.98	1	5380.0%	1	R.DFNHINVELSLLGK.K
UPRSX_HUMAN99.6%133518.0%389441737.5(Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44)
	TK251102_lung_cytoE16_2_step11.3032.3032.2	1.2249	0.1595	2238.77	34	1840.0%	1	K.MIMATNRPDTLDPALLRPGR.L
	TK251102_lung_cytoE16_2_step08.0820.0820.1	0.6722	0.1019	416.41	1	7500.0%	1	K.ELR.E
	TK251102_lung_cytoE16_2_step12.1373.1373.3	1.6169	0.1233	1772.79	1	3120.0%	1	K.GCLLYGPPGTGKTLLAR.A
	TK251102_lung_cytoE16_2_step11.2214.2214.1	1.9076	0.235	1435.94	1	5910.0%	1	R.KIHIDLPNEQAR.L
	TK251102_lung_cytoE16_2_step09.1884.1884.1	1.4673	0.2737	838.54	2	5710.0%	5	K.IHAGPITK.H
	TK251102_lung_cytoE16_2_step07.1710.1710.1	1.2242	0.0955	796.67	1	6670.0%	1	K.YIGESAR.L
	TK251102_lung_cytoE16_2_step01.1291.1291.1	0.7963	0.0013	401.51	2	10000.0%	2	R.LIR.E
USAHH_MOUSE99.6%131926.2%431475576.5(P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP)
	TK251102_lung_cytoE16_2_step03.2285.2285.1	2.7232	0.52	1382.74	1	5830.0%	2	K.KLDEAVAEAHLGK.L
	TK251102_lung_cytoE16_2_step03.2254.2254.1	1.4156	0.2262	1259.77	1	6110.0%	1	K.SKFDNLYGCR.E
*	TK251102_lung_cytoE16_2_step11.3617.3617.3	1.0541	0.1436	3716.72	14	1140.0%	1	R.GFGARVIITEIDPINALQAAMEGYEVTTMDEACK.E
	TK251102_lung_cytoE16_2_step08.3319.3319.1	1.4752	0.0894	1157.61	9	4440.0%	1	K.YPVGVHFLPK.K
	TK251102_lung_cytoE16_2_step01.3326.3326.1	1.1956	0.1615	1560.85	7	3460.0%	1	K.ALDIAENEMPGLMR.M
	TK251102_lung_cytoE16_2_step01.1135.1135.1	0.8152	0.1567	520.4	28	6670.0%	1	K.LPYK.V
*	TK251102_lung_cytoE16_2_step07.3643.3643.2	2.3061	0.2741	2236.18	1	5000.0%	2	K.QAQYLGMPINGPFKPDHYR.Y
	TK251102_lung_cytoE16_2_step03.1762.1762.1	2.0749	0.1964	1070.6	1	5620.0%	2	K.VNIKPQVDR.Y
UDPY2_MOUSE99.6%276730.4%572621716.4(O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein)
	TK251102_lung_cytoE16_2_step03.3177.3177.2	5.0843	0.6562	2171.56	1	6320.0%	3	R.NLHQSGFSLSGAQIDDNIPR.R
	TK251102_lung_cytoE16_2_step07.4331.4331.3	1.3777	0.0618	3859.27	2	1640.0%	1	K.AALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSK.S
	TK251102_lung_cytoE16_2_step03.2863.2863.1	1.6229	0.3011	1296.61	1	5000.0%	2	R.MVIPGGIDVHTR.F
	TK251102_lung_cytoE16_2_step09.3603.3603.3	1.5244	0.0047	2116.9	12	2370.0%	1	K.QIGENLIVPGGVKTIEAHSR.M
	TK251102_lung_cytoE16_2_step05.3499.3499.2	3.0426	0.5688	2555.96	1	3910.0%	3	K.KGTVVYGEPITASLGTDGSHYWSK.N
*	TK251102_lung_cytoE16_2_step05.3927.3927.2	2.4131	0.4182	2072.27	1	5000.0%	2	K.THNSALEYNIFEGMECR.G
	TK251102_lung_cytoE16_2_step01.3263.3263.2	2.1969	0.4771	2426.91	1	3410.0%	1	K.GTVVYGEPITASLGTDGSHYWSK.N
	TK251102_lung_cytoE16_2_step12.5595.5595.2	1.3173	0.0666	2857.21	52	1670.0%	1	K.GIQEEMEALVKDHGVNSFLVYMAFK.D
	TK251102_lung_cytoE16_2_step01.3664.3664.1	1.906	0.0723	1248.64	3	5500.0%	1	K.GIQEEMEALVK.D
	TK251102_lung_cytoE16_2_step03.4738.4738.2	2.6571	0.5629	3141.45	1	2240.0%	4	K.AALAGGTTMIIDHVVPEPGTSLLAAFDQWR.E
	TK251102_lung_cytoE16_2_step02.1366.1366.1	0.871	0.1184	813.43	183	3330.0%	1	K.TIEAHSR.M
	TK251102_lung_cytoE16_2_step01.1432.1432.1	1.4319	0.121	1085.68	1	6000.0%	1	R.GSPLVVISQGK.I
	TK251102_lung_cytoE16_2_step05.3279.3279.1	2.3266	0.2851	1142.58	2	5000.0%	4	R.KPFPDFVYK.R
UG3P1_HUMAN99.6%5119.3%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12)
*	TK251102_lung_cytoE16_2_step01.1862.1862.1	2.9838	0.52	1371.5	1	5710.0%	3	R.GAAQNLIPASTGAAK.A
*	TK251102_lung_cytoE16_2_step01.1886.1886.1	1.6152	0.1398	873.41	4	5000.0%	1	K.VIPELDGK.L
*	TK251102_lung_cytoE16_2_step01.1762.1762.1	0.7687	0.0565	806.84	118	2860.0%	1	K.VGVDGFGR.I
UHBE_MOUSE99.6%3010255.5%146160058.2(P02104) Hemoglobin epsilon-Y2 chain
	TK251102_lung_cytoE16_2_step04.2921.2921.1	2.2267	0.4667	1194.61	1	7000.0%	5	K.KVLTAFGESIK.N
	TK251102_lung_cytoE16_2_step06.2932.2932.2	3.0315	0.3988	2081.82	1	6250.0%	3	K.LSELHCDKLHVDPENFK.L
	TK251102_lung_cytoE16_2_step04.2580.2580.1	1.729	0.208	1168.59	1	5910.0%	4	K.LVAGVATALSHK.Y
	TK251102_lung_cytoE16_2_step01.1178.1178.2	1.4071	0.0323	1004.54	1	7140.0%	1	K.LSELHCDK.L
	TK251102_lung_cytoE16_2_step01.1750.1750.1	1.9613	0.2319	1329.83	1	4580.0%	2	K.VNVEEVGGEALGR.L
	TK251102_lung_cytoE16_2_step01.3142.3142.1	1.5316	0.3588	1032.95	1	6250.0%	2	K.TLINGLWSK.V
	TK251102_lung_cytoE16_2_step02.3933.3933.2	2.9607	0.1518	2021.61	1	4440.0%	3	R.FFDSFGNLSSASAIMGNPR.V
URSP4_MOUSE99.6%135116.6%295327194.8(P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor)
	TK251102_lung_cytoE16_2_step01.1852.1852.1	1.597	0.2242	1204.11	1	4170.0%	1	K.FAAATGATPIAGR.F
	TK251102_lung_cytoE16_2_step04.3309.3309.1	1.8534	0.1675	1265.72	6	4500.0%	6	R.KSDGIYIINLK.R
	TK251102_lung_cytoE16_2_step11.1904.1904.3	0.8405	0.0057	2400.02	9	1670.0%	1	R.GTISREHPWEVMPDLYFYR.D
	TK251102_lung_cytoE16_2_step03.4499.4499.1	0.9201	0.0147	657.33	10	5000.0%	2	K.LLLAAR.A
URL26_HUMAN99.6%206637.9%1451725810.6(Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26
	TK251102_lung_cytoE16_2_step02.3601.3601.1	0.898	0.1521	1295.78	219	3000.0%	1	K.FNPFVTSDRSK.N
	TK251102_lung_cytoE16_2_step10.2143.2143.2	2.8832	0.4723	1677.45	1	5330.0%	2	R.EKANGTTVHVGIHPSK.V
	TK251102_lung_cytoE16_2_step04.5093.5093.2	1.1692	0.1005	1263.18	1	4000.0%	1	K.IMSSPLSKELR.Q
	TK251102_lung_cytoE16_2_step01.1908.1908.1	1.2365	0.1423	863.94	7	5710.0%	1	K.IMSSPLSK.E
	TK251102_lung_cytoE16_2_step06.1949.1949.1	1.8043	0.2786	1420.74	1	4620.0%	6	K.ANGTTVHVGIHPSK.V
	TK251102_lung_cytoE16_2_step11.2333.2333.1	1.1589	0.0438	1084.59	7	5000.0%	3	K.KYVIYIER.V
	TK251102_lung_cytoE16_2_step12.1513.1513.1	1.9688	0.3081	1080.03	1	6250.0%	2	R.HFNAPSHIR.R
UMTPN_MOUSE99.6%4447.0%117127305.5(P80144) Myotrophin (V-1 protein) (Granule cell differentiation protein)
	TK251102_lung_cytoE16_2_step08.0043.0043.3	1.2155	0.0112	3088.29	18	1540.0%	1	R.TLEGGRKPLHYAADCGQLEILEFLLLK.G
	TK251102_lung_cytoE16_2_step12.3393.3393.2	1.7384	0.2541	2147.76	1	4170.0%	1	K.HHITPLLSAVYEGHVSCVK.L
	TK251102_lung_cytoE16_2_step12.3271.3271.3	5.1764	0.5552	3031.45	1	3060.0%	1	K.GADINAPDKHHITPLLSAVYEGHVSCVK.L
UMAP4_MOUSE99.6%111311.9%11251176755.0(P27546) Microtubule-associated protein 4 (MAP 4)
*	TK251102_lung_cytoE16_2_step02.1926.1926.1	1.094	0.0586	994.59	10	5000.0%	1	R.SKTTSASSVK.R
*	TK251102_lung_cytoE16_2_step04.1481.1481.1	1.2116	0.2895	1125.63	1	4500.0%	1	K.AKPLATTQPAK.T
*	TK251102_lung_cytoE16_2_step04.2805.2805.1	1.1866	0.1405	972.57	42	4380.0%	1	K.VATVPIKDK.G
*	TK251102_lung_cytoE16_2_step12.1416.1416.2	2.2203	0.5241	1651.39	1	4060.0%	1	R.TSPSKPSSAPALKPGPK.T
*	TK251102_lung_cytoE16_2_step12.1709.1709.1	1.7003	0.4152	1580.51	1	4000.0%	2	K.KPMSLASGSVPAAPHK.R
*	TK251102_lung_cytoE16_2_step02.4519.4519.3	1.016	0.0619	4588.68	61	880.0%	1	R.VDYPDYQSSQNWPEDASFCFQPQQVLDTDQAEPFNEHR.D
*	TK251102_lung_cytoE16_2_step07.4487.4487.2	1.1265	0.0051	1816.9	7	3240.0%	1	R.VKPMSAPSRSSGALSVDK.K
*	TK251102_lung_cytoE16_2_step03.1473.1473.2	3.2006	0.4507	1354.09	1	6430.0%	1	K.AAGSIASAQKPPAGK.V
UQ91Y3899.6%799.0%10461169806.7(Q91Y38) UDP-N-acetylglucosaminyltransferase
	TK251102_lung_cytoE16_2_step12.1841.1841.1	0.492	0.0163	1342.66	8	1500.0%	1	R.GQLQEAIEHYR.H
	TK251102_lung_cytoE16_2_step12.1867.1867.1	1.6496	0.3503	1572.47	1	5830.0%	1	K.INVLHKPPYEHPK.D
	TK251102_lung_cytoE16_2_step03.1607.1607.2	1.0309	0.1847	1592.27	2	4000.0%	1	-.MASSVGNVADSTEPTK.R
	TK251102_lung_cytoE16_2_step01.0404.0404.3	1.3028	0.1035	1850.18	23	2810.0%	1	R.VAASQLTCLGCLELIAK.S
	TK251102_lung_cytoE16_2_step09.3337.3337.2	1.3683	0.1773	2119.42	1	3420.0%	2	R.AIQINPAFADAHSNLASIHK.D
	TK251102_lung_cytoE16_2_step06.3321.3321.2	1.2226	0.0018	1955.85	135	2190.0%	1	R.IHQDGIHILVNMNGYTK.G
UQ9CWI599.6%6147.8%2042404711.6(Q9CWI5) Ribosomal protein L15
	TK251102_lung_cytoE16_2_step12.1479.1479.1	1.3304	0.2513	1013.54	1	5620.0%	2	K.FHHTIGGSR.R
	TK251102_lung_cytoE16_2_step05.1919.1919.1	1.6563	0.1453	881.51	1	6670.0%	3	R.NTLQLHR.Y
UQ9D89299.6%3520.7%198219465.9(Q9D892) 2010016I08Rik protein
	TK251102_lung_cytoE16_2_step10.4249.4249.2	3.1391	0.5738	1796.87	1	5670.0%	2	K.LKPEGLHQLLAGFEDK.S
*	TK251102_lung_cytoE16_2_step08.2622.2622.3	1.654	0.0649	3026.75	89	1460.0%	1	R.DFGWDPCFQPDGYEQTYAEMPKSEK.N
UO0879499.6%338729.1%9661094046.2(O08794) Alpha glucosidase II, alpha subunit
*	TK251102_lung_cytoE16_2_step11.4168.4168.3	3.7515	0.4443	3901.68	1	2000.0%	2	K.THSDSKPYGPTSVGLDFSLPGMEHVYGIPEHADSLR.L
*	TK251102_lung_cytoE16_2_step03.3463.3463.2	1.5598	0.2493	1353.58	1	5000.0%	2	K.GHLETPIWIER.V
	TK251102_lung_cytoE16_2_step10.1703.1703.1	1.4249	0.111	979.45	36	5000.0%	2	R.AHAHLDTGR.R
	TK251102_lung_cytoE16_2_step10.2481.2481.2	1.9972	0.1288	1145.97	1	6110.0%	1	R.SIRPGLSPYR.A
*	TK251102_lung_cytoE16_2_step06.1990.1990.1	1.4033	0.1282	831.67	1	7500.0%	3	R.NHGLYVK.T
*	TK251102_lung_cytoE16_2_step09.4619.4619.2	2.9206	0.511	1625.94	1	6920.0%	6	R.FPQPLNMLEHLASK.R
	TK251102_lung_cytoE16_2_step11.2516.2516.1	1.3622	0.0922	1232.81	1	6500.0%	1	R.KLVAIVDPHIK.V
	TK251102_lung_cytoE16_2_step08.1865.1865.1	0.8711	0.0010	749.11	33	3750.0%	3	R.RPRYR.V
*	TK251102_lung_cytoE16_2_step10.4622.4622.2	2.0211	0.3633	2401.46	1	4250.0%	2	R.DIHNIYGLYVHMATADGLIQR.S
*	TK251102_lung_cytoE16_2_step05.2037.2037.3	1.5969	0.0309	1652.56	10	3040.0%	1	R.KPGVSVASDWSIHLR.-
*	TK251102_lung_cytoE16_2_step06.3042.3042.2	1.2574	0.2044	1682.61	1	3440.0%	1	R.VVIMGAGKPAAVVLQTK.G
	TK251102_lung_cytoE16_2_step09.4449.4449.3	1.9223	0.1172	3669.13	43	1480.0%	1	K.DDPITLFVALSPQGTAQGELFLDDGHTFNYQTR.H
*	TK251102_lung_cytoE16_2_step05.2225.2225.2	2.0181	0.2581	1328.04	2	6500.0%	2	K.DAVHYGGWEHR.D
*	TK251102_lung_cytoE16_2_step04.3700.3700.2	1.259	0.1858	1848.68	2	3570.0%	1	R.REPWLLASQYQDAIR.D
	TK251102_lung_cytoE16_2_step05.4327.4327.2	1.9567	0.3377	2535.66	1	3180.0%	1	R.QYASLTGTQALPPLFSLGYHQSR.W
*	TK251102_lung_cytoE16_2_step05.5268.5268.3	0.8093	0.0035	4692.87	163	710.0%	1	R.FGAVWTGDNTAEWDHLKISIPMCLSLALVGLSFCGADVGGFFK.N
UQ91Y3799.6%6814.9%623695665.6(Q91Y37) Cytosolic aminopeptidase P
	TK251102_lung_cytoE16_2_step05.2743.2743.3	1.5933	0.0419	2958.19	35	1390.0%	2	R.RAFVSGFDGSAGTAIITEEHAAMWTDGR.Y
*	TK251102_lung_cytoE16_2_step11.1614.1614.1	1.6565	0.2417	1045.96	2	5560.0%	1	R.SAGHHLVPVK.E
	TK251102_lung_cytoE16_2_step05.3140.3140.1	1.2205	0.047	1015.45	3	5620.0%	1	K.GHLLDSFAR.S
	TK251102_lung_cytoE16_2_step11.4421.4421.3	4.5062	0.6181	3632.84	1	2650.0%	1	R.SALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYK.T
	TK251102_lung_cytoE16_2_step03.3243.3243.2	1.1873	0.0543	1383.88	31	3640.0%	1	R.TMHFGTPTAYEK.E
UO0879599.6%41011.5%521587934.5(O08795) Alpha glucosidase II, beta subunit
	TK251102_lung_cytoE16_2_step02.5035.5035.3	1.0775	0.3205	4754.14	4	860.0%	1	R.SLEQEISFDFGPSGEFAYLYSQCYELTTNEYVYRLCPFK.L
	TK251102_lung_cytoE16_2_step08.3423.3423.2	2.1817	0.464	2151.09	1	4250.0%	3	K.HGGSPTSLGTWGSWAGPDHDK.F
UQ99KR399.6%2210.1%288327546.3(Q99KR3) Hypothetical 32.8 kDa protein
*	TK251102_lung_cytoE16_2_step11.2252.2252.2	2.9604	0.1753	1901.63	1	5000.0%	1	K.ANIIYPGHGPVIHNAEAK.I
*	TK251102_lung_cytoE16_2_step11.3062.3062.2	3.3194	0.4589	1348.32	1	7000.0%	1	K.MAEHNLLLHLR.K
UQ99PC399.6%7177.9%3924659810.0(Q99PC3) CGI-74-like SR-rich protein
	TK251102_lung_cytoE16_2_step10.2909.2909.2	3.7186	0.5475	1866.09	1	6670.0%	2	K.SHLLNCCPHDVLSGTR.M
	TK251102_lung_cytoE16_2_step04.2109.2109.1	1.333	0.1399	825.68	1	7500.0%	2	K.VHDLALR.A
	TK251102_lung_cytoE16_2_step02.1862.1862.1	1.1676	0.0599	846.44	1	6430.0%	3	R.LADHFGGK.L
UQ8R1K599.6%149010.4%222216349.4(Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens)
	TK251102_lung_cytoE16_2_step02.2746.2746.1	0.8287	0.0418	881.32	3	5000.0%	1	R.GGYGGGGGGSR.G
	TK251102_lung_cytoE16_2_step05.1732.1732.1	2.3369	0.5124	1474.57	1	5450.0%	8	K.YHTINGHNCEVK.K
UHS9A_MOUSE99.6%8445232.0%732846575.0(P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA)
	TK251102_lung_cytoE16_2_step05.3736.3736.2	2.5769	0.3637	1789.6	1	5000.0%	7	K.HLEINPDHSIIETLR.Q
	TK251102_lung_cytoE16_2_step11.2864.2864.2	2.9977	0.3308	1917.74	1	5670.0%	1	K.KHLEINPDHSIIETLR.Q
	TK251102_lung_cytoE16_2_step03.1966.1966.1	1.234	0.1421	1395.69	13	4090.0%	1	R.DKEVSDDEAEEK.E
	TK251102_lung_cytoE16_2_step01.2939.2939.1	1.9756	0.4282	1517.2	1	3850.0%	4	R.GVVDSEDLPLNISR.E
	TK251102_lung_cytoE16_2_step01.1894.1894.1	1.3444	0.2488	1541.0	1	3460.0%	1	R.YESLTDPSKLDSGK.E
*	TK251102_lung_cytoE16_2_step05.3096.3096.1	1.4963	0.2278	1211.58	1	5560.0%	4	K.HIYFITGETK.D
	TK251102_lung_cytoE16_2_step05.4519.4519.2	4.3829	0.6688	1782.91	1	7140.0%	9	K.HSQFIGYPITLFVEK.E
	TK251102_lung_cytoE16_2_step01.2838.2838.1	0.9873	0.0841	1244.9	40	3180.0%	1	K.ADLINNLGTIAK.S
	TK251102_lung_cytoE16_2_step04.3649.3649.2	2.7599	0.3806	1266.21	1	6670.0%	2	R.RAPFDLFENR.K
	TK251102_lung_cytoE16_2_step04.3240.3240.2	2.7833	0.5054	1350.86	1	8500.0%	8	K.HFSVEGQLEFR.A
	TK251102_lung_cytoE16_2_step02.3093.3093.2	1.6986	0.4281	2258.96	1	3680.0%	1	K.HNDDEQYAWESSAGGSFTVR.T
	TK251102_lung_cytoE16_2_step09.2799.2799.1	1.1976	0.2119	724.66	7	5000.0%	8	K.VILHLK.E
	TK251102_lung_cytoE16_2_step04.4457.4457.2	1.8176	0.1829	2579.05	1	2750.0%	1	K.HGLEVIYMIEPIDEYCVQQLK.E
*	TK251102_lung_cytoE16_2_step03.3262.3262.1	1.8291	0.302	1165.58	2	5560.0%	2	K.ELHINLIPSK.Q
	TK251102_lung_cytoE16_2_step11.1394.1394.1	1.2906	0.0169	791.63	74	6000.0%	1	K.EEEKEK.E
	TK251102_lung_cytoE16_2_step01.1527.1527.1	1.1926	0.0831	810.69	16	7000.0%	1	K.FENLCK.I
	TK251102_lung_cytoE16_2_step03.1922.1922.1	1.351	0.1313	1041.48	7	4290.0%	1	K.TKFENLCK.I
	TK251102_lung_cytoE16_2_step01.3066.3066.1	2.2819	0.4138	1351.96	1	5000.0%	4	R.TLTIVDTGIGMTK.A
	TK251102_lung_cytoE16_2_step06.1858.1858.2	1.9057	0.3486	1297.9	1	6500.0%	1	K.LGIHEDSQNRK.K
*	TK251102_lung_cytoE16_2_step06.3138.3138.1	1.3727	0.07	1563.62	56	2500.0%	1	K.ELHINLIPSKQDR.T
	TK251102_lung_cytoE16_2_step04.3172.3172.2	2.299	0.4532	2019.08	1	4670.0%	7	K.VILHLKEDQTEYLEER.R
	TK251102_lung_cytoE16_2_step01.1044.1044.1	1.2659	0.011	558.25	5	7500.0%	1	K.AQALR.D
	TK251102_lung_cytoE16_2_step01.0218.0218.1	1.1403	0.1136	747.6	1	8330.0%	1	K.TLVSVTK.E
UFLNA_HUMAN99.6%381069.4%26472807596.1(P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin)
*	TK251102_lung_cytoE16_2_step04.1357.1357.1	1.2257	0.1214	1081.62	66	4000.0%	1	R.VNVGAGSHPNK.V
*	TK251102_lung_cytoE16_2_step03.5261.5261.1	0.3958	0.244	414.23	13	1670.0%	4	R.VVVP.-
*	TK251102_lung_cytoE16_2_step11.3877.3877.2	2.9688	0.5795	1945.6	1	5290.0%	4	K.HTAMVSWGGVSIPNSPFR.V
*	TK251102_lung_cytoE16_2_step12.3549.3549.2	1.1526	0.0867	2319.92	5	2500.0%	1	K.DGTVTVRYAPSEAGLHEMDIR.Y
*	TK251102_lung_cytoE16_2_step12.1384.1384.2	2.6868	0.4365	1635.95	1	5000.0%	2	R.VHGPGIQSGTTNKPNK.F
*	TK251102_lung_cytoE16_2_step05.1717.1717.1	1.9224	0.4257	1110.6	1	4000.0%	3	R.ALTQTGGPHVK.A
*	TK251102_lung_cytoE16_2_step06.2938.2938.1	1.8012	0.3207	1156.62	1	6000.0%	3	R.NGHVGISFVPK.E
*	TK251102_lung_cytoE16_2_step11.2237.2237.3	1.4166	0.0125	2589.29	1	2270.0%	1	K.KTHIQDNHDGTYTVAYVPDVTGR.Y
*	TK251102_lung_cytoE16_2_step12.3293.3293.3	1.3354	0.0678	2696.19	20	1920.0%	1	K.SADFVVEAIGDDVGTLGFSVEGPSQAK.I
	TK251102_lung_cytoE16_2_step12.1557.1557.2	1.0509	0.0719	1895.94	32	2000.0%	1	R.QMQLENVSVALEFLDR.E
*	TK251102_lung_cytoE16_2_step04.1404.1404.1	1.4557	0.1525	1196.61	1	6000.0%	1	R.VKVEPSHDASK.V
*	TK251102_lung_cytoE16_2_step09.2828.2828.2	3.2915	0.5176	1700.87	1	6330.0%	3	R.TGVELGKPTHFTVNAK.A
*	TK251102_lung_cytoE16_2_step05.2057.2057.1	1.7267	0.2608	1150.57	2	4440.0%	3	K.ETGEHLVHVK.K
*	TK251102_lung_cytoE16_2_step12.1545.1545.2	1.3935	0.2641	1075.13	1	5000.0%	1	K.LKPGAPLRPK.L
*	TK251102_lung_cytoE16_2_step09.4155.4155.3	1.142	0.0535	4564.01	5	1130.0%	4	K.AHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIR.N
UH2AG_HUMAN99.6%133551.2%1291397610.9(P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3)
	TK251102_lung_cytoE16_2_step01.1014.1014.1	0.8335	0.0567	498.57	3	8330.0%	2	R.IIPR.H
	TK251102_lung_cytoE16_2_step07.5006.5006.2	2.9466	0.5901	2919.94	1	2860.0%	4	R.VGAGAPVYLAAVLEYLTAEILELAGNAAR.D
	TK251102_lung_cytoE16_2_step01.4559.4559.2	1.4351	0.31	1934.42	1	3330.0%	1	K.VTIAQGGVLPNIQAVLLPK.K
	TK251102_lung_cytoE16_2_step10.2933.2933.2	2.3835	0.2354	851.26	1	10000.0%	2	R.HLQLAIR.N
	TK251102_lung_cytoE16_2_step04.0086.0086.1	0.8775	0.1617	867.45	59	4170.0%	1	K.KTESHHK.A
UPSA6_MOUSE99.6%4618.7%246273726.7(Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain)
	TK251102_lung_cytoE16_2_step01.3806.3806.3	0.9925	0.1968	4141.96	22	570.0%	1	R.IADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYK.C
	TK251102_lung_cytoE16_2_step05.3127.3127.1	1.9093	0.4838	1158.54	1	6670.0%	1	R.HITIFSPEGR.L
UCYPB_MOUSE99.6%92730.3%208227139.5(P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1)
	TK251102_lung_cytoE16_2_step08.3014.3014.2	3.0471	0.4875	1476.68	1	7310.0%	3	K.HYGPGWVSMANAGK.D
*	TK251102_lung_cytoE16_2_step09.4085.4085.3	0.969	0.0147	2448.22	41	1310.0%	1	K.VYFDLQIGDESVGRVVFGLFGK.T
*	TK251102_lung_cytoE16_2_step03.4274.4274.3	1.4841	0.1003	2741.07	1	2310.0%	1	K.VLFAAALIVGSVVFLLLPGPSVANDKK.K
UGDIR_MOUSE99.6%147627.0%204234075.2(Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1)
	TK251102_lung_cytoE16_2_step01.2454.2454.2	3.6507	0.5987	1918.62	1	6000.0%	1	K.SIQEIQELDKDDESLR.K
	TK251102_lung_cytoE16_2_step04.4064.4064.2	2.86	0.5323	2367.3	1	3890.0%	8	R.FTDDDKTDHLSWEWNLTIK.K
	TK251102_lung_cytoE16_2_step06.2412.2412.1	1.5281	0.1561	849.71	2	6670.0%	1	K.KQSFVLK.E
	TK251102_lung_cytoE16_2_step05.1713.1713.1	0.9659	0.0836	982.53	1	6670.0%	3	K.YIQHTYR.K
	TK251102_lung_cytoE16_2_step01.3047.3047.1	0.6188	0.1168	755.67	16	3000.0%	1	K.EGVEYR.I
URL7_MOUSE99.6%257734.1%2703142010.9(P14148) 60S ribosomal protein L7
	TK251102_lung_cytoE16_2_step05.4823.4823.2	4.0598	0.5632	2138.88	1	5880.0%	1	K.FGIICMEDLIHEIYTVGK.R
	TK251102_lung_cytoE16_2_step06.2346.2346.1	2.1491	0.13	1083.73	3	5000.0%	6	K.KVPAVPETLK.K
	TK251102_lung_cytoE16_2_step01.1927.1927.1	1.2776	0.1292	954.19	1	6250.0%	3	K.VPAVPETLK.K
	TK251102_lung_cytoE16_2_step05.2095.2095.1	2.0732	0.3895	1014.64	1	6670.0%	2	K.KVATVPGTLK.K
	TK251102_lung_cytoE16_2_step07.1840.1840.1	1.9089	0.0722	1488.63	1	4620.0%	1	K.KTTHFVEGGDAGNR.E
	TK251102_lung_cytoE16_2_step04.2303.2303.1	1.2302	0.0169	1320.68	3	4550.0%	2	R.KAGNFYVPAEPK.L
	TK251102_lung_cytoE16_2_step03.2047.2047.1	1.5815	0.1553	793.55	1	8000.0%	2	R.KLIYEK.A
	TK251102_lung_cytoE16_2_step09.0925.0925.1	0.9436	0.2262	698.31	1	5000.0%	3	K.KVPAGPK.T
	TK251102_lung_cytoE16_2_step07.2295.2295.1	1.435	0.1134	608.46	4	7500.0%	2	K.KFALK.T
	TK251102_lung_cytoE16_2_step01.4312.4312.1	1.6653	0.2627	1268.05	2	6110.0%	1	K.EANNFLWPFK.L
UMYG1_MOUSE99.6%6188.7%380427237.0(Q9JK81) MYG1 protein (Gamm1 protein)
	TK251102_lung_cytoE16_2_step03.1486.1486.1	1.172	0.1992	987.53	15	5000.0%	1	K.EPHSFQSR.L
*	TK251102_lung_cytoE16_2_step09.3797.3797.2	3.0765	0.2372	1533.25	1	8180.0%	4	R.LNFYQHSWLPAR.A
*	TK251102_lung_cytoE16_2_step09.3911.3911.2	1.3249	0.0851	1420.78	1	4580.0%	1	K.LSSAGLVYLHFGR.K
UQ9EPL899.6%445.6%10391195864.8(Q9EPL8) RanBP7/importin 7
	TK251102_lung_cytoE16_2_step11.4986.4986.2	3.2795	0.414	1651.53	1	6430.0%	1	R.SPLVAAMQHFLPVLK.D
	TK251102_lung_cytoE16_2_step04.3301.3301.1	0.9011	0.1375	1521.27	37	2080.0%	1	R.ETENDDLTNVIQK.M
	TK251102_lung_cytoE16_2_step07.3034.3034.3	1.2964	0.0344	2708.18	31	1740.0%	1	K.FDVFEDFISPTTAAQTLLFTACSK.R
	TK251102_lung_cytoE16_2_step04.3713.3713.1	0.6863	0.1593	764.82	28	4000.0%	1	K.QYMAPR.V
UANX6_MOUSE99.6%318926.0%672757555.5(P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II)
	TK251102_lung_cytoE16_2_step03.4118.4118.2	1.9129	0.4449	1672.13	1	4640.0%	2	R.LILGLMMPPAHYDAK.Q
	TK251102_lung_cytoE16_2_step03.3894.3894.1	1.7813	0.0043	1031.46	1	6250.0%	1	K.TLIEILATR.T
	TK251102_lung_cytoE16_2_step09.4137.4137.2	1.2286	0.0295	1474.91	7	3460.0%	1	K.EIKDAISGIGTDEK.C
	TK251102_lung_cytoE16_2_step01.3396.3396.2	3.4249	0.5328	1764.48	1	6670.0%	1	R.DLESDIIGDTSGHFQK.M
	TK251102_lung_cytoE16_2_step07.2014.2014.1	0.9876	0.0892	772.72	5	7000.0%	3	R.SYPHLR.R
	TK251102_lung_cytoE16_2_step01.3323.3323.1	1.1418	0.119	1074.44	28	3750.0%	1	R.SEIDLLNIR.R
*	TK251102_lung_cytoE16_2_step10.3166.3166.3	1.7338	0.2176	2734.6	1	2100.0%	1	K.SLHQAIEGDTSGDFMKALLALCGGED.-
	TK251102_lung_cytoE16_2_step12.1680.1680.3	1.9804	0.0659	2137.72	11	2630.0%	1	K.TTGKPIEASIRGELSGDFEK.L
	TK251102_lung_cytoE16_2_step01.3862.3862.2	1.2136	0.1251	2558.45	2	2730.0%	1	R.GSVHDFPEFDANQDAEALYTAMK.G
*	TK251102_lung_cytoE16_2_step06.2674.2674.2	1.4298	0.1622	1361.92	61	4500.0%	5	K.KTNYDIEHVIK.K
	TK251102_lung_cytoE16_2_step06.3762.3762.2	3.8969	0.2784	1131.81	1	9440.0%	4	K.MLVVLLQGTR.E
	TK251102_lung_cytoE16_2_step02.1999.1999.2	1.3829	0.3154	1173.35	1	6000.0%	1	K.TTGKPIEASIR.G
	TK251102_lung_cytoE16_2_step10.4398.4398.2	1.6791	0.1286	1713.1	3	3670.0%	4	K.GIGTDEATIIDIVTHR.S
UPPI1_MOUSE99.6%71316.7%270317626.4(P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha)
*	TK251102_lung_cytoE16_2_step08.3425.3425.2	2.2194	0.3559	1416.8	1	6360.0%	2	K.HVEAIYIDIADR.S
	TK251102_lung_cytoE16_2_step05.1975.1975.1	1.8545	0.025	890.45	1	6670.0%	2	K.IYHLQSK.V
	TK251102_lung_cytoE16_2_step02.1711.1711.1	0.6533	0.0129	1034.37	158	1880.0%	1	K.AEEDPAKFK.S
	TK251102_lung_cytoE16_2_step08.2629.2629.2	3.0548	0.4299	2033.39	1	3750.0%	2	K.IETWHKPDLGTQENVHK.L
UQ8VI5299.6%226.0%386432395.7(Q8VI52) Endophilin B1b
	TK251102_lung_cytoE16_2_step12.3016.3016.2	3.6303	0.6371	1685.42	1	6790.0%	1	R.LLLEGISSTHAHHLR.C
	TK251102_lung_cytoE16_2_step04.1268.1268.1	0.7333	0.0401	997.65	20	3570.0%	1	R.ITQSEFDR.Q
UARI1_MOUSE99.6%5512.6%469555677.2(Q9Z1K5) Ariadne-1 protein homolog (ARI-1) (Ubiquitin-conjugating enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) (Fragment)
	TK251102_lung_cytoE16_2_step08.2623.2623.2	3.235	0.426	1452.06	1	7730.0%	1	R.VLLQHVHEGYEK.D
	TK251102_lung_cytoE16_2_step02.3325.3325.3	1.233	0.093	3149.56	105	1390.0%	1	K.IMEEGMGQTISCPAHGCDILVDDNTVMR.L
	TK251102_lung_cytoE16_2_step04.1972.1972.2	1.1434	0.0191	1414.05	1	5450.0%	1	K.LFAECHVINPSK.K
	TK251102_lung_cytoE16_2_step03.1647.1647.1	0.9644	0.0822	886.55	54	5000.0%	1	K.CHVTIEK.D
UIF5A_HUMAN99.6%4361749.7%153167015.2(P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor)
	TK251102_lung_cytoE16_2_step02.2677.2677.1	1.2149	0.0607	905.55	38	5000.0%	1	R.KNGFVVLK.G
	TK251102_lung_cytoE16_2_step10.4953.4953.2	4.5557	0.5075	2629.97	1	4570.0%	5	K.YDCGEEILITVLSAMTEEAAVAIK.A
	TK251102_lung_cytoE16_2_step08.4130.4130.2	3.1052	0.5942	1301.99	1	8180.0%	15	K.VHLVGIDIFTGK.K
	TK251102_lung_cytoE16_2_step05.4672.4672.2	1.5264	0.159	2738.02	4	2170.0%	2	K.RNDFQLIGIQDGYLSLLQDSGEVR.E
	TK251102_lung_cytoE16_2_step01.1524.1524.1	1.5392	0.195	829.08	1	6430.0%	1	R.LPEGDLGK.E
UEF11_MOUSE99.6%108353243.3%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu)
	TK251102_lung_cytoE16_2_step01.1290.1290.1	1.7969	0.0996	786.41	3	6670.0%	1	K.KLEDGPK.F
	TK251102_lung_cytoE16_2_step01.1692.1692.1	1.1665	0.2548	839.81	3	5830.0%	2	K.EVSTYIK.K
	TK251102_lung_cytoE16_2_step06.4833.4833.2	3.5308	0.4964	2914.25	1	3210.0%	57	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK251102_lung_cytoE16_2_step01.2128.2128.1	0.6658	0.019	1024.59	12	4000.0%	1	K.IGGIGTVPVGR.V
	TK251102_lung_cytoE16_2_step01.0262.0262.1	1.2422	0.0935	870.66	1	7860.0%	1	K.QLIVGVNK.M
	TK251102_lung_cytoE16_2_step02.1965.1965.1	1.1413	0.0434	937.57	53	5830.0%	1	K.RYEEIVK.E
	TK251102_lung_cytoE16_2_step03.3914.3914.2	4.0962	0.5342	2518.01	1	4350.0%	2	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK251102_lung_cytoE16_2_step01.0246.0246.1	1.0282	0.1779	914.75	5	5620.0%	1	R.QTVAVGVIK.A
	TK251102_lung_cytoE16_2_step05.2169.2169.1	1.4475	0.1816	1122.64	8	3890.0%	4	K.STTTGHLIYK.C
	TK251102_lung_cytoE16_2_step05.3059.3059.2	2.3476	0.497	1408.4	1	6360.0%	12	K.YYVTIIDAPGHR.D
	TK251102_lung_cytoE16_2_step04.3524.3524.1	2.0069	0.2848	1317.8	1	5910.0%	7	R.EHALLAYTLGVK.Q
	TK251102_lung_cytoE16_2_step10.5338.5338.2	0.7981	0.0207	2689.94	63	1670.0%	1	K.THINIVVIGHVDSGKSTTTGHLIYK.C
	TK251102_lung_cytoE16_2_step12.4015.4015.3	1.545	0.2411	4386.34	2	1500.0%	1	K.NDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK.F
	TK251102_lung_cytoE16_2_step01.1850.1850.1	1.5095	0.2495	977.72	1	7140.0%	4	R.LPLQDVYK.I
	TK251102_lung_cytoE16_2_step12.4257.4257.1	2.2604	0.5159	1592.48	1	5000.0%	3	K.THINIVVIGHVDSGK.S
UENPL_MOUSE99.6%246419.7%802924764.8(P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96)
	TK251102_lung_cytoE16_2_step03.2959.2959.2	2.1974	0.2387	1516.45	1	5770.0%	2	K.NLLHVTDTGVGMTR.E
	TK251102_lung_cytoE16_2_step01.3772.3772.1	1.5193	0.2892	1597.87	1	4170.0%	1	R.VFITDDFHDMMPK.Y
	TK251102_lung_cytoE16_2_step03.2253.2253.1	1.113	0.1055	849.45	2	5830.0%	2	R.KTLDMIK.K
	TK251102_lung_cytoE16_2_step01.0776.0776.1	1.1856	0.1957	646.49	1	7000.0%	1	K.VIVTSK.H
*	TK251102_lung_cytoE16_2_step04.3055.3055.2	3.4461	0.6027	2251.84	1	5000.0%	4	R.FQSSHHSTDITSLDQYVER.M
	TK251102_lung_cytoE16_2_step10.2049.2049.1	1.2339	0.1336	635.66	2	7500.0%	4	R.HPLIR.D
	TK251102_lung_cytoE16_2_step04.2173.2173.1	1.0594	0.0115	809.6	5	5830.0%	1	K.EFGTNIK.L
	TK251102_lung_cytoE16_2_step04.3051.3051.3	1.2807	0.0293	3075.67	2	1800.0%	1	K.KGYEVIYLTEPVDEYCIQALPEFDGK.R
	TK251102_lung_cytoE16_2_step01.0770.0770.1	1.3309	0.1028	706.49	7	7000.0%	1	R.FQNVAK.E
*	TK251102_lung_cytoE16_2_step11.5144.5144.3	1.3232	0.1244	2274.19	27	2120.0%	1	R.LISLTDENALAGNEELTVKIK.C
	TK251102_lung_cytoE16_2_step01.2504.2504.1	1.0956	0.1011	1487.17	15	3080.0%	1	K.GVVDSDDLPLNVSR.E
	TK251102_lung_cytoE16_2_step09.4775.4775.2	2.4305	0.3507	2543.76	1	3420.0%	4	K.TVWDWELMNDIKPIWQRPSK.E
UQ9CWK199.6%103629.7%259294445.7(Q9CWK1) 2410026J11Rik protein
	TK251102_lung_cytoE16_2_step12.4572.4572.2	1.134	0.1627	1787.79	129	2000.0%	1	R.YQPFKPLSIGGIIILK.D
	TK251102_lung_cytoE16_2_step02.3231.3231.2	1.0995	0.0097	2008.58	13	2350.0%	3	K.SNCKPSTFAYPAPLEVPK.E
	TK251102_lung_cytoE16_2_step09.4471.4471.2	2.1837	0.356	2441.46	1	3040.0%	5	K.FGAILAQGILDAGGHNVTISLQSR.T
	TK251102_lung_cytoE16_2_step08.3518.3518.2	1.3303	0.2587	2333.66	25	2220.0%	1	K.IEEEEQEPEPPEPFEYIDD.-
UPDX1_MOUSE99.6%2816449.2%199221768.1(P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein)
*	TK251102_lung_cytoE16_2_step01.3740.3740.2	2.1876	0.3524	1637.76	1	6330.0%	1	K.QGGLGPMNIPLISDPK.R
	TK251102_lung_cytoE16_2_step01.2818.2818.1	1.2837	0.1045	1199.06	10	5000.0%	2	R.LVQAFQFTDK.H
	TK251102_lung_cytoE16_2_step01.3312.3312.1	2.3807	0.1831	922.58	9	7140.0%	3	R.GLFIIDDK.G
*	TK251102_lung_cytoE16_2_step11.3684.3684.2	2.1714	0.4337	2771.14	1	2610.0%	1	K.LNCQVIGASVDSHFCHLAWINTPK.K
	TK251102_lung_cytoE16_2_step02.1830.1830.1	1.9548	0.2152	890.47	5	5830.0%	2	K.SKEYFSK.Q
*	TK251102_lung_cytoE16_2_step11.3558.3558.2	2.3699	0.3064	1767.26	1	4380.0%	4	K.KQGGLGPMNIPLISDPK.R
*	TK251102_lung_cytoE16_2_step09.2655.2655.2	3.6447	0.4885	2396.59	1	3810.0%	11	K.HGEVCPAGWKPGSDTIKPDVNK.S
	TK251102_lung_cytoE16_2_step01.1812.1812.1	2.1735	0.142	1109.88	1	6110.0%	2	R.TIAQDYGVLK.A
U143T_MOUSE99.6%5524.9%245277784.8(P35216) 14-3-3 protein tau (14-3-3 protein theta)
	TK251102_lung_cytoE16_2_step08.1325.1325.1	0.7741	0.0	615.34	4	5000.0%	1	K.LQLIK.D
	TK251102_lung_cytoE16_2_step07.4712.4712.2	1.3571	0.076	2422.29	1	2140.0%	1	K.AVTEQGAELSNEERNLLSVAYK.N
	TK251102_lung_cytoE16_2_step01.4634.4634.2	2.6915	0.5373	2147.37	1	3890.0%	1	K.TAFDEAIAELDTLNEDSYK.D
	TK251102_lung_cytoE16_2_step08.2705.2705.1	1.5191	0.0319	742.64	2	7000.0%	1	K.KLQLIK.D
	TK251102_lung_cytoE16_2_step03.5213.5213.2	0.8377	0.0188	1549.39	157	1540.0%	1	R.VISSIEQKTDTSDK.K
UQ8TCG399.6%2213.0%247288094.8(Q8TCG3) TPMsk3 (Fragment)
*	TK251102_lung_cytoE16_2_step02.2202.2202.2	4.8905	0.5664	1771.61	1	7500.0%	1	R.KIQVLQQQADDAEER.A
*	TK251102_lung_cytoE16_2_step07.4410.4410.2	1.6029	0.1352	1936.61	1	3440.0%	1	K.YKAISEELDHALNDMTS.-
UPDL1_MOUSE99.6%51714.1%326357176.8(O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin)
	TK251102_lung_cytoE16_2_step08.3462.3462.2	4.3562	0.6576	2106.7	1	5000.0%	4	K.MNLASEPQEVLHIGSAHNR.S
*	TK251102_lung_cytoE16_2_step09.4547.4547.3	1.6438	0.1284	2950.52	9	1830.0%	1	K.QSTSFLVLQEILESDGKGDPNKPSGFR.S
UALDR_MOUSE99.6%167614.3%315356017.2(P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase)
	TK251102_lung_cytoE16_2_step04.2817.2817.1	1.2426	0.1431	1106.7	7	5620.0%	1	K.RQDLFIVSK.L
	TK251102_lung_cytoE16_2_step08.2839.2839.1	2.5462	0.5383	1244.6	1	6670.0%	4	K.HKDYPFHAEV.-
	TK251102_lung_cytoE16_2_step07.2787.2787.2	3.5668	0.4916	2222.25	1	5000.0%	3	K.YKPAVNQIECHPYLTQEK.L
	TK251102_lung_cytoE16_2_step08.2062.2062.1	1.9008	0.03	884.72	10	5710.0%	7	R.ILNKPGLK.Y
UQ9CXA299.6%4108.2%354378046.7(Q9CXA2) 2810055F11Rik protein
*	TK251102_lung_cytoE16_2_step08.3029.3029.2	2.4554	0.5749	1735.48	1	5940.0%	3	R.IVHAGCPEVAGPTLLAK.R
*	TK251102_lung_cytoE16_2_step05.2992.2992.1	1.2376	0.0469	1392.61	20	3180.0%	1	K.GLLQLNQTRAFK.S
UQ9DAE499.6%2210.8%342389265.5(Q9DAE4) 1700012F10Rik protein
	TK251102_lung_cytoE16_2_step02.3595.3595.2	1.151	0.0102	1973.29	6	3240.0%	1	R.DMFASVGADGSVRMFDLR.H
	TK251102_lung_cytoE16_2_step12.2551.2551.2	3.744	0.6092	2336.24	1	5560.0%	1	R.HLEHSTIIYEDPQHHPLLR.L
UBAG3_MOUSE99.6%226.2%577618287.5(Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis)
*	TK251102_lung_cytoE16_2_step08.2009.2009.2	3.1747	0.5275	2299.8	1	4720.0%	1	K.THYPAQQGEYQPQQPVYHK.I
*	TK251102_lung_cytoE16_2_step01.4424.4424.2	0.9838	0.0034	1902.93	70	2190.0%	1	K.GPENKDPQTESQQLEAK.A
URS8_HUMAN99.6%7921.3%2072407410.3(P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8
	TK251102_lung_cytoE16_2_step09.2121.2121.2	3.1694	0.5073	1348.12	1	7730.0%	1	R.KYELGRPAANTK.I
	TK251102_lung_cytoE16_2_step12.1417.1417.1	1.0314	0.0377	781.6	17	4000.0%	1	R.RIHTVR.V
	TK251102_lung_cytoE16_2_step03.3403.3403.2	1.1654	0.0076	1619.65	3	3750.0%	1	R.QWYESHYALPLGR.K
	TK251102_lung_cytoE16_2_step01.2711.2711.1	1.5541	0.1625	1507.97	1	5000.0%	1	K.ISSLLEEQFQQGK.L
	TK251102_lung_cytoE16_2_step08.1525.1525.1	1.0739	0.0791	625.6	1	8750.0%	1	R.IHTVR.V
UQ9CQX899.6%3536.3%1021110110.0(Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene)
*	TK251102_lung_cytoE16_2_step06.2857.2857.2	3.1818	0.4774	2339.14	1	3480.0%	1	K.LSASEALGSAALPSHSSAISQHSK.G
*	TK251102_lung_cytoE16_2_step12.2295.2295.2	2.7905	0.388	1431.54	1	5830.0%	2	R.VVQVVKPHAPLIK.F
URS24_HUMAN99.6%184832.3%1331542310.8(P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19)
	TK251102_lung_cytoE16_2_step06.1509.1509.1	1.625	0.1905	704.57	1	6670.0%	2	R.THFGGGK.T
	TK251102_lung_cytoE16_2_step05.4745.4745.2	1.3671	0.1805	1399.54	1	5000.0%	3	K.TTPDVIFVFGFR.T
	TK251102_lung_cytoE16_2_step03.3211.3211.2	2.4143	0.3416	1238.07	1	7500.0%	2	K.QMVIDVLHPGK.A
	TK251102_lung_cytoE16_2_step09.1937.1937.1	0.971	0.0282	796.6	9	6000.0%	4	R.KFMTNR.L
	TK251102_lung_cytoE16_2_step10.3267.3267.2	3.1828	0.4826	1366.85	1	7730.0%	1	R.KQMVIDVLHPGK.A
	TK251102_lung_cytoE16_2_step03.1655.1655.1	1.715	0.2222	748.51	2	7000.0%	3	R.HGLYEK.K
UMLEN_MOUSE99.6%3519.9%141157314.9(Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment)
	TK251102_lung_cytoE16_2_step04.2575.2575.1	2.6539	0.3722	996.72	1	7500.0%	2	R.HVLVTLGEK.M
*	TK251102_lung_cytoE16_2_step12.3299.3299.2	0.8999	0.0951	1949.17	10	2220.0%	1	R.ALGQNPTNAEVLKVLGTPK.S
UUBCI_HUMAN99.6%5915.2%158180078.7(P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18)
	TK251102_lung_cytoE16_2_step11.2774.2774.1	1.8485	0.3157	1444.79	1	5000.0%	2	R.KDHPFGFVAVPTK.N
	TK251102_lung_cytoE16_2_step05.3520.3520.2	2.6634	0.4628	1220.57	1	7000.0%	2	K.KGTPWEGGLFK.L
UQ8R57499.6%7929.5%369408817.2(Q8R574) Phosphoribosyl pyrophosphate synthetase-associated protein 2
*	TK251102_lung_cytoE16_2_step04.2715.2715.3	1.5263	0.0026	2479.67	29	1900.0%	1	R.LIEESAIDEVVVTNTIPHEIQK.L
	TK251102_lung_cytoE16_2_step10.3717.3717.2	1.6509	0.231	1581.49	1	4230.0%	1	K.AGLTHLITMDLHQK.E
	TK251102_lung_cytoE16_2_step06.4976.4976.2	2.632	0.3984	2461.55	1	4320.0%	2	R.IAIIVDDIIDDVDSFLAAAETLK.E
	TK251102_lung_cytoE16_2_step05.3692.3692.2	1.3558	0.0543	1715.04	5	3670.0%	1	K.IFVMATHGLLSSDAPR.L
	TK251102_lung_cytoE16_2_step09.4631.4631.2	1.1527	0.084	2083.21	39	2500.0%	1	R.ASPFLLQYIQEEIPDYR.N
	TK251102_lung_cytoE16_2_step05.4416.4416.2	1.8785	0.3538	1819.62	1	3750.0%	1	R.SVAAIHPSLEIPMLIPK.E
UQ9CSN899.6%113514.4%369422218.5(Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment)
	TK251102_lung_cytoE16_2_step07.2464.2464.2	2.1124	0.2555	1796.52	1	4640.0%	4	K.LITQTFNHHNQLAQK.A
	TK251102_lung_cytoE16_2_step05.2617.2617.2	1.8732	0.3451	1645.67	1	5360.0%	4	K.LKPNLGNGADLPNYR.W
	TK251102_lung_cytoE16_2_step08.4425.4425.3	1.7405	0.0308	1829.04	1	3120.0%	1	K.GKLKPNLGNGADLPNYR.W
	TK251102_lung_cytoE16_2_step02.2229.2229.1	1.5123	0.1547	924.51	2	7140.0%	1	K.VVTVHLEK.I
	TK251102_lung_cytoE16_2_step08.1878.1878.2	1.0132	0.02	1452.06	10	3330.0%	1	R.QKSMGLPTSDEQK.K
UQ9D96799.6%1110.4%164185826.8(Q9D967) 1810034K20Rik protein (Magnesium-dependent phosphatase-1)
*	TK251102_lung_cytoE16_2_step06.3650.3650.2	3.1461	0.5304	1969.07	1	5000.0%	1	R.RGQNIQLYPEVPEVLGR.L
UIDHC_MOUSE99.6%81418.8%414466606.9(O88844) Isocitrate dehydrogenase [NADP] cytoplasmic (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP)
*	TK251102_lung_cytoE16_2_step02.1371.1371.3	1.0891	0.0226	2019.23	172	1810.0%	1	R.ATDFVVPGPGKVEITYTPK.D
*	TK251102_lung_cytoE16_2_step06.1746.1746.1	1.2008	0.155	807.62	7	5830.0%	1	K.KYNVGVK.C
*	TK251102_lung_cytoE16_2_step09.4011.4011.2	1.5944	0.1413	1453.78	8	3750.0%	3	R.LVTGWVKPIIIGR.H
	TK251102_lung_cytoE16_2_step09.1783.1783.1	1.0375	0.0386	638.63	2	6250.0%	1	K.KYDGR.F
	TK251102_lung_cytoE16_2_step01.0808.0808.3	1.0775	0.0075	2373.02	26	1500.0%	1	R.LIDDMVAQAMKSEGGFIWACK.N
	TK251102_lung_cytoE16_2_step01.1443.1443.1	0.8677	0.1977	1342.66	1	4580.0%	1	K.TVEAEAAHGTVTR.H
UQ99J3599.6%5917.1%375410266.5(Q99J35) Hypothetical 41.0 kDa protein
*	TK251102_lung_cytoE16_2_step05.2375.2375.2	1.7371	0.2352	1976.08	1	3120.0%	2	R.EVSTDVCGFCHKPVSPR.E
*	TK251102_lung_cytoE16_2_step12.2388.2388.3	3.4448	0.3876	3281.09	1	2420.0%	1	K.GSSVHPPPGHAIPSEEELPPPPEEPVTLPER.E
	TK251102_lung_cytoE16_2_step08.3503.3503.2	2.6457	0.4626	1901.94	1	5000.0%	2	R.KFAPVCSICENPIIPR.D
UCATA_MOUSE99.6%81215.8%526596347.9(P24270) Catalase (EC 1.11.1.6)
*	TK251102_lung_cytoE16_2_step09.2263.2263.2	2.6064	0.487	1702.09	1	5330.0%	2	K.NAIHTYTQAGSHMAAK.G
	TK251102_lung_cytoE16_2_step04.1139.1139.2	0.6716	0.062	1312.82	34	2000.0%	1	K.RLCENIAGHLK.D
	TK251102_lung_cytoE16_2_step06.1469.1469.1	1.0352	0.0614	837.51	6	5830.0%	1	R.NPQTHLK.D
*	TK251102_lung_cytoE16_2_step11.0672.0672.2	0.8379	0.0763	3168.68	13	1300.0%	1	R.DGPMCMHDNQGGAPNYYPNSFSAPEQQR.S
*	TK251102_lung_cytoE16_2_step02.2450.2450.3	0.9968	0.0056	1690.67	23	1790.0%	2	K.AVKNFTDVHPDYGAR.I
*	TK251102_lung_cytoE16_2_step06.4308.4308.3	0.8354	0.0626	3902.65	37	830.0%	1	R.VANYQRDGPMCMHDNQGGAPNYYPNSFSAPEQQR.S
USPH2_MOUSE99.5%336.5%617656186.6(Q9JIA7) Sphingosine kinase 2 (EC 2.7.1.-) (SK 2) (SPK 2)
*	TK251102_lung_cytoE16_2_step12.2527.2527.2	3.1632	0.4435	2037.89	1	5790.0%	1	K.SELVLAPAPAPAATHSPLHR.S
	TK251102_lung_cytoE16_2_step10.2122.2122.1	1.0656	0.0334	626.53	44	5000.0%	1	R.QNHAR.E
	TK251102_lung_cytoE16_2_step08.3777.3777.2	1.4245	0.1157	1758.7	1	3570.0%	1	R.AEAQRWATALTCLLR.G
UQ9CPN899.5%688.3%579635758.9(Q9CPN8) 10 days embryo cDNA, RIKEN full-length enriched library, clone:2610036B18, full insert sequence (Igf2 mRNA-binding protein 3)
	TK251102_lung_cytoE16_2_step08.2447.2447.2	2.2008	0.2937	1141.08	1	7780.0%	1	K.ILAHNNFVGR.L
*	TK251102_lung_cytoE16_2_step10.2649.2649.2	3.2018	0.3858	1849.55	1	5670.0%	1	K.MELHGKPMEVEHSVPK.R
	TK251102_lung_cytoE16_2_step02.2879.2879.2	1.2333	0.031	1430.04	1	5420.0%	1	R.MVIITGPPEAQFK.A
	TK251102_lung_cytoE16_2_step01.1419.1419.1	1.388	0.1206	1073.07	44	5000.0%	1	K.IQEILTQVK.Q
UQ91VJ399.5%81220.2%361401496.2(Q91VJ3) Similar to Adenosin kinase
*	TK251102_lung_cytoE16_2_step05.4675.4675.3	1.9601	0.1539	2931.26	39	1670.0%	1	K.VEAPQALSENVLFGMGNPLLDISAVVDK.D
	TK251102_lung_cytoE16_2_step08.2458.2458.2	1.6357	0.0691	1592.31	1	5000.0%	1	R.RTGCTFPEKPDFH.-
*	TK251102_lung_cytoE16_2_step02.3070.3070.2	2.5078	0.3975	1350.6	1	6500.0%	2	K.VAQWLIQEPHK.A
*	TK251102_lung_cytoE16_2_step05.1576.1576.1	1.211	0.0806	756.53	12	6670.0%	1	K.KAQALPK.V
*	TK251102_lung_cytoE16_2_step09.4549.4549.3	1.2668	0.031	2838.14	34	1770.0%	1	K.VEYHAGGSTQNSMKVAQWLIQEPHK.A
UTPM1_MOUSE99.5%81012.3%284326814.7(P58771) Tropomyosin 1 alpha chain (Alpha-tropomyosin)
	TK251102_lung_cytoE16_2_step04.1433.1433.1	1.2014	0.0143	711.54	14	6000.0%	1	K.YSEALK.D
	TK251102_lung_cytoE16_2_step01.1376.1376.1	1.5816	0.2244	894.58	1	7500.0%	1	R.KYEEVAR.K
	TK251102_lung_cytoE16_2_step01.3491.3491.1	1.1123	0.0519	1232.36	13	4500.0%	1	R.AQERLATALQK.L
	TK251102_lung_cytoE16_2_step03.2998.2998.2	3.2202	0.4178	1400.35	1	8500.0%	2	R.RIQLVEEELDR.A
	TK251102_lung_cytoE16_2_step01.2423.2423.1	1.9852	0.2764	1244.24	1	7780.0%	1	R.IQLVEEELDR.A
USTB2_MOUSE99.5%5512.3%593663586.7(Q64324) Syntaxin binding protein 2 (UNC-18 homolog 2) (UNC-18B) (MUSEC1)
*	TK251102_lung_cytoE16_2_step12.2624.2624.3	1.3729	0.0156	2312.73	12	1670.0%	1	R.KLWPFVSDPAPVPSSQAAVSAR.F
	TK251102_lung_cytoE16_2_step12.1743.1743.1	1.4263	0.138	811.53	1	7000.0%	1	R.FGHWHK.N
	TK251102_lung_cytoE16_2_step11.5282.5282.2	0.9233	0.3285	2440.01	3	1820.0%	1	K.GSVEKLCSVEQDLAMGSDAEGEK.I
	TK251102_lung_cytoE16_2_step06.2993.2993.2	3.06	0.5082	1649.75	1	6000.0%	1	R.KGPEDTAQLAHAVLAK.L
*	TK251102_lung_cytoE16_2_step01.0623.0623.1	1.1004	0.0334	629.43	7	7000.0%	1	R.LAKAVK.T
UO8870199.5%5712.5%375426794.7(O88701) Nucleosome assembly protein 1-like protein 4
	TK251102_lung_cytoE16_2_step04.3485.3485.1	2.4236	0.3644	1459.12	1	6360.0%	2	R.KYAALYQPLFDK.R
	TK251102_lung_cytoE16_2_step02.1781.1781.1	1.4458	0.0289	754.49	3	8000.0%	1	K.HLQDIK.V
*	TK251102_lung_cytoE16_2_step05.4193.4193.3	1.0041	0.0909	3408.63	11	1340.0%	1	K.FSDPGQPMSFVLEFHFEPNDYFTNPVLTK.T
UK6PF_MOUSE99.5%446.8%779851378.0(P47857) 6-phosphofructokinase, muscle type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme A) (PFK-A)
	TK251102_lung_cytoE16_2_step04.5305.5305.2	0.9096	0.0914	1972.55	46	2350.0%	1	R.KNVLGHMQQGGSPTPFDR.N
	TK251102_lung_cytoE16_2_step11.3749.3749.3	2.1623	0.0963	2614.0	4	2280.0%	1	R.EATWESVSMMLQLGGTVIGSARCK.D
	TK251102_lung_cytoE16_2_step05.2919.2919.2	3.0515	0.4994	1841.7	1	5620.0%	1	K.NVLGHMQQGGSPTPFDR.N
	TK251102_lung_cytoE16_2_step12.1980.1980.2	2.0959	0.408	1217.34	1	5500.0%	1	K.LLAHVRPPVSK.G
UQ8VDP499.5%8107.9%9991124725.8(Q8VDP4) Hypothetical 112.5 kDa protein (Fragment)
	TK251102_lung_cytoE16_2_step10.3843.3843.2	2.489	0.5003	1805.63	1	4330.0%	1	K.QGILGAQPQLIFQPHR.I
*	TK251102_lung_cytoE16_2_step12.3153.3153.1	2.5034	0.3871	1500.81	1	5000.0%	2	K.SPAPPLLHVAALGQK.Q
	TK251102_lung_cytoE16_2_step02.2291.2291.1	1.4304	0.0084	952.35	5	5710.0%	1	R.ETPEHPLK.Q
	TK251102_lung_cytoE16_2_step05.2564.2564.1	1.3337	0.13	853.55	5	6670.0%	1	K.IHTLELK.L
*	TK251102_lung_cytoE16_2_step08.5402.5402.3	1.1978	0.0299	1610.31	1	1610.0%	1	R.VLLTLGIRLSAEQAK.Q
	TK251102_lung_cytoE16_2_step02.4021.4021.2	2.7204	0.3881	1877.58	1	5290.0%	1	K.GLVPHNGSLINVGSLLQR.A
UO7056599.5%61813.2%295329364.8(O70565) Cp27 protein
	TK251102_lung_cytoE16_2_step10.2726.2726.1	1.0131	0.0512	840.62	35	2860.0%	1	R.KAQGIPAR.K
	TK251102_lung_cytoE16_2_step03.2655.2655.2	2.4951	0.4415	2065.81	1	3750.0%	4	R.EKPQALVTSPATPLPAGSGIK.R
	TK251102_lung_cytoE16_2_step08.2523.2523.1	0.8272	0.0794	950.51	75	2780.0%	1	R.ASGMSSLLGK.I
UTPM3_MOUSE99.5%223.9%284328634.7(P21107) Tropomyosin alpha 3 chain (Tropomyosin 3) (Tropomyosin gamma)
	TK251102_lung_cytoE16_2_step05.3181.3181.2	2.8023	0.243	1288.22	1	8000.0%	1	R.KLVIIEGDLER.T
UGFA1_MOUSE99.5%8109.7%680765926.8(P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1)
	TK251102_lung_cytoE16_2_step05.3019.3019.1	0.962	0.0756	854.7	3	6670.0%	1	K.RLPDLIK.E
*	TK251102_lung_cytoE16_2_step11.1525.1525.2	3.2217	0.3197	1827.42	1	6000.0%	1	R.WATHGEPNPVNSHPQR.S
	TK251102_lung_cytoE16_2_step04.2097.2097.2	1.6793	0.2731	1988.02	4	3440.0%	1	R.QGRPVVICDKEDTETIK.N
	TK251102_lung_cytoE16_2_step08.1325.1325.1	0.7741	0.0	615.34	4	5000.0%	1	K.IQLIK.K
	TK251102_lung_cytoE16_2_step06.2705.2705.1	1.2819	0.167	949.81	1	5620.0%	1	K.HGPLALVDK.L
	TK251102_lung_cytoE16_2_step09.2537.2537.1	1.3131	0.0175	1257.83	223	3640.0%	2	K.SVHFPGQAVGTR.R
UO9575299.4%687.4%12881471826.8(O95752) Chromosome-associated polypeptide-C
*	TK251102_lung_cytoE16_2_step02.1123.1123.2	0.7864	0.0028	1672.85	7	2310.0%	1	R.LHNTIVEINNHKLK.A
*	TK251102_lung_cytoE16_2_step07.3707.3707.3	1.4994	0.1615	2900.43	5	2100.0%	1	K.ISLHPIEDNPIEEISVLSPEDLEAIK.N
*	TK251102_lung_cytoE16_2_step10.3535.3535.2	1.6461	0.0735	2409.6	24	2110.0%	1	K.FTASIQRLIEQEEYLNVQVK.E
*	TK251102_lung_cytoE16_2_step07.3631.3631.2	2.6436	0.4993	1459.38	1	7270.0%	2	R.LMITHIVNQNFK.S
*	TK251102_lung_cytoE16_2_step09.3827.3827.3	1.5241	0.1417	2437.09	8	2050.0%	1	R.WRVVTLQGQIIEQSGTMTGGGSK.V
UQ96F8699.4%228.5%508560787.1(Q96F86) Hypothetical protein
*	TK251102_lung_cytoE16_2_step01.4435.4435.2	0.8962	0.0058	3187.14	42	1350.0%	1	R.IYLCDIGIPQQVFQEVGINYHSPFGCK.F
*	TK251102_lung_cytoE16_2_step05.3368.3368.2	2.7298	0.5073	2033.27	1	6000.0%	1	R.YRHDENILESEPIVYR.R
UST13_MOUSE99.4%5136.5%371416565.3(Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13)
	TK251102_lung_cytoE16_2_step06.3969.3969.2	2.7186	0.5316	1937.8	1	5000.0%	3	R.LLGHWEEAAHDLALACK.L
*	TK251102_lung_cytoE16_2_step06.1272.1272.1	1.0665	0.0923	749.91	8	5000.0%	2	K.VPPATHK.A
UQ9DC5699.4%4423.9%418473175.8(Q9DC56) 1200003A09Rik protein
	TK251102_lung_cytoE16_2_step09.5244.5244.2	1.0805	0.2252	1217.46	4	3330.0%	1	K.EFSIDVGYER.F
*	TK251102_lung_cytoE16_2_step12.5517.5517.2	1.1335	0.1491	3019.25	16	1550.0%	1	R.TLTGTVIDSGDGVTPVIPVAEGYVIGSCIK.H
	TK251102_lung_cytoE16_2_step05.4529.4529.2	2.3917	0.5042	2682.59	1	3410.0%	1	R.YAVWFGGSMLASTPEFYQVCHTK.K
	TK251102_lung_cytoE16_2_step01.0780.0780.3	1.4169	0.0174	4318.23	10	1110.0%	1	R.FLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVR.R
UQ9D0Q899.4%51115.5%168193278.8(Q9D0Q8) 2600005K24Rik protein
	TK251102_lung_cytoE16_2_step06.3484.3484.2	2.2791	0.2436	1693.31	1	6540.0%	1	K.RLNQVIFPVSYNDK.F
	TK251102_lung_cytoE16_2_step08.2271.2271.1	1.329	0.2192	1379.27	1	4550.0%	3	K.RIEPADAHVLQK.N
UTPMT_MOUSE99.4%115.8%240275866.4(O55060) Thiopurine S-methyltransferase (EC 2.1.1.67) (Thiopurine methyltransferase)
*	TK251102_lung_cytoE16_2_step12.2179.2179.2	2.5447	0.5174	1701.41	1	5770.0%	1	R.HISFHQEQGHQLLK.K
UMCM4_MOUSE99.4%192915.3%862967367.2(P49717) DNA replication licensing factor MCM4 (CDC21 homolog) (P1-CDC21)
	TK251102_lung_cytoE16_2_step12.1311.1311.3	1.5344	0.0026	1407.06	81	3750.0%	1	K.ELSRKPDIYER.L
	TK251102_lung_cytoE16_2_step09.2685.2685.1	2.0777	0.2431	1155.6	1	6250.0%	3	K.THIDVIHYR.K
	TK251102_lung_cytoE16_2_step09.2369.2369.2	0.9266	0.0224	1281.93	25	4440.0%	1	K.THIDVIHYRK.T
*	TK251102_lung_cytoE16_2_step04.1484.1484.2	2.1288	0.2713	1000.83	2	7500.0%	1	R.QRPDLGSAR.K
	TK251102_lung_cytoE16_2_step03.1654.1654.1	1.063	0.022	920.59	16	5000.0%	1	R.KPDIYER.L
*	TK251102_lung_cytoE16_2_step03.3557.3557.3	2.2038	0.2399	3395.63	3	1850.0%	1	R.TSQLIPEMQEAFFQCQVCAHTTRVEIDR.G
	TK251102_lung_cytoE16_2_step02.3613.3613.2	0.8429	0.0931	2145.2	231	1670.0%	1	R.NLNPEDIDQLITISGMVIR.T
	TK251102_lung_cytoE16_2_step02.3461.3461.2	1.1808	0.1716	1816.19	2	3330.0%	1	R.SVLHEVMEQQTLSIAK.A
	TK251102_lung_cytoE16_2_step11.3412.3412.2	2.7687	0.3171	1864.81	1	4330.0%	1	K.KTTIENIQLPHTLLSR.F
	TK251102_lung_cytoE16_2_step07.2372.2372.1	1.2969	0.0088	701.92	2	7000.0%	2	R.KLILSK.G
	TK251102_lung_cytoE16_2_step07.2100.2100.2	2.9191	0.3518	1425.63	1	8180.0%	1	K.RLHGLDEEAEQK.L
	TK251102_lung_cytoE16_2_step01.0676.0676.1	1.2569	0.036	530.29	4	6250.0%	1	K.TPALK.Y
UGTT1_MOUSE99.4%114.6%239272457.3(Q64471) Glutathione S-transferase theta 1 (EC 2.5.1.18) (GST class-theta)
*	TK251102_lung_cytoE16_2_step07.2482.2482.1	1.8424	0.4098	1230.47	1	6000.0%	1	R.KGEHLSDAFAR.V
U143E_HUMAN99.4%134512.9%255291744.7(P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E)
	TK251102_lung_cytoE16_2_step09.1379.1379.1	0.6084	0.1809	416.63	1	7500.0%	1	K.MIR.E
	TK251102_lung_cytoE16_2_step01.1098.1098.1	1.0229	0.0191	629.51	2	8000.0%	1	K.NVIGAR.R
	TK251102_lung_cytoE16_2_step01.1983.1983.1	0.986	0.1097	719.34	57	6250.0%	1	K.VFYYK.M
	TK251102_lung_cytoE16_2_step09.1520.1520.1	1.1796	0.0963	906.61	1	5830.0%	1	K.MKGDYHR.Y
	TK251102_lung_cytoE16_2_step04.2003.2003.1	2.197	0.3979	1239.6	1	5910.0%	5	K.HLIPAANTGESK.V
UQ9EQC899.4%229.0%491523024.9(Q9EQC8) Papillary renal cell carcinoma-associated protein
*	TK251102_lung_cytoE16_2_step07.3095.3095.2	2.7907	0.5315	2239.63	1	4550.0%	1	K.TKPASLAPVLGTTTTTPSPSAIK.A
*	TK251102_lung_cytoE16_2_step02.2934.2934.3	1.5456	4.0E-4	2081.77	33	2250.0%	1	K.KVVLQGSGEGTGLSALLPQPK.N
UXPO4_MOUSE99.4%559.2%11511299655.1(Q9ESJ0) Exportin 4 (Exp4)
*	TK251102_lung_cytoE16_2_step03.2259.2259.2	2.4611	0.5159	1860.1	1	4690.0%	1	R.HQQQFLASPGSSTIDNK.M
	TK251102_lung_cytoE16_2_step05.4727.4727.2	1.3613	0.0365	1918.2	4	3120.0%	1	R.SPPLNFLSSPVQRTLMK.A
*	TK251102_lung_cytoE16_2_step11.4754.4754.3	1.5262	0.0193	3122.09	4	1900.0%	1	K.QICYLGESKAMHLYEACLTLLQVYSK.N
	TK251102_lung_cytoE16_2_step11.4725.4725.2	1.0334	0.296	2805.46	5	1670.0%	1	R.HILETSKVDYVLFQAATAIMEAVVR.E
	TK251102_lung_cytoE16_2_step07.4778.4778.2	1.7325	0.0602	2437.51	7	2500.0%	1	R.SAALEEVLDKDDMVYMEAYDK.L
UTHIO_MOUSE99.4%133347.1%104115444.9(P10639) Thioredoxin (ATL-derived factor) (ADF)
	TK251102_lung_cytoE16_2_step05.4019.4019.2	1.8556	0.2149	1742.68	1	5360.0%	4	K.LVVVDFSATWCGPCK.M
*	TK251102_lung_cytoE16_2_step06.5194.5194.2	0.7345	0.0253	3043.87	93	1300.0%	1	K.EAFQEALAAAGDKLVVVDFSATWCGPCK.M
*	TK251102_lung_cytoE16_2_step01.2532.2532.1	1.1205	0.0050	1323.78	8	3750.0%	3	K.EAFQEALAAAGDK.L
*	TK251102_lung_cytoE16_2_step10.3530.3530.3	1.4451	0.062	3242.64	8	1630.0%	1	K.LVVVDFSATWCGPCKMIKPFFHSLCDK.Y
	TK251102_lung_cytoE16_2_step01.1266.1266.1	2.3572	0.3252	910.4	1	6880.0%	2	K.VGEFSGANK.E
*	TK251102_lung_cytoE16_2_step12.3268.3268.1	2.2924	0.3561	1525.92	1	4550.0%	1	K.MIKPFFHSLCDK.Y
UQ9CQR699.4%4103.3%305351595.7(Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit)
	TK251102_lung_cytoE16_2_step10.2091.2091.1	1.7541	0.2316	1184.56	1	5000.0%	3	R.AHQLVHEGYK.F
UKC22_MOUSE99.4%3312.9%350412158.5(O54833) Casein kinase II, alpha' chain (CK II) (EC 2.7.1.37)
	TK251102_lung_cytoE16_2_step06.4498.4498.2	0.7649	0.0187	2180.82	48	1470.0%	1	K.YHIDLDPHFNDILGQHSR.K
	TK251102_lung_cytoE16_2_step09.2147.2147.2	1.4383	0.0281	1373.05	65	4170.0%	1	R.GGTNIIKLIDTVK.D
	TK251102_lung_cytoE16_2_step10.2098.2098.2	2.5774	0.5252	1689.83	1	6150.0%	1	R.DVKPHNVMIDHQQK.K
UQ922S199.4%7911.2%508576458.0(Q922S1) Similar to phenylalanine-tRNA synthetase-like
	TK251102_lung_cytoE16_2_step03.2823.2823.1	1.2142	0.0456	1057.58	151	3750.0%	2	R.KLLTEVILK.T
	TK251102_lung_cytoE16_2_step10.3907.3907.2	2.5793	0.5176	2734.56	1	3180.0%	1	R.FKPAYNPYTEPSMEVFSYHQGLK.K
	TK251102_lung_cytoE16_2_step04.1667.1667.1	1.0843	0.0399	1016.49	16	3890.0%	1	R.VDKSAADGPR.V
	TK251102_lung_cytoE16_2_step11.2954.2954.2	1.9593	0.393	1484.11	1	5000.0%	1	R.GVLPDSGHLHPLLK.V
	TK251102_lung_cytoE16_2_step06.4390.4390.3	1.0626	0.0465	2861.54	184	1200.0%	1	R.FKPAYNPYTEPSMEVFSYHQGLKK.W
UQ9JKR699.4%10248.9%9991111815.2(Q9JKR6) 170 kDa glucose regulated protein GRP170 precursor
*	TK251102_lung_cytoE16_2_step08.3058.3058.2	2.1917	0.3185	1722.98	1	5000.0%	1	R.SRFPEHELIVDPQR.Q
*	TK251102_lung_cytoE16_2_step07.4903.4903.3	2.8053	0.3352	4760.96	1	1610.0%	1	R.VEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGATR.V
	TK251102_lung_cytoE16_2_step12.1604.1604.1	1.056	0.0206	803.67	5	5830.0%	1	R.AMAKLLR.E
	TK251102_lung_cytoE16_2_step06.3768.3768.2	1.8304	0.3425	1708.63	1	4000.0%	4	K.VAIVKPGVPMEIVLNK.E
*	TK251102_lung_cytoE16_2_step04.2184.2184.1	1.2956	0.2287	986.66	3	5000.0%	2	R.KTPVTVTLK.E
*	TK251102_lung_cytoE16_2_step11.3604.3604.3	1.7998	0.0259	3136.81	80	1380.0%	1	R.VPGPVQQALQSAEMSLDQIEQVILVGGATR.V
UQ9DBQ499.4%6614.0%720815267.5(Q9DBQ4) 1200016L19Rik protein
	TK251102_lung_cytoE16_2_step03.0086.0086.2	0.7764	0.0088	3162.05	11	1430.0%	1	R.VGVTVAQTTMEPHLLEACVRDVLNDAAPR.A
	TK251102_lung_cytoE16_2_step06.2197.2197.2	1.2423	0.1678	1738.15	1	3570.0%	1	K.GFHQVPFASTVFIER.S
	TK251102_lung_cytoE16_2_step09.3819.3819.2	1.5367	0.215	1544.13	9	3750.0%	1	R.HTGYVIELQNIVR.G
	TK251102_lung_cytoE16_2_step02.2175.2175.1	0.9525	0.1628	1118.74	2	3750.0%	1	K.FHKPGENYK.T
	TK251102_lung_cytoE16_2_step03.4745.4745.2	2.6506	0.5271	2634.63	1	3260.0%	1	R.AMAVLEPLQVVITNFPAPKPLDIR.V
	TK251102_lung_cytoE16_2_step03.2111.2111.2	0.9941	0.1018	1238.43	17	4500.0%	1	K.QHLEITGGQVR.T
UODPA_MOUSE99.4%337.2%390432328.2(P35486) Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursor (EC 1.2.4.1) (PDHE1-A type I)
	TK251102_lung_cytoE16_2_step10.2162.2162.2	2.8471	0.5102	1595.27	1	8080.0%	1	R.YHGHSMSDPGVSYR.T
	TK251102_lung_cytoE16_2_step01.1198.1198.1	0.9045	0.0194	482.52	2	8330.0%	1	K.YNGK.D
	TK251102_lung_cytoE16_2_step03.5134.5134.1	0.2467	0.0034	1131.13	4	560.0%	1	K.FAAAYCRSGK.G
UHBB0_MOUSE99.4%61028.1%146162818.6(P04443) Hemoglobin beta-H0 chain
	TK251102_lung_cytoE16_2_step02.2417.2417.1	2.0724	0.4039	1100.59	1	5620.0%	2	K.LHVDPENFK.L
*	TK251102_lung_cytoE16_2_step02.3301.3301.3	1.4104	0.0844	2834.18	6	1880.0%	1	K.LHVDPENFKLLGNMLVIVLSSYFGK.E
	TK251102_lung_cytoE16_2_step01.1142.1142.1	0.9061	0.094	788.46	16	4290.0%	1	K.VGGETLGR.L
	TK251102_lung_cytoE16_2_step03.1829.1829.1	1.3423	0.1618	960.53	1	6430.0%	2	-.VHFTAEEK.A
UQ9CVB699.4%6828.2%170199138.4(Q9CVB6) 2210023N03Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step02.4705.4705.2	0.9397	0.1199	2185.15	6	2370.0%	1	K.DTDAAVGDNIGYITFVLFPR.H
	TK251102_lung_cytoE16_2_step11.2312.2312.2	1.5022	0.1927	1453.77	1	5420.0%	1	R.ASHTAPQVLFSHR.E
	TK251102_lung_cytoE16_2_step07.2622.2622.1	1.9869	0.1731	1088.52	1	6430.0%	1	R.DYLHYHIK.C
	TK251102_lung_cytoE16_2_step01.1655.1655.1	0.8387	0.0135	827.71	28	5000.0%	1	R.EPPLELK.D
UVAA1_MOUSE99.4%669.7%617682685.9(P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1)
	TK251102_lung_cytoE16_2_step03.3099.3099.1	1.1442	0.1201	1308.75	1	4550.0%	1	R.VGHSELVGEIIR.L
*	TK251102_lung_cytoE16_2_step04.2067.2067.1	0.9632	0.0331	1119.91	10	4380.0%	1	R.EHMGEILYK.L
	TK251102_lung_cytoE16_2_step12.2591.2591.3	1.7179	0.0509	2413.92	11	2120.0%	1	R.DMGYHVSMMADSTSRWAEALR.E
	TK251102_lung_cytoE16_2_step11.1990.1990.2	2.3761	0.4815	1317.6	1	6360.0%	1	K.LPANHPLLTGQR.V
	TK251102_lung_cytoE16_2_step03.1791.1791.1	1.4578	0.0585	733.87	1	8000.0%	1	K.FKDPVK.D
UQ9DBF199.4%336.7%510555146.4(Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1)
*	TK251102_lung_cytoE16_2_step07.4176.4176.2	2.9165	0.5054	1512.06	1	7080.0%	1	K.KAWNIWADIPAPK.R
*	TK251102_lung_cytoE16_2_step04.2139.2139.1	1.2539	0.1256	806.72	12	5830.0%	1	R.KIGDAFR.E
	TK251102_lung_cytoE16_2_step09.0846.0846.1	0.5179	0.0081	1450.06	17	1540.0%	1	R.VNLLSFTGSTQVGK.E
UDJA1_MOUSE99.4%122624.4%397448687.1(P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2)
	TK251102_lung_cytoE16_2_step03.4363.4363.2	0.8855	0.1052	2722.74	1	2500.0%	1	K.ITFHGEGDQEPGLEPGDIIIVLDQK.D
	TK251102_lung_cytoE16_2_step06.1972.1972.1	1.1753	0.04	700.68	3	7000.0%	2	R.KLALQK.N
	TK251102_lung_cytoE16_2_step07.2012.2012.1	1.2201	0.1096	572.59	2	6250.0%	1	R.KLALK.Y
	TK251102_lung_cytoE16_2_step06.4161.4161.2	0.8651	0.1841	2686.37	11	1360.0%	1	R.HYNGEAYEDDEHHPRGGVQCQTS.-
	TK251102_lung_cytoE16_2_step04.2539.2539.1	1.5119	0.0094	1394.71	9	4170.0%	3	R.TIVITSHPGQIVK.H
	TK251102_lung_cytoE16_2_step12.2876.2876.2	2.3155	0.3449	2880.63	1	3330.0%	1	R.IHQIGPGMVQQIQSVCMECQGHGER.I
UQ920Q699.4%2214.5%346369398.5(Q920Q6) RNA-binding protein Musashi2-L
	TK251102_lung_cytoE16_2_step08.2011.2011.1	1.7038	0.4082	1359.51	1	5000.0%	1	K.VLGQPHHELDSK.T
*	TK251102_lung_cytoE16_2_step04.3869.3869.3	1.0109	0.0138	3924.6	17	880.0%	1	-.MEANGSPGTSGSANDSQHDPGKMFIGGLSWQTSPDSLR.D
UQ9Z1Y499.4%2210.6%480509347.3(Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6)
*	TK251102_lung_cytoE16_2_step08.2757.2757.2	2.5327	0.4987	1830.97	1	4330.0%	1	K.LVHDMSHPPSGEYFGR.C
	TK251102_lung_cytoE16_2_step07.3748.3748.3	0.8701	0.0243	4177.99	2	740.0%	1	R.SFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCK.A
UQ8R2X099.4%4414.0%443500256.4(Q8R2X0) Similar to EH-domain containing 2
	TK251102_lung_cytoE16_2_step11.1236.1236.1	0.6316	0.07	825.14	18	4170.0%	1	K.TWMVGTK.L
*	TK251102_lung_cytoE16_2_step04.2452.2452.2	1.8087	0.3111	1304.13	3	4550.0%	1	K.LEGHGLPTNLPR.R
	TK251102_lung_cytoE16_2_step06.2801.2801.2	2.5321	0.4984	2021.77	1	5000.0%	1	K.IQLEHHISPGDFPDCQK.M
*	TK251102_lung_cytoE16_2_step11.0522.0522.2	0.9434	0.0112	2816.67	17	1600.0%	1	K.LMPLLRQEELESVEAGVQGGAFEGTR.M
UQ9QZM199.4%225.8%582621225.0(Q9QZM1) PLIC-1
	TK251102_lung_cytoE16_2_step12.4219.4219.1	1.8913	0.4039	1443.25	1	3750.0%	1	K.SHIDQLVLIFAGK.I
	TK251102_lung_cytoE16_2_step10.3622.3622.2	1.1179	0.1627	2326.79	2	3000.0%	1	K.DQDTLSQHGIHDGLTVHLVIK.T
UQ9QZF499.4%3314.0%349401804.9(Q9QZF4) Cytoplasmic linker protein 50
	TK251102_lung_cytoE16_2_step06.3576.3576.2	2.861	0.5196	1670.76	1	6430.0%	1	K.SLHSVVQTLESDKVK.L
	TK251102_lung_cytoE16_2_step06.2406.2406.1	1.1505	0.1076	825.59	6	7000.0%	1	K.RESEFR.K
	TK251102_lung_cytoE16_2_step01.4914.4914.2	0.7959	0.0749	3122.8	12	1480.0%	1	K.MKVEMMSEAALNGNGEDLNSYDSDDQEK.Q
UAIP_MOUSE99.4%466.1%330376056.4(O08915) AH receptor-interacting protein (AIP)
	TK251102_lung_cytoE16_2_step06.3449.3449.1	2.074	0.3817	1141.54	1	6110.0%	2	K.HVVLYPLVAK.S
*	TK251102_lung_cytoE16_2_step04.2701.2701.1	1.6844	0.1623	1073.56	9	5000.0%	1	R.GKPMELIVGK.K
UQ9D8F999.4%2226.5%170195064.9(Q9D8F9) 2010003J03Rik protein
	TK251102_lung_cytoE16_2_step10.1859.1859.3	1.3631	0.0327	2642.36	20	1850.0%	1	R.TPGNNLHEVETAQGQRFLVSMPSK.Y
*	TK251102_lung_cytoE16_2_step10.3413.3413.2	2.818	0.5291	2410.34	1	4250.0%	1	K.HVVQEVLGEHMVPSDHQQIVK.V
UQ91YE499.4%465.5%564666476.4(Q91YE4) 67 kDa polymerase-associated factor PAF67
	TK251102_lung_cytoE16_2_step10.3357.3357.2	2.9472	0.5048	2143.16	1	5000.0%	2	K.FLSPVVPNYDNVHPNYHK.E
	TK251102_lung_cytoE16_2_step05.1721.1721.1	1.1153	0.3024	647.55	1	6250.0%	1	R.HSLYK.M
	TK251102_lung_cytoE16_2_step04.3247.3247.1	1.5179	0.0775	1098.78	7	5710.0%	1	K.NFIQYFHK.T
UZ313_MOUSE99.4%4414.9%228260417.8(Q9ET26) Zinc finger protein 313
	TK251102_lung_cytoE16_2_step08.1510.1510.1	1.6565	0.3965	976.44	1	6430.0%	1	K.KPVCGVCR.S
*	TK251102_lung_cytoE16_2_step02.2603.2603.2	1.1769	0.0571	1232.36	1	4440.0%	1	R.SANFMEHIQR.R
*	TK251102_lung_cytoE16_2_step05.3392.3392.2	1.2821	0.0797	1334.14	1	6110.0%	1	R.YTFPCPYCPK.K
*	TK251102_lung_cytoE16_2_step01.0268.0268.1	1.1044	0.0549	721.71	3	8000.0%	1	K.NFILSK.I
UQ9D0C499.4%5514.6%501567947.9(Q9D0C4) 2610027O18Rik protein (RIKEN cDNA 2610027O18 gene)
*	TK251102_lung_cytoE16_2_step11.2742.2742.2	2.8091	0.5295	2122.56	1	4740.0%	1	K.HLIGQVMVDKNPGITSAVNK.T
*	TK251102_lung_cytoE16_2_step04.2085.2085.1	1.2992	0.267	1138.64	1	4440.0%	1	R.RVALQRPGIK.R
*	TK251102_lung_cytoE16_2_step12.2172.2172.1	1.8255	0.2613	1130.28	1	6110.0%	1	R.VGHIAHLNLR.D
*	TK251102_lung_cytoE16_2_step11.3184.3184.2	1.6326	0.1433	2202.48	11	2650.0%	1	R.NFQMEVLCGEENMLTKVR.E
	TK251102_lung_cytoE16_2_step06.2890.2890.2	0.9688	0.065	1562.43	75	2860.0%	1	K.AVLPEGQDVTSGFSR.V
UQ9CRF999.4%117.7%169190238.6(Q9CRF9) 2410081F06Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step04.3009.3009.2	2.8593	0.5077	1546.64	1	5830.0%	1	K.AALLNQHYQVNFK.G
UNPM_MOUSE99.4%82014.0%292325604.8(Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38)
	TK251102_lung_cytoE16_2_step03.1782.1782.1	2.0964	0.4056	1025.51	1	6430.0%	4	K.ADKDYHFK.V
	TK251102_lung_cytoE16_2_step01.1736.1736.1	1.3247	0.1799	1569.18	2	3750.0%	1	K.VDNDENEHQLSLR.T
	TK251102_lung_cytoE16_2_step09.1281.1281.2	0.7096	0.0257	862.52	97	2140.0%	1	K.LLGMSGKR.S
	TK251102_lung_cytoE16_2_step01.0420.0420.1	0.5191	0.0035	530.04	10	5000.0%	1	R.DTPAK.N
	TK251102_lung_cytoE16_2_step01.0266.0266.1	0.8873	0.049	745.72	2	6670.0%	1	K.VTLATLK.M
UQ9D1G199.4%3523.9%201221875.7(Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene)
	TK251102_lung_cytoE16_2_step06.1828.1828.2	2.9092	0.5315	1442.4	1	6070.0%	2	R.MGPGAASGGERPNLK.I
*	TK251102_lung_cytoE16_2_step01.5250.5250.3	1.5126	0.0163	3563.66	15	1480.0%	1	K.EFADSLGVPFLETSAKNATNVEQAFMTMAAEIK.K
U143B_MOUSE99.4%226245.3%245279554.8(Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1)
	TK251102_lung_cytoE16_2_step01.2340.2340.1	1.4073	0.151	910.75	3	6430.0%	3	R.NLLSVAYK.N
	TK251102_lung_cytoE16_2_step01.1426.1426.1	2.5994	0.3155	1598.74	1	5000.0%	1	K.AVTEQGHELSNEER.N
	TK251102_lung_cytoE16_2_step01.4451.4451.1	1.4129	0.1149	1191.94	1	4440.0%	2	K.DSTLIMQLLR.D
	TK251102_lung_cytoE16_2_step10.1891.1891.1	1.8296	0.0242	1238.49	2	5560.0%	1	K.KEMQPTHPIR.L
	TK251102_lung_cytoE16_2_step04.1643.1643.2	1.2267	0.2015	1111.98	5	5620.0%	3	K.EMQPTHPIR.L
	TK251102_lung_cytoE16_2_step01.4674.4674.2	2.7148	0.498	2162.83	1	4170.0%	1	K.TAFDEAIAELDTLNEESYK.D
	TK251102_lung_cytoE16_2_step01.2088.2088.1	1.0241	0.0748	1018.33	1	5000.0%	1	R.YDDMAAAMK.A
	TK251102_lung_cytoE16_2_step01.0130.0130.1	1.1778	0.0618	615.65	2	8000.0%	1	K.NVVGAR.R
*	TK251102_lung_cytoE16_2_step08.3001.3001.3	1.1454	0.011	3462.33	4	1470.0%	1	K.IEAELQDICNDVLELLDKYLILNATQAESK.V
	TK251102_lung_cytoE16_2_step01.0346.0346.1	1.2163	0.1751	670.67	5	7500.0%	3	K.VFYLK.M
UQ9DC9999.4%467.4%272302798.2(Q9DC99) 0710007A14Rik protein
	TK251102_lung_cytoE16_2_step05.2119.2119.1	1.7769	0.3994	826.52	1	7140.0%	1	K.HAALSLSK.E
	TK251102_lung_cytoE16_2_step06.2782.2782.2	1.54	0.1441	1426.42	4	5000.0%	2	K.FAAQNLHQNLIR.K
UCYC_MOUSE99.4%61810.6%104114749.6(P00009) Cytochrome c, somatic
	TK251102_lung_cytoE16_2_step11.3136.3136.1	1.7275	0.278	1170.81	2	5000.0%	3	K.TGPNLHGLFGR.K
URS4_HUMAN99.4%194117.9%2622946710.2(P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10)
	TK251102_lung_cytoE16_2_step03.2742.2742.1	1.4651	0.2756	831.44	2	6000.0%	1	K.HWMLDK.L
	TK251102_lung_cytoE16_2_step11.2008.2008.1	1.6724	0.3016	1509.96	1	4170.0%	2	R.ERHPGSFDVVHVK.D
	TK251102_lung_cytoE16_2_step11.1948.1948.1	1.9066	0.2862	1217.73	1	6000.0%	2	K.GIPHLVTHDAR.T
	TK251102_lung_cytoE16_2_step01.0816.0816.1	0.6571	0.0742	663.28	102	4000.0%	1	K.IFVGTK.G
	TK251102_lung_cytoE16_2_step09.3347.3347.1	1.2598	0.0352	1169.6	1	5560.0%	4	K.GNKPWISLPR.G
	TK251102_lung_cytoE16_2_step07.2235.2235.1	1.2529	0.2453	792.61	2	5000.0%	2	R.KIFVGTK.G
	TK251102_lung_cytoE16_2_step11.2126.2126.1	1.7254	0.4172	1224.58	1	4500.0%	2	R.HPGSFDVVHVK.D
UQ9CY9199.4%667.8%601657005.1(Q9CY91) G1 to phase transition 2
	TK251102_lung_cytoE16_2_step01.0887.0887.1	0.7343	0.0683	683.05	6	5000.0%	1	R.LPIVDK.Y
	TK251102_lung_cytoE16_2_step10.3290.3290.2	2.6941	0.4071	1889.66	1	5310.0%	1	K.KDIHFMPCSGLTGANIK.E
	TK251102_lung_cytoE16_2_step09.2372.2372.1	0.9711	0.0283	633.83	100	5000.0%	1	K.VGFSPK.K
	TK251102_lung_cytoE16_2_step11.2694.2694.1	2.3284	0.1935	1238.8	2	6000.0%	1	K.HFTILDAPGHK.S
	TK251102_lung_cytoE16_2_step02.1803.1803.1	1.5762	0.1145	801.5	10	6670.0%	1	R.EHAMLAK.T
UQ9D1M299.4%41018.2%143161995.3(Q9D1M2) 1110003E08Rik protein
	TK251102_lung_cytoE16_2_step07.2767.2767.2	1.4423	0.2878	1655.94	1	4620.0%	1	K.KNIPEGSHQYELLK.H
	TK251102_lung_cytoE16_2_step02.2006.2006.1	1.5683	0.2549	1228.2	1	5000.0%	3	K.HAEATLGSGNLR.M
UQ9CWW199.4%114.5%379421588.6(Q9CWW1) 2410003B16Rik protein
	TK251102_lung_cytoE16_2_step06.2760.2760.2	2.954	0.5106	2098.25	1	5000.0%	1	R.LDVYTQWHQQPQTTKPK.K
UQ9CSM499.4%114322.4%851021110.6(Q9CSM4) 60S ribosomal protein L27 (Fragment)
	TK251102_lung_cytoE16_2_step05.2711.2711.2	2.5549	0.4657	1410.81	1	6500.0%	3	K.VYNYNHLMPTR.Y
	TK251102_lung_cytoE16_2_step05.1571.1571.1	1.5526	0.1897	807.59	1	5710.0%	3	-.KVTAAMGK.K
UPSD3_MOUSE99.4%71110.8%530606998.2(P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen)
	TK251102_lung_cytoE16_2_step06.1457.1457.1	1.4013	0.0345	874.54	1	6670.0%	1	R.FVLRALR.M
*	TK251102_lung_cytoE16_2_step02.2787.2787.2	1.5241	0.2419	1424.95	16	4170.0%	2	K.AVHGFFTSNNATR.D
	TK251102_lung_cytoE16_2_step07.1992.1992.1	1.4307	0.151	1056.66	6	5000.0%	1	K.APQHTAVGFK.Q
*	TK251102_lung_cytoE16_2_step02.5210.5210.3	1.2095	0.1562	3021.58	12	1250.0%	1	K.AASAPLLPEVEAYLQLLMVIFLMNSKR.Y
UGSH1_MOUSE99.4%81018.9%636725985.8(P97494) Glutamate--cysteine ligase catalytic subunit (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS heavy chain)
	TK251102_lung_cytoE16_2_step09.3028.3028.2	1.5912	0.1752	2352.25	1	3100.0%	2	R.LGCPGFTLPEHRPNPEEGGASK.S
	TK251102_lung_cytoE16_2_step11.5050.5050.3	1.8235	0.2467	4549.33	4	1340.0%	1	K.EATSVLGEHQALCTITSFPRLGCPGFTLPEHRPNPEEGGASK.S
	TK251102_lung_cytoE16_2_step01.6163.6163.3	1.1293	0.1121	3831.43	145	860.0%	1	R.YLYDQLATICPIVMALSAASPFYRGYVSDIDCR.W
	TK251102_lung_cytoE16_2_step03.2335.2335.2	1.3059	0.0612	1038.92	7	5620.0%	1	R.GLEPLKNNR.F
	TK251102_lung_cytoE16_2_step01.4188.4188.3	1.3985	0.111	2904.51	5	1630.0%	1	K.IHLDDANESDHFENIQSTNWQTMR.F
	TK251102_lung_cytoE16_2_step04.2036.2036.1	1.2241	0.0261	1085.55	4	5000.0%	1	K.HPRFGTLTR.N
	TK251102_lung_cytoE16_2_step08.5562.5562.1	0.2301	0.0432	495.14	3	2500.0%	1	R.WMR.E
UCLP2_MOUSE99.4%4165.2%305331567.6(Q08093) Calponin H2, smooth muscle
	TK251102_lung_cytoE16_2_step05.4188.4188.2	2.6476	0.4979	1991.14	1	4670.0%	4	R.SMQNWHQLENLSNFIK.A
UHDA1_MOUSE99.4%4419.1%482550755.5(O09106) Histone deacetylase 1 (HD1)
	TK251102_lung_cytoE16_2_step09.2561.2561.3	1.2886	0.0386	2267.72	23	2380.0%	1	K.SFNLPMLMLGGGGYTIRNVAR.C
	TK251102_lung_cytoE16_2_step04.3421.3421.3	1.2492	0.0116	2203.35	17	2110.0%	1	K.LNKQQTDIAVNWAGGLHHAK.K
	TK251102_lung_cytoE16_2_step04.4264.4264.3	0.8863	0.0754	4351.38	96	710.0%	1	R.NVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFK.L
	TK251102_lung_cytoE16_2_step03.2622.2622.2	2.7266	0.4992	2234.53	1	5280.0%	1	K.LHISPSNMTNQNTNEYLEK.I
URL5_MOUSE99.4%123417.2%296342699.8(P47962) 60S ribosomal protein L5
	TK251102_lung_cytoE16_2_step01.1506.1506.1	1.3017	0.0307	1001.9	45	5000.0%	1	K.EFNAEVHR.K
	TK251102_lung_cytoE16_2_step03.1955.1955.1	1.3249	0.088	1188.64	1	4440.0%	2	K.RFPGYDSESK.E
	TK251102_lung_cytoE16_2_step07.1244.1244.1	0.8106	0.0274	638.72	4	5000.0%	5	K.AHAAIR.E
	TK251102_lung_cytoE16_2_step01.1991.1991.1	1.9144	0.4093	1339.92	1	4620.0%	1	K.GAVDGGLSIPHSTK.R
	TK251102_lung_cytoE16_2_step01.2075.2075.1	1.5968	0.1931	634.74	1	8000.0%	1	K.VFGALK.G
	TK251102_lung_cytoE16_2_step05.2121.2121.1	1.0789	0.0034	871.62	222	4170.0%	1	K.RLVIQDK.N
UQ8VBV799.4%3327.3%209232565.2(Q8VBV7) Hypothetical 23.3 kDa protein (Similar to COP9 homolog) (Expressed sequence AA408242)
*	TK251102_lung_cytoE16_2_step04.2243.2243.2	2.483	0.4487	1358.53	1	7080.0%	1	R.KPASGTLDVSLNR.F
*	TK251102_lung_cytoE16_2_step02.5583.5583.3	1.0597	0.0871	4676.02	3	1280.0%	1	R.AFALVSQAYTSIIADDFAAFVGLPVEEAVKGVLEQGWQADSTTR.M
UO8847799.4%221.7%577634519.2(O88477) Coding region determinant binding protein (Coding region determinant-binding protein)
	TK251102_lung_cytoE16_2_step08.2403.2403.1	2.0234	0.4079	1208.7	1	6110.0%	1	K.RLEIEHSVPK.K
URL17_MOUSE99.4%93121.7%1842142310.2(Q9CPR4) 60S ribosomal protein L17 (L23)
	TK251102_lung_cytoE16_2_step03.4090.4090.1	2.3128	0.3964	1190.28	1	6110.0%	2	K.SAEFLLHMLK.N
	TK251102_lung_cytoE16_2_step02.3755.3755.2	1.5061	0.282	1782.25	1	4000.0%	5	K.GLDVDSLVIEHIQVNK.A
	TK251102_lung_cytoE16_2_step01.1787.1787.2	1.3647	0.1272	1626.51	3	4230.0%	1	K.EQIVPKPEEEVAQK.K
UQ8VEE999.4%91315.3%504559565.2(Q8VEE9) Similar to proteasome (Prosome, macropain) 26S subunit, non-ATPase, 5
*	TK251102_lung_cytoE16_2_step04.2408.2408.3	1.2401	0.0244	2385.48	3	2500.0%	1	R.EQAAELRLRPLFSLLNQNNR.E
*	TK251102_lung_cytoE16_2_step05.3360.3360.2	2.9208	0.4713	1360.8	1	6820.0%	2	R.LLQAVEPIHLAR.N
*	TK251102_lung_cytoE16_2_step03.3417.3417.2	2.4398	0.5073	1661.16	1	5000.0%	2	R.ALQSVVQAVPLHELR.E
*	TK251102_lung_cytoE16_2_step12.3899.3899.2	2.8781	0.4882	1585.92	1	7080.0%	1	R.LRPLFSLLNQNNR.E
*	TK251102_lung_cytoE16_2_step08.4129.4129.2	1.3684	0.024	2485.2	11	2250.0%	1	R.LMFNSPGFVEFVMDRSVEHDK.A
	TK251102_lung_cytoE16_2_step01.2575.2575.1	0.7791	0.0070	1069.87	5	3120.0%	1	R.LEAPLEELR.A
UAK10_MOUSE99.4%3311.9%503558755.7(O88845) A kinase anchor protein 10, mitochondrial (Protein kinase A anchoring protein 10) (PRKA10) (Dual specificity A-Kinase anchoring protein 2) (D-AKAP-2) (Fragment)
	TK251102_lung_cytoE16_2_step08.4274.4274.2	1.238	0.0060	2188.76	2	3060.0%	1	K.KGQYDGQEAQNDAMILYDK.Y
*	TK251102_lung_cytoE16_2_step10.3657.3657.2	1.5136	0.0736	2330.93	1	2500.0%	1	R.RLGDSSSAPLLVTQSEGTDPGSR.T
*	TK251102_lung_cytoE16_2_step10.2567.2567.2	2.3369	0.5269	2033.48	1	4410.0%	1	R.TQNPQNHLLLSQEGHSAR.S
UG3BP_MOUSE99.4%158722.4%465518295.6(P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1)
	TK251102_lung_cytoE16_2_step10.3219.3219.2	2.0802	0.2118	1234.48	24	5000.0%	1	K.VLSNRPIMFR.G
*	TK251102_lung_cytoE16_2_step12.5109.5109.3	1.135	0.0968	4447.31	173	790.0%	1	K.NLPPSGAVPVTGTPPHVVKVPASQPRPESKPDSQIPPQRPQR.D
	TK251102_lung_cytoE16_2_step11.2845.2845.2	2.1191	0.4011	2083.86	1	3530.0%	1	R.HPDSHQLFIGNLPHEVDK.S
*	TK251102_lung_cytoE16_2_step07.2455.2455.2	1.3322	0.229	1870.52	6	2780.0%	9	K.NLPPSGAVPVTGTPPHVVK.V
*	TK251102_lung_cytoE16_2_step03.2371.2371.2	0.815	0.0161	1832.54	76	1880.0%	1	R.GPRPIREAGEPGDVEPR.R
	TK251102_lung_cytoE16_2_step06.4397.4397.2	0.9223	0.0194	1989.87	4	2810.0%	1	-.MVMEKPSPLLVGREFVR.Q
UQ8QZY999.4%4612.0%424443568.6(Q8QZY9) Splicing factor 3b, subunit 4, 49kD (Hypothetical 44.4 kDa protein)
	TK251102_lung_cytoE16_2_step08.1999.1999.1	1.5135	0.0925	846.59	2	6670.0%	1	K.LYGKPIR.V
	TK251102_lung_cytoE16_2_step05.4819.4819.2	2.6019	0.5276	2608.41	1	3180.0%	2	K.VSEPLLWELFLQAGPVVNTHMPK.D
	TK251102_lung_cytoE16_2_step04.3080.3080.2	1.593	0.0049	2254.88	22	2500.0%	1	R.GPLPPPRPTPRPPVPPRGPLR.G
UR10A_MOUSE99.4%154334.6%2172491610.0(P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6)
	TK251102_lung_cytoE16_2_step03.3573.3573.2	2.881	0.4937	1488.11	1	6250.0%	2	K.KYDAFLASESLIK.Q
	TK251102_lung_cytoE16_2_step07.3484.3484.2	1.3801	0.1276	1266.62	2	5910.0%	2	K.VLCLAVAVGHVK.M
	TK251102_lung_cytoE16_2_step07.3472.3472.2	1.8672	0.2951	1602.12	1	5380.0%	5	K.FPSLLTHNENMVAK.V
	TK251102_lung_cytoE16_2_step02.1531.1531.2	1.4973	0.0556	952.44	49	5710.0%	1	R.EVLHGNQR.K
	TK251102_lung_cytoE16_2_step01.1932.1932.1	1.2919	0.1197	812.36	29	4290.0%	1	R.ILGPGLNK.A
	TK251102_lung_cytoE16_2_step05.1376.1376.1	1.3018	0.1797	904.57	2	7140.0%	2	K.STMGKPQR.L
	TK251102_lung_cytoE16_2_step08.4285.4285.2	1.6796	0.1728	1420.21	2	5910.0%	2	K.FLETVELQISLK.N
UPSA1_MOUSE99.4%165423.6%263295476.4(Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain)
	TK251102_lung_cytoE16_2_step07.3458.3458.2	1.4822	0.0492	1333.93	43	4000.0%	2	R.FVFDRPLPVSR.L
	TK251102_lung_cytoE16_2_step01.1351.1351.1	2.0212	0.2779	1084.55	3	5000.0%	3	R.AQSELAAHQK.K
	TK251102_lung_cytoE16_2_step03.2891.2891.2	2.925	0.2604	1434.62	1	6820.0%	1	R.IHQIEYAMEAVK.Q
	TK251102_lung_cytoE16_2_step10.4066.4066.3	1.4931	0.0431	2088.91	3	2630.0%	1	K.ILHVDNHIGISIAGLTADAR.L
	TK251102_lung_cytoE16_2_step08.2891.2891.1	1.7267	0.1473	953.83	7	5000.0%	6	K.THAVLVALK.R
UGYG2_HUMAN99.4%71113.6%501552125.1(O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2)
*	TK251102_lung_cytoE16_2_step03.3543.3543.3	1.2836	0.075	2496.26	9	2120.0%	1	K.HLPFIYNLSSNTMYTYSPAFK.Q
*	TK251102_lung_cytoE16_2_step04.2251.2251.2	1.3366	0.1316	1707.97	29	3460.0%	1	K.VVHFLGSMKPWNYK.Y
*	TK251102_lung_cytoE16_2_step08.2969.2969.2	2.7421	0.3946	1128.46	1	7780.0%	2	K.RPELGLTLTK.L
*	TK251102_lung_cytoE16_2_step09.3952.3952.3	1.6494	0.0812	3773.76	10	1480.0%	1	K.VFDEVIEVNLIDSADYIHLAFLKRPELGLTLTK.L
UGLYG_MOUSE99.4%91517.2%332372715.3(Q9R062) Glycogenin-1 (EC 2.4.1.186)
*	TK251102_lung_cytoE16_2_step10.4881.4881.2	1.8016	0.2364	2963.76	2	2120.0%	1	K.VLETVFDDVIMVDVLDSGDSAHLTLMK.R
*	TK251102_lung_cytoE16_2_step05.2492.2492.2	2.8195	0.4047	1642.49	1	6670.0%	2	R.TKPWNYTYNPQTK.S
	TK251102_lung_cytoE16_2_step09.2985.2985.2	1.3973	0.0742	828.14	2	7500.0%	1	K.VVHFLGR.T
*	TK251102_lung_cytoE16_2_step08.2969.2969.2	2.7421	0.3946	1128.46	1	7780.0%	2	K.RPELGITLTK.L
UDLG2_HUMAN99.4%3311.6%870975006.4(Q15700) Channel associated protein of synapse-110 (Chapsyn-110) (Discs, large homolog 2)
*	TK251102_lung_cytoE16_2_step11.1784.1784.3	1.068	0.1001	4687.84	8	750.0%	1	R.HYSPVECDKSFLLSAPYSHYHLGLLPDSEMTSHSQHSTATR.Q
*	TK251102_lung_cytoE16_2_step12.4705.4705.3	3.4237	0.3144	3038.59	1	2500.0%	1	K.EQSEQETSDPERGQEDLILSYEPVTR.Q
*	TK251102_lung_cytoE16_2_step10.4954.4954.3	1.2696	0.1306	3354.17	2	1670.0%	1	K.GLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQK.D
U143Z_MOUSE99.4%6624.9%245277714.8(P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit)
	TK251102_lung_cytoE16_2_step01.1824.1824.1	2.2603	0.3598	1279.83	1	6820.0%	1	R.YLAEVAAGDDKK.G
	TK251102_lung_cytoE16_2_step06.4613.4613.3	1.5219	0.1777	2764.38	1	1770.0%	1	K.ACSLAKTAFDEAIAELDTLSEESYK.D
*	TK251102_lung_cytoE16_2_step01.2028.2028.1	1.5526	0.0722	1331.6	1	5910.0%	1	K.FLIPNASQPESK.V
	TK251102_lung_cytoE16_2_step01.4820.4820.1	2.6234	0.2843	1421.78	1	7270.0%	1	R.DICNDVLSLLEK.F
	TK251102_lung_cytoE16_2_step12.2467.2467.3	1.4326	0.2656	2130.72	8	1940.0%	1	K.TAFDEAIAELDTLSEESYK.D
UQ91Z5399.4%2213.4%328353297.6(Q91Z53) Similar to glyoxylate reductase/hydroxypyruvate reductase
*	TK251102_lung_cytoE16_2_step07.3122.3122.2	2.8549	0.4939	1752.87	1	5670.0%	1	R.KDLEQGVVGAHGLLCR.L
*	TK251102_lung_cytoE16_2_step05.2977.2977.3	0.6733	0.0167	2947.49	5	930.0%	1	R.GIRVGYTPGVLTDATAELAVSLLLTTCR.R
UP7030399.4%338.5%586655156.5(P70303) CTP synthetase homolog (CTPSH)
*	TK251102_lung_cytoE16_2_step08.3559.3559.2	2.8693	0.4932	2487.47	1	3570.0%	1	K.KENFYNIHVSLVPQPSATGEQK.T
	TK251102_lung_cytoE16_2_step04.3931.3931.2	0.9806	0.0159	2276.08	1	2370.0%	1	R.DCYASVFKALEHSALAINHK.L
	TK251102_lung_cytoE16_2_step04.1781.1781.1	1.403	0.0575	1014.55	3	5710.0%	1	K.IYQHVINK.E
UQ8VDD599.4%683.3%19602263555.7(Q8VDD5) Nonmuscle heavy chain myosin II-A
	TK251102_lung_cytoE16_2_step07.5356.5356.2	0.9242	0.0598	2804.26	7	1740.0%	1	K.FIRINFDVNGYIVGANIETYLLEK.S
	TK251102_lung_cytoE16_2_step04.3799.3799.1	0.9951	0.1036	1575.21	25	2310.0%	1	K.VSHLLGINVTDFTR.G
	TK251102_lung_cytoE16_2_step12.0991.0991.2	1.0339	1.0E-4	3016.64	3	1400.0%	1	K.NMDPLNDNIATLLHQSSDKFVSELWK.D
	TK251102_lung_cytoE16_2_step09.2608.2608.1	1.0985	0.0303	910.48	14	5000.0%	1	K.FVSELWK.D
UAMPL_MOUSE99.4%101417.7%487526197.0(Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase)
	TK251102_lung_cytoE16_2_step03.4311.4311.2	1.8095	0.3187	1847.15	1	5330.0%	1	R.LILADALCYAHTFNPK.V
	TK251102_lung_cytoE16_2_step12.1411.1411.1	1.003	0.1905	749.65	52	6000.0%	1	K.VHIRPK.S
	TK251102_lung_cytoE16_2_step04.3579.3579.1	1.3375	0.1002	1457.36	1	4170.0%	2	K.WAHLDIAGVMTNK.D
	TK251102_lung_cytoE16_2_step03.1457.1457.1	1.1867	0.0461	957.54	108	4380.0%	1	K.ANKPGDVVR.A
	TK251102_lung_cytoE16_2_step12.1559.1559.1	0.8594	1.0E-4	1199.8	4	3000.0%	1	R.EMLNISGPPLK.A
	TK251102_lung_cytoE16_2_step08.5117.5117.1	0.2338	0.0	404.48	4	2500.0%	1	K.QKK.K
	TK251102_lung_cytoE16_2_step03.4091.4091.2	1.2602	0.258	2065.1	11	2780.0%	2	R.TFYGLHQDFPSVVVVGLGK.R
	TK251102_lung_cytoE16_2_step05.3211.3211.1	1.1623	0.1487	1193.47	6	5000.0%	1	R.MPLFEHYTR.Q
URADI_MOUSE99.4%91314.9%583684526.1(P26043) Radixin
	TK251102_lung_cytoE16_2_step03.2319.2319.1	1.7798	0.0688	1003.62	3	7140.0%	1	K.KENPLQFK.F
	TK251102_lung_cytoE16_2_step08.2114.2114.1	1.437	0.0671	1412.56	1	5450.0%	1	K.EIHKPGYLANDR.L
*	TK251102_lung_cytoE16_2_step01.3923.3923.3	1.2579	0.1553	4788.88	15	1020.0%	1	K.TVMSAPPPPPPPPVIPPTENEHDEQDENSAEASAELSSEGVMNHR.S
	TK251102_lung_cytoE16_2_step04.1909.1909.2	2.8028	0.3489	1496.7	1	7080.0%	1	K.KTQNDVLHAENVK.A
	TK251102_lung_cytoE16_2_step07.1903.1903.1	1.6863	0.3025	1250.67	1	6250.0%	2	R.IQNWHEEHR.G
UQ9JK3199.3%222.1%13061384884.8(Q9JK31) ATFa-associated factor
	TK251102_lung_cytoE16_2_step12.1819.1819.2	2.748	0.4928	1815.12	1	5620.0%	1	R.LPPEAASTSLPQKPHLK.L
*	TK251102_lung_cytoE16_2_step05.2125.2125.1	0.847	0.0739	1255.8	243	3500.0%	1	K.SEDMDSVQSTR.R
UQ91YS899.3%335.6%374416245.4(Q91YS8) Similar to calcium/calmodulin-dependent protein kinase I
	TK251102_lung_cytoE16_2_step02.1941.1941.1	1.6223	0.1657	1282.53	2	6500.0%	1	K.NIHQSVSEQIK.K
	TK251102_lung_cytoE16_2_step10.3030.3030.2	2.4587	0.4217	1223.0	1	8330.0%	1	K.YLHDLGIVHR.D
UQ9EPZ299.3%6616.1%831926317.4(Q9EPZ2) ELAC2
*	TK251102_lung_cytoE16_2_step10.3377.3377.2	3.1454	0.4007	2462.74	1	4750.0%	1	R.FGPDTQHLILNENCPSVHNLR.S
*	TK251102_lung_cytoE16_2_step10.2746.2746.2	1.0271	0.051	1224.2	1	5000.0%	1	R.RPRPSKDPLR.H
	TK251102_lung_cytoE16_2_step02.2418.2418.3	1.393	0.0102	2839.98	63	1590.0%	1	R.AWLQQYHNHCQEILHHVSMIPAK.C
*	TK251102_lung_cytoE16_2_step08.4005.4005.3	1.2153	0.1257	4336.55	6	1150.0%	1	R.EIAAEELCTPPDPGLVFIVVECPDEGFILPICENDTFK.R
*	TK251102_lung_cytoE16_2_step03.3207.3207.3	1.4698	0.0388	1919.54	10	2970.0%	1	R.MHWSNVGGLCGMILTLK.E
*	TK251102_lung_cytoE16_2_step11.3513.3513.3	1.3135	0.0153	2927.4	113	1350.0%	1	R.SHKIQTQLSLIHPDIFPQLTSFYSK.E
UH2AZ_HUMAN99.3%2211.0%1271342210.6(P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z)
	TK251102_lung_cytoE16_2_step11.2428.2428.1	1.6339	0.1669	1371.94	1	4620.0%	1	K.ATIAGGGVIPHIHK.S
UQ8R0B299.3%355.5%236263696.8(Q8R0B2) Hypothetical 26.4 kDa protein (Fragment)
	TK251102_lung_cytoE16_2_step12.2121.2121.1	2.4733	0.3675	1496.82	1	5420.0%	2	K.LFHTAPNVPHYAK.N
UDNPE_HUMAN99.3%112.3%475524287.4(Q9ULA0) Aspartyl aminopeptidase (EC 3.4.11.21)
	TK251102_lung_cytoE16_2_step12.1572.1572.1	1.8897	0.3884	1444.83	1	5500.0%	1	K.HEENHRPLFHK.G
USTN1_MOUSE99.3%145229.1%148171436.0(P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein)
	TK251102_lung_cytoE16_2_step06.1882.1882.1	2.1365	0.3342	1042.57	1	6880.0%	6	R.KSHEAEVLK.Q
	TK251102_lung_cytoE16_2_step01.3655.3655.1	1.1563	0.0109	1392.18	65	3330.0%	2	R.ASGQAFELILSPR.S
*	TK251102_lung_cytoE16_2_step01.2658.2658.1	1.8805	0.1636	1315.32	2	5910.0%	3	K.ESVPDFPLSPPK.K
	TK251102_lung_cytoE16_2_step01.1242.1242.1	1.3911	0.2725	912.55	1	6430.0%	1	K.SHEAEVLK.Q
	TK251102_lung_cytoE16_2_step01.1944.1944.1	1.7964	0.0682	1076.36	1	6880.0%	1	K.DLSLEEIQK.K
UQ9CXT499.3%81612.5%200231614.4(Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence
	TK251102_lung_cytoE16_2_step02.1982.1982.1	1.2721	0.0911	860.5	14	6670.0%	1	K.LELSENR.I
	TK251102_lung_cytoE16_2_step01.2214.2214.1	1.4868	0.0869	1017.71	5	5620.0%	1	K.DLSTIEPLK.K
	TK251102_lung_cytoE16_2_step07.1943.1943.1	1.7828	0.1616	885.51	1	6430.0%	3	K.HLNLSGNK.I
	TK251102_lung_cytoE16_2_step03.1903.1903.1	1.5674	0.188	990.56	2	5710.0%	2	K.KLELSENR.I
UAPA2_MOUSE99.3%359.8%102113197.2(P09813) Apolipoprotein A-II precursor (Apo-AII)
*	TK251102_lung_cytoE16_2_step04.2493.2493.1	1.7958	0.3807	1195.58	1	6110.0%	2	K.THEQLTPLVR.S
UQ9CTD499.3%2213.9%259301634.7(Q9CTD4) 6030455P07Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step01.5626.5626.3	1.4655	0.12	3048.34	128	1540.0%	1	R.LSKAEILSNWNMFVGSQATNYGEDLTR.H
	TK251102_lung_cytoE16_2_step05.2168.2168.1	1.9337	0.3818	1112.53	1	5620.0%	1	R.AWIAHTQQR.H
UQ9D28599.3%3329.9%134149088.5(Q9D285) Adult male colon cDNA, RIKEN full-length enriched library, clone:9030215D04, full insert sequence
	TK251102_lung_cytoE16_2_step12.1676.1676.1	2.0573	0.392	1596.97	1	5420.0%	1	R.VHIYHHTGNNTFR.V
	TK251102_lung_cytoE16_2_step10.2722.2722.2	1.6902	0.1789	1763.95	1	4640.0%	1	R.KIQDHQVVINCAIPK.G
	TK251102_lung_cytoE16_2_step01.2968.2968.2	0.8561	0.0067	1582.85	28	2730.0%	1	K.YNQATQTFHQWR.D
UQ91W5099.3%111514.7%798887916.4(Q91W50) Hypothetical 88.8 kDa protein
*	TK251102_lung_cytoE16_2_step05.1887.1887.1	1.084	0.1718	827.55	1	7140.0%	1	R.TGKPIAIK.L
	TK251102_lung_cytoE16_2_step04.4581.4581.3	0.8489	0.0102	3012.45	19	1150.0%	1	R.ATNIEVLSNTFQFTNEAREMGVIAAMR.D
	TK251102_lung_cytoE16_2_step11.5750.5750.3	1.541	0.0581	2439.08	2	2120.0%	1	K.FQLCVLGQNAQTMAYNITPLR.R
*	TK251102_lung_cytoE16_2_step07.1971.1971.2	1.2222	0.1328	1248.09	64	4440.0%	1	K.IKPEIHPEER.M
	TK251102_lung_cytoE16_2_step02.4038.4038.2	1.0284	0.2311	3010.17	24	1150.0%	1	R.LLPQGTVIFEDISIEHFEGTVTKVIPK.V
	TK251102_lung_cytoE16_2_step11.1470.1470.1	1.2299	0.102	1367.72	12	3180.0%	1	K.GTVSFHSHSDHR.F
*	TK251102_lung_cytoE16_2_step09.1921.1921.2	2.3887	0.4919	1414.76	1	6820.0%	2	K.QRPGQQIATCVR.L
	TK251102_lung_cytoE16_2_step09.4708.4708.2	1.6138	0.4265	2574.87	1	2950.0%	2	R.LLPQGTVIFEDISIEHFEGTVTK.V
UCBG_MOUSE99.3%2211.6%397447695.2(Q06770) Corticosteroid-binding globulin precursor (CBG) (Transcortin)
*	TK251102_lung_cytoE16_2_step07.3888.3888.3	0.9228	0.1701	3877.05	2	790.0%	1	K.NTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSK.M
*	TK251102_lung_cytoE16_2_step01.1387.1387.1	1.7713	0.3879	1109.62	1	6110.0%	1	K.AGEQINNHVK.N
UPUA2_MOUSE99.3%467.9%456501506.6(P46664) Adenylosuccinate synthetase, non-muscle isozyme (EC 6.3.4.4) (IMP--aspartate ligase) (AdSS) (AMPSase)
	TK251102_lung_cytoE16_2_step06.3498.3498.2	3.159	0.2931	2211.69	1	4720.0%	2	R.AHIVFDFHQAADGIQEQQR.Q
*	TK251102_lung_cytoE16_2_step02.5129.5129.2	0.7887	0.0027	1007.65	95	1880.0%	1	K.GIRPVYSSK.A
	TK251102_lung_cytoE16_2_step02.1774.1774.2	1.2377	0.2355	869.8	5	5710.0%	1	R.EFGVTTGR.K
UNCR2_MOUSE99.2%11118.5%24722708568.4(Q9WU42) Nuclear receptor co-repressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated co-repressor) (T3 receptor-associating factor) (TRAC)
	TK251102_lung_cytoE16_2_step07.3832.3832.2	1.5045	0.0781	1860.57	58	2350.0%	1	R.GLSPRESSLALNYAAGPR.G
	TK251102_lung_cytoE16_2_step06.2029.2029.1	0.8242	0.0828	1158.73	17	3120.0%	1	K.RTYDMMEGR.V
	TK251102_lung_cytoE16_2_step12.3121.3121.2	0.8691	0.0295	1419.72	93	3080.0%	1	R.SSSGPPHETAAPKR.T
*	TK251102_lung_cytoE16_2_step02.2451.2451.1	1.2115	0.0794	1142.49	2	5000.0%	1	R.EGTPPPPPPPR.D
*	TK251102_lung_cytoE16_2_step11.1898.1898.2	0.9146	0.1012	3076.91	46	890.0%	1	R.GHIPLAFDPTSIPRGIPLEAAAAAYYLPR.H
*	TK251102_lung_cytoE16_2_step11.2090.2090.2	2.9453	0.4665	1789.94	1	5360.0%	1	R.SHTDVGLLEYQHHPR.D
*	TK251102_lung_cytoE16_2_step04.3545.3545.3	1.4134	0.0281	2685.44	115	1800.0%	1	R.TPAKNLAPHHASPDPPAPTSASDLHR.E
*	TK251102_lung_cytoE16_2_step10.3419.3419.3	1.534	0.1439	2957.28	2	1760.0%	1	R.LLSPRPSLLTPAGDPRASTSPQKPLDLK.Q
*	TK251102_lung_cytoE16_2_step10.2311.2311.3	1.2251	0.0053	2123.68	33	2220.0%	1	R.AAEPRYPPHGISYPVQIAR.S
	TK251102_lung_cytoE16_2_step10.2318.2318.3	1.8888	0.2738	2884.07	5	1900.0%	1	K.QQQLEEEAAKPPEPEKPVSPPPIESK.H
*	TK251102_lung_cytoE16_2_step04.4385.4385.2	1.3704	0.2356	1866.06	1	3440.0%	1	K.EAEKPAFFPAFPTEGPK.L
UC61A_MOUSE99.2%224.1%291333405.8(P46737) C6.1A protein
	TK251102_lung_cytoE16_2_step10.2675.2675.2	2.9119	0.4805	1352.06	1	8640.0%	1	R.IHSLTHLDSVTK.I
UQ922F499.2%4611.0%447500904.9(Q922F4) Unknown (Protein for MGC:6469)
	TK251102_lung_cytoE16_2_step09.1580.1580.1	0.9291	0.1079	652.49	12	5000.0%	1	R.GPMSMK.E
	TK251102_lung_cytoE16_2_step05.4676.4676.2	2.8741	0.4891	2828.86	1	3000.0%	2	R.SGPFGQLFRPDNFIFGQTGAGNNWAK.G
	TK251102_lung_cytoE16_2_step01.4644.4644.2	1.6834	0.3823	1860.51	1	3750.0%	1	K.MASTFIGNSTAIQELFK.R
UQ9DAS899.2%339.1%637693016.0(Q9DAS8) 1600029N02Rik protein
*	TK251102_lung_cytoE16_2_step01.1068.1068.3	1.6154	0.0345	1870.04	1	3000.0%	1	K.SHIYFWSLEGGSLSKR.Q
	TK251102_lung_cytoE16_2_step05.4505.4505.3	1.4699	0.0055	2751.98	53	1500.0%	1	K.YGGHSSHVTNVAFLWDDSMALTTGGK.D
*	TK251102_lung_cytoE16_2_step12.3236.3236.2	2.8892	0.4704	1964.0	1	5330.0%	1	K.LVHLWSSETHQPVWSR.S
UQ922K299.2%689.7%641749236.8(Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment)
	TK251102_lung_cytoE16_2_step11.3274.3274.2	1.3656	0.118	1705.55	2	3080.0%	1	R.GFHCESSAHWPIFK.W
	TK251102_lung_cytoE16_2_step09.2205.2205.1	1.0	0.0393	712.54	3	6250.0%	2	K.LHWQK.N
	TK251102_lung_cytoE16_2_step04.3355.3355.1	0.6968	0.019	1136.08	37	2500.0%	1	K.IELIKMFDK.Q
	TK251102_lung_cytoE16_2_step02.3917.3917.2	1.6194	0.1178	1952.72	2	4410.0%	1	K.GYIFLEYASPAHAVDAVK.N
	TK251102_lung_cytoE16_2_step03.3506.3506.2	2.8819	0.4852	1923.54	1	5330.0%	1	R.FSHQGVQLIDFSPCER.Y
URL1X_MOUSE99.2%176527.3%1762073210.7(P11249) 60S ribosomal protein L18a
	TK251102_lung_cytoE16_2_step11.2108.2108.1	1.1057	0.0123	766.64	39	6000.0%	1	K.FPLPHR.V
	TK251102_lung_cytoE16_2_step07.2363.2363.1	1.8643	0.1787	1095.8	2	6110.0%	1	R.IFAPNHVVAK.S
	TK251102_lung_cytoE16_2_step02.2998.2998.1	1.3571	0.2598	783.5	1	7000.0%	4	K.RPNTFF.-
	TK251102_lung_cytoE16_2_step10.2183.2183.2	1.5509	0.2255	1043.8	8	5000.0%	1	K.CHTPPLYR.M
	TK251102_lung_cytoE16_2_step05.2323.2323.1	2.079	0.378	929.59	6	6430.0%	6	R.AHSIQIMK.V
	TK251102_lung_cytoE16_2_step05.1589.1589.1	1.1778	0.1436	967.59	1	5710.0%	3	R.SGTHNMYR.E
	TK251102_lung_cytoE16_2_step12.2613.2613.2	1.5457	0.2158	1008.23	3	6430.0%	1	K.IKFPLPHR.V
UQ9D0X899.2%4614.9%195211099.5(Q9D0X8) 1110055E19Rik protein
	TK251102_lung_cytoE16_2_step08.2879.2879.2	2.8202	0.4864	1387.99	1	5830.0%	2	K.YGGPQHIVGSPFK.A
	TK251102_lung_cytoE16_2_step02.3674.3674.2	1.0457	0.081	1685.59	21	3080.0%	1	K.HMGNRVYNVTYTVK.E
	TK251102_lung_cytoE16_2_step09.3787.3787.2	1.4915	0.1437	1346.92	7	4500.0%	1	R.VYNVTYTVKEK.G
UQ91VZ699.2%226.4%440476608.5(Q91VZ6) Similar to hypothetical protein FLJ13159
	TK251102_lung_cytoE16_2_step07.3750.3750.2	2.7912	0.4649	1608.34	1	6250.0%	1	R.RPQTDQAVEFFIR.D
*	TK251102_lung_cytoE16_2_step06.1829.1829.2	1.5985	0.3142	1725.74	36	3210.0%	1	R.EKEPEKPAKPLTTEK.L
UKAC_MOUSE99.2%2217.9%106117785.4(P01837) Ig kappa chain C region
	TK251102_lung_cytoE16_2_step01.1131.1131.1	0.8542	0.0135	832.49	186	4290.0%	1	K.TSTSPIVK.S
	TK251102_lung_cytoE16_2_step06.1502.1502.1	2.2861	0.3543	1348.64	1	5500.0%	1	R.HNSYTCEATHK.T
UMAT3_HUMAN99.1%8109.4%847946236.3(P43243) Matrin 3
	TK251102_lung_cytoE16_2_step11.2744.2744.2	2.2306	0.5113	2037.98	1	3890.0%	1	R.VIHLSNLPHSGYSDSAVLK.L
	TK251102_lung_cytoE16_2_step10.2013.2013.1	2.275	0.374	1472.6	1	5450.0%	1	K.NTHCSSLPHYQK.L
*	TK251102_lung_cytoE16_2_step04.1916.1916.2	2.0428	0.3532	1511.41	1	5420.0%	1	K.EWSQHINGASHSR.R
	TK251102_lung_cytoE16_2_step07.1515.1515.1	1.1985	0.0129	711.66	23	6000.0%	2	R.VHLSQK.Y
	TK251102_lung_cytoE16_2_step04.2296.2296.1	0.9288	0.046	1485.08	32	2920.0%	1	K.TESSTEGKEQEEK.S
*	TK251102_lung_cytoE16_2_step07.3499.3499.3	1.797	0.2481	3490.58	1	1980.0%	1	K.GYPHLCSICDLPVHSNKEWSQHINGASHSR.R
UMIF_MOUSE99.1%105215.8%114123737.3(P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor)
	TK251102_lung_cytoE16_2_step02.3215.3215.1	1.5826	0.1347	1289.22	3	6000.0%	1	-.PMFIVNTNVPR.A
*	TK251102_lung_cytoE16_2_step06.1889.1889.1	1.0913	0.0642	839.65	11	5830.0%	7	R.LHISPDR.V
USNX3_MOUSE99.1%7934.6%162187578.7(O70492) Sorting nexin 3 (SDP3 protein)
	TK251102_lung_cytoE16_2_step04.5277.5277.3	1.2766	0.0606	3771.8	10	1180.0%	1	R.LITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGR.F
	TK251102_lung_cytoE16_2_step04.2641.2641.2	2.7405	0.3283	1205.55	1	7780.0%	1	R.KQGLEQFINK.V
	TK251102_lung_cytoE16_2_step06.1598.1598.2	1.9487	0.2753	1193.88	1	6000.0%	1	K.VAGHPLAQNER.C
	TK251102_lung_cytoE16_2_step06.3758.3758.3	1.5505	0.1009	2250.28	32	1970.0%	1	K.QGLEQFINKVAGHPLAQNER.C
UQ9CT0599.1%556.9%654753955.3(Q9CT05) 2610027H02Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step06.1864.1864.1	1.2235	0.1691	686.46	1	8000.0%	1	R.HASLMK.R
	TK251102_lung_cytoE16_2_step09.3596.3596.2	2.045	0.2901	2243.07	1	2650.0%	1	R.QEFAQHANAFHQWIQETR.T
	TK251102_lung_cytoE16_2_step03.2290.2290.1	1.4476	0.2179	1101.71	11	4380.0%	1	K.LLEAQSHFR.K
	TK251102_lung_cytoE16_2_step04.2073.2073.1	2.2128	0.2584	1497.48	1	5450.0%	1	R.MQHNLEQQIQAR.N
UC1TC_HUMAN99.1%112.1%9341014287.3(P11586) C-1-tetrahydrofolate synthase, cytoplasmic (C1-THF synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)]
*	TK251102_lung_cytoE16_2_step04.3315.3315.2	2.739	0.4668	2125.85	1	5790.0%	1	K.CTHWAEGGKGALALAQAVQR.A
UQ99MP499.1%335.3%778862405.0(Q99MP4) Nucleolar protein C7
	TK251102_lung_cytoE16_2_step03.3710.3710.2	1.8312	0.04	1675.47	20	3570.0%	1	R.VVSSTSEEEEAFTEK.F
	TK251102_lung_cytoE16_2_step04.2129.2129.2	2.7289	0.4689	1639.91	1	5310.0%	1	K.HSSAAADAHGEGSSLLK.E
	TK251102_lung_cytoE16_2_step05.1964.1964.1	0.9024	0.1151	1004.63	21	4380.0%	1	K.TFGNHTLSK.K
USYV2_MOUSE99.1%9910.6%12631402157.8(Q9Z1Q9) Valyl-tRNA synthetase 2 (EC 6.1.1.9) (Valine--tRNA ligase 2) (ValRS 2)
	TK251102_lung_cytoE16_2_step05.3987.3987.2	1.1691	0.1152	1698.96	20	3000.0%	1	K.DPEAEAALELALSITR.A
*	TK251102_lung_cytoE16_2_step11.2965.2965.3	1.7857	0.0225	2527.22	12	1700.0%	1	-.MSILYVSPHPDAFPSLRALIAAR.Y
*	TK251102_lung_cytoE16_2_step03.2590.2590.2	1.2732	0.1263	2013.95	36	3060.0%	1	K.GFVPSATSKPEGHESLVDR.W
	TK251102_lung_cytoE16_2_step01.6192.6192.2	1.0943	0.1681	2324.45	2	1940.0%	1	R.LLSPFMPFVTEELFQRLPR.R
*	TK251102_lung_cytoE16_2_step05.2921.2921.2	1.2092	6.0E-4	1546.52	2	4230.0%	1	K.ELTGRTLLPVPGYK.E
*	TK251102_lung_cytoE16_2_step11.2542.2542.3	1.8997	0.336	2747.23	13	2300.0%	1	R.YGEAGDGPGWGGPHPRICLQPPPSSR.T
*	TK251102_lung_cytoE16_2_step02.2255.2255.2	1.1836	0.1975	1611.67	3	3330.0%	1	R.YGEAGDGPGWGGPHPR.I
	TK251102_lung_cytoE16_2_step05.1579.1579.1	0.997	0.0297	688.63	6	7500.0%	1	R.YQHLK.G
*	TK251102_lung_cytoE16_2_step10.3309.3309.2	2.6582	0.4909	1401.96	1	6820.0%	1	R.HRLEAISIMDSK.G
UQ9CXX799.1%114.5%287322669.9(Q9CXX7) Small nuclear ribonucleoprotein polypeptide A
	TK251102_lung_cytoE16_2_step03.2307.2307.1	2.1979	0.3622	1543.62	1	5830.0%	1	R.ANHTIYINNLNEK.I
UNED4_MOUSE99.1%12247.7%9571099685.6(P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment)
	TK251102_lung_cytoE16_2_step07.1612.1612.1	1.3232	0.1558	905.42	27	5830.0%	1	R.AHTCFNR.L
	TK251102_lung_cytoE16_2_step05.2983.2983.1	1.363	0.0591	889.53	3	6000.0%	1	R.KYEFFR.R
*	TK251102_lung_cytoE16_2_step02.1865.1865.2	2.7129	0.4642	2172.42	1	3500.0%	3	R.LAVCGNPATSQPVTSSNHSSR.G
*	TK251102_lung_cytoE16_2_step12.1703.1703.1	0.517	0.0232	1106.12	2	2500.0%	1	K.TGGSEIVVTNK.N
	TK251102_lung_cytoE16_2_step11.1473.1473.1	1.1063	0.0531	706.62	17	6000.0%	1	K.IPAHLR.G
*	TK251102_lung_cytoE16_2_step01.0668.0668.1	0.7312	0.0916	651.4	21	6250.0%	1	K.MMLQK.L
*	TK251102_lung_cytoE16_2_step01.1147.1147.1	1.5991	0.2409	1112.35	1	5620.0%	1	R.SYYVDHNSK.T
*	TK251102_lung_cytoE16_2_step06.3116.3116.1	2.1832	0.2479	1133.71	5	5620.0%	3	R.VFFINHNIK.K
UPRS7_MOUSE99.1%123811.5%433486485.9(P46471) 26S protease regulatory subunit 7 (MSS1 protein)
	TK251102_lung_cytoE16_2_step03.2295.2295.1	1.6147	0.2174	1015.61	1	6250.0%	1	K.KINELTGIK.E
	TK251102_lung_cytoE16_2_step12.3197.3197.2	1.2258	0.0244	2238.2	6	2380.0%	1	R.FVNLGIEPPKGVLLFGPPGTGK.T
	TK251102_lung_cytoE16_2_step07.2110.2110.1	1.1656	0.1268	645.42	3	6250.0%	1	R.THIFK.I
	TK251102_lung_cytoE16_2_step10.3475.3475.2	2.6755	0.4885	1208.86	1	7780.0%	1	K.YQIHIPLPPK.I
	TK251102_lung_cytoE16_2_step09.1403.1403.1	1.1257	0.0753	496.78	1	8330.0%	5	K.IHAR.S
USYD_MOUSE99.1%153116.8%501571176.5(Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS)
	TK251102_lung_cytoE16_2_step06.2841.2841.2	1.4426	0.0608	1910.24	35	3210.0%	1	K.QFPCEPFKFLEPTLR.L
	TK251102_lung_cytoE16_2_step07.3266.3266.1	1.1937	0.1555	1232.73	11	3890.0%	2	R.LQSGICHLFR.E
	TK251102_lung_cytoE16_2_step05.1865.1865.3	1.6787	0.0877	2426.54	7	2140.0%	1	R.QQQFNVQALVAVGDHASKQMVK.F
	TK251102_lung_cytoE16_2_step11.4072.4072.1	1.3964	0.1216	1401.02	18	3180.0%	1	R.VTMLFLGLHNVR.Q
	TK251102_lung_cytoE16_2_step10.2742.2742.2	2.1143	0.4435	1437.61	1	6790.0%	3	R.FGAPPHAGGGIGLER.V
	TK251102_lung_cytoE16_2_step09.2469.2469.1	2.2637	0.2833	1134.69	1	5000.0%	3	R.ALHHGIDLEK.I
UT172_HUMAN99.1%778.4%18492068866.5(O14981) TBP-associated factor 172 (TAF-172) (TAF(II)170)
*	TK251102_lung_cytoE16_2_step10.1987.1987.3	1.2504	0.0706	2623.12	87	1590.0%	1	R.LLCVFALDRFGDFVSDEVVAPVR.E
*	TK251102_lung_cytoE16_2_step02.2337.2337.3	1.6787	0.0833	2352.85	11	2120.0%	1	R.ETCAQTLGVVLKHMNETGVHK.T
*	TK251102_lung_cytoE16_2_step10.1799.1799.3	1.4204	0.0052	1539.09	7	3460.0%	1	R.EQEAGVLAMDALHR.Q
*	TK251102_lung_cytoE16_2_step05.2344.2344.3	0.8671	0.0262	3413.65	36	860.0%	1	K.NLCSSLCVDPYLTPCVTCPVPTQSGQENSK.G
*	TK251102_lung_cytoE16_2_step12.2749.2749.2	2.5828	0.4813	2002.31	1	4380.0%	1	K.LCNHPALVLTPQHPEFK.T
*	TK251102_lung_cytoE16_2_step01.3407.3407.2	0.8058	1.0E-4	2166.25	46	1110.0%	1	R.TRQEPTSESSMEDSPTTER.L
*	TK251102_lung_cytoE16_2_step06.3753.3753.3	1.3044	0.0308	3520.36	44	1420.0%	1	R.IILSGTPIQNNVLELWSLFDFLMPGFLGTER.Q
UQ9R1D299.1%5712.3%326370286.6(Q9R1D2) Cyclin-dependent kinase 6
*	TK251102_lung_cytoE16_2_step09.4104.4104.2	0.9143	0.0089	1722.38	97	2500.0%	1	K.ILDIIGLPGEEDWPR.D
	TK251102_lung_cytoE16_2_step06.3137.3137.1	1.1194	0.0149	1575.18	89	2500.0%	1	R.GLDFLHSHRVVHR.D
	TK251102_lung_cytoE16_2_step07.2783.2783.2	2.1767	0.4392	1479.05	1	5450.0%	2	R.HLETFEHPNVVR.L
UO9489499.1%334.0%10321174619.3(O94894) Hypothetical protein KIAA0801
*	TK251102_lung_cytoE16_2_step04.2605.2605.1	0.813	0.1092	1039.12	10	2780.0%	1	K.EKTDGGESSK.E
*	TK251102_lung_cytoE16_2_step11.2916.2916.2	2.4655	0.4857	2299.37	1	3500.0%	1	K.HGYEKPTPIQTQAIPAIMSGR.D
*	TK251102_lung_cytoE16_2_step03.2625.2625.1	1.3658	0.2042	1137.48	5	5560.0%	1	R.KLLEPVDHGK.I
UHBBZ_MOUSE99.1%2215.8%146163638.7(P04444) Hemoglobin beta-H1 chain (Z protein)
	TK251102_lung_cytoE16_2_step06.3057.3057.1	0.9408	0.0511	1114.8	1	5000.0%	1	K.KVLTSLGLGVK.N
*	TK251102_lung_cytoE16_2_step05.3224.3224.2	2.5913	0.4758	1222.05	1	7270.0%	1	K.LVIGVANALSHK.Y
UUE3A_MOUSE99.1%101222.4%8851011765.1(O08759) Ubiquitin-protein ligase E3A (EC 6.3.2.-) (Oncogenic protein-associated protein E6-AP)
*	TK251102_lung_cytoE16_2_step01.5563.5563.3	1.0146	0.1363	4333.38	1	1360.0%	1	R.DPNYLNLFIILMENSNLHSPEYLEMALPLFCKAMCK.L
*	TK251102_lung_cytoE16_2_step11.5858.5858.3	0.9591	0.0728	4779.41	9	730.0%	1	K.MVYYANVVGGDVDTNHNEEDDEEPIPESSELTLQELLGDERR.N
	TK251102_lung_cytoE16_2_step07.2452.2452.3	1.63	0.0245	2462.65	6	2120.0%	1	R.LPTSHTCFNVLLLPEYSSKEK.L
	TK251102_lung_cytoE16_2_step07.4208.4208.2	2.4106	0.483	2207.73	1	3890.0%	1	R.LPTSHTCFNVLLLPEYSSK.E
	TK251102_lung_cytoE16_2_step04.4137.4137.3	1.454	0.0269	4201.65	50	1250.0%	1	K.YLFRPEEIELLICGSRNLDFQALEETTEYDGGYTR.E
	TK251102_lung_cytoE16_2_step04.1824.1824.3	1.8534	0.0692	1499.19	6	3330.0%	1	K.ENGDKIPITNENR.K
*	TK251102_lung_cytoE16_2_step10.3758.3758.3	2.1332	0.1089	2877.79	3	2200.0%	2	K.VISNEFNSRNLVNDDDAIVAASNCLK.M
*	TK251102_lung_cytoE16_2_step06.4397.4397.3	1.2477	0.0062	2984.3	13	1770.0%	1	K.EFFQLVVEEIFNPDIGMFTYDEATK.L
UQ6115299.1%114.0%453502028.3(Q61152) Protein-tyrosine phosphatase 18 (EC 3.1.3.48) (PTP-K1) (Fetal liver phosphatase 1) (FLP1) (PTP 49) (PTP HSCF)
*	TK251102_lung_cytoE16_2_step07.1859.1859.2	2.4917	0.4822	1925.12	1	5880.0%	1	R.AQRPVAHTEDAQGTTALR.R
UQ99LX799.1%229.4%288312578.5(Q99LX7) Hypothetical 31.3 kDa protein (Fragment)
*	TK251102_lung_cytoE16_2_step05.2287.2287.2	1.0592	0.0528	1590.13	123	2690.0%	1	R.FASGANFQYIITEK.K
*	TK251102_lung_cytoE16_2_step05.2876.2876.2	2.3529	0.4795	1426.55	1	5420.0%	1	K.NSSVGLIQLNRPK.A
UQ9CXZ299.1%84013.5%163174037.1(Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence
	TK251102_lung_cytoE16_2_step01.1608.1608.1	1.5325	0.0975	890.91	1	5000.0%	6	K.AAVSGLWGK.V
	TK251102_lung_cytoE16_2_step01.1772.1772.1	1.6099	0.221	1288.01	3	4580.0%	2	K.VNADEVGGEALGR.L
UQ91WQ399.1%71111.4%528591057.0(Q91WQ3) Similar to tyrosyl-tRNA synthetase (Hypothetical 59.1 kDa protein) (Expressed sequence AL024047)
	TK251102_lung_cytoE16_2_step11.3016.3016.3	1.6166	0.0050	2281.68	250	1840.0%	1	K.AGCEVTILFADLHAYLDNMK.A
	TK251102_lung_cytoE16_2_step02.0103.0103.1	0.8695	0.0204	1048.4	34	3750.0%	1	R.EKFNTPALK.K
	TK251102_lung_cytoE16_2_step06.2922.2922.2	1.1734	0.1073	1996.94	3	2940.0%	2	K.AFCEPGNVENNGVLSFIK.H
	TK251102_lung_cytoE16_2_step07.3379.3379.1	1.6444	0.3674	855.44	1	6670.0%	1	K.HVLFPLK.S
	TK251102_lung_cytoE16_2_step10.2641.2641.1	1.6165	0.2454	753.47	1	8000.0%	2	K.LHLITR.N
UPSD9_MOUSE99.1%3310.4%222247206.4(Q9CR00) 26S proteasome non-ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27)
	TK251102_lung_cytoE16_2_step08.2485.2485.1	1.8537	0.2646	1391.65	1	6000.0%	1	R.HNIICLQNDHK.A
	TK251102_lung_cytoE16_2_step06.2498.2498.2	2.3622	0.491	1434.15	1	5910.0%	1	K.QVEEALHQLHAR.D
UACDL_MOUSE99.1%226.3%430480828.2(P51174) Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13) (LCAD)
*	TK251102_lung_cytoE16_2_step10.3563.3563.2	1.7353	0.162	2085.94	1	4000.0%	1	R.KFFQEEVIPHHTEWEK.A
*	TK251102_lung_cytoE16_2_step10.1914.1914.2	2.6486	0.4684	1263.52	1	7000.0%	1	K.TVAHIQTVQHK.L
UQ9JHU999.1%3314.7%557609326.4(Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1)
*	TK251102_lung_cytoE16_2_step12.2319.2319.2	2.6334	0.4656	2321.13	1	4050.0%	1	K.MERPGPGIKPGEVVATSPLPCK.K
	TK251102_lung_cytoE16_2_step07.4192.4192.2	1.2013	0.054	1960.64	26	2650.0%	1	R.SSAGLDKVIVLWTANTER.F
*	TK251102_lung_cytoE16_2_step12.3979.3979.3	1.1301	0.0259	4592.02	2	1160.0%	1	R.VSFCTDSDPEPQGFHTVLSLLSFLFKAPLVPPGSPVVNALFR.Q
UMOES_MOUSE99.0%11218.2%576676366.6(P26041) Moesin (Membrane-organizing extension spike protein)
	TK251102_lung_cytoE16_2_step01.1404.1404.1	2.0621	0.3267	1360.51	1	6500.0%	1	K.KAQQELEEQTR.R
	TK251102_lung_cytoE16_2_step07.2424.2424.1	1.7769	0.2984	1235.7	2	5000.0%	2	R.IQVWHEEHR.G
	TK251102_lung_cytoE16_2_step07.2146.2146.1	1.0466	0.0514	744.67	26	6000.0%	1	K.YGDFNK.E
	TK251102_lung_cytoE16_2_step04.2864.2864.1	1.9561	0.1606	963.7	2	5710.0%	3	R.KESPLLFK.F
	TK251102_lung_cytoE16_2_step05.2212.2212.1	1.8154	0.3086	1532.76	1	4170.0%	2	K.KTANDMIHAENMR.L
UQ6086499.0%8109.2%543625826.8(Q60864) MSTI1
	TK251102_lung_cytoE16_2_step05.3288.3288.2	2.9849	0.445	1133.52	1	8890.0%	1	R.KAAALEFLNR.F
*	TK251102_lung_cytoE16_2_step03.1866.1866.1	1.3252	0.2504	1067.56	1	6250.0%	1	K.HEANNLQLK.E
	TK251102_lung_cytoE16_2_step07.1763.1763.1	1.4511	0.18	1017.64	1	7140.0%	1	K.HYTEAIKR.N
*	TK251102_lung_cytoE16_2_step03.2143.2143.2	2.2388	0.3473	1910.25	1	4330.0%	2	K.KEPKPEPMEEDLPENK.K
	TK251102_lung_cytoE16_2_step01.0952.0952.1	1.6033	0.2685	769.37	1	7500.0%	1	K.NPVIAQK.I
UQ9D02999.0%394.2%309334495.6(Q9D029) DNA segment, Chr 7, Wayne state University 128, expressed (Unknown) (Protein for MGC:19443)
	TK251102_lung_cytoE16_2_step09.2975.2975.2	2.4033	0.4479	1393.77	1	5000.0%	3	K.IHSITGLPPAMQK.V
UO7543399.0%447.8%591682867.0(O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog)
*	TK251102_lung_cytoE16_2_step11.3453.3453.2	1.3925	0.0942	2443.69	57	1840.0%	1	K.LNPRYLGAWTLMGHEYMEMK.N
	TK251102_lung_cytoE16_2_step11.1633.1633.1	1.6285	0.3666	1241.6	1	5000.0%	1	R.AAHFLHGCNSK.K
*	TK251102_lung_cytoE16_2_step04.1616.1616.1	1.0141	0.0041	871.59	133	3570.0%	1	K.MALVKLAK.L
	TK251102_lung_cytoE16_2_step06.1978.1978.1	1.0285	0.1566	741.5	10	5000.0%	1	R.GLLHSSK.W
UDCT2_MOUSE99.0%352.5%402441175.3(Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2)
	TK251102_lung_cytoE16_2_step04.2263.2263.2	2.2671	0.4867	1288.76	1	6110.0%	1	K.VHQLYETIQR.W
UPHS3_HUMAN99.0%9238.1%843966966.9(P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1)
*	TK251102_lung_cytoE16_2_step12.3468.3468.2	0.7767	0.0015	3017.11	28	1200.0%	1	R.HLEIIYAINQRHLDHVAALFPGDVDR.L
*	TK251102_lung_cytoE16_2_step11.3065.3065.2	2.0194	0.1598	2020.97	1	3610.0%	1	R.INMAHLCVIGSHAVNGVAR.I
*	TK251102_lung_cytoE16_2_step05.0075.0075.2	1.1056	0.1006	2697.72	254	1360.0%	1	K.ARPEYMLPVHFYGRVEHTPDGVK.W
*	TK251102_lung_cytoE16_2_step09.3563.3563.2	2.8904	0.3622	1372.53	1	7500.0%	4	R.HLEIIYAINQR.H
*	TK251102_lung_cytoE16_2_step06.3584.3584.2	2.9391	0.4443	1662.88	1	6430.0%	2	R.HLDHVAALFPGDVDR.L
UK1CJ_HUMAN98.9%227.3%593595195.2(P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10)
	TK251102_lung_cytoE16_2_step01.4780.4780.2	2.8977	0.4595	2874.6	1	2880.0%	1	R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S
	TK251102_lung_cytoE16_2_step02.3135.3135.2	0.8353	0.0588	1495.3	68	2330.0%	1	K.SSSSGSVGESSSKGPR.Y
UTCP1_MOUSE98.9%9137.4%556603416.1(P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A)
	TK251102_lung_cytoE16_2_step01.0536.0536.1	1.1532	0.0131	590.51	5	7500.0%	1	K.NTKAR.T
	TK251102_lung_cytoE16_2_step10.2242.2242.2	0.852	0.0526	1540.36	8	3750.0%	1	R.AFHNEAQVNPERK.N
	TK251102_lung_cytoE16_2_step11.3546.3546.2	2.8535	0.4585	1391.6	1	6820.0%	1	K.WIGLDLVHGKPR.D
	TK251102_lung_cytoE16_2_step07.2598.2598.1	1.771	0.338	1230.61	1	5500.0%	2	K.IHPTSVISGYR.L
	TK251102_lung_cytoE16_2_step02.1790.1790.2	2.5792	0.2565	1412.91	1	6360.0%	1	R.AFHNEAQVNPER.K
URL6_MOUSE98.9%257731.4%2873261210.8(P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107)
*	TK251102_lung_cytoE16_2_step07.4794.4794.1	1.6393	0.2213	1530.76	1	4640.0%	3	R.SSITPGTVLIILTGR.H
*	TK251102_lung_cytoE16_2_step10.1690.1690.1	0.9451	0.1056	609.63	1	6250.0%	2	K.KVHPK.G
	TK251102_lung_cytoE16_2_step01.0264.0264.1	1.8923	0.3457	866.71	1	8570.0%	1	K.FVIATSTK.V
*	TK251102_lung_cytoE16_2_step01.2758.2758.1	1.5427	7.0E-4	996.82	11	5620.0%	1	K.AVDLQILPK.I
*	TK251102_lung_cytoE16_2_step08.1405.1405.2	1.8806	0.0513	1187.62	2	6360.0%	1	K.KAGSDAAASRPR.A
*	TK251102_lung_cytoE16_2_step06.1750.1750.1	1.1825	0.2102	732.35	2	5830.0%	1	K.VLATVTK.T
	TK251102_lung_cytoE16_2_step03.2575.2575.1	1.5465	0.2481	996.59	1	5710.0%	4	K.HLTDAYFK.K
	TK251102_lung_cytoE16_2_step12.1448.1448.1	1.17	0.0014	1000.63	2	4290.0%	2	K.KPFSQHVR.R
	TK251102_lung_cytoE16_2_step01.1730.1730.1	1.5743	0.1977	697.82	1	8000.0%	1	R.NPVLVR.G
*	TK251102_lung_cytoE16_2_step12.2728.2728.1	0.901	0.0909	642.17	2	5000.0%	1	K.KPAAKK.A
	TK251102_lung_cytoE16_2_step11.1500.1500.1	1.2171	0.1558	782.55	1	5830.0%	1	R.KLLSHGK.K
UQ921R298.9%113330.7%1401614210.7(Q921R2) Similar to ribosomal protein S13
	TK251102_lung_cytoE16_2_step11.3005.3005.2	2.0293	0.2933	1383.45	1	6670.0%	2	K.KGLTPSQIGVILR.D
	TK251102_lung_cytoE16_2_step01.3854.3854.1	1.275	0.025	1254.99	44	4090.0%	1	K.GLTPSQIGVILR.D
	TK251102_lung_cytoE16_2_step01.4562.4562.2	1.3947	0.0909	1694.13	30	3570.0%	1	K.GLAPDLPEDLYHLIK.K
	TK251102_lung_cytoE16_2_step09.1345.1345.1	0.7424	0.1019	640.72	42	4000.0%	5	R.MHAPGK.G
	TK251102_lung_cytoE16_2_step01.1371.1371.1	1.6017	0.3738	968.54	1	5620.0%	1	R.DSHGVAQVR.F
UNDKA_MOUSE98.9%205454.6%152172087.4(P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1)
	TK251102_lung_cytoE16_2_step12.4653.4653.2	1.8617	0.3786	2117.66	1	4170.0%	2	K.YMHSGPVVAMVWEGLNVVK.T
	TK251102_lung_cytoE16_2_step02.2794.2794.1	1.8118	0.2507	1346.75	4	4550.0%	3	R.TFIAIKPDGVQR.G
	TK251102_lung_cytoE16_2_step01.1764.1764.1	1.3659	0.2544	1486.0	2	3460.0%	1	R.NIIHGSDSVKSAEK.E
	TK251102_lung_cytoE16_2_step04.1381.1381.1	0.9639	0.0557	709.1	125	6250.0%	1	K.RFEQK.G
*	TK251102_lung_cytoE16_2_step01.4878.4878.2	1.8575	0.3067	1912.28	2	3570.0%	1	K.EISLWFQPEELVEYK.S
*	TK251102_lung_cytoE16_2_step04.3377.3377.2	2.3977	0.2662	1181.52	3	6670.0%	2	K.DRPFFTGLVK.Y
	TK251102_lung_cytoE16_2_step03.1834.1834.1	1.2079	0.2522	1069.63	1	5560.0%	2	R.NIIHGSDSVK.S
	TK251102_lung_cytoE16_2_step01.2932.2932.1	1.4747	0.1552	828.65	14	5710.0%	1	R.GLVGEIIK.R
UQ9JKX698.9%226.0%218239845.5(Q9JKX6) Nudix hydrolase
*	TK251102_lung_cytoE16_2_step11.3514.3514.1	2.1814	0.2443	1515.99	1	5000.0%	1	K.HANSKPFEVPFLK.F
UQ9D1J198.9%2218.8%266285988.0(Q9D1J1) 1110005F07Rik protein
*	TK251102_lung_cytoE16_2_step12.2791.2791.2	2.8392	0.462	1774.35	1	4440.0%	1	R.ARPTSAGGLSLLPPPPGGK.S
	TK251102_lung_cytoE16_2_step03.3946.3946.3	1.4161	0.096	3313.0	1	1750.0%	1	K.LEDRTSGELFAQAPVDQFPGTAVESVTDSSR.Y
UTAGL_MOUSE98.9%92923.5%200224458.8(P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27)
*	TK251102_lung_cytoE16_2_step10.3938.3938.3	1.4471	0.0315	1926.33	27	2350.0%	2	R.TLMALGSLAVTKNDGNYR.G
	TK251102_lung_cytoE16_2_step09.2704.2704.1	0.9308	2.0E-4	1211.65	31	3500.0%	3	K.HVIGLQMGSNR.G
*	TK251102_lung_cytoE16_2_step07.3766.3766.2	1.7704	0.1462	2097.08	1	4120.0%	4	R.LVEWIVVQCGPDVGRPDR.G
URS20_HUMAN98.9%3319.3%119133739.9(P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20
	TK251102_lung_cytoE16_2_step02.2147.2147.2	2.8041	0.3737	1248.03	1	9000.0%	1	K.TPVEPEVAIHR.I
	TK251102_lung_cytoE16_2_step01.2772.2772.1	1.418	0.1342	1351.12	1	5450.0%	1	R.LIDLHSPSEIVK.Q
UGTM2_MOUSE98.9%225.5%217255857.4(P15626) Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (Glutathione S-transferase pmGT2) (GST 5-5)
*	TK251102_lung_cytoE16_2_step07.2763.2763.2	1.4149	0.1817	1432.32	2	6360.0%	1	K.KKPEYLEGLPEK.M
UQ99PC998.9%4104.7%594691398.6(Q99PC9) Protein phosphatase 2 regulatory subunit B56 delta isoform
	TK251102_lung_cytoE16_2_step03.2890.2890.2	0.9092	0.1506	1665.25	2	3080.0%	1	R.ILPIMFPALYRNSK.S
	TK251102_lung_cytoE16_2_step10.1679.1679.2	3.0792	0.3734	1512.2	1	6920.0%	3	K.RPSNSTPPPTQLSK.I
UQ91W4898.9%8814.9%511572306.2(Q91W48) Archain 1
	TK251102_lung_cytoE16_2_step11.5525.5525.1	0.6483	0.0907	1081.76	112	1880.0%	1	K.LYMVLITTK.N
	TK251102_lung_cytoE16_2_step07.1914.1914.2	3.0859	0.3847	1465.39	1	7080.0%	1	K.GVQLQTHPNVDKK.L
	TK251102_lung_cytoE16_2_step06.3501.3501.2	1.3707	0.1373	1802.05	11	3210.0%	1	R.NTLEWCLPVIDAKNK.S
*	TK251102_lung_cytoE16_2_step11.2398.2398.1	1.6975	0.2079	1589.65	1	3850.0%	1	K.VHAPPINMESVHMK.I
	TK251102_lung_cytoE16_2_step07.3838.3838.2	1.7481	0.1339	1420.22	2	5000.0%	1	K.NSNILEDLETLR.L
	TK251102_lung_cytoE16_2_step11.1325.1325.2	1.5874	0.1222	1235.65	5	4580.0%	1	K.VAPAPARPSGPSK.A
UCALU_MOUSE98.9%5519.4%315370644.7(O35887) Calumenin precursor
	TK251102_lung_cytoE16_2_step03.4278.4278.2	0.7492	0.0782	2702.45	1	1960.0%	1	K.EEIVDKYDLFVGSQATDFGEALVR.H
	TK251102_lung_cytoE16_2_step10.1927.1927.2	1.4922	0.3449	1461.87	1	5000.0%	1	K.DRVHHEPQLSDK.V
	TK251102_lung_cytoE16_2_step08.1741.1741.1	2.5708	0.3036	1191.6	1	7220.0%	1	R.VHHEPQLSDK.V
	TK251102_lung_cytoE16_2_step01.0852.0852.3	1.2762	0.0359	2923.9	4	1460.0%	1	K.NATYGYVLDDPDPDDGFNYKQMMVR.D
UO3572998.8%4417.7%339378336.8(O35729) Polycomb-M33 interacting protein Ring1B (Fragment)
	TK251102_lung_cytoE16_2_step03.3643.3643.2	1.2574	0.3068	2162.31	2	2220.0%	1	R.INKHNNQQALSHSIEEGLK.I
	TK251102_lung_cytoE16_2_step07.2791.2791.2	2.8476	0.4465	1805.19	1	6000.0%	1	K.HNNQQALSHSIEEGLK.I
	TK251102_lung_cytoE16_2_step07.1550.1550.3	1.4249	0.1358	2192.79	5	2080.0%	1	R.SLRPDPNFDALISKIYPSR.D
	TK251102_lung_cytoE16_2_step02.0055.0055.2	1.1372	0.0071	2627.43	4	2140.0%	1	R.SLHSELMCPICLDMLKNTMTTK.E
UH12_MOUSE98.8%226.6%2112113511.0(P15864) Histone H1.2 (H1 VAR.1) (H1C)
	TK251102_lung_cytoE16_2_step08.1703.1703.1	0.7926	0.1025	515.66	22	3750.0%	1	K.KVAAK.K
*	TK251102_lung_cytoE16_2_step05.1437.1437.1	1.5474	0.4055	856.54	2	6250.0%	1	K.KPAAAAVTK.K
UCYTB_MOUSE98.8%41026.5%98110467.4(Q62426) Cystatin B (Stefin B)
*	TK251102_lung_cytoE16_2_step11.2796.2796.2	2.7115	0.4575	2444.11	1	3500.0%	3	R.VFQPLPHENKPLTLSSYQTNK.E
*	TK251102_lung_cytoE16_2_step08.1793.1793.1	0.8432	0.0020	684.64	21	5000.0%	1	K.CVHLR.V
UAP19_MOUSE98.8%51720.7%111121629.1(P56212) cAMP-regulated phosphoprotein 19 (ARPP-19)
	TK251102_lung_cytoE16_2_step12.2516.2516.2	2.7134	0.4613	1672.96	1	6070.0%	1	R.YPHLGQKPGGSDFLR.K
	TK251102_lung_cytoE16_2_step07.1747.1747.1	1.8866	0.3115	831.52	1	5710.0%	4	R.KPSLVASK.L
UQ9Z1A198.8%5715.9%397430205.1(Q9Z1A1) TFG protein (Trk-fused gene)
	TK251102_lung_cytoE16_2_step08.4598.4598.3	1.8044	0.0307	2735.26	6	2380.0%	1	R.IPIHNEDITYDELVLMMQRVFR.G
*	TK251102_lung_cytoE16_2_step08.2022.2022.2	1.1877	0.0708	914.08	2	8330.0%	1	R.RELVELR.N
	TK251102_lung_cytoE16_2_step02.5225.5225.2	0.9397	0.118	1812.06	1	2500.0%	1	K.QSTQVMAASMSAFDPLK.N
*	TK251102_lung_cytoE16_2_step12.1939.1939.2	2.6321	0.4616	1864.67	1	4690.0%	2	R.NRPPFGQGYAQPGPGYR.-
UQ9CR4998.8%5256.8%147161468.2(Q9CR49) Hemoglobin Y, beta-like embryonic chain
*	TK251102_lung_cytoE16_2_step07.3914.3914.2	2.3625	0.4574	1286.64	1	7220.0%	5	R.LLVVYPWTHR.F
URS17_MOUSE98.7%92114.9%134153939.8(P06584) 40S ribosomal protein S17
	TK251102_lung_cytoE16_2_step09.1931.1931.2	2.9254	0.2981	1203.13	1	7780.0%	2	R.LGNDFHTNKR.V
	TK251102_lung_cytoE16_2_step05.2960.2960.1	1.6864	0.0883	1135.67	6	5000.0%	2	K.IAGYVTHLMK.R
UACLY_MOUSE98.7%172912.6%10911197287.4(Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme)
	TK251102_lung_cytoE16_2_step09.3639.3639.2	2.6382	0.3392	1872.95	1	3890.0%	2	K.GVTIIGPATVGGIKPGCFK.I
*	TK251102_lung_cytoE16_2_step03.4821.4821.2	2.9075	0.417	2156.24	1	5000.0%	1	R.SFDELGEIIQSVYEDLVAK.G
*	TK251102_lung_cytoE16_2_step09.2560.2560.1	1.6667	0.0194	1160.56	5	5560.0%	3	R.HLLVHAPEDK.K
*	TK251102_lung_cytoE16_2_step12.1732.1732.1	1.4969	0.2271	1287.62	3	4000.0%	2	R.HLLVHAPEDKK.E
	TK251102_lung_cytoE16_2_step06.2740.2740.1	1.4316	0.0715	838.48	2	6000.0%	1	K.FYWGHK.E
*	TK251102_lung_cytoE16_2_step03.1443.1443.1	1.2088	0.1624	911.57	2	5620.0%	2	R.LGHEATVGK.A
	TK251102_lung_cytoE16_2_step04.2788.2788.2	1.7179	0.1948	1542.54	1	5830.0%	1	R.KPASFMTSICDER.G
	TK251102_lung_cytoE16_2_step07.1870.1870.1	1.0998	0.1677	1246.61	1	4000.0%	1	R.RGGPNYQEGLR.V
	TK251102_lung_cytoE16_2_step07.2588.2588.1	1.3582	0.0837	786.69	2	8000.0%	1	K.SWLKPR.L
*	TK251102_lung_cytoE16_2_step08.4197.4197.2	1.2837	0.0051	1383.54	1	4620.0%	1	K.LGLVGVNLSLDGVK.S
	TK251102_lung_cytoE16_2_step09.2479.2479.2	1.4215	0.1259	1370.2	8	4550.0%	1	K.LYRPGSVAYVSR.S
	TK251102_lung_cytoE16_2_step03.4433.4433.2	1.6732	0.1272	1972.44	1	3120.0%	1	K.QHFPATPLLDYALEVEK.I
UQ9R0C498.7%776.5%18212020094.3(Q9R0C4) Intermediate filament protein nestin
*	TK251102_lung_cytoE16_2_step02.1645.1645.3	1.4776	0.0327	1609.03	6	2860.0%	1	R.SLEGENHDPLSSVVK.E
*	TK251102_lung_cytoE16_2_step06.3338.3338.2	1.067	0.0201	1420.01	3	4550.0%	1	K.FQLALEALEQEK.Q
*	TK251102_lung_cytoE16_2_step09.3145.3145.3	1.7924	0.2	2021.44	1	3440.0%	1	R.VSSIFQEEEGQIWELVK.K
*	TK251102_lung_cytoE16_2_step10.3027.3027.2	0.7646	0.0054	2783.86	17	1670.0%	1	K.NVEAEKTLENGVLELSKPLGEEEPR.M
*	TK251102_lung_cytoE16_2_step06.5552.5552.2	1.2291	0.1228	2941.83	6	1880.0%	1	K.LENESQDSGKFFEDESQETFGFLEK.E
*	TK251102_lung_cytoE16_2_step02.2139.2139.2	1.1235	0.0585	821.67	107	5000.0%	1	K.ESQESLK.S
*	TK251102_lung_cytoE16_2_step12.2720.2720.2	2.2181	0.4958	1698.38	1	5310.0%	1	K.APLVGSPVHLGPSQPLK.F
UQ9Z1J098.7%6610.5%10141138275.8(Q9Z1J0) Kinesin-related mitotic motor protein (Fragment)
*	TK251102_lung_cytoE16_2_step01.4483.4483.2	1.0706	0.0703	3067.81	17	1850.0%	1	R.VANQHSSFVAQMTSDEESCKAGSLELDK.T
*	TK251102_lung_cytoE16_2_step01.3487.3487.3	1.5891	0.1105	3702.85	6	1250.0%	1	K.TLFGNLMSCSVSALDTITTTALESLVSIPENVSAR.V
	TK251102_lung_cytoE16_2_step05.4321.4321.2	1.5051	0.0134	1813.78	59	2860.0%	1	K.TQELETTQKHLQETK.L
*	TK251102_lung_cytoE16_2_step05.2556.2556.2	2.4732	0.4736	2206.22	1	4710.0%	1	K.KYENIQKPLNSIQENTER.R
*	TK251102_lung_cytoE16_2_step11.3954.3954.2	1.1274	0.094	2235.07	3	2650.0%	1	K.YENIQKPLNSIQENTERR.S
*	TK251102_lung_cytoE16_2_step11.1520.1520.1	0.8296	0.2461	1072.13	5	3120.0%	1	K.QKAMLDVHK.T
UTPM4_HUMAN98.7%2212.9%248285224.7(P07226) Tropomyosin alpha 4 chain (Tropomyosin 4) (TM30p1)
*	TK251102_lung_cytoE16_2_step07.2267.2267.2	1.1168	0.0586	1343.99	111	2270.0%	1	K.SLEAASEKYSEK.E
*	TK251102_lung_cytoE16_2_step01.4380.4380.2	2.7676	0.4523	2340.8	1	4740.0%	1	K.EENVGLHQTLDQTLNELNCI.-
UPRSA_MOUSE98.6%9319.7%442494935.2(O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1)
	TK251102_lung_cytoE16_2_step07.4574.4574.2	2.3914	0.4655	1864.23	1	5000.0%	5	K.QIQELVEAIVLPMNHK.E
	TK251102_lung_cytoE16_2_step03.1893.1893.1	1.6716	0.2928	1056.58	2	6250.0%	2	R.VTHELQAMK.D
	TK251102_lung_cytoE16_2_step04.2432.2432.1	1.9596	0.2843	1141.54	1	5500.0%	1	K.LKPGDLVGVNK.D
	TK251102_lung_cytoE16_2_step01.0630.0630.1	1.1667	0.0392	744.53	1	6670.0%	1	K.VIAATNR.V
UQ9DCZ698.6%114.1%244273865.2(Q9DCZ6) 2410007D12Rik protein (RIKEN cDNA 2410007D12 gene)
*	TK251102_lung_cytoE16_2_step11.1574.1574.2	2.3233	0.4637	1133.29	1	7220.0%	1	R.IHVIDHSGVR.L
ULIS1_MOUSE98.6%5711.7%409465397.4(P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1)
	TK251102_lung_cytoE16_2_step07.2680.2680.1	1.1054	0.0584	889.65	50	5830.0%	1	K.KWTSVIR.L
	TK251102_lung_cytoE16_2_step11.2850.2850.2	2.7134	0.4481	1898.73	1	4670.0%	1	K.TLNAHEHFVTSLDFHK.T
	TK251102_lung_cytoE16_2_step10.3805.3805.2	1.1053	0.0152	1937.02	17	3000.0%	1	K.EWIPRPPEKYALSGHR.S
	TK251102_lung_cytoE16_2_step06.2564.2564.1	1.7147	0.2686	903.57	2	5620.0%	2	R.GVLFHSGGK.F
UVDP_MOUSE98.6%6611.8%9411051534.9(Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment)
	TK251102_lung_cytoE16_2_step04.2229.2229.2	1.2955	0.2461	1600.12	6	4170.0%	1	K.TLEQHDNIVTHYK.N
	TK251102_lung_cytoE16_2_step08.4183.4183.3	1.9038	0.14	2742.45	2	1930.0%	1	R.ASQKPQPNFPSPEYMIFDHEFTK.L
	TK251102_lung_cytoE16_2_step10.4897.4897.3	1.6787	0.0548	2791.05	58	1600.0%	1	R.LLTSLLKQLGPPVQQIILVSPMGVSR.L
	TK251102_lung_cytoE16_2_step10.2753.2753.3	2.3419	0.1816	2852.3	16	1800.0%	1	K.DNHHQGSHGDGAQVNGIQPEEISRLR.E
*	TK251102_lung_cytoE16_2_step12.2245.2245.3	1.3303	0.1778	2651.65	6	1820.0%	1	K.IVAFENAFERLLDIITEEGNSDR.G
ULEG3_MOUSE98.6%115.3%263273848.4(P16110) Galectin-3 (Galactose-specific lectin 3) (MAC-2 antigen) (IgE-binding protein) (35 kDa lectin) (Carbohydrate binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-34 galactoside-binding lectin)
	TK251102_lung_cytoE16_2_step07.2658.2658.2	2.55	0.4621	1651.87	1	5000.0%	1	K.VAVNDAHLLQYNHR.M
URL2A_MOUSE98.6%61223.8%1471645811.1(P14115) 60S ribosomal protein L27a (L29)
	TK251102_lung_cytoE16_2_step12.1147.1147.2	1.7396	0.0915	1074.34	1	6670.0%	1	R.GNAGGMHHHR.I
	TK251102_lung_cytoE16_2_step08.2349.2349.1	0.9579	0.058	970.5	3	4290.0%	3	K.YHPGYFGK.V
	TK251102_lung_cytoE16_2_step12.0462.0462.1	0.741	0.1693	653.06	43	4000.0%	1	R.KHPGGR.G
	TK251102_lung_cytoE16_2_step01.2994.2994.1	1.6906	0.3376	1140.96	1	5500.0%	1	K.TGVAPIIDVVR.S
UACF7_MOUSE98.6%22344.7%53276079845.5(Q9QXZ0) Actin cross-linking family protein 7 (Microtubule actin crosslinking factor) (MACF)
*	TK251102_lung_cytoE16_2_step05.2575.2575.1	1.1674	0.0422	1498.73	15	3640.0%	1	R.FDIEDSEAECRK.M
*	TK251102_lung_cytoE16_2_step05.2292.2292.3	1.6309	0.0918	2133.32	71	2220.0%	1	K.QFHETAEPISDFLSVTANK.L
	TK251102_lung_cytoE16_2_step07.1248.1248.1	0.7478	0.0032	598.14	28	3750.0%	1	K.LHQAK.E
	TK251102_lung_cytoE16_2_step10.3302.3302.3	0.7911	0.0719	2229.86	15	1050.0%	2	R.FRGALPDDTEALQSLIDTHK.E
	TK251102_lung_cytoE16_2_step03.2342.2342.1	0.6768	0.1273	497.3	2	6250.0%	1	R.TPGPK.R
	TK251102_lung_cytoE16_2_step02.2597.2597.1	0.9477	0.0131	662.65	32	6000.0%	1	R.SKPSSR.A
*	TK251102_lung_cytoE16_2_step10.4273.4273.3	2.9267	0.4343	3963.39	1	1520.0%	1	R.HQELLSQQQNFIVATQSAQSFLDQHSHNLTPEER.Q
	TK251102_lung_cytoE16_2_step05.1381.1381.1	1.4185	0.2276	626.69	5	6250.0%	3	K.KTFTK.W
	TK251102_lung_cytoE16_2_step01.4187.4187.2	0.9464	0.0605	2078.91	15	1670.0%	1	R.TSLAGDTSNSSSPASTGAKANR.A
	TK251102_lung_cytoE16_2_step02.2709.2709.3	1.3285	0.0565	2230.94	42	2240.0%	1	R.VAQKELEEAVTSALQQETEK.S
*	TK251102_lung_cytoE16_2_step03.1453.1453.1	1.0512	0.0048	1011.59	54	4380.0%	1	K.ILKIGPQLK.E
*	TK251102_lung_cytoE16_2_step12.3592.3592.3	1.6832	0.0399	2947.17	6	1830.0%	2	R.EAEEELAASGGQSPTGEQIPQFQQRQK.E
*	TK251102_lung_cytoE16_2_step05.1808.1808.1	1.6858	0.3373	814.66	1	7500.0%	1	K.WHAVSSK.V
	TK251102_lung_cytoE16_2_step04.1584.1584.2	0.9303	0.0171	1305.92	15	3500.0%	1	K.ATDETDRDIIR.E
	TK251102_lung_cytoE16_2_step08.1833.1833.1	1.4356	0.06	969.63	63	5000.0%	1	R.QVKLVNIR.N
	TK251102_lung_cytoE16_2_step07.3840.3840.2	0.8468	0.0202	1606.67	116	2000.0%	2	K.VPEGGEGISATEVDSR.W
*	TK251102_lung_cytoE16_2_step04.3973.3973.3	1.3182	0.0046	2734.78	3	1900.0%	1	K.DQVDPLQVKLQQVNGLGQGLIQSAGK.N
UPLSL_MOUSE98.6%112713.1%627702025.4(Q61233) L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65)
*	TK251102_lung_cytoE16_2_step08.3742.3742.3	1.8372	8.0E-4	2017.56	24	2360.0%	4	K.GDEEGIPAVVIDMSGLREK.D
	TK251102_lung_cytoE16_2_step01.3284.3284.1	1.8297	0.3348	1589.16	1	4620.0%	1	R.VYALPEDLVEVNPK.M
*	TK251102_lung_cytoE16_2_step09.2305.2305.1	1.173	0.1342	700.68	2	6000.0%	2	K.VFHGLK.T
	TK251102_lung_cytoE16_2_step01.5307.5307.2	1.3527	0.3786	2700.84	1	1880.0%	1	K.ISTSLPVLDLIDAIQPGSINYDLLK.T
*	TK251102_lung_cytoE16_2_step01.6112.6112.1	0.7837	0.0248	1521.91	75	2690.0%	1	R.YTLNILEDIGGGQK.V
	TK251102_lung_cytoE16_2_step03.5118.5118.1	0.6025	0.0774	414.87	4	5000.0%	2	R.GNPK.L
USDFL_MOUSE98.6%4417.6%221236487.4(Q9ESP1) Stromal cell-derived factor 2-like protein 1 precursor (SDF2 like protein 1)
	TK251102_lung_cytoE16_2_step05.2096.2096.1	1.7777	0.349	869.65	1	7140.0%	1	R.LTHVLTGK.N
*	TK251102_lung_cytoE16_2_step11.1621.1621.2	1.4339	0.2055	2002.61	3	3530.0%	1	R.GQHEVHGMPSANAHNTWK.A
	TK251102_lung_cytoE16_2_step12.2704.2704.1	0.9464	0.0656	1538.11	1	2310.0%	1	R.CGQAVRLTHVLTGK.N
	TK251102_lung_cytoE16_2_step10.1706.1706.1	0.974	0.0986	849.56	3	6670.0%	1	R.LHSHDIK.Y
URS11_HUMAN98.6%92123.4%1581843110.3(P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11
	TK251102_lung_cytoE16_2_step07.3504.3504.2	0.6477	0.0144	1076.06	47	2780.0%	1	R.VLLGETGKEK.L
	TK251102_lung_cytoE16_2_step01.2467.2467.1	1.712	0.3434	749.46	1	7500.0%	1	K.NIGLGFK.T
	TK251102_lung_cytoE16_2_step10.2947.2947.2	2.437	0.3098	1136.47	1	9290.0%	1	R.RDYLHYIR.K
	TK251102_lung_cytoE16_2_step05.2275.2275.1	1.014	0.1688	972.62	5	5000.0%	1	K.RVLLGETGK.E
	TK251102_lung_cytoE16_2_step09.3136.3136.2	1.9963	0.3941	1351.41	1	6000.0%	4	K.NMSVHLSPCFR.D
UQ9CX8698.6%123820.7%305305309.3(Q9CX86) 3010025E17Rik protein
*	TK251102_lung_cytoE16_2_step02.3657.3657.2	2.8183	0.4386	1689.58	1	7140.0%	3	R.GFGFVYFQSHDAADK.A
	TK251102_lung_cytoE16_2_step12.1509.1509.2	1.4304	0.1268	992.45	30	5000.0%	1	K.FHPIQGHR.V
	TK251102_lung_cytoE16_2_step01.2466.2466.1	1.7771	0.0721	735.14	5	6670.0%	1	K.LFVGGLK.G
	TK251102_lung_cytoE16_2_step06.2912.2912.3	1.283	0.1566	3400.73	3	1530.0%	1	R.CFGFVTYSNVEEADAAMAASPHAVDGNTVELK.R
	TK251102_lung_cytoE16_2_step09.2836.2836.1	1.7961	0.181	863.64	1	6430.0%	5	K.KLFVGGLK.G
UBIN1_MOUSE98.6%338.0%588644705.0(O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9)
*	TK251102_lung_cytoE16_2_step09.4393.4393.3	1.1523	0.0072	2123.97	2	2190.0%	1	K.KLSECLQEVYEPEWPGR.D
	TK251102_lung_cytoE16_2_step09.1916.1916.1	1.8595	0.3308	1213.53	1	6110.0%	1	R.HHYESLQTAK.K
	TK251102_lung_cytoE16_2_step09.4627.4627.2	2.0331	0.3242	2301.48	1	3160.0%	1	R.VGFYVNTFQSIAGLEENFHK.E
UQ9CVL398.6%484.2%263282868.2(Q9CVL3) 1810024J13Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step11.2288.2288.2	2.6939	0.3806	1319.85	1	7500.0%	2	K.KPIPEEHLILK.T
UQ9CPT498.6%2226.5%166179826.8(Q9CPT4) DNA segment, Chr 17, Wayne state University 104, expressed (Stromal cell-derived growth factor SF20/IL25)
*	TK251102_lung_cytoE16_2_step11.1505.1505.1	1.7607	0.3339	1170.62	5	5000.0%	1	K.TAVSHRPGAFK.A
*	TK251102_lung_cytoE16_2_step09.4371.4371.3	1.6474	0.0692	3335.63	59	1170.0%	1	K.LAAAVSEPTTVPFDVRPGGVVHSFSQDVGPGNK.F
UPRO2_MOUSE98.6%2210.8%139149017.0(Q9JJV2) Profilin II
	TK251102_lung_cytoE16_2_step04.1039.1039.1	0.3525	0.0314	797.06	7	1670.0%	1	K.KAYSMAK.Y
	TK251102_lung_cytoE16_2_step03.3458.3458.1	1.9454	0.3347	894.77	3	7140.0%	1	R.VLVFVMGK.E
UQ91X9498.6%7217.4%257292839.3(Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD)
	TK251102_lung_cytoE16_2_step11.1510.1510.1	1.8935	0.3221	1047.64	1	5620.0%	2	K.KYHNVGLSK.C
	TK251102_lung_cytoE16_2_step05.1820.1820.1	2.3097	0.3037	919.51	1	7860.0%	4	K.YHNVGLSK.C
	TK251102_lung_cytoE16_2_step01.1784.1784.1	1.489	0.1301	1168.92	1	5000.0%	1	K.FGEVVDCTLK.L
UQ9CY8298.6%4816.2%277321054.2(Q9CY82) 5730420M11Rik protein
	TK251102_lung_cytoE16_2_step11.0060.0060.3	1.809	0.1449	3729.84	2	1450.0%	2	K.IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR.V
	TK251102_lung_cytoE16_2_step01.1860.1860.1	1.736	0.3467	1448.87	1	5420.0%	2	K.EFHLNESGDPSSK.S
UAOP2_MOUSE98.6%91733.6%223247396.0(O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx)
	TK251102_lung_cytoE16_2_step12.4732.4732.2	1.4328	0.1301	3040.58	1	2310.0%	1	R.NFDEILRVVDSLQLTGTKPVATPVDWK.K
	TK251102_lung_cytoE16_2_step04.3435.3435.1	1.7206	0.3382	1150.72	1	5560.0%	2	R.VVFIFGPDKK.L
	TK251102_lung_cytoE16_2_step11.5102.5102.2	1.2042	0.0424	2035.17	5	3440.0%	1	R.FHDFLGDSWGILFSHPR.D
	TK251102_lung_cytoE16_2_step01.3143.3143.2	1.9436	0.4594	2156.19	1	3950.0%	1	R.VVDSLQLTGTKPVATPVDWK.K
*	TK251102_lung_cytoE16_2_step01.3579.3579.2	2.2146	0.292	2143.22	4	3500.0%	1	-.PGGLLLGDEAPNFEANTTIGR.I
USERC_MOUSE98.6%196718.1%370404738.0(Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP)
*	TK251102_lung_cytoE16_2_step11.2249.2249.2	2.3012	0.2806	1240.78	1	8000.0%	1	K.KFGTVNIVHPK.L
*	TK251102_lung_cytoE16_2_step09.3661.3661.2	1.4435	0.0534	1301.61	2	5000.0%	5	R.GLGISVLEMSHR.S
*	TK251102_lung_cytoE16_2_step01.3590.3590.1	1.0108	0.0124	1357.99	4	4170.0%	1	R.SADYVVTGAWSAK.A
	TK251102_lung_cytoE16_2_step10.3482.3482.1	2.0255	0.2237	1278.61	3	4500.0%	5	K.LPHSVLLEIQK.Q
*	TK251102_lung_cytoE16_2_step06.2652.2652.2	2.1561	0.3364	1112.58	1	7220.0%	2	K.FGTVNIVHPK.L
*	TK251102_lung_cytoE16_2_step09.1523.1523.3	1.4687	0.1363	2271.08	491	1970.0%	1	K.IIGNTENLVRELLAVPNNYK.V
UQ9WV3998.6%574.9%11401268815.3(Q9WV39) Damage-specific DNA binding protein 1
	TK251102_lung_cytoE16_2_step05.4071.4071.2	2.9664	0.4357	1204.63	2	6670.0%	1	K.IAVMELFRPK.G
*	TK251102_lung_cytoE16_2_step06.3938.3938.2	1.3344	0.064	1687.59	3	3570.0%	1	R.LKIYVVTAEGLRPVK.E
	TK251102_lung_cytoE16_2_step10.4857.4857.2	1.5622	0.1078	2650.5	1	2610.0%	1	R.KTEPATGFIDGDLIESFLDISRPK.M
	TK251102_lung_cytoE16_2_step05.2988.2988.1	1.3999	0.1572	976.53	3	6670.0%	2	K.IEHSFWR.S
UFAS_MOUSE98.5%224015.8%838912137.7(P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment)
	TK251102_lung_cytoE16_2_step08.3170.3170.2	2.4592	0.3533	950.15	1	8750.0%	1	K.AVAHILGIR.D
	TK251102_lung_cytoE16_2_step11.5202.5202.2	1.4849	0.169	3036.98	3	2040.0%	1	R.DTSFEQHVLLHTGGKGVDLVLNSLAEEK.L
	TK251102_lung_cytoE16_2_step04.1505.1505.1	1.1907	0.0591	860.58	14	5830.0%	2	K.TFCPAHK.S
	TK251102_lung_cytoE16_2_step09.1447.1447.1	0.7546	0.0597	416.63	6	5000.0%	3	K.AGIR.D
	TK251102_lung_cytoE16_2_step08.4210.4210.3	1.065	0.036	3227.27	12	1120.0%	1	R.DLAGINLDSTLADLGLDSLMGVEVRQILER.E
	TK251102_lung_cytoE16_2_step06.2422.2422.2	2.6607	0.4068	1262.47	1	6500.0%	1	K.VSVHIIEGDHR.T
	TK251102_lung_cytoE16_2_step05.4840.4840.2	2.5116	0.4561	2449.44	1	3640.0%	1	R.TLLEGSGLESIINIIHSSLAEPR.V
	TK251102_lung_cytoE16_2_step09.1473.1473.1	0.6835	0.339	425.66	4	7500.0%	2	K.HIR.E
	TK251102_lung_cytoE16_2_step03.2787.2787.2	2.4108	0.2875	1671.2	1	5000.0%	2	R.DTSFEQHVLLHTGGK.G
	TK251102_lung_cytoE16_2_step08.2707.2707.1	1.5129	0.1707	1074.66	4	5620.0%	2	K.YHGNVTLLR.A
	TK251102_lung_cytoE16_2_step02.1639.1639.1	1.9831	0.306	952.47	1	6430.0%	2	R.KLQEMSSK.T
UCOF2_MOUSE98.5%2213.9%166187107.9(P45591) Cofilin, muscle isoform (Cofilin 2)
	TK251102_lung_cytoE16_2_step07.2070.2070.1	1.2568	0.0337	693.85	3	7000.0%	1	K.KFTGIK.H
	TK251102_lung_cytoE16_2_step11.4713.4713.2	2.5986	0.4443	1990.23	1	4380.0%	1	K.KEDLVFIFWAPESAPLK.S
UQ9NYE598.5%886.1%27252910206.0(Q9NYE5) Gamma-filamin
	TK251102_lung_cytoE16_2_step06.5406.5406.3	1.0959	0.0166	2404.17	42	1300.0%	1	K.VCAYGPGLKGGLVGTPAPFSIDTK.G
	TK251102_lung_cytoE16_2_step12.2716.2716.2	1.0408	0.0784	2111.33	122	1840.0%	1	R.DAGEGLLTVQILDPEGKPKK.A
	TK251102_lung_cytoE16_2_step10.3391.3391.2	1.3491	0.0096	2094.11	1	3680.0%	1	R.LSGGHSLHETSTVLVETVTK.S
	TK251102_lung_cytoE16_2_step08.3051.3051.2	2.2905	0.4662	1714.95	1	5000.0%	1	R.TGVEVGKPTHFTVLTK.G
	TK251102_lung_cytoE16_2_step06.1476.1476.1	1.1587	0.0441	624.67	4	7000.0%	1	K.VAGLHK.V
	TK251102_lung_cytoE16_2_step11.4805.4805.2	1.3186	0.0229	2009.72	14	2350.0%	1	K.HTIIISWGGVNVPKSPFR.V
	TK251102_lung_cytoE16_2_step09.3601.3601.3	1.0676	0.0562	4564.15	22	940.0%	1	R.CTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACR.A
	TK251102_lung_cytoE16_2_step04.3181.3181.3	1.284	0.0451	2402.53	54	1710.0%	1	K.GEVVRDFEIIDNHDYSYTVK.Y
UQ91YR598.5%354.3%698787576.8(Q91YR5) Hypothetical 78.8 kDa protein
*	TK251102_lung_cytoE16_2_step08.2747.2747.2	2.2866	0.4649	1699.64	1	5000.0%	2	R.YTLHVVDNPAVKPSR.D
*	TK251102_lung_cytoE16_2_step06.4368.4368.2	1.4936	0.0187	1711.5	6	3570.0%	1	K.LATPELLEMAQVLER.T
URSU1_MOUSE98.4%81418.4%277315508.9(Q01730) Ras suppressor protein 1 (Rsu-1) (RSP-1)
	TK251102_lung_cytoE16_2_step10.1641.1641.2	2.5819	0.4491	1277.82	1	7500.0%	1	R.HMQANPEPPKK.N
	TK251102_lung_cytoE16_2_step10.2882.2882.2	1.4462	0.0426	2028.77	3	2940.0%	1	R.DNDLISLPKEIGELTQLK.E
	TK251102_lung_cytoE16_2_step12.1912.1912.2	1.2841	0.03	1150.17	11	5000.0%	1	R.HMQANPEPPK.K
	TK251102_lung_cytoE16_2_step04.1896.1896.1	0.8745	0.0155	627.37	20	5000.0%	1	R.KPLAAK.N
	TK251102_lung_cytoE16_2_step02.1842.1842.1	2.3513	0.1817	968.4	1	7140.0%	3	K.ELHIQGNR.L
	TK251102_lung_cytoE16_2_step08.2486.2486.1	1.2284	0.0801	954.56	7	5710.0%	1	K.HLNLGMNR.L
UQ8VHX898.4%1124.3%115126634.5(Q8VHX8) Filamin A (Fragment)
*	TK251102_lung_cytoE16_2_step02.3737.3737.2	2.5408	0.446	2964.41	1	3330.0%	1	R.FGGEHVPNSPFQVTALAGDQPTVQTPLR.S
UCUL3_MOUSE98.4%8166.2%768889488.4(Q9JLV5) Cullin homolog 3 (CUL-3)
	TK251102_lung_cytoE16_2_step01.0530.0530.1	0.934	0.041	515.51	35	6670.0%	1	R.ELVR.A
	TK251102_lung_cytoE16_2_step07.1478.1478.1	1.1282	0.0824	624.64	15	6250.0%	1	K.QHLAR.R
	TK251102_lung_cytoE16_2_step08.0893.0893.1	0.7572	0.22	416.8	1	5000.0%	3	R.GAIR.N
	TK251102_lung_cytoE16_2_step07.5256.5256.3	1.1294	0.0249	1951.04	134	1320.0%	1	K.KEDGSEVGVGGAQVTGSNTR.K
	TK251102_lung_cytoE16_2_step06.3673.3673.2	2.8179	0.4393	1740.41	1	6070.0%	2	K.MQHNVLVAEVTQQLK.A
UQ99LF498.4%6812.1%505552497.2(Q99LF4) Hypothetical 55.2 kDa protein
	TK251102_lung_cytoE16_2_step03.3395.3395.2	1.1274	0.0537	1641.75	2	4330.0%	2	R.GLGHQVATDALVAMEK.A
	TK251102_lung_cytoE16_2_step10.3119.3119.2	1.1077	0.0138	1859.48	67	2190.0%	1	K.NVTDVVNTCHDAGISKK.A
	TK251102_lung_cytoE16_2_step11.2310.2310.2	2.285	0.1879	910.29	4	7860.0%	1	K.LRPIAVIK.G
	TK251102_lung_cytoE16_2_step08.3203.3203.2	2.4544	0.4599	1445.58	1	5770.0%	1	K.QIGNVAALPGIVHR.S
	TK251102_lung_cytoE16_2_step06.2230.2230.1	1.2005	0.2757	738.54	11	6000.0%	1	R.TLLVHR.K
UQ9CSP098.3%112.5%403440799.6(Q9CSP0) 2700023B17Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step05.1728.1728.1	1.6248	0.3361	1238.77	2	5560.0%	1	K.VPRPENEQLR.N
UCLI1_MOUSE98.3%5173.7%241270135.2(Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP)
	TK251102_lung_cytoE16_2_step07.2807.2807.1	2.3688	0.225	1097.53	1	7500.0%	4	K.LHIVQVVCK.K
UDPY4_MOUSE98.3%113.5%572619627.0(O35098) Dihydropyrimidinase related protein-4 (DRP-4) (ULIP4 protein)
	TK251102_lung_cytoE16_2_step06.2744.2744.2	2.3268	0.4558	2140.87	1	4210.0%	1	R.NLHQSGFSLSGSQADDHIAR.R
UO5520198.3%577.2%10821206645.0(O55201) Chromatin structural protein homolog Supt5hp (Similar to suppressor of Ty (S.cerevisiae) 5 homolog)
	TK251102_lung_cytoE16_2_step12.1673.1673.3	1.2923	0.122	2240.84	26	1620.0%	1	K.SFAMSAVITEGVKPTLSELEK.F
	TK251102_lung_cytoE16_2_step01.0411.0411.3	1.5667	0.0906	2375.33	368	1550.0%	1	R.SLGGDVASDGDFLIFEGNRYSR.K
	TK251102_lung_cytoE16_2_step09.1972.1972.2	1.9367	0.488	1654.02	2	4640.0%	2	R.TPHYGSQTPLHDGSR.T
*	TK251102_lung_cytoE16_2_step11.3874.3874.2	1.372	0.0636	2212.97	132	1580.0%	1	R.QRLTTVDSQRPGGMTSTYGR.T
UQ9D6F998.3%5179.9%444495284.9(Q9D6F9) Tubulin, beta 4
	TK251102_lung_cytoE16_2_step01.3816.3816.2	1.1692	0.0262	3118.45	8	1920.0%	1	K.FWEVISDEHGIDPTGTYHGDSDLQLER.I
	TK251102_lung_cytoE16_2_step04.2145.2145.2	1.8459	0.054	1824.49	1	3750.0%	4	R.EIVHLQAGQCGNQIGAK.F
UCAN2_MOUSE98.2%577.0%700798725.0(O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80)
	TK251102_lung_cytoE16_2_step06.0016.0016.3	1.4922	0.0272	2900.73	3	2100.0%	1	K.DGELLFVHSAEGSEFWSALLEKAYAK.I
	TK251102_lung_cytoE16_2_step08.4450.4450.1	1.401	0.0184	1468.69	62	3500.0%	1	K.EFYILWTKIQK.Y
*	TK251102_lung_cytoE16_2_step11.2381.2381.1	1.9107	0.2868	1435.06	3	4090.0%	1	K.LPCQLHQVIVAR.F
UQ8WZA098.2%1114.7%190214954.9(Q8WZA0) Leucine zipper & ICAT homologous protein LZIC
*	TK251102_lung_cytoE16_2_step06.4904.4904.2	2.4724	0.4531	2970.1	1	3150.0%	1	K.IMSGNMTLVDELSGMQLAIQAAISQAFK.T
UUBPA_MOUSE98.2%469.8%793870935.2(P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15) (Ubiquitin thiolesterase 10) (Ubiquitin-specific processing protease 10) (Deubiquitinating enzyme 10)
*	TK251102_lung_cytoE16_2_step11.2416.2416.3	1.3064	0.0234	3878.69	15	1070.0%	1	K.SWASLFHDSKPSASSPMAYVETKCSPPVPSPLASEK.Q
*	TK251102_lung_cytoE16_2_step12.4207.4207.3	1.2874	0.0696	2670.54	91	1190.0%	1	K.VINQYQVVKPPADRTAYLLYYR.R
*	TK251102_lung_cytoE16_2_step11.4412.4412.2	2.4773	0.4505	2260.37	1	3160.0%	2	K.IAELLETVTLIHKPVSLQPR.G
UPAK3_MOUSE98.2%61211.8%544606845.5(Q61036) Serine/threonine-protein kinase PAK 3 (EC 2.7.1.-) (p21-activated kinase 3) (PAK-3) (Beta-PAK) (CDC42/RAC effector kinase PAK-B)
	TK251102_lung_cytoE16_2_step04.3111.3111.1	2.0127	0.263	1227.64	1	5000.0%	3	K.KNPQAVLDVLK.F
	TK251102_lung_cytoE16_2_step11.4134.4134.2	1.462	0.1674	1636.78	1	3670.0%	1	K.LAKPLSSLTPLIIAAK.E
	TK251102_lung_cytoE16_2_step10.4925.4925.3	1.2287	0.1331	4230.03	28	1180.0%	1	K.EKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWAR.L
UFSC1_MOUSE98.2%112517.9%492542746.7(Q61553) Fascin (Singed-like protein)
	TK251102_lung_cytoE16_2_step03.3385.3385.2	0.7996	0.0675	2373.29	31	2000.0%	1	K.KQIWTLEQPPDEAGSAAVCLR.T
*	TK251102_lung_cytoE16_2_step08.3030.3030.3	1.5083	0.0547	2270.57	2	2240.0%	1	R.HDGRLVARPEPATGFTLEFR.S
	TK251102_lung_cytoE16_2_step08.2614.2614.2	1.2179	0.0249	2815.5	1	1960.0%	1	R.QGMDLSANQDEETDQETFQLEIDR.D
	TK251102_lung_cytoE16_2_step01.3415.3415.1	1.731	0.3276	1148.09	1	7220.0%	1	K.YLTAEAFGFK.V
*	TK251102_lung_cytoE16_2_step01.3040.3040.3	0.7477	0.0795	3187.35	3	670.0%	1	R.QGMDLSANQDEETDQETFQLEIDRDTR.K
*	TK251102_lung_cytoE16_2_step08.3822.3822.2	2.4444	0.1824	1806.86	1	4670.0%	4	R.LVARPEPATGFTLEFR.S
	TK251102_lung_cytoE16_2_step02.1697.1697.1	1.8011	0.3109	1074.67	10	5000.0%	2	R.KVTGTLDANR.S
UO5472498.2%4411.5%392439545.5(O54724) Polymerase I-transcript release factor (Polymerase I and transcript release factor)
	TK251102_lung_cytoE16_2_step10.1383.1383.2	0.8432	0.0839	1804.01	43	2500.0%	1	R.QAEMEGAVQSIQGELSK.L
	TK251102_lung_cytoE16_2_step08.2335.2335.2	1.2136	0.1526	1420.06	308	3180.0%	1	R.KSFTPDHVVYAR.S
	TK251102_lung_cytoE16_2_step05.1709.1709.1	1.5468	0.1439	773.6	3	7500.0%	1	R.KVSVNVK.T
	TK251102_lung_cytoE16_2_step11.3058.3058.1	1.8864	0.3267	1073.57	1	6250.0%	1	K.VPPFTFHVK.K
UCAZ2_MOUSE98.1%71933.6%286329675.8(P47754) F-actin capping protein alpha-2 subunit (CapZ alpha-2)
	TK251102_lung_cytoE16_2_step12.3993.3993.3	1.007	0.0066	4275.22	22	1050.0%	1	R.EGAAHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGK.F
*	TK251102_lung_cytoE16_2_step06.2530.2530.3	1.7921	0.1565	3604.07	50	1210.0%	1	K.FTVTPSTTQVVGILKIQVHYYEDGNVQLVSHK.D
	TK251102_lung_cytoE16_2_step11.2716.2716.3	1.2598	0.0030	2787.06	27	1560.0%	1	K.IEGYEDQVLITEHGDLGNGKFLDPK.N
*	TK251102_lung_cytoE16_2_step08.3687.3687.2	1.6807	0.1368	2305.05	1	3950.0%	4	K.KVDGQQTIIACIESHQFQAK.N
URS5_MOUSE98.1%71332.8%204228899.7(P97461) 40S ribosomal protein S5
	TK251102_lung_cytoE16_2_step05.1757.1757.1	1.4142	0.1159	1102.69	7	5000.0%	3	R.KAQCPIVER.L
	TK251102_lung_cytoE16_2_step05.2224.2224.2	2.3751	0.4479	1179.33	1	7220.0%	1	R.LTNSMMMHGR.N
*	TK251102_lung_cytoE16_2_step08.2149.2149.3	1.4477	0.094	2404.21	3	2140.0%	1	-.MTEWEAATPAVAETPDIKLFGK.W
*	TK251102_lung_cytoE16_2_step01.5116.5116.2	1.6742	0.1297	1999.5	1	3820.0%	1	R.NIKNIAECLADELINAAK.G
	TK251102_lung_cytoE16_2_step07.1642.1642.1	1.1988	0.023	900.57	3	6430.0%	1	K.YLPHSAGR.Y
UQ9CZH098.1%113.7%321365515.6(Q9CZH0) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700098C24, full insert sequence
	TK251102_lung_cytoE16_2_step06.1618.1618.1	1.5861	0.3469	1309.59	1	5000.0%	1	R.AHLNAQAACTPR.R
UR23B_MOUSE98.1%392.6%416435174.8(P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58)
	TK251102_lung_cytoE16_2_step09.3412.3412.2	3.0071	0.4125	1262.8	1	8500.0%	3	K.NFVVVMVTKPK.A
UQ9CWU398.0%227.4%367426065.4(Q9CWU3) 2410004D02Rik protein
	TK251102_lung_cytoE16_2_step02.2206.2206.2	1.7241	0.1556	1323.71	8	5500.0%	1	R.YRDPTTVTTLR.V
	TK251102_lung_cytoE16_2_step05.4220.4220.2	2.968	0.4026	1846.7	1	4670.0%	1	R.VPVFRPMDLMVEASPR.R
UMBNL_HUMAN98.0%245.4%388418178.9(Q9NR56) Muscleblind-like protein (Triplet-expansion RNA-binding protein)
*	TK251102_lung_cytoE16_2_step11.4409.4409.2	2.2941	0.4534	2272.99	1	3250.0%	2	K.RPLEATFDLGIPQAVLPPLPK.R
UPTB_MOUSE98.0%101824.7%527564788.3(P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)
	TK251102_lung_cytoE16_2_step04.1457.1457.3	1.6855	0.1296	1956.49	100	2500.0%	1	K.LPSDVTEGEVISLGLPFGK.V
	TK251102_lung_cytoE16_2_step01.4467.4467.2	1.5719	0.3444	2277.84	1	3410.0%	1	R.IAIPGLAGAGNSVLLVSNLNPER.V
*	TK251102_lung_cytoE16_2_step05.0044.0044.3	0.8971	0.0082	4671.17	92	530.0%	1	K.TDSSPNQVRAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR.I
	TK251102_lung_cytoE16_2_step06.2866.2866.2	1.8803	0.0487	1433.8	1	6820.0%	3	R.GQPIYIQFSNHK.E
	TK251102_lung_cytoE16_2_step02.4798.4798.2	2.5617	0.4382	2489.92	1	3250.0%	1	R.IIVENLFYPVTLDVLHQIFSK.F
	TK251102_lung_cytoE16_2_step01.0419.0419.1	1.0711	0.0495	673.5	153	5000.0%	1	R.SAGVPSR.V
UMY9B_HUMAN97.9%10402.3%21582435558.7(Q13459) Myosin IXb (Unconventional myosin-9b)
*	TK251102_lung_cytoE16_2_step11.2184.2184.2	1.0026	0.0046	1499.63	17	3640.0%	1	K.IQSHCSYTYGRK.G
*	TK251102_lung_cytoE16_2_step08.0846.0846.1	0.4804	0.1222	487.84	7	3750.0%	1	K.EPGGK.G
*	TK251102_lung_cytoE16_2_step01.2760.2760.1	1.6554	0.0075	1157.86	2	6250.0%	6	K.YLDEFLLNK.I
*	TK251102_lung_cytoE16_2_step08.1891.1891.1	0.7732	0.0551	668.45	4	6250.0%	1	K.NLKHR.F
*	TK251102_lung_cytoE16_2_step05.2981.2981.2	0.8586	0.1879	2079.03	3	1940.0%	1	K.LGFSSPYEGVLNKSPQVPR.D
UVAA1_HUMAN97.9%116.3%617683045.5(P38606) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) (Isoform VA68)
*	TK251102_lung_cytoE16_2_step11.5021.5021.3	2.9106	0.4978	4146.08	1	1710.0%	1	R.TGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.G
UQ9Z13097.9%4414.0%301335597.3(Q9Z130) JKTBP (Heterogeneous nuclear ribonucleoprotein D-like)
	TK251102_lung_cytoE16_2_step07.1784.1784.1	0.7464	0.0242	746.5	11	6000.0%	1	K.KLLESR.Y
	TK251102_lung_cytoE16_2_step01.0843.0843.1	1.3991	0.0268	586.44	17	7500.0%	1	K.LIDPK.R
	TK251102_lung_cytoE16_2_step04.4669.4669.2	0.8141	0.1816	2704.11	7	1360.0%	1	K.EYFGAFGEIENIELPMDTKTNER.R
	TK251102_lung_cytoE16_2_step05.1544.1544.1	1.5725	0.3376	890.07	1	6430.0%	1	R.YHQIGSGK.C
UQ9H1B797.9%337.2%796826598.2(Q9H1B7) Polyglutamine-containing protein
*	TK251102_lung_cytoE16_2_step07.5258.5258.2	1.0732	0.0531	1419.12	81	3210.0%	1	R.QSPNSSSAAASVASR.R
*	TK251102_lung_cytoE16_2_step10.2102.2102.3	1.2872	0.146	2300.21	19	1600.0%	1	R.APSAPPGTGALPPAAPSGRGAAASLR.K
	TK251102_lung_cytoE16_2_step03.2234.2234.2	2.9139	0.4184	1881.57	1	4330.0%	1	R.LEDTHFVQCPSVPSHK.F
UPFD5_MOUSE97.9%62016.9%154173566.3(Q9WU28) Prefoldin subunit 5 (C-myc binding protein Mm-1) (Myc modulator 1) (EIG-1)
	TK251102_lung_cytoE16_2_step08.3978.3978.2	2.9012	0.4071	2189.32	1	4170.0%	4	K.LHDVEHVLIDVGTGYYVEK.T
	TK251102_lung_cytoE16_2_step03.2795.2795.1	1.3732	0.0671	867.49	13	5830.0%	2	R.KIDFLTK.Q
UQ9CR1597.9%6624.5%408457956.2(Q9CR15) 1110014J22Rik protein
*	TK251102_lung_cytoE16_2_step06.1765.1765.1	1.3885	0.1736	920.56	21	5710.0%	1	R.LQANPHLK.E
*	TK251102_lung_cytoE16_2_step12.3849.3849.3	1.3571	0.0466	2772.9	193	1410.0%	1	K.FTEPRMTPTDDSDPWWAAFSGACK.A
*	TK251102_lung_cytoE16_2_step05.3244.3244.2	2.9008	0.3924	1797.62	1	4670.0%	1	R.TIHMTFVPDEEVGGHK.G
*	TK251102_lung_cytoE16_2_step08.2311.2311.1	1.3683	0.2352	1330.62	1	4000.0%	1	R.TPVLLHDHNER.L
*	TK251102_lung_cytoE16_2_step01.6198.6198.2	0.7299	0.061	3091.07	56	1250.0%	1	K.LEGGVAYNVVPATMSASFDFRVAPDVDMK.A
*	TK251102_lung_cytoE16_2_step11.2888.2888.2	1.4572	0.0625	1581.31	2	5450.0%	1	K.EHWHHDPFEAFK.D
UQ1283997.9%449.5%597663855.2(Q12839) H326 protein
*	TK251102_lung_cytoE16_2_step06.1418.1418.1	0.8479	0.101	738.65	2	7000.0%	1	K.RVAQHK.G
	TK251102_lung_cytoE16_2_step08.2778.2778.2	2.8751	0.4268	1414.33	1	8640.0%	1	R.RQPVLDFESGHK.S
*	TK251102_lung_cytoE16_2_step12.4321.4321.3	1.1147	0.0661	4289.73	2	860.0%	1	K.SSCQIIQFMEGDKGGVVNCLEPHPHLPVLATSGLDHDVK.I
UQ9DAH097.9%4416.8%279319247.6(Q9DAH0) Four and a half LIM domains 4
*	TK251102_lung_cytoE16_2_step08.1346.1346.1	0.8852	0.0602	698.87	15	5000.0%	1	K.EVCYK.E
*	TK251102_lung_cytoE16_2_step10.5285.5285.3	1.2422	0.0045	3436.47	20	1250.0%	1	K.CKKPITSGGVSYQDQPWHSECFVCVSCSK.E
	TK251102_lung_cytoE16_2_step01.2027.2027.1	1.5121	0.395	833.93	1	6430.0%	1	K.NPITGFGK.G
	TK251102_lung_cytoE16_2_step04.1307.1307.1	1.2125	0.0257	665.53	1	7500.0%	1	K.KYVQK.D
UGTA4_MOUSE97.8%6149.0%222255647.4(P24472) Glutathione S-transferase 5.7 (EC 2.5.1.18) (GST 5.7) (GST class-alpha) (GST A4-4) (GSTA4-4)
	TK251102_lung_cytoE16_2_step02.4255.4255.1	0.8635	0.0239	931.44	57	4170.0%	1	R.YFPVFEK.I
*	TK251102_lung_cytoE16_2_step05.2487.2487.2	1.6379	0.1589	1453.6	7	4580.0%	3	R.KPPPDGPYVEVVR.T
URL24_HUMAN97.8%4617.2%1571777911.3(P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30)
	TK251102_lung_cytoE16_2_step08.1609.1609.1	0.9593	0.0689	682.62	1	6000.0%	1	K.IVKPVK.V
	TK251102_lung_cytoE16_2_step01.2967.2967.1	1.5364	0.1631	968.72	6	6430.0%	2	K.VFQFLNAK.C
	TK251102_lung_cytoE16_2_step01.3231.3231.1	2.0192	0.3173	1263.72	1	5830.0%	1	R.AITGASLADIMAK.R
URL10_MOUSE97.8%124422.1%2132447310.1(P45634) 60S ribosomal protein L10 (QM protein homolog)
	TK251102_lung_cytoE16_2_step05.1893.1893.1	1.5064	0.2777	1190.7	2	4090.0%	6	R.GAFGKPQGTVAR.V
	TK251102_lung_cytoE16_2_step09.2249.2249.1	1.246	0.0675	1178.51	27	3890.0%	1	K.SCGKDGFHIR.V
	TK251102_lung_cytoE16_2_step12.2564.2564.2	1.1208	0.1405	1019.34	1	6430.0%	1	R.LHPFHVIR.I
	TK251102_lung_cytoE16_2_step07.2668.2668.1	1.3301	0.2018	766.68	1	7000.0%	1	K.KWGFTK.F
	TK251102_lung_cytoE16_2_step11.3334.3334.1	1.247	0.0733	1254.96	4	4500.0%	2	R.VHIGQVIMSIR.T
USNXC_MOUSE97.8%396.7%165191167.3(O70493) Sorting nexin 12 (SDP8 protein)
	TK251102_lung_cytoE16_2_step07.1724.1724.1	1.9756	0.2002	1207.67	4	5000.0%	3	K.IAGHPLAQNER.C
UTEBP_MOUSE97.8%51114.4%160187214.5(Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23)
	TK251102_lung_cytoE16_2_step01.2835.2835.1	1.0898	0.1948	1446.88	1	4170.0%	1	K.LTFSCLGGSDNFK.H
	TK251102_lung_cytoE16_2_step03.1850.1850.1	1.93	0.2711	1133.57	1	5560.0%	3	R.KGESGQSWPR.L
ULEG1_MOUSE97.8%2220.1%134147355.5(P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin)
	TK251102_lung_cytoE16_2_step02.2709.2709.2	2.2513	0.4516	1487.63	1	5910.0%	1	K.DSNNLCLHFNPR.F
	TK251102_lung_cytoE16_2_step02.2002.2002.2	2.2844	0.2714	1664.26	1	5710.0%	1	R.FNAHGDANTIVCNTK.E
UQ9JM6597.8%246.8%308345675.1(Q9JM65) Nonclathrin coat protein epsilon-COP (Coatomer protein complex, subunit epsilon)
*	TK251102_lung_cytoE16_2_step05.3579.3579.2	2.0433	0.1266	2300.69	2	3250.0%	2	R.KYGVVLDEIKPSSAPELQAVR.M
UPSB5_MOUSE97.7%4424.4%209229678.5(O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6)
	TK251102_lung_cytoE16_2_step09.3640.3640.3	1.9261	0.0567	2797.34	2	1880.0%	1	K.KVIEINPYLLGTMAGGAADCSFWER.L
	TK251102_lung_cytoE16_2_step11.3734.3734.2	1.2488	0.0037	2669.93	4	1960.0%	1	K.VIEINPYLLGTMAGGAADCSFWER.L
	TK251102_lung_cytoE16_2_step05.2560.2560.1	1.0863	0.0315	1582.66	2	3080.0%	1	K.RGPGLYYVDSEGNR.I
	TK251102_lung_cytoE16_2_step07.3120.3120.2	2.4543	0.4369	1285.49	1	7730.0%	1	K.FLHGVIVAADSR.A
UKCRB_MOUSE97.7%155319.9%381427135.7(Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK)
	TK251102_lung_cytoE16_2_step03.2006.2006.1	1.8424	0.2684	985.45	4	5000.0%	3	R.GIWHNDNK.T
*	TK251102_lung_cytoE16_2_step11.3217.3217.2	2.6158	0.4019	2456.72	1	4250.0%	1	K.LRFPAEDEFPDLSSHNNHMAK.V
	TK251102_lung_cytoE16_2_step01.3278.3278.1	1.2162	0.1363	1306.16	1	5500.0%	1	K.VLTPELYAELR.A
*	TK251102_lung_cytoE16_2_step05.1428.1428.1	1.3149	0.1959	1254.35	1	4500.0%	1	R.HGGYQPSDEHK.T
	TK251102_lung_cytoE16_2_step06.1712.1712.1	1.0701	0.0072	624.67	56	4000.0%	1	R.AGVHIK.L
*	TK251102_lung_cytoE16_2_step05.4337.4337.2	2.0164	0.4172	1674.81	1	5000.0%	6	K.TFLVWINEEDHLR.V
*	TK251102_lung_cytoE16_2_step11.1776.1776.1	1.113	0.103	666.52	1	6000.0%	2	K.LPHLGK.H
UQ9D7M397.6%359.4%341377735.9(Q9D7M3) 2310002N04Rik protein (RIKEN cDNA 2310002N04 gene)
*	TK251102_lung_cytoE16_2_step11.1301.1301.2	2.291	0.4336	1719.72	1	4690.0%	1	R.HPSHSTSPSGPGDEVAR.G
	TK251102_lung_cytoE16_2_step03.4307.4307.2	0.6943	0.0454	1737.72	2	2140.0%	2	K.LRPPGAEKPSWLEEQ.-
UICAL_MOUSE97.6%8821.2%788849225.5(P51125) Calpain inhibitor (Calpastatin)
	TK251102_lung_cytoE16_2_step09.4344.4344.3	1.4775	0.2106	2079.93	4	2790.0%	1	K.CGEDEDTVPAEYRLKPAK.D
	TK251102_lung_cytoE16_2_step10.3514.3514.2	1.1268	0.0202	2285.31	12	1820.0%	1	K.LASLKGVVPEDAVETLAGSLGTR.E
	TK251102_lung_cytoE16_2_step11.3585.3585.3	1.0647	0.0088	3765.76	108	860.0%	1	K.NEGITQPLPDSPKPMGTDQAIDALSSDFTCSSPTGK.Q
*	TK251102_lung_cytoE16_2_step10.2019.2019.2	2.164	0.4913	2123.97	1	2860.0%	1	K.AASLGSSQPSRPHVGEAATATK.V
*	TK251102_lung_cytoE16_2_step10.3227.3227.3	1.3415	0.0215	3027.81	38	1530.0%	1	K.AASLGSSQPSRPHVGEAATATKVTASSAATSK.S
	TK251102_lung_cytoE16_2_step01.0487.0487.1	0.7924	0.0257	614.47	23	5000.0%	1	R.SSVPPK.E
	TK251102_lung_cytoE16_2_step05.2100.2100.2	1.6748	0.2653	2256.62	1	3500.0%	1	K.EQKPFTPASPVQSTPSKPSDK.S
	TK251102_lung_cytoE16_2_step01.3092.3092.3	1.125	2.0E-4	3101.75	22	1080.0%	1	K.LSAAISEVVSQTPAPSTHAAAPLPGTEQKDK.E
UQ9CRE797.4%82015.3%354399855.5(Q9CRE7) 2410174K12Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step05.2864.2864.1	1.6293	0.0366	1076.58	3	5000.0%	1	R.AYCHILLGK.Y
*	TK251102_lung_cytoE16_2_step07.3503.3503.1	2.346	0.2662	1524.78	2	4580.0%	1	R.LLHPIIPEQSTFK.V
*	TK251102_lung_cytoE16_2_step11.2416.2416.2	0.8989	0.1	2586.13	24	1500.0%	1	K.YDWYQTESHVIITLMIKSVQK.N
*	TK251102_lung_cytoE16_2_step02.1885.1885.1	1.3309	0.1605	1342.45	6	4000.0%	1	K.NMYPSSSHYTR.N
UP7834497.4%223.4%9071023627.1(P78344) Eukaryotic translation initiation factor 4 gamma 2 (P97) (Death associated protein 5) (DAP-5) (Translation repressor NAT1)
*	TK251102_lung_cytoE16_2_step04.1253.1253.1	0.9321	0.0392	793.54	111	5000.0%	1	R.FSPTMGR.H
*	TK251102_lung_cytoE16_2_step05.3568.3568.2	2.7638	0.4226	2630.12	1	3910.0%	1	K.SQGLSQLYHNQSQGLLSQLQGQSK.D
UU2AG_MOUSE97.4%115.9%239278158.8(Q9D883) Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 snRNP auxiliary factor small subunit)
	TK251102_lung_cytoE16_2_step12.3407.3407.2	3.0391	0.3507	1666.29	1	5380.0%	1	R.GGFCNFMHLKPISR.E
UMGD1_MOUSE97.4%4412.6%775856707.5(Q9QYH6) Melanoma-associated antigen D1 (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) (Dlxin-1)
*	TK251102_lung_cytoE16_2_step04.4560.4560.3	1.4084	0.1386	3408.14	2	1640.0%	1	R.FPQAFTGPIIGPSGTATANFAANFGAIGFFWVE.-
	TK251102_lung_cytoE16_2_step05.2616.2616.3	1.5628	0.1303	2750.84	246	1700.0%	1	R.VPNSNPPEYEFLWGLRSYHETSK.M
	TK251102_lung_cytoE16_2_step05.2420.2420.3	1.4228	0.1659	2874.93	30	1500.0%	1	K.EIDKEEHLYILISTPESLAGILGTTK.D
*	TK251102_lung_cytoE16_2_step03.1714.1714.1	1.5589	0.3258	1541.73	1	3670.0%	1	K.GPHAASDFSQAAPTGK.S
UQ8VCF497.3%335.9%4765708810.8(Q8VCF4) Similar to hypothetical protein FLJ13213
	TK251102_lung_cytoE16_2_step10.1753.1753.1	1.0225	0.1508	631.49	118	4000.0%	1	R.DTSGPR.K
*	TK251102_lung_cytoE16_2_step12.1644.1644.2	2.6945	0.41	1642.92	1	6150.0%	1	R.TVILHDRPEVAHPR.H
	TK251102_lung_cytoE16_2_step08.1291.1291.2	0.7028	0.1479	992.37	10	2860.0%	1	R.HVVERHGR.D
UQ8R50997.2%9199.1%528567549.2(Q8R509) Polypirimidine tract binding protein
*	TK251102_lung_cytoE16_2_step04.2767.2767.2	1.5519	0.2442	1436.4	1	5910.0%	2	R.GQPNYIQFSNHK.E
	TK251102_lung_cytoE16_2_step06.2845.2845.3	1.3382	0.0247	2987.64	13	1760.0%	1	K.ENALVQMADGSQAQLAMSHLNGHKLHGK.S
	TK251102_lung_cytoE16_2_step07.2016.2016.2	2.2002	0.4439	965.34	1	7860.0%	1	K.HQSVQLPR.E
UARS1_MOUSE97.2%61410.9%348388234.9(O54984) Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA)
	TK251102_lung_cytoE16_2_step09.3825.3825.3	1.4968	0.1555	3232.34	13	1610.0%	1	K.GMNFSVVVFDTAPTGHTLRLLNFPTIVER.G
	TK251102_lung_cytoE16_2_step09.3204.3204.2	2.1899	0.4314	1074.34	1	8120.0%	2	K.LPLLPHEVR.G
UQ9P0H797.2%7910.6%12301363615.8(Q9P0H7) TIP120 protein
	TK251102_lung_cytoE16_2_step08.3955.3955.3	1.1745	0.0981	4566.11	73	1090.0%	1	K.IDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYK.I
	TK251102_lung_cytoE16_2_step07.1531.1531.1	0.5404	0.1407	858.25	43	4170.0%	1	K.ALHKQMK.E
	TK251102_lung_cytoE16_2_step12.4759.4759.2	1.2455	0.0232	2043.78	2	2500.0%	1	K.TVIGELPPASSGSALAANVCK.K
	TK251102_lung_cytoE16_2_step08.0079.0079.3	1.4628	0.2811	3877.26	12	1360.0%	1	K.EIISSASVVGLKPYVENIWALLLKHCECAEEGTR.N
	TK251102_lung_cytoE16_2_step11.2656.2656.2	1.1205	0.0919	1734.22	12	3000.0%	2	R.MLTGPVYSQSTALTHK.Q
	TK251102_lung_cytoE16_2_step12.3395.3395.2	1.0245	0.1216	1550.95	44	3180.0%	1	R.EYCIQAFESFVR.R
UQ9CQU797.2%227.9%177192088.1(Q9CQU7) 4833408F11Rik protein (1100001J08Rik protein) (Peptidyl prolyl isomerase H) (Cyclophilin H)
	TK251102_lung_cytoE16_2_step10.1863.1863.2	2.678	0.2886	1537.3	1	6540.0%	1	R.KIENVPTGPNNKPK.L
UVASP_MOUSE97.2%468.8%376398258.5(P70460) Vasodilator-stimulated phosphoprotein (VASP)
	TK251102_lung_cytoE16_2_step04.1973.1973.1	0.9678	0.0684	1183.65	7	4500.0%	1	R.KATQVGEKPPK.D
	TK251102_lung_cytoE16_2_step02.2181.2181.1	1.067	0.1553	1138.51	55	3330.0%	1	R.QVWGLNFGSK.E
	TK251102_lung_cytoE16_2_step07.3214.3214.1	1.6349	0.3125	1562.06	2	4090.0%	2	K.YNQATPIFHQWR.D
UR13A_MOUSE97.2%153730.2%2022333311.0(P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen)
	TK251102_lung_cytoE16_2_step05.4231.4231.2	0.9368	0.0371	1982.05	4	3440.0%	1	K.VVVVRCEGINISGNFYR.N
	TK251102_lung_cytoE16_2_step08.1551.1551.1	0.9615	0.0849	606.52	3	8330.0%	1	K.MHYR.K
	TK251102_lung_cytoE16_2_step04.2197.2197.1	1.6337	0.1715	942.5	2	6430.0%	4	R.LAHEVGWK.Y
*	TK251102_lung_cytoE16_2_step06.1549.1549.1	1.0931	0.1667	902.62	29	2860.0%	1	K.RGQAALER.L
	TK251102_lung_cytoE16_2_step03.4190.4190.1	1.0476	0.153	1254.38	74	3000.0%	1	K.YQAVTATLEEK.R
	TK251102_lung_cytoE16_2_step09.2167.2167.1	1.4256	0.0943	652.61	2	7000.0%	3	R.GHLLGR.L
	TK251102_lung_cytoE16_2_step10.2203.2203.1	1.5654	0.1051	778.5	1	6000.0%	2	R.GPYHFR.A
	TK251102_lung_cytoE16_2_step08.1871.1871.1	0.9754	0.0033	699.75	30	5000.0%	2	R.KVVVVR.C
UQ9D0V497.2%4621.0%157177895.2(Q9D0V4) 2700047N05Rik protein
	TK251102_lung_cytoE16_2_step07.2147.2147.1	2.0162	0.3154	880.62	1	6880.0%	2	R.HVALAVGGR.E
	TK251102_lung_cytoE16_2_step01.1454.1454.1	1.033	0.0199	804.76	18	5000.0%	1	R.IVLTKTK.R
	TK251102_lung_cytoE16_2_step11.3338.3338.2	1.6351	0.2096	1969.81	1	3750.0%	1	K.LFDSTIADEGTWTLEDR.K
UQ9CT3897.2%3326.3%175202998.1(Q9CT38) 1110021H02Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step06.4862.4862.2	2.6652	0.4176	2690.35	1	4170.0%	1	K.FGLAHLMALGLGPWLAVEVPDLIQK.G
	TK251102_lung_cytoE16_2_step07.3735.3735.3	1.3701	0.0787	1801.9	23	3120.0%	1	R.WFGKCWYIHDFLK.Y
	TK251102_lung_cytoE16_2_step06.1774.1774.1	1.0186	0.0264	1071.74	6	5000.0%	1	R.ELWVQRLK.E
UQ9CVA397.2%227.5%161183749.1(Q9CVA3) 2210415M20Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step06.3525.3525.2	1.7069	0.1312	1313.44	7	5450.0%	1	K.IVVHLHPAPSNK.E
USMD1_HUMAN97.1%4610.9%1191328211.6(P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen)
	TK251102_lung_cytoE16_2_step04.3059.3059.2	2.6044	0.3052	1556.52	1	6250.0%	2	K.NREPVQLETLSIR.G
	TK251102_lung_cytoE16_2_step08.3899.3899.2	1.3885	0.1097	1287.59	15	5000.0%	1	R.EPVQLETLSIR.G
UO3594597.1%5174.8%501545887.7(O35945) Aldehyde dehydrogenase Ahd-2-like
*	TK251102_lung_cytoE16_2_step09.3453.3453.2	2.0422	0.245	2679.99	1	2610.0%	4	K.YILGNPLNSGINQGPQIDKEQHNK.I
UEFTU_HUMAN97.1%5716.4%452495427.6(P49411) Elongation factor Tu, mitochondrial precursor (P43)
*	TK251102_lung_cytoE16_2_step10.2202.2202.2	1.1194	0.2534	1773.55	65	3570.0%	2	R.HYAHTDCPGHADYVK.N
*	TK251102_lung_cytoE16_2_step12.2287.2287.2	1.8065	0.176	1620.35	4	3570.0%	1	R.GLVMVKPGSIKPHQK.V
*	TK251102_lung_cytoE16_2_step10.4438.4438.3	1.9585	0.0283	3656.73	6	1560.0%	1	K.LLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGR.G
*	TK251102_lung_cytoE16_2_step01.3588.3588.1	0.9811	0.0404	1367.9	24	3500.0%	1	K.YEEIDNAPEER.A
UHS71_MOUSE97.1%4104.4%641699945.6(P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2)
	TK251102_lung_cytoE16_2_step01.3603.3603.2	1.2132	0.0371	2778.91	2	2170.0%	3	K.QTQTFTTYSDNQPGVLIQVYEGER.A
	TK251102_lung_cytoE16_2_step01.1088.1088.1	0.7573	0.038	458.54	6	8330.0%	1	R.LIGR.K
UTBB3_MOUSE97.1%6624.7%450504194.9(Q9ERD7) Tubulin beta-3
	TK251102_lung_cytoE16_2_step06.2036.2036.3	1.2965	0.1066	2171.71	6	1970.0%	1	R.GLKMSSTFIGNSTAIQELFK.R
	TK251102_lung_cytoE16_2_step02.2266.2266.2	0.9342	0.1698	2946.8	19	1110.0%	1	R.TLKLATPTYGDLNHLVSATMSGVTTSLR.F
	TK251102_lung_cytoE16_2_step07.2710.2710.2	0.9554	0.0542	1872.05	1	3000.0%	1	R.MSMKEVDEQMLAIQSK.N
	TK251102_lung_cytoE16_2_step02.4099.4099.3	1.1974	0.1295	3556.43	5	1170.0%	1	R.KECENCDCLQGFQLTHSLGGGTGSGMGTLLISK.V
	TK251102_lung_cytoE16_2_step03.4634.4634.2	2.4367	0.4298	1875.49	1	4380.0%	1	K.MSSTFIGNSTAIQELFK.R
	TK251102_lung_cytoE16_2_step12.4604.4604.2	1.2962	0.24	1607.75	1	3850.0%	1	R.LHFFMPGFAPLTAR.G
USON_MOUSE97.0%683.0%24042614285.6(Q9QX47) SON protein
	TK251102_lung_cytoE16_2_step04.2527.2527.3	1.354	0.1344	2315.78	22	1970.0%	1	K.IEEVLSGVLDTELRYKPDLK.E
	TK251102_lung_cytoE16_2_step01.0207.0207.1	0.8379	7.0E-4	472.68	6	8330.0%	2	R.SPIR.R
*	TK251102_lung_cytoE16_2_step05.2777.2777.1	2.0852	0.3052	1586.6	1	5000.0%	1	K.SHHDGNLESDSFLK.F
*	TK251102_lung_cytoE16_2_step01.3536.3536.1	1.2574	0.0403	1570.1	133	2140.0%	1	R.DKSAASPVVISIPER.A
	TK251102_lung_cytoE16_2_step03.3826.3826.3	1.1911	0.1256	2326.29	1	2240.0%	1	R.LSENAFDLEAMSMLNRAQER.I
UC43B_MOUSE97.0%6616.7%624711115.4(Q9EQG9) Goodpasture antigen-binding protein (EC 2.7.1.37) (GPBP) (Collagen type IV alpha 3 binding protein)
*	TK251102_lung_cytoE16_2_step11.3449.3449.2	2.1281	0.4926	2183.1	1	3160.0%	1	R.LHWPTSLPSGDTFSSVGTHR.F
	TK251102_lung_cytoE16_2_step03.4581.4581.2	1.1509	3.0E-4	1984.06	3	2780.0%	1	K.ITYVANVNPGGWAPASVLR.A
	TK251102_lung_cytoE16_2_step01.3460.3460.3	1.7208	0.0787	2661.47	67	1930.0%	1	K.ATHAVKGVTGHEVCNYFWNVDVR.N
	TK251102_lung_cytoE16_2_step02.3630.3630.2	1.0808	0.0838	2380.17	15	1960.0%	1	R.HGSMVSLVSGASGYSATSTSSFKK.G
	TK251102_lung_cytoE16_2_step09.3500.3500.2	1.431	0.1272	1892.49	32	2650.0%	1	R.SSSMSSIDLVSASDDVHR.F
UQ9R1T297.0%41010.3%350386205.4(Q9R1T2) mRNA similar to human SUA1, complete CDS (2400010M20RIK protein)
*	TK251102_lung_cytoE16_2_step01.3856.3856.2	1.029	0.1143	2984.38	2	1670.0%	1	K.GLTMLDHEQVSPEDPGAQFLIQTGSVGR.N
*	TK251102_lung_cytoE16_2_step05.2651.2651.1	1.7321	0.1639	985.6	1	5710.0%	3	K.KPESFFTK.F
UQ8R3Y896.9%127030.8%289302037.4(Q8R3Y8) Hypothetical 30.2 kDa protein
	TK251102_lung_cytoE16_2_step07.4182.4182.3	1.812	0.1871	3861.97	12	1280.0%	8	R.LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCR.E
	TK251102_lung_cytoE16_2_step05.2495.2495.1	1.0563	0.0703	1193.65	2	4550.0%	1	R.EPGKALASSGFK.Y
	TK251102_lung_cytoE16_2_step09.2641.2641.2	1.6025	0.4179	2136.36	1	4410.0%	1	R.ERLEDTHFVQCPSVPGHK.F
*	TK251102_lung_cytoE16_2_step04.1272.1272.2	2.274	0.4297	1793.49	1	4440.0%	2	R.AGGASPAASSTTQPPAQHR.L
UQ9DC4996.9%115.1%2352510410.3(Q9DC49) Repeat family 3 gene
	TK251102_lung_cytoE16_2_step01.3024.3024.1	2.2213	0.301	1465.94	3	4550.0%	1	K.SPYQEFTDHLVK.T
UQ6116796.8%114.4%225256785.7(Q61167) APC-binding protein EB2 (Fragment)
	TK251102_lung_cytoE16_2_step06.2582.2582.1	1.9638	0.3064	1329.41	1	6110.0%	1	K.LEHEYIHNFK.V
UO8817996.8%466.7%550605155.4(O88179) Guanine nucleotide regulatory protein (Fragment)
	TK251102_lung_cytoE16_2_step10.3339.3339.1	1.9037	0.1343	951.62	3	6430.0%	2	K.HLIVLINK.M
	TK251102_lung_cytoE16_2_step10.3290.3290.2	2.6941	0.4071	1889.66	1	5310.0%	1	K.KDIHFMPCSGLTGANLK.E
	TK251102_lung_cytoE16_2_step08.3350.3350.2	1.1655	0.1172	1417.56	83	3180.0%	1	R.TFDAQIVIIEHK.S
UQ9D2X996.8%224.2%548626535.2(Q9D2X9) 9130026N02Rik protein
	TK251102_lung_cytoE16_2_step10.3782.3782.2	2.7725	0.3787	1609.38	1	5770.0%	1	R.LGSFHELLLEPPKK.S
	TK251102_lung_cytoE16_2_step11.1682.1682.1	1.4411	0.2177	1071.65	1	6250.0%	1	R.HGYMGHLTR.I
UPA1B_MOUSE96.6%5530.6%229254926.2(Q61206) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit)
	TK251102_lung_cytoE16_2_step12.4825.4825.3	1.1149	0.0641	4712.32	4	1120.0%	1	K.EPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTR.H
	TK251102_lung_cytoE16_2_step07.1867.1867.1	1.302	0.3107	958.51	41	5000.0%	1	R.WMSQHNR.F
	TK251102_lung_cytoE16_2_step03.2119.2119.2	1.582	0.232	1384.31	2	4550.0%	1	R.LKNGELENIKPK.V
	TK251102_lung_cytoE16_2_step10.2955.2955.2	1.3206	0.0039	1167.93	4	5000.0%	1	R.GEKPNPLRQK.N
UVINC_MOUSE96.5%778.5%10651166745.9(Q64727) Vinculin (Metavinculin)
*	TK251102_lung_cytoE16_2_step12.1079.1079.2	1.0043	0.1713	2009.42	10	2190.0%	1	R.EEVFDERAANFENHSGR.L
	TK251102_lung_cytoE16_2_step03.1625.1625.1	0.8124	0.0036	838.91	7	5000.0%	1	R.GLVAEGHR.L
	TK251102_lung_cytoE16_2_step03.1650.1650.1	1.1195	0.231	824.59	1	6430.0%	1	K.AAVHLEGK.I
	TK251102_lung_cytoE16_2_step10.2059.2059.2	1.4044	0.0978	1594.75	1	4330.0%	1	R.GVGQAAIRGLVAEGHR.L
	TK251102_lung_cytoE16_2_step01.5298.5298.2	2.1321	0.4696	2077.58	1	4750.0%	1	K.AIPDLTAPVAAVQAAVSNLVR.V
	TK251102_lung_cytoE16_2_step02.1859.1859.1	0.9906	0.031	925.5	231	4170.0%	1	R.EEVFDER.A
	TK251102_lung_cytoE16_2_step05.0010.0010.2	0.9105	0.0078	3048.48	27	1430.0%	1	K.IDAAQNWLADPNGGPEGEEQIRGALAEAR.K
UENOG_MOUSE96.5%356.9%433471655.1(P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2)
	TK251102_lung_cytoE16_2_step11.4464.4464.3	3.2289	0.239	3028.64	1	2330.0%	2	R.HIAQLAGNSDLILPVPAFNVINGGSHAGNK.L
UQ9H85396.5%1713711.6%241275468.4(Q9H853) Hypothetical protein FLJ13940
*	TK251102_lung_cytoE16_2_step05.4205.4205.2	1.6047	0.067	1813.5	33	3000.0%	1	K.EDAANNYAWGHYTIGK.E
*	TK251102_lung_cytoE16_2_step04.3427.3427.1	1.0218	0.1032	1413.93	1	4090.0%	6	R.QIFHPEQLITGK.E
UQ9Z32696.4%113.5%460494099.1(Q9Z326) 49 kDa zinc finger protein
	TK251102_lung_cytoE16_2_step12.2812.2812.2	2.7823	0.3617	1825.62	1	4670.0%	1	K.LYTGPGLAIHCMQVHK.E
UENOA_HUMAN96.4%7213.9%433470387.4(P06733) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase)
*	TK251102_lung_cytoE16_2_step01.1770.1770.1	1.9824	0.3017	1183.95	1	5000.0%	4	K.GVSKAVEHINK.T
	TK251102_lung_cytoE16_2_step01.0230.0230.1	1.0483	0.0858	806.61	15	6000.0%	2	K.YNQLLR.I
UEF1D_MOUSE96.4%102417.8%281312935.0(P57776) Elongation factor 1-delta (EF-1-delta)
*	TK251102_lung_cytoE16_2_step09.2889.2889.2	1.1547	0.0062	2067.88	44	2350.0%	1	K.DIDLFGSDEEEEDKEAAR.L
*	TK251102_lung_cytoE16_2_step01.3576.3576.1	1.43	0.2233	1287.15	1	4550.0%	1	R.GVVQDLQQAISK.L
*	TK251102_lung_cytoE16_2_step08.1787.1787.1	1.9008	0.0347	758.63	1	7500.0%	3	K.KPTLVAK.S
	TK251102_lung_cytoE16_2_step04.1633.1633.1	1.6395	0.2589	1425.68	2	3750.0%	2	R.ATAPQTQHVSPMR.Q
UQ96MZ896.4%134313.4%618678798.7(Q96MZ8) Hypothetical protein FLJ31638
	TK251102_lung_cytoE16_2_step11.3726.3726.2	0.8454	0.029	2919.82	1	1600.0%	1	R.IPQPNQTLDPEPQHLSLTALFGKQDK.A
	TK251102_lung_cytoE16_2_step09.1384.1384.2	2.0278	0.0932	1460.12	2	5450.0%	4	K.QLCPAIQKLMVR.S
	TK251102_lung_cytoE16_2_step07.4564.4564.3	1.3485	0.0745	3758.77	32	1330.0%	3	K.ATCQETVEPPQTLHQQQQQQQQQQQEKLPIR.Q
*	TK251102_lung_cytoE16_2_step10.4102.4102.2	1.0839	0.1547	1747.06	54	2690.0%	1	R.NARLSIYGIWFYDK.E
USKD1_MOUSE96.4%6817.3%444493897.5(P46467) SKD1 protein (Vacuolar sorting protein 4b)
*	TK251102_lung_cytoE16_2_step03.2971.2971.1	0.7042	0.0482	1062.07	47	2220.0%	1	K.EAQSGPVDEK.G
*	TK251102_lung_cytoE16_2_step05.4839.4839.3	1.3949	0.0064	2793.22	96	1460.0%	1	R.AAMFRLHLGSTQNSLTEADFQELGR.K
*	TK251102_lung_cytoE16_2_step07.3663.3663.2	1.1181	0.0522	2345.89	6	2500.0%	1	R.LHLGSTQNSLTEADFQELGRK.T
*	TK251102_lung_cytoE16_2_step02.3834.3834.3	0.9656	0.0955	3589.8	5	1090.0%	1	R.ADPNCIVNDLLTPCSPGDPGAIEMTWMDVPGDK.L
	TK251102_lung_cytoE16_2_step11.3120.3120.1	1.9129	0.3013	948.64	1	6430.0%	2	K.FPHLFTGK.R
UQ9HBY896.3%113.5%427476047.5(Q9HBY8) Protein kinase
	TK251102_lung_cytoE16_2_step03.2771.2771.1	1.6934	0.2911	1514.35	2	4640.0%	1	R.MNSSPAGTPSPQPSR.A
UQ9EQ3096.3%444.3%11001237744.9(Q9EQ30) Ran binding protein 5 (Fragment)
	TK251102_lung_cytoE16_2_step01.4684.4684.2	0.9179	0.0957	2159.03	21	2370.0%	1	R.QLALEVIVTLSETAAAMLRK.H
	TK251102_lung_cytoE16_2_step02.3313.3313.1	0.6761	0.06	1159.21	37	2780.0%	1	K.LQELIQKGTK.L
*	TK251102_lung_cytoE16_2_step01.1292.1292.1	1.7042	0.3037	855.5	2	5710.0%	1	R.VIQAPEAK.T
	TK251102_lung_cytoE16_2_step12.2713.2713.1	1.1629	0.0304	1077.87	26	4380.0%	1	K.HLHSIMVLK.L
US23A_MOUSE96.3%448.8%623704248.2(Q01405) Protein transport protein Sec23A (SEC23-related protein A) (Fragment)
	TK251102_lung_cytoE16_2_step03.2110.2110.1	1.6805	0.2987	957.35	2	6430.0%	1	K.HFEALANR.A
	TK251102_lung_cytoE16_2_step01.3864.3864.1	0.8222	0.0705	1312.39	41	3330.0%	1	R.LCQKFGEYHK.D
	TK251102_lung_cytoE16_2_step10.1385.1385.3	1.4316	0.0211	2586.51	34	1750.0%	1	K.ERPDLPPIQYEPVLCSRTTCR.A
	TK251102_lung_cytoE16_2_step11.2542.2542.2	0.9829	0.0643	1831.82	21	2670.0%	1	R.LAIYRAETEEGPDVLR.W
UQ9CXI596.3%2219.0%179203748.1(Q9CXI5) 3230402M22Rik protein
	TK251102_lung_cytoE16_2_step12.2347.2347.2	2.9162	0.3381	1924.93	1	5310.0%	1	K.IINEVSKPLAHHIPVEK.I
	TK251102_lung_cytoE16_2_step08.2358.2358.2	1.0369	0.0439	1964.29	4	2810.0%	1	K.ENRLCYYIGATDDAATK.I
UQ9CT4196.3%336.4%561637384.8(Q9CT41) 2600017A12Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step10.2321.2321.2	1.7408	0.0581	1434.03	2	5000.0%	1	R.HFSEHPSMSNMK.A
	TK251102_lung_cytoE16_2_step12.1109.1109.3	1.1137	0.0246	1927.44	327	2190.0%	1	K.LLLFDRHPDGVASVSFR.E
	TK251102_lung_cytoE16_2_step03.1901.1901.1	1.7794	0.294	795.6	2	7500.0%	1	K.LHVEVAK.F
USWS1_MOUSE96.3%116.7%240267915.1(Q9D8Y0) Swiprosin 1
	TK251102_lung_cytoE16_2_step02.1851.1851.2	2.7056	0.3732	1726.65	1	6670.0%	1	R.RADLNQGIGEPQSPSR.R
USG2N_MOUSE96.3%689.3%796871505.3(Q9ERG2) Cell-cycle autoantigen SG2NA (S/G2 antigen)
	TK251102_lung_cytoE16_2_step03.2081.2081.1	1.0934	0.1079	926.61	6	5000.0%	1	R.AHWEVER.A
	TK251102_lung_cytoE16_2_step01.5599.5599.2	0.8576	0.0481	3076.57	47	1110.0%	1	R.SHFDGVRALAFHPVEPVLVTASEDHTLK.L
	TK251102_lung_cytoE16_2_step06.0939.0939.1	0.3087	0.3159	518.47	10	2500.0%	1	K.TVPAK.K
*	TK251102_lung_cytoE16_2_step08.3835.3835.2	1.1383	0.1622	1701.94	6	2810.0%	1	R.SLLGLSNSEPNGSVEAK.N
	TK251102_lung_cytoE16_2_step09.3061.3061.2	2.984	0.2444	1873.19	1	5940.0%	2	R.VVSHPTLPVTITAHEDR.H
UO8844396.3%337.4%585689966.0(O88443) SWAP-70
*	TK251102_lung_cytoE16_2_step07.4187.4187.2	2.9634	0.3172	2396.8	1	3750.0%	1	K.NPHLITNWGPAAFTQAELEER.E
*	TK251102_lung_cytoE16_2_step09.2399.2399.1	1.5307	0.1504	1190.38	1	5000.0%	1	K.KLEMATHMTK.S
*	TK251102_lung_cytoE16_2_step03.3235.3235.2	0.9026	0.0904	1496.86	56	2730.0%	1	K.VWVIFNFLSEDK.Y
UDYL1_HUMAN96.2%3520.2%89103667.4(Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)
	TK251102_lung_cytoE16_2_step01.1659.1659.1	1.1528	0.2133	767.8	3	5830.0%	1	K.DIAAHIK.K
	TK251102_lung_cytoE16_2_step07.3006.3006.2	2.4502	0.4244	1403.5	1	6000.0%	2	K.YNPTWHCIVGR.N
URL44_HUMAN96.1%4810.5%1051231010.6(P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a)
	TK251102_lung_cytoE16_2_step08.2383.2383.2	1.3858	0.0956	1193.31	1	6670.0%	2	R.CKHFELGGDK.K
	TK251102_lung_cytoE16_2_step06.2277.2277.1	2.164	0.2619	1032.54	1	6880.0%	2	K.HFELGGDKK.R
UTYB4_MOUSE96.1%108224.0%5056795.0(P20065) Thymosin beta-4 (T beta 4)
	TK251102_lung_cytoE16_2_step01.1410.1410.1	2.1002	0.2902	1372.81	1	5450.0%	1	K.TETQEKNPLPSK.E
	TK251102_lung_cytoE16_2_step01.1408.1408.1	1.4666	0.0773	657.52	2	7000.0%	9	K.NPLPSK.E
U143F_HUMAN96.0%114.1%245280884.8(Q04917) 14-3-3 protein eta (Protein AS1)
*	TK251102_lung_cytoE16_2_step10.1885.1885.2	2.9686	0.0042	1237.75	1	7780.0%	1	K.EQMQPTHPIR.L
UDDX3_MOUSE96.0%335.7%661729707.2(Q62167) DEAD-box protein 3 (DEAD-box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1PAS1 related sequence 2)
*	TK251102_lung_cytoE16_2_step03.1586.1586.1	1.0056	0.0134	830.54	40	3890.0%	1	R.SGGGGHGGSR.G
	TK251102_lung_cytoE16_2_step06.3710.3710.1	1.1506	0.0592	1251.85	1	5500.0%	1	K.DSLTLVFVETK.K
*	TK251102_lung_cytoE16_2_step08.2941.2941.2	2.3805	0.4208	1902.3	1	4060.0%	1	R.VRPCVVYGGAEIGQQIR.D
UO8854595.9%247.4%324358805.7(O88545) COP9 complex subunit 6 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6) (ARABIDOPSIS) (Similar TO COP9 (Constitutive PHOTOMORPHOGENIC), subunit 6)
	TK251102_lung_cytoE16_2_step04.4736.4736.2	1.5615	0.1633	2456.01	5	2390.0%	2	R.MTATGSGENSTVAEHLIAQHSAIK.M
UQ8R1Q895.9%71112.2%523566146.4(Q8R1Q8) Hypothetical 56.6 kDa protein
*	TK251102_lung_cytoE16_2_step04.2631.2631.2	2.5162	0.3948	1751.71	1	5000.0%	2	K.SGQKPVLSDVHAELDR.I
	TK251102_lung_cytoE16_2_step10.1379.1379.1	0.5386	0.1437	670.01	18	2500.0%	1	R.VPGGSPR.T
	TK251102_lung_cytoE16_2_step05.3463.3463.2	2.5036	0.3737	1413.48	1	6820.0%	2	K.IGILHENFQTLK.V
*	TK251102_lung_cytoE16_2_step03.3863.3863.3	1.6468	0.0389	2332.26	2	2230.0%	1	K.TGSPGGPGVGGSPGGGAAGASPSLPPSAK.K
UQ99LE795.9%4422.2%378417827.5(Q99LE7) Similar to paxillin (Fragment)
	TK251102_lung_cytoE16_2_step11.2476.2476.2	2.0285	0.4846	2410.92	1	3890.0%	1	K.TWHPEHFVCTHCQEEIGSR.N
	TK251102_lung_cytoE16_2_step07.5495.5495.3	1.2998	0.2279	2708.94	3	1670.0%	1	R.AILENYISALNTLWHPECFVCR.E
	TK251102_lung_cytoE16_2_step07.2563.2563.2	2.753	0.3679	1301.1	1	7500.0%	1	K.KPIAGQVVTAMGK.T
	TK251102_lung_cytoE16_2_step10.2111.2111.3	1.4088	0.0023	2945.56	5	1720.0%	1	K.TGSSSPPGGLSKPGSQLDSMLGSLQSDLNK.L
UQ8R22395.8%115.3%457505226.5(Q8R223) Similar to autoantigen (Fragment)
*	TK251102_lung_cytoE16_2_step10.4273.4273.2	2.3292	0.4164	2642.59	1	2830.0%	1	R.AEVQHQLHVAVGSLQESILAQVQR.I
UGRB2_MOUSE95.7%115.5%217252386.3(Q60631) Growth factor receptor-bound protein 2 (GRB2 adapter protein) (SH2/SH3 adapter GRB2)
	TK251102_lung_cytoE16_2_step07.2334.2334.1	1.6376	0.2899	1318.7	2	4550.0%	1	K.GACHGQTGMFPR.N
UO8852695.7%114.0%323357177.9(O88526) Nitrilase homolog 1
	TK251102_lung_cytoE16_2_step05.3092.3092.2	2.301	0.4078	1412.21	1	5000.0%	1	R.RPDLYGSLGHPLS.-
UQ924M495.6%223.8%10411160374.8(Q924M4) RANBP9 isoform 1
	TK251102_lung_cytoE16_2_step07.2020.2020.1	2.0473	0.2788	1379.74	3	5000.0%	1	K.LLQHGINADDKR.L
	TK251102_lung_cytoE16_2_step12.3949.3949.2	0.8108	0.0339	2843.75	37	1110.0%	1	R.IAAQDLLLAVATDFQNESAVALATAATR.H
UQ9CZX895.6%142420.8%2122294010.8(Q9CZX8) Ribosomal protein S19
	TK251102_lung_cytoE16_2_step06.3290.3290.1	1.0952	0.1049	1128.34	23	5000.0%	2	R.RVLQALEGLK.M
	TK251102_lung_cytoE16_2_step01.2543.2543.1	1.2687	0.0372	970.88	1	6880.0%	1	R.VLQALEGLK.M
	TK251102_lung_cytoE16_2_step09.2492.2492.1	1.04	0.0277	701.41	3	7500.0%	1	R.HLYLR.G
	TK251102_lung_cytoE16_2_step03.3398.3398.1	1.5949	0.1865	1315.64	19	4000.0%	2	K.LKVPEWVDTVK.L
	TK251102_lung_cytoE16_2_step07.1487.1487.1	0.9435	0.0187	928.56	19	5000.0%	2	R.KLTPQGQR.D
*	TK251102_lung_cytoE16_2_step10.1742.1742.2	1.7321	0.2055	1159.39	4	6110.0%	1	R.NGVRPSHFSR.G
UUBP4_MOUSE95.6%91117.3%9621082815.6(P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15) (Ubiquitin thiolesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein)
	TK251102_lung_cytoE16_2_step12.3273.3273.3	1.2406	0.189	4618.16	19	1030.0%	1	K.YMSNTYEQLSKLDNTIQDAGLYQGQVLVIEPQNEDGTWPR.Q
	TK251102_lung_cytoE16_2_step09.3699.3699.2	1.4157	0.2116	2301.03	1	2500.0%	2	K.SRPSSASSGAVLYGQPLLVSVPK.H
	TK251102_lung_cytoE16_2_step05.5269.5269.3	1.1014	0.0295	4020.67	78	1030.0%	1	K.TQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNR.V
	TK251102_lung_cytoE16_2_step11.3252.3252.3	1.914	0.1987	3707.76	1	1850.0%	1	R.FAPQFSGYQQQDSQELLAFILDGLHEDLNRVK.K
	TK251102_lung_cytoE16_2_step05.2239.2239.2	1.0495	0.0073	1737.91	3	3460.0%	1	R.SLYFDEQESEACEK.H
	TK251102_lung_cytoE16_2_step09.4987.4987.3	1.2073	0.0643	2129.86	15	2210.0%	1	R.SSYEGDEEEEMDHQEEGK.E
	TK251102_lung_cytoE16_2_step07.3964.3964.3	1.6078	0.1166	2679.32	41	1850.0%	1	R.YIKQPLPDEFLSSPLEPGACNGSR.S
*	TK251102_lung_cytoE16_2_step11.2166.2166.1	1.1658	0.0024	1120.96	41	3890.0%	1	R.KVVDDGLFVK.H
UQ99LN995.5%118.3%302329034.9(Q99LN9) Similar to CG2245 gene product
*	TK251102_lung_cytoE16_2_step10.4375.4375.2	2.6899	0.3666	2602.15	1	3330.0%	1	R.HEVGYVLGQLQHEAAVPGLAATLAR.T
URL35_HUMAN95.3%578.2%1221442011.0(P42766) 60S ribosomal protein L35
*	TK251102_lung_cytoE16_2_step12.2036.2036.1	2.0186	0.2605	1260.16	1	6110.0%	2	K.KYKPLDLRPK.K
*	TK251102_lung_cytoE16_2_step10.2713.2713.2	1.3762	0.2019	1130.52	7	5000.0%	1	K.YKPLDLRPK.K
UQ9DCG995.2%4614.4%125141415.3(Q9DCG9) 0610038D11Rik protein
	TK251102_lung_cytoE16_2_step01.0884.0884.1	1.2556	0.0283	732.5	5	8000.0%	1	R.LFPISR.G
	TK251102_lung_cytoE16_2_step12.2675.2675.2	2.5639	0.3868	1392.15	1	7730.0%	1	K.LLTHNLLSSHVR.G
UQ8R5F295.1%3314.8%271312704.9(Q8R5F2) Hypothetical 31.3 kDa protein
	TK251102_lung_cytoE16_2_step04.1904.1904.2	1.828	0.376	1286.38	2	6670.0%	1	K.TRPDGNCFYR.A
	TK251102_lung_cytoE16_2_step02.4306.4306.2	2.21	0.4156	1650.82	1	5710.0%	1	R.AFGFSHLEALLDDSK.E
	TK251102_lung_cytoE16_2_step11.3641.3641.2	2.242	0.3962	1916.14	1	5360.0%	1	K.VYLLYRPGHYDILYK.-
UQ99J3695.0%2211.7%350388856.1(Q99J36) Similar to hypothetical protein FLJ20274
*	TK251102_lung_cytoE16_2_step09.4712.4712.3	1.4343	0.2609	3245.61	12	1210.0%	1	K.ELAGIVGSLNSENKVDLTNPEYTVVVEIIK.A
	TK251102_lung_cytoE16_2_step11.2792.2792.1	1.9601	0.2855	1397.69	1	7000.0%	1	K.LVHHILQDMYK.T
UDLDH_MOUSE94.9%5115.1%509542127.9(O08749) Dihydrolipoamide dehydrogenase, mitochondrial precursor (EC 1.8.1.4)
	TK251102_lung_cytoE16_2_step06.3721.3721.1	1.7502	0.2693	1129.74	2	4500.0%	3	K.ALTGGIAHLFK.Q
	TK251102_lung_cytoE16_2_step12.2255.2255.2	2.2656	0.3504	1757.05	1	5000.0%	1	K.ALLNNSHYYHMAHGK.D
UQ9JII694.9%102817.3%324364567.4(Q9JII6) Alcohol dehydrogenase [NADP+] (EC 1.1.1.2) (Aldehyde reductase)
	TK251102_lung_cytoE16_2_step01.3150.3150.1	1.0245	0.3405	1506.96	2	3750.0%	1	R.DAGHPLYPFNDPY.-
	TK251102_lung_cytoE16_2_step08.4978.4978.2	0.8208	0.0905	3032.15	33	1740.0%	1	R.KTLADLQLEYLDLYLMHWPYAFER.G
*	TK251102_lung_cytoE16_2_step07.1782.1782.1	1.3969	0.2131	874.51	7	6430.0%	3	K.HALSAGYR.H
	TK251102_lung_cytoE16_2_step06.2068.2068.1	1.9087	0.1915	1301.57	1	5500.0%	4	K.HHPEDVEPALR.K
URL19_HUMAN94.9%112715.8%1962346611.5(P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19
	TK251102_lung_cytoE16_2_step10.2663.2663.1	1.2732	0.1393	1022.6	11	4290.0%	2	R.ILMEHIHK.L
	TK251102_lung_cytoE16_2_step07.1778.1778.1	1.8221	0.098	644.69	1	7000.0%	4	R.HMGIGK.R
	TK251102_lung_cytoE16_2_step11.1356.1356.1	1.1792	0.1821	923.63	49	4290.0%	1	R.KPVTVHSR.A
	TK251102_lung_cytoE16_2_step11.2440.2440.1	1.6104	0.2451	1193.77	11	3750.0%	1	R.HMYHSLYLK.V
UQ8R3P194.8%116.6%196212144.7(Q8R3P1) Similar to hypothetical protein MGC16714
*	TK251102_lung_cytoE16_2_step10.1919.1919.2	2.657	0.3511	1427.86	1	7500.0%	1	K.KLEGGQQVGMHSR.G
UPRS6_MOUSE94.8%81020.1%418472815.3(P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21)
	TK251102_lung_cytoE16_2_step07.3263.3263.2	1.0307	0.0287	1840.36	10	2190.0%	1	K.TMLAKAVAHHTTAAFIR.V
	TK251102_lung_cytoE16_2_step03.2646.2646.2	0.8529	0.0163	1421.87	2	3750.0%	2	R.ELLKPNASVALHK.H
	TK251102_lung_cytoE16_2_step11.1880.1880.1	1.6386	0.1946	1295.83	2	4550.0%	1	K.AVAHHTTAAFIR.V
	TK251102_lung_cytoE16_2_step05.4035.4035.2	2.4116	0.4024	2540.08	1	4210.0%	1	K.LQQELEFLEVQEEYIKDEQK.N
*	TK251102_lung_cytoE16_2_step09.0004.0004.3	1.2862	0.0056	3724.37	1	1970.0%	1	K.RIQSIPLVIGQFLEAVDQNTAIVASTTGSNYYVR.M
USEP7_MOUSE94.7%4612.4%436505508.6(O55131) Septin 7 (CDC10 protein homolog)
	TK251102_lung_cytoE16_2_step05.2431.2431.2	0.9702	0.0371	1716.01	4	3210.0%	1	K.GQLTKSPLAQMEEER.R
	TK251102_lung_cytoE16_2_step03.0118.0118.2	1.097	0.1382	2611.84	15	1820.0%	2	K.STLINSLFLTDLYSPEYPGPSHR.I
	TK251102_lung_cytoE16_2_step07.3390.3390.3	1.1248	0.0318	4259.91	1	1580.0%	1	R.GFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHR.I
UQ91YN594.6%226.7%522586096.5(Q91YN5) Hypothetical 58.6 kDa protein
	TK251102_lung_cytoE16_2_step04.2512.2512.2	2.7861	0.3033	2004.7	1	5000.0%	1	K.DVVNVYEPQLQHHVAQK.K
*	TK251102_lung_cytoE16_2_step11.4358.4358.2	0.7166	0.0307	2162.66	2	1760.0%	1	K.CTIPWYIMTSGRTMESTK.E
UQ91VM994.6%2211.2%330381157.0(Q91VM9) Similar to pyrophosphatase (Inorganic)
*	TK251102_lung_cytoE16_2_step12.3107.3107.2	2.8339	0.3063	1831.53	1	5000.0%	1	K.HVAGHYISPFHDIPLK.A
*	TK251102_lung_cytoE16_2_step06.3369.3369.3	1.0197	0.0209	2385.13	39	1250.0%	1	R.DKSTDCCGDNDPIDVCEIGSK.V
UH2B1_MOUSE94.5%61027.2%1251380510.3(P10853) Histone H2B F (H2B 291A)
	TK251102_lung_cytoE16_2_step09.1919.1919.1	1.0958	0.0973	822.57	54	5000.0%	2	K.RSTITSR.E
	TK251102_lung_cytoE16_2_step05.1499.1499.1	1.1411	0.2102	745.48	2	6000.0%	2	R.LAHYNK.R
	TK251102_lung_cytoE16_2_step07.1332.1332.1	0.5829	0.0242	570.72	33	3000.0%	1	K.SAPAPK.K
	TK251102_lung_cytoE16_2_step01.5107.5107.2	2.6013	0.3695	1747.59	1	5360.0%	1	K.AMGIMNSFVNDIFER.I
UCTE1_MOUSE94.2%121624.3%419461366.6(O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I)
	TK251102_lung_cytoE16_2_step09.4260.4260.2	1.0277	0.0028	2696.78	34	1740.0%	1	K.RDVQTPFVVELEVLDGHEPDGGQR.L
	TK251102_lung_cytoE16_2_step11.3157.3157.1	1.44	0.3777	1011.87	2	5500.0%	1	K.GPGIGLLGISK.G
	TK251102_lung_cytoE16_2_step10.1585.1585.1	0.9026	0.0012	626.61	2	6250.0%	1	R.RVPVR.E
	TK251102_lung_cytoE16_2_step11.1234.1234.2	1.9518	0.2235	933.97	1	7860.0%	1	R.LAHAVHER.H
	TK251102_lung_cytoE16_2_step04.4783.4783.2	1.8721	0.4496	3045.62	3	2320.0%	1	R.ATLFLPPEPGPFPGIIDLFGVGGGLLEYR.A
	TK251102_lung_cytoE16_2_step03.4154.4154.2	1.8693	0.354	2025.39	1	4060.0%	2	R.SDTTFLFLVGQDDHNWK.S
	TK251102_lung_cytoE16_2_step09.2725.2725.2	2.0949	0.4305	897.69	1	7860.0%	2	R.HFLAPGVR.R
UZO1_MOUSE94.2%687.3%17451947106.7(P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1)
*	TK251102_lung_cytoE16_2_step03.4330.4330.3	0.9764	0.1188	3581.03	82	650.0%	1	K.EAIQQQQNQLVWVSEGKADGATSDDLDLHDDR.L
*	TK251102_lung_cytoE16_2_step11.3444.3444.3	1.7208	0.1203	3446.13	3	1640.0%	2	K.KVQIPVSHPDPEPVSDNEDDSYDEEVHDPR.A
	TK251102_lung_cytoE16_2_step12.1805.1805.2	2.4475	0.3912	1970.75	1	4060.0%	1	R.LPEPQKPQVKPPEDIVR.S
*	TK251102_lung_cytoE16_2_step06.1845.1845.1	1.3619	0.0815	1290.72	20	4090.0%	1	R.DGDIQEGDVVLK.I
*	TK251102_lung_cytoE16_2_step03.3527.3527.3	1.1846	0.0106	4042.04	13	1250.0%	1	R.RSFESKPSAHLPAGHHSEPAKPVHSQSQPNFPSYSSK.G
UO0917294.1%395.8%274305355.5(O09172) Gamma-glutamylcysteine synthetase, regulatory (EC 6.3.2.2)
*	TK251102_lung_cytoE16_2_step04.3153.3153.2	1.2444	0.0308	1783.32	7	3000.0%	3	R.ASTLHLQTGNLLNWGR.L
UANM1_MOUSE94.1%91327.0%371424365.4(Q9JIF0) Protein arginine N-methyltransferase 1 (EC 2.1.1.-)
*	TK251102_lung_cytoE16_2_step11.3953.3953.3	1.1054	0.0416	4313.37	4	1140.0%	1	K.VEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHAR.D
	TK251102_lung_cytoE16_2_step03.3178.3178.3	1.0218	0.0375	2231.65	10	2350.0%	1	K.RNDYVHALVAYFNIEFTR.C
	TK251102_lung_cytoE16_2_step02.2906.2906.2	1.3404	0.2056	1727.44	1	3570.0%	1	R.TGFSTSPESPYTHWK.Q
	TK251102_lung_cytoE16_2_step07.3098.3098.2	2.5892	0.3528	1352.19	1	6820.0%	2	K.ANKLDHVVTIIK.G
	TK251102_lung_cytoE16_2_step06.1940.1940.1	1.181	0.1496	905.44	2	6670.0%	1	R.NSMFHNR.H
	TK251102_lung_cytoE16_2_step01.4136.4136.1	1.052	0.1079	1399.98	49	2730.0%	1	K.WLAPDGLIFPDR.A
UQ9D82394.0%4167.2%971113311.8(Q9D823) Ribosomal protein L37
	TK251102_lung_cytoE16_2_step05.2075.2075.1	1.3759	0.3511	898.46	2	5000.0%	4	R.KYNWSAK.A
UPNPH_MOUSE94.0%5726.6%289322776.2(P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP)
	TK251102_lung_cytoE16_2_step03.3295.3295.2	2.511	0.3823	1738.41	1	5710.0%	1	R.DHINLPGFCGQNPLR.G
	TK251102_lung_cytoE16_2_step07.0082.0082.2	0.9522	0.011	1916.47	454	2220.0%	1	K.MLGADAVGMSTVPEVIVAR.H
*	TK251102_lung_cytoE16_2_step11.2217.2217.3	0.745	0.0060	2405.21	16	750.0%	1	K.VVMDYENLEKANHMEVLDAGK.A
	TK251102_lung_cytoE16_2_step09.3849.3849.2	1.2845	0.2279	2444.62	1	2860.0%	2	R.KLQEGTYVMLAGPNFETVAESR.L
UTCPH_MOUSE94.0%81212.9%544596527.8(P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta)
	TK251102_lung_cytoE16_2_step02.2277.2277.1	0.8781	0.0037	561.38	18	6250.0%	1	K.MIGIK.K
	TK251102_lung_cytoE16_2_step01.3612.3612.1	1.2733	0.0394	1567.38	2	3080.0%	1	K.LPIGDVATQYFADR.D
	TK251102_lung_cytoE16_2_step04.3173.3173.2	1.794	0.5494	1155.7	1	7780.0%	1	R.SLHDAIMIVR.R
	TK251102_lung_cytoE16_2_step10.4838.4838.2	2.5077	0.3842	2892.27	1	3480.0%	1	R.VHTVEDYQAIVDAEWNILYDKLEK.I
	TK251102_lung_cytoE16_2_step11.2900.2900.2	2.289	0.1237	2021.17	2	4690.0%	2	K.QVKPYVEEGLHPQIIIR.A
URL29_MOUSE94.0%102419.5%1591745611.8(P47915) 60S ribosomal protein L29
	TK251102_lung_cytoE16_2_step01.1364.1364.1	0.9622	0.0189	504.59	26	6250.0%	1	K.AVSAR.A
*	TK251102_lung_cytoE16_2_step06.1428.1428.1	1.1705	0.0121	870.52	8	6670.0%	1	R.LCQPKPK.V
*	TK251102_lung_cytoE16_2_step08.2750.2750.1	0.9814	0.0253	898.54	16	5000.0%	3	R.LAFIAHPK.L
*	TK251102_lung_cytoE16_2_step12.1619.1619.1	1.5861	0.1453	1195.09	2	5500.0%	3	K.ALVKPQAIKPK.M
UK6A3_HUMAN94.0%111.2%740837366.9(P51812) Ribosomal protein S6 kinase alpha 3 (EC 2.7.1.-) (S6K-alpha 3) (90 kDa ribosomal protein S6 kinase 3) (p90-RSK 3) (Ribosomal S6 kinase 2) (RSK-2) (pp90RSK2) (Insulin-stimulated protein kinase 1) (ISPK-1)
*	TK251102_lung_cytoE16_2_step08.2119.2119.1	1.4876	0.3699	1048.64	1	5000.0%	1	K.EIAITHHVK.E
UQ6112393.9%7153.4%754868235.6(Q61123) MEM3
	TK251102_lung_cytoE16_2_step08.1613.1613.1	1.561	0.2328	943.41	8	6250.0%	1	K.HFGAGGNQR.I
	TK251102_lung_cytoE16_2_step12.2003.2003.1	1.9562	0.2497	1306.65	1	5560.0%	2	K.HFHNTLEHLR.T
	TK251102_lung_cytoE16_2_step07.1682.1682.1	1.2086	0.0085	808.55	60	3330.0%	3	R.GVQHPLR.G
UPSB2_MOUSE93.9%118.5%201229067.0(Q9R1P3) Proteasome subunit beta type 2 (EC 3.4.25.1) (Proteasome component C7-I) (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I)
*	TK251102_lung_cytoE16_2_step03.3667.3667.2	2.2512	0.398	1924.71	1	3750.0%	1	R.VIDKDGIHNLENIAFPK.R
UPSE2_MOUSE93.8%4618.4%239270575.7(P97372) Proteasome activator complex subunit 2 (Proteasome activator 28-beta subunit) (PA28beta) (PA28b) (Activator of multicatalytic protease subunit 2) (11S regulator complex beta subunit) (REG-beta)
	TK251102_lung_cytoE16_2_step02.2375.2375.2	1.2928	0.0536	1353.96	1	5450.0%	1	K.TKVEAFQTTISK.Y
	TK251102_lung_cytoE16_2_step05.4791.4791.2	1.9552	0.2089	1898.9	1	4330.0%	2	R.AFYAELYHIISSNLEK.I
*	TK251102_lung_cytoE16_2_step07.4835.4835.2	2.3432	0.3902	1807.59	1	5000.0%	1	K.LLALLALVKPEVWTLK.E
UQ923D293.6%3317.5%206221977.0(Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein)
*	TK251102_lung_cytoE16_2_step03.2434.2434.2	2.1042	0.4164	1759.88	1	4690.0%	1	R.LPSEGPQPAHVVVGDVR.Q
*	TK251102_lung_cytoE16_2_step01.1622.1622.1	1.2658	0.1425	1211.87	1	4440.0%	1	R.LQDVTDDHIR.M
	TK251102_lung_cytoE16_2_step11.2838.2838.1	1.3777	0.1273	1127.6	2	4380.0%	1	K.HDLGHFMLR.C
UQ9DC4693.6%223.2%624715896.2(Q9DC46) 1200003I18Rik protein
*	TK251102_lung_cytoE16_2_step06.1328.1328.2	1.3314	0.1343	1172.35	24	5000.0%	1	R.LKETPFDPPK.V
	TK251102_lung_cytoE16_2_step06.1821.1821.1	1.9203	0.2585	1009.46	1	6670.0%	1	R.VIHAIANSGK.L
UY379_HUMAN93.5%224.7%10591134666.2(O15084) Hypothetical protein KIAA0379 (Fragment)
*	TK251102_lung_cytoE16_2_step11.3137.3137.3	1.2263	0.2242	3602.66	1	1180.0%	1	R.NGLTMVVQELLGKGASVLAVDENGYTPALACAPNK.D
*	TK251102_lung_cytoE16_2_step08.2982.2982.2	2.2975	0.3913	1708.08	1	5360.0%	1	R.DKNWQTPLHIAAANK.A
UPRS8_HUMAN93.5%6128.6%406456267.5(P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG)
	TK251102_lung_cytoE16_2_step09.2489.2489.1	1.6188	0.1556	1429.62	1	5000.0%	3	R.AVAHHTDCTFIR.V
	TK251102_lung_cytoE16_2_step10.2175.2175.3	1.8581	0.0505	2236.69	3	2640.0%	1	K.FVVDVDKNIDINDVTPNCR.V
	TK251102_lung_cytoE16_2_step01.0858.0858.1	1.0093	0.0733	458.33	5	8330.0%	1	K.VLVK.V
UEF1G_MOUSE93.4%9159.8%437500616.7(Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma)
	TK251102_lung_cytoE16_2_step11.4066.4066.2	1.1994	0.2242	1992.24	14	2500.0%	1	K.DPFAHLPKSTFVLDEFK.R
*	TK251102_lung_cytoE16_2_step03.3713.3713.1	1.3981	0.1848	1123.66	1	5560.0%	1	R.ILGLLDTHLK.T
*	TK251102_lung_cytoE16_2_step03.1478.1478.1	1.3133	0.128	936.55	1	5710.0%	1	K.KFAESQPK.K
	TK251102_lung_cytoE16_2_step07.1738.1738.1	1.2988	0.0145	647.63	1	7000.0%	2	R.KFPAGK.V
	TK251102_lung_cytoE16_2_step10.2810.2810.2	2.1887	0.3231	1125.86	1	7220.0%	2	K.AKDPFAHLPK.S
UE2BA_HUMAN93.4%2213.1%305337127.3(Q14232) Translation initiation factor eIF-2B alpha subunit (eIF-2B GDP-GTP exchange factor)
*	TK251102_lung_cytoE16_2_step01.2810.2810.1	2.2798	0.2468	1490.97	10	3850.0%	1	K.ADTLKVAQTGQDLK.E
*	TK251102_lung_cytoE16_2_step11.2736.2736.3	2.3204	0.1891	2846.82	3	2100.0%	1	K.MAKALCHLNVPVTVVLDAAVGYIMEK.A
UQ9DAR793.3%61010.9%338389886.5(Q9DAR7) 1700001E16Rik protein (RIKEN cDNA 1700001E16 gene)
*	TK251102_lung_cytoE16_2_step06.4589.4589.2	2.0222	0.5231	1853.83	1	5330.0%	1	R.AHLLAQVIENLECDPK.H
*	TK251102_lung_cytoE16_2_step03.1693.1693.1	1.2634	0.0334	712.56	1	7000.0%	2	R.HLSDIK.T
*	TK251102_lung_cytoE16_2_step02.1730.1730.1	0.8252	0.0139	888.76	213	3570.0%	1	R.EGQEAILK.R
	TK251102_lung_cytoE16_2_step08.3077.3077.1	1.3549	0.0956	829.74	5	5830.0%	2	K.IIFLHGK.V
UQ9D3R693.3%242.9%409461318.0(Q9D3R6) 4933439B08Rik protein
	TK251102_lung_cytoE16_2_step01.2871.2871.1	1.5637	0.2726	1174.71	3	4090.0%	2	K.GLLLYGPPGTGK.T
UQ9H85693.3%4417.0%523587586.1(Q9H856) Hypothetical protein FLJ13936 (Fragment)
*	TK251102_lung_cytoE16_2_step10.1825.1825.1	1.5633	0.2729	708.69	1	7000.0%	1	R.IHGINR.A
*	TK251102_lung_cytoE16_2_step08.3375.3375.2	1.1336	0.1238	2092.21	16	2110.0%	1	R.TTGALHTPPIALRSSQVIVK.A
*	TK251102_lung_cytoE16_2_step01.4647.4647.3	1.3168	0.0344	4555.67	1	1500.0%	1	R.STNTLKEMPWGHINNNVTQSYSIGYEGSYDASADLFDDIAK.E
*	TK251102_lung_cytoE16_2_step09.3132.3132.3	1.4306	0.2883	2467.39	23	1900.0%	1	R.SLSEDFIQPSQKLSLQSLSDSR.H
UPHS1_MOUSE93.3%11177.6%850974317.1(Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1)
	TK251102_lung_cytoE16_2_step03.1402.1402.1	0.8956	0.0024	689.59	45	6250.0%	1	R.IHEYK.R
	TK251102_lung_cytoE16_2_step03.4701.4701.2	1.3067	0.0037	1920.46	172	2500.0%	1	R.HLEIIYEINQKHLDR.I
	TK251102_lung_cytoE16_2_step01.1014.1014.1	0.8335	0.0567	498.57	3	8330.0%	2	K.LLPR.H
*	TK251102_lung_cytoE16_2_step04.1925.1925.1	1.5837	0.2824	868.47	1	7500.0%	1	R.HGNPWEK.A
*	TK251102_lung_cytoE16_2_step09.4727.4727.2	1.9056	0.3806	1993.73	1	4380.0%	1	R.LKQEYFVVAATLQDVIR.R
	TK251102_lung_cytoE16_2_step06.1690.1690.1	1.3308	0.2057	945.54	14	4380.0%	2	K.AAPGYHMAK.M
	TK251102_lung_cytoE16_2_step12.2853.2853.1	1.4811	0.1258	996.77	2	5000.0%	2	R.HLHFTLVK.D
UIDHP_MOUSE93.2%224.8%523587498.7(P54071) Isocitrate dehydrogenase [NADP], mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH) (IDP) (ICD-M)
	TK251102_lung_cytoE16_2_step09.0860.0860.1	1.4564	0.2169	955.82	1	6430.0%	1	R.HAHGDQYK.A
*	TK251102_lung_cytoE16_2_step04.2635.2635.2	2.7349	0.2919	1977.33	1	4380.0%	1	R.IKVEKPVVEMDGDEMTR.I
US106_MOUSE93.2%1128.1%89100515.5(P14069) Calcyclin (Prolactin receptor associated protein) (5B10)
*	TK251102_lung_cytoE16_2_step08.4866.4866.2	2.0293	0.4801	2860.24	1	3960.0%	1	K.DQEVNFQEYVAFLGALALIYNEALK.-
UO9491593.1%449.5%12361382074.8(O94915) Hypothetical protein KIAA0826 (Fragment)
*	TK251102_lung_cytoE16_2_step06.4400.4400.3	0.9057	0.0263	4790.19	33	760.0%	1	K.GDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSR.T
*	TK251102_lung_cytoE16_2_step04.4661.4661.3	1.092	0.01	3895.76	5	1320.0%	1	K.NEAEVINMSEELAQLESILKEAESASENEEIDISK.A
*	TK251102_lung_cytoE16_2_step06.5364.5364.2	1.0076	0.2423	2760.7	75	1400.0%	1	R.KSTGQLNLSTSPINSSSYLGYNSNAR.S
*	TK251102_lung_cytoE16_2_step10.3851.3851.2	2.0892	0.4175	1523.75	1	5000.0%	1	K.LLIHLPLDKSESR.E
UPSA5_MOUSE93.1%6646.1%241264114.8(Q9Z2U1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome zeta chain) (EC 3.4.25.1) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain)
	TK251102_lung_cytoE16_2_step01.2248.2248.1	1.3645	0.188	1433.04	1	4580.0%	1	R.ITSPLMEPSSIEK.I
*	TK251102_lung_cytoE16_2_step01.2059.2059.2	2.5226	0.3675	1963.34	1	3610.0%	1	R.AIGSASEGAQSSLQEVYHK.S
	TK251102_lung_cytoE16_2_step01.4363.4363.3	1.0403	0.1288	3219.22	49	740.0%	1	K.QVMEEKLNATNIELATVQPGQNFHMFTK.E
	TK251102_lung_cytoE16_2_step01.2418.2418.1	1.5473	0.014	774.81	7	6670.0%	1	K.SSLIILK.Q
	TK251102_lung_cytoE16_2_step02.3442.3442.2	1.1969	0.1138	2163.53	1	3060.0%	1	K.GPQLFHMDPSGTFVQCDAR.A
	TK251102_lung_cytoE16_2_step10.0096.0096.2	0.7768	0.0794	2658.11	9	1460.0%	1	K.IVEIDAHIGCAMSGLIADAKTLIDK.A
UIMD2_HUMAN93.0%113.5%514558056.9(P12268) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2)
*	TK251102_lung_cytoE16_2_step08.4266.4266.2	2.0802	0.4077	1968.57	1	4710.0%	1	K.GKLPIVNEDDELVAIIAR.T
UUBPE_MOUSE93.0%4102.4%492558715.2(Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15) (Ubiquitin thiolesterase 14) (Ubiquitin-specific processing protease 14) (Deubiquitinating enzyme 14)
*	TK251102_lung_cytoE16_2_step05.2773.2773.2	2.08	0.4165	1352.5	1	5450.0%	3	R.SSSSGHYVSWVR.R
UPHS_HUMAN93.0%3517.5%103118686.8(P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH) (P80095) Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (Dimerization cofactor of HNF1) (DCoH)
	TK251102_lung_cytoE16_2_step07.2430.2430.1	0.7928	0.0268	708.43	37	6250.0%	1	K.QFHFK.D
	TK251102_lung_cytoE16_2_step07.3534.3534.2	2.4598	0.3722	1700.39	1	5420.0%	2	K.LDHHPEWFNVYNK.V
UK2C8_MOUSE92.8%224.1%488543185.6(P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A)
	TK251102_lung_cytoE16_2_step01.3288.3288.1	1.8536	0.2478	1386.73	3	4550.0%	1	K.SLNNKFASFIDK.V
	TK251102_lung_cytoE16_2_step01.2960.2960.1	0.9535	0.0504	932.97	27	5000.0%	1	K.LLEGEESR.L
UQ8VCQ892.7%468.3%530604537.4(Q8VCQ8) Similar to caldesmon 1
*	TK251102_lung_cytoE16_2_step03.2885.2885.1	1.1483	0.0374	1377.55	88	3640.0%	2	R.QKMPEDGLSEDK.K
*	TK251102_lung_cytoE16_2_step11.1934.1934.2	2.4175	0.3766	2021.62	1	3950.0%	1	K.ASKPMKPAASDLPVPAEGVR.N
	TK251102_lung_cytoE16_2_step07.0084.0084.1	0.6925	0.0538	1204.77	26	1820.0%	1	K.ETAGLKVGVSSR.I
UQ8VDP392.6%9275.1%10481167856.1(Q8VDP3) Similar to hypothetical protein FLJ11937
	TK251102_lung_cytoE16_2_step05.1243.1243.3	1.0505	0.0319	2037.23	359	1410.0%	1	R.ESLYQLLSQTSPENMHR.N
*	TK251102_lung_cytoE16_2_step04.1575.1575.1	0.8741	0.0147	971.52	16	4290.0%	1	K.LLEVVNQR.D
*	TK251102_lung_cytoE16_2_step06.1169.1169.1	0.5299	0.0395	446.54	11	3330.0%	4	R.EMPA.-
*	TK251102_lung_cytoE16_2_step06.3902.3902.2	1.6471	0.2646	2388.13	2	2830.0%	3	K.NTSHSSGLVSQPSGTPSAILFLGK.L
UZ147_MOUSE92.5%112.4%634717728.3(Q61510) Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp)
*	TK251102_lung_cytoE16_2_step12.1584.1584.1	1.4854	0.3352	1533.89	1	4290.0%	1	K.TPVAPGPPSHFSPNK.L
UCSE1_MOUSE92.5%333.7%9711104555.8(Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein)
	TK251102_lung_cytoE16_2_step11.1874.1874.1	1.5629	0.2628	1046.61	1	6250.0%	1	K.IHLAQSLHK.L
	TK251102_lung_cytoE16_2_step04.3669.3669.2	1.9142	0.2349	1808.56	1	4670.0%	1	K.ANIVHLMLSSPEQIQK.Q
	TK251102_lung_cytoE16_2_step02.1662.1662.3	1.2432	0.0016	1373.28	95	3250.0%	1	K.WPDLLTEMVNR.F
UQ9CZP292.4%82023.0%291317788.5(Q9CZP2) 1110025F24Rik protein
*	TK251102_lung_cytoE16_2_step09.1716.1716.2	0.9627	0.0742	1224.13	87	3000.0%	1	R.GYRHGGFSVSR.Q
*	TK251102_lung_cytoE16_2_step07.0090.0090.3	1.5531	0.1304	4515.9	4	1190.0%	3	K.QQGAEVVRGDQDDAASMELALAGAHATFIVTNYWETCSQDR.E
*	TK251102_lung_cytoE16_2_step03.1783.1783.1	1.3865	0.2971	917.51	1	5000.0%	3	K.LAAGHFDGK.G
*	TK251102_lung_cytoE16_2_step05.1444.1444.1	1.5	0.2461	617.67	1	8000.0%	1	R.KLTAGK.L
UPSD6_MOUSE92.3%579.5%389455365.5(Q99JI4) 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit S10) (p42A)
	TK251102_lung_cytoE16_2_step04.3507.3507.1	1.705	0.2484	1113.69	2	5620.0%	1	R.FLLSLPEHR.G
	TK251102_lung_cytoE16_2_step12.1720.1720.2	1.8811	0.148	1948.16	2	3530.0%	1	K.VIKGAEILEVLHSLPAVR.Q
	TK251102_lung_cytoE16_2_step11.3181.3181.2	1.5563	0.0724	1334.34	1	6670.0%	1	K.KDWLFAPHYR.Y
UQ8R4X392.3%222.5%10031036478.3(Q8R4X3) SWAN
	TK251102_lung_cytoE16_2_step02.2770.2770.2	1.2829	0.0624	1775.17	8	3330.0%	1	R.RFETANLDIPPANASR.S
	TK251102_lung_cytoE16_2_step07.2704.2704.1	1.9628	0.2438	1083.71	1	6880.0%	1	R.FIQVHPITK.K
UQ99KN992.2%358.3%531567585.9(Q99KN9) Similar to KIAA0171 gene product (Fragment)
*	TK251102_lung_cytoE16_2_step05.1536.1536.2	2.4012	0.3572	2410.2	1	3260.0%	2	K.ASPDQNASTHTPQSSAKPSVPSSK.S
	TK251102_lung_cytoE16_2_step09.2069.2069.3	1.7389	0.1508	2374.79	6	2370.0%	1	R.SLENYHFVDEHGKDQGINIR.Q
URLA0_MOUSE92.1%3314.8%317342166.2(P14869) 60S acidic ribosomal protein P0 (L10E)
	TK251102_lung_cytoE16_2_step02.1855.1855.1	2.1787	0.178	1223.55	1	6000.0%	1	R.GHLENNPALEK.L
	TK251102_lung_cytoE16_2_step08.4425.4425.2	1.2481	2.0E-4	1219.7	12	5560.0%	1	K.IIQLLDDYPK.C
	TK251102_lung_cytoE16_2_step02.3865.3865.2	1.3819	0.2734	2789.52	3	1800.0%	1	R.NVASVCLQIGYPTVASVPHSIINGYK.R
UTES_MOUSE92.1%5712.5%423479838.3(P47226) Testin (TES1/TES2)
	TK251102_lung_cytoE16_2_step03.1913.1913.1	0.9646	0.0134	1039.55	7	5000.0%	1	R.QYMQMLPK.E
*	TK251102_lung_cytoE16_2_step06.1390.1390.1	0.963	0.2001	851.57	1	5620.0%	2	R.HAPAAVASK.D
	TK251102_lung_cytoE16_2_step08.2163.2163.2	2.4247	0.3717	2205.67	1	4440.0%	1	K.NHAVVCQGCHNAIDPEVQR.V
*	TK251102_lung_cytoE16_2_step12.1665.1665.3	1.6021	0.1221	2099.7	9	2500.0%	1	K.IYVMVTDKPVCKPCYVK.N
URS10_MOUSE92.0%599.7%1651891610.2(P09900) 40S ribosomal protein S10
	TK251102_lung_cytoE16_2_step05.2536.2536.1	1.898	0.2404	1053.52	1	5620.0%	2	K.NVPNLHVMK.A
	TK251102_lung_cytoE16_2_step08.1630.1630.1	1.4219	0.2458	854.51	1	5830.0%	1	K.KDVHMPK.H
UFRZB_MOUSE92.0%7279.9%323360118.3(P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3)
*	TK251102_lung_cytoE16_2_step08.2270.2270.3	1.1765	0.0114	2076.41	5	2500.0%	1	R.HSWPESLACDELPVYDR.G
	TK251102_lung_cytoE16_2_step09.2120.2120.1	1.3817	0.0664	626.66	4	7000.0%	5	R.HLGLGK.T
	TK251102_lung_cytoE16_2_step04.2821.2821.1	1.4855	0.0215	1059.64	40	5000.0%	1	R.QGCEPILIK.Y
UQ91YZ892.0%8109.4%615678539.5(Q91YZ8) Hypothetical 67.9 kDa protein
	TK251102_lung_cytoE16_2_step08.3753.3753.1	0.8485	0.0455	682.41	18	5000.0%	1	K.YASSVR.S
	TK251102_lung_cytoE16_2_step04.1034.1034.2	0.7732	0.0075	1001.3	50	1880.0%	1	K.EREAELGAK.A
	TK251102_lung_cytoE16_2_step05.3043.3043.1	0.8365	0.0238	1078.64	212	4290.0%	1	K.FEQLKQER.I
	TK251102_lung_cytoE16_2_step08.4230.4230.2	1.6556	0.1625	1671.36	1	4640.0%	1	R.LFPLIQTMHSNLAGK.I
	TK251102_lung_cytoE16_2_step05.4648.4648.1	1.096	0.0924	1100.11	1	4380.0%	1	R.YQGVNLYIK.N
	TK251102_lung_cytoE16_2_step05.2017.2017.1	1.4495	0.2504	1391.61	2	4500.0%	2	R.KAHLTNQYMQR.V
UQ1504792.0%224.1%12911431576.0(Q15047) Hypothetical protein KIAA0067
*	TK251102_lung_cytoE16_2_step06.3474.3474.3	2.8335	0.3599	2119.08	2	3030.0%	1	K.SSSQDLHKGTLSQMSGELSK.D
*	TK251102_lung_cytoE16_2_step01.4426.4426.3	0.7752	0.0571	3404.56	46	470.0%	1	R.KPTAGQTSATAVDSDDIQTISSGSEGDDFEDKK.N
UQ9D7S791.8%2214.8%122144679.4(Q9D7S7) 3110001N18Rik protein
*	TK251102_lung_cytoE16_2_step02.2586.2586.1	0.9476	0.082	810.54	44	5000.0%	1	K.ETYELR.Y
*	TK251102_lung_cytoE16_2_step02.2615.2615.2	2.1284	0.3894	1309.28	1	6360.0%	1	K.TGNLGNVVHIER.L
UQ9Y6Y491.7%884.5%22652572528.2(Q9Y6Y4) IDN3 protein
	TK251102_lung_cytoE16_2_step08.4114.4114.2	0.7228	0.0139	1404.39	7	3640.0%	1	R.NKADQQLVEIDK.K
	TK251102_lung_cytoE16_2_step12.5441.5441.2	1.1914	0.0777	2944.04	39	1600.0%	1	K.LLMEHLDPDEEEEEGEVSASTNARNK.A
	TK251102_lung_cytoE16_2_step07.3058.3058.2	1.0782	0.0835	1745.59	83	2140.0%	1	K.QSESRLAESKPNENR.L
	TK251102_lung_cytoE16_2_step10.3606.3606.2	0.8701	0.0875	1345.7	8	4090.0%	1	K.ILNITDVVAACR.D
	TK251102_lung_cytoE16_2_step02.1653.1653.1	1.553	0.2683	1121.46	5	5560.0%	1	K.DGNVTQETKK.M
	TK251102_lung_cytoE16_2_step02.2725.2725.1	1.1841	0.1196	958.47	14	5000.0%	1	K.NFVIPKIK.R
	TK251102_lung_cytoE16_2_step10.0968.0968.1	0.9484	0.1034	1522.01	92	1540.0%	1	K.YAGFIHMKAVAGMK.M
	TK251102_lung_cytoE16_2_step08.1365.1365.1	1.1724	0.0114	524.6	2	7500.0%	1	R.GVHGR.L
UFSC1_HUMAN91.7%71111.6%492543997.2(Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55)
	TK251102_lung_cytoE16_2_step11.3296.3296.2	2.5035	0.349	1241.69	1	6670.0%	2	K.LINRPIIVFR.G
	TK251102_lung_cytoE16_2_step05.2428.2428.3	1.4161	0.1341	2056.95	96	2060.0%	2	R.EVPGPDCRFLIVAHDDGR.W
	TK251102_lung_cytoE16_2_step11.0752.0752.2	1.1537	0.2139	2679.23	45	1520.0%	1	K.VGKDELFALEQSCAQVVLQAANER.N
	TK251102_lung_cytoE16_2_step01.1558.1558.1	0.9614	0.0258	577.81	1	8750.0%	1	R.NVSTR.Q
UDPD2_MOUSE91.7%113.6%469513695.8(O35654) DNA polymerase delta subunit 2 (EC 2.7.7.7)
*	TK251102_lung_cytoE16_2_step10.3074.3074.2	2.506	0.3551	1728.47	1	5000.0%	1	R.AHTLLAPPSASNATFAR.V
UQ91YW291.7%3310.4%757852916.5(Q91YW2) Similar to tight junction protein 1 (Fragment)
*	TK251102_lung_cytoE16_2_step09.4520.4520.3	1.2638	0.0531	2139.98	146	2340.0%	1	R.YEASSYTDQFSRNYDHR.L
*	TK251102_lung_cytoE16_2_step11.5537.5537.3	1.0606	0.0241	4031.87	37	1180.0%	1	R.RSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSK.G
*	TK251102_lung_cytoE16_2_step06.2994.2994.2	2.5019	0.3524	2729.58	1	2920.0%	1	K.AHSSTQPPEFDSGVETFSVHTDKPK.Y
UIDE_MOUSE91.6%575.1%10191177726.5(Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease)
	TK251102_lung_cytoE16_2_step09.3189.3189.2	2.5496	0.3315	1845.71	1	5000.0%	2	R.FIIQSEKPPHYLESR.V
	TK251102_lung_cytoE16_2_step08.1641.1641.1	1.0703	0.0428	615.5	2	7500.0%	1	K.HPFSK.F
*	TK251102_lung_cytoE16_2_step01.3595.3595.1	1.0344	0.2219	1108.46	1	4000.0%	1	R.SILGARPPPAK.R
*	TK251102_lung_cytoE16_2_step11.5581.5581.2	1.1169	0.218	2596.1	26	2000.0%	1	K.LSAECAKYWGEIISQQYNYDR.D
UFABE_MOUSE91.5%2225.2%135151376.5(Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein)
*	TK251102_lung_cytoE16_2_step01.2703.2703.1	2.0181	0.2263	1500.97	1	5000.0%	1	R.LMESHGFEEYMK.E
*	TK251102_lung_cytoE16_2_step03.2853.2853.2	1.8491	0.3965	2576.95	1	3100.0%	1	R.KTETVCTFQDGALVQHQQWDGK.E
UQ9CPS791.5%3320.6%248274549.8(Q9CPS7) 1810003N24Rik protein (Putative 25.7 kDa protein) (RIKEN cDNA 1810003N24 gene)
*	TK251102_lung_cytoE16_2_step11.3429.3429.2	2.0053	0.478	1727.46	1	5330.0%	1	K.RPVFPPLSGDQLLTGK.E
	TK251102_lung_cytoE16_2_step11.4736.4736.2	0.8618	0.17	2123.57	27	1470.0%	1	R.LDDLFLESFEITDVKPLK.G
	TK251102_lung_cytoE16_2_step09.3144.3144.2	1.3098	0.1627	1858.09	13	2810.0%	1	K.MARTAICNLILGNPPSK.V
UITA3_MOUSE91.4%464.7%10531167456.6(Q62470) Integrin alpha-3 precursor (Galactoprotein B3) (GAPB3) (VLA-3 alpha chain) (CD49c)
*	TK251102_lung_cytoE16_2_step09.3589.3589.3	1.4162	0.0753	2729.26	5	1960.0%	1	K.MDVDENLYPDLLVGSLSDHIVLLR.A
	TK251102_lung_cytoE16_2_step11.4766.4766.1	1.3654	0.0373	1432.62	55	2920.0%	2	R.TGAVYLCPLTAHK.D
*	TK251102_lung_cytoE16_2_step08.5149.5149.2	1.1632	0.0585	1420.84	1	4580.0%	1	K.AKSETVLTCSNGR.A
USYFB_MOUSE91.3%6612.4%589656707.1(Q9WUA2) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20) (Phenylalanine--tRNA ligase beta chain) (PheRS)
	TK251102_lung_cytoE16_2_step08.1586.1586.1	1.2808	0.0183	940.5	9	5830.0%	1	K.LHQNICR.K
	TK251102_lung_cytoE16_2_step03.2862.2862.2	2.5019	0.3435	1194.05	1	7000.0%	1	K.LGVLHPDVITK.F
	TK251102_lung_cytoE16_2_step07.2034.2034.1	1.2322	0.0205	588.52	8	6250.0%	1	K.QIISK.E
*	TK251102_lung_cytoE16_2_step03.4313.4313.2	0.9996	0.0715	2592.67	18	1900.0%	1	R.HLCAVYYSKTPGFEIIHGLLDR.I
	TK251102_lung_cytoE16_2_step07.2902.2902.1	1.1214	0.0163	1324.51	171	3500.0%	1	K.SSTFPELPYRK.E
	TK251102_lung_cytoE16_2_step09.3860.3860.2	1.0409	0.0209	1765.7	20	3120.0%	1	K.LGLDISATKAVHISNPK.T
UYAP1_MOUSE91.3%392.8%472507035.0(P46938) 65 kDa Yes-associated protein (YAP65)
	TK251102_lung_cytoE16_2_step11.2949.2949.1	1.5185	0.0495	1533.71	5	2920.0%	3	R.KLPDSFFKPPEPK.S
URL31_HUMAN91.2%8509.6%1251446310.5(P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31
	TK251102_lung_cytoE16_2_step06.1970.1970.1	1.1365	0.028	624.47	1	7500.0%	1	R.KFAMK.E
	TK251102_lung_cytoE16_2_step08.2318.2318.1	1.6935	0.1743	759.57	1	7500.0%	7	R.IHGVGFK.K
UO8841291.2%117.6%524583937.8(O88412) Zinc finger protein 105
*	TK251102_lung_cytoE16_2_step11.4021.4021.3	2.7792	0.3485	3976.54	1	1540.0%	1	K.ATQEAAAASPFGSYSLAGTLAESQILELHGNPTPTGAKSK.N
UQ9DAD691.1%3520.4%137146978.4(Q9DAD6) 1700012P12Rik protein (Profilin-III)
*	TK251102_lung_cytoE16_2_step07.2007.2007.1	1.7426	0.2409	894.62	1	5620.0%	2	R.GVHGGILNK.T
*	TK251102_lung_cytoE16_2_step01.0440.0440.3	1.4099	0.0087	2199.12	2	2500.0%	1	R.CCVIRDYLLAEGDGVLDAR.T
UQ9D6M091.0%358.5%448487785.4(Q9D6M0) 2310076L09Rik protein (RIKEN cDNA 2310076L09 gene)
*	TK251102_lung_cytoE16_2_step08.1818.1818.1	2.1803	0.0629	1155.6	2	5560.0%	2	R.HLAYEHSLGK.L
*	TK251102_lung_cytoE16_2_step11.3390.3390.2	0.9602	0.1298	3127.91	1	1670.0%	1	R.GASPSPTFHPPKTQELWGSWSPCLENGR.S
UZYX_MOUSE91.0%467.8%564607906.9(Q62523) Zyxin
*	TK251102_lung_cytoE16_2_step11.1293.1293.2	1.7702	0.4146	1739.58	3	4290.0%	1	K.QHPQPPPAQNQNQVR.S
	TK251102_lung_cytoE16_2_step09.2295.2295.2	1.8027	0.2971	1054.44	1	7220.0%	2	K.FAPVVAPKPK.V
*	TK251102_lung_cytoE16_2_step03.2383.2383.2	2.4887	0.3478	1966.12	1	4720.0%	1	K.VNPFRPGDSEPPVAAGAQR.A
UQ99JS991.0%2210.0%412449716.4(Q99JS9) Similar to hypothetical protein MGC2744
*	TK251102_lung_cytoE16_2_step08.2838.2838.3	1.6132	0.0193	2108.76	2	2920.0%	1	R.RAEAQALLQDYVSTQSAEE.-
*	TK251102_lung_cytoE16_2_step10.2842.2842.2	2.4843	0.3613	2369.37	1	2860.0%	1	R.RGAQADHFTESPLSPGSQVQVR.V
UILF3_MOUSE90.9%81210.3%911980429.2(Q9Z1X4) Interleukin enhancer-binding factor 3
*	TK251102_lung_cytoE16_2_step12.5328.5328.3	0.9248	0.1049	3222.79	1	880.0%	1	R.SGGNSYGSSGSSSYNTGSHGGYGTGSGGSSSYQGK.Q
	TK251102_lung_cytoE16_2_step03.2834.2834.1	1.0342	0.0415	1117.51	23	4440.0%	1	K.EKPTTALLDK.V
	TK251102_lung_cytoE16_2_step06.2398.2398.1	1.5475	0.0702	1301.63	2	5500.0%	2	R.LNQLKPGLQYK.L
	TK251102_lung_cytoE16_2_step04.3837.3837.2	1.7928	0.387	1761.65	1	4330.0%	2	K.EPPLSLTIHLTSPVVR.E
	TK251102_lung_cytoE16_2_step07.1947.1947.1	1.4081	0.1273	666.53	2	7000.0%	1	K.LHVAVK.V
	TK251102_lung_cytoE16_2_step05.2284.2284.2	2.2134	0.3032	1602.53	1	4330.0%	1	K.SIGTANRPMGAGEALR.R
UDDB1_HUMAN90.9%223.0%11401269685.3(Q16531) DNA damage binding protein 1 (Damage-specific DNA binding protein 1) (DDB p127 subunit) (DDBa) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (Xeroderma pigmentosum group E complementing protein) (XPCe) (X-associated protein 1) (XAP-1)
*	TK251102_lung_cytoE16_2_step07.4734.4734.2	1.3275	0.0942	2239.51	1	3610.0%	1	R.LFMLLLEKEEQMDGTVTLK.D
*	TK251102_lung_cytoE16_2_step05.3935.3935.2	2.6233	0.1045	1689.13	1	5000.0%	1	R.LEIYVVTAEGLRPVK.E
UQ6148290.9%112.2%763867164.8(Q61482) CDE1-binding protein CDEBP
*	TK251102_lung_cytoE16_2_step07.2238.2238.2	2.6286	0.1684	1650.53	1	5310.0%	1	K.GSGMAEQDGGLIGAEEK.V
UIF2G_MOUSE90.8%6810.2%471509348.4(Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X)
	TK251102_lung_cytoE16_2_step07.2855.2855.1	1.282	0.1903	1124.68	1	6250.0%	1	K.LMCKPIFSK.I
	TK251102_lung_cytoE16_2_step03.1923.1923.1	1.1263	0.0010	935.5	19	5830.0%	1	R.FKNELER.N
	TK251102_lung_cytoE16_2_step03.2530.2530.1	1.8596	0.235	1252.5	3	5000.0%	1	K.LTPLSHEVISR.Q
	TK251102_lung_cytoE16_2_step07.2947.2947.1	2.0291	0.1943	978.55	3	7140.0%	1	K.HILILQNK.I
	TK251102_lung_cytoE16_2_step11.2161.2161.2	0.8954	0.0365	1513.99	28	2920.0%	2	K.IPVPPRDFTSEPR.L
UQ9ESF790.8%5521.5%419487386.1(Q9ESF7) Sep2 (Fragment)
*	TK251102_lung_cytoE16_2_step06.3790.3790.3	1.611	0.146	2152.77	126	1970.0%	1	K.AAMEALQSQALHATSQQPLR.K
	TK251102_lung_cytoE16_2_step04.4776.4776.2	0.6975	0.0178	2346.64	134	1390.0%	1	R.QYPWGVVQVENENHCDFVK.L
*	TK251102_lung_cytoE16_2_step08.2769.2769.2	2.5317	0.3157	1940.97	1	6000.0%	1	R.LRPQTYDLQESNVHLK.L
*	TK251102_lung_cytoE16_2_step01.4234.4234.3	1.722	0.2757	2849.84	3	2210.0%	1	-.NAEPEPRSLSLGGHVGFDSLPDQLVSK.S
	TK251102_lung_cytoE16_2_step03.1859.1859.1	1.031	0.067	994.43	28	5000.0%	1	R.QMFVNKVK.E
UQ9ER9890.7%2244.7%8592539.7(Q9ER98) Stretch responsive muscle (X-chromosome) (SMPX protein) (Muscle-specific protein CSL)
*	TK251102_lung_cytoE16_2_step09.3715.3715.2	2.2113	0.3786	1769.74	1	5000.0%	1	K.KFPGPVVNLSEIQNVK.S
	TK251102_lung_cytoE16_2_step10.3730.3730.3	1.6189	0.1443	2276.13	1	2980.0%	1	R.AIQANINIPMGAFRPGAGQPPR.R
UCTF1_HUMAN90.7%2412.9%201212279.0(Q16619) Cardiotrophin-1 (CT-1)
*	TK251102_lung_cytoE16_2_step08.2663.2663.3	2.7156	0.4094	2981.37	2	2200.0%	2	K.YAEQLLQEYVQLQGDPFGLPSFSPPR.L
UQ9DBI690.6%448.4%669694859.7(Q9DBI6) 1300007E16Rik protein
	TK251102_lung_cytoE16_2_step12.1817.1817.2	1.776	0.2129	1556.98	3	4230.0%	1	R.AIEALHGHELRPGR.A
*	TK251102_lung_cytoE16_2_step02.1402.1402.1	0.9492	0.1205	717.29	11	5000.0%	1	R.ENAGAVR.A
*	TK251102_lung_cytoE16_2_step01.4327.4327.3	1.3999	0.0617	2483.28	13	1850.0%	1	R.AQPSASLGVGYRTQPMAAQAASYR.A
	TK251102_lung_cytoE16_2_step07.1850.1850.1	1.5104	0.2914	1300.56	1	4000.0%	1	R.RLPDAHSDYAR.Y
UPPCE_MOUSE90.6%152914.8%710807525.7(Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE)
	TK251102_lung_cytoE16_2_step09.3419.3419.2	1.8428	0.1301	985.3	1	8570.0%	2	K.IPMFIVHK.K
	TK251102_lung_cytoE16_2_step06.4332.4332.2	1.6512	0.054	1609.26	7	4170.0%	2	R.SNFLVLCYLHDVK.N
	TK251102_lung_cytoE16_2_step09.3083.3083.2	1.7623	0.3206	1494.12	1	4580.0%	2	R.KQSNPLLIHVDTK.A
	TK251102_lung_cytoE16_2_step06.2386.2386.1	1.136	0.1662	892.68	40	4290.0%	1	R.VVPLHSLK.F
	TK251102_lung_cytoE16_2_step05.2072.2072.1	1.1755	0.0778	957.55	1	5710.0%	3	K.YSPLHNVK.L
*	TK251102_lung_cytoE16_2_step05.2653.2653.3	1.4746	0.046	2834.47	24	1700.0%	1	K.DVLEWVACVRSNFLVLCYLHDVK.N
	TK251102_lung_cytoE16_2_step02.4221.4221.3	1.33	0.1066	2787.19	9	1700.0%	1	K.QNCFDDFQCAAEYLIKEGYTSPK.R
	TK251102_lung_cytoE16_2_step10.4126.4126.3	2.6007	0.2459	3402.66	3	1640.0%	2	K.LPEADDIQYPSMLLLTADHDDRVVPLHSLK.F
UNF3L_MOUSE90.5%61414.3%350388296.3(Q9EQ80) NIF3-like protein 1
	TK251102_lung_cytoE16_2_step01.1719.1719.1	1.2066	0.1209	500.77	5	8330.0%	1	R.DPLR.V
	TK251102_lung_cytoE16_2_step08.4111.4111.2	2.0759	0.3911	2008.72	1	3820.0%	2	K.TEILSLEKPLLLHTGMGR.L
*	TK251102_lung_cytoE16_2_step05.4481.4481.3	1.375	0.0082	3029.49	11	1570.0%	3	R.ALENRVAVYSPHTAYDAAPQGVNSWLAK.G
UA2MG_MOUSE90.5%667.3%14951658276.7(Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M)
*	TK251102_lung_cytoE16_2_step12.1136.1136.1	1.0804	0.0357	650.49	2	7500.0%	1	K.IHKPR.F
*	TK251102_lung_cytoE16_2_step08.1943.1943.1	1.5608	0.2553	880.63	1	7140.0%	1	K.NLKPAPIK.V
	TK251102_lung_cytoE16_2_step08.5117.5117.1	0.2338	0.0	404.48	4	2500.0%	1	K.MQK.T
*	TK251102_lung_cytoE16_2_step02.4791.4791.3	1.1822	0.2498	4497.38	9	940.0%	1	K.GVFSLPIQVEPGMAPEAQLLIYAILPNEELVADAQNFEIEK.C
*	TK251102_lung_cytoE16_2_step08.4441.4441.2	1.288	0.1465	2740.09	1	2400.0%	1	K.VKAAPLSLCALTAVDQSVLLLKPEAK.L
*	TK251102_lung_cytoE16_2_step12.2527.2527.3	1.6964	0.0206	3056.34	38	1700.0%	1	K.FRVVSVDISFRPLNETFPVVYIETPK.R
UMBNL_MOUSE90.5%5524.3%341369768.6(Q9JKP5) Muscleblind-like protein (Triplet-expansion RNA-binding protein)
	TK251102_lung_cytoE16_2_step12.1961.1961.2	1.7467	0.228	1310.0	1	6500.0%	1	K.YFHPPAHLQAK.I
	TK251102_lung_cytoE16_2_step03.4590.4590.2	0.9876	0.0399	3073.71	106	1150.0%	1	R.FAHPADSTMIDTNDNTVTVCMDYIKGR.C
	TK251102_lung_cytoE16_2_step08.1486.1486.1	1.2176	0.0851	686.56	2	7000.0%	1	K.FAHPSK.S
*	TK251102_lung_cytoE16_2_step08.3031.3031.3	1.1966	0.0295	3897.68	30	1250.0%	1	K.AAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEK.T
UO5480790.4%351.8%11841298006.2(O54807) Ankhzn protein
*	TK251102_lung_cytoE16_2_step01.1456.1456.1	1.2076	0.01	957.74	148	5000.0%	1	K.NGWSLLHK.G
	TK251102_lung_cytoE16_2_step10.3314.3314.2	2.0866	0.3737	1455.61	1	6250.0%	2	R.RLESIATTLVSHK.A
UQ9JJB390.3%397.6%184204349.5(Q9JJB3) Brain cDNA, clone MNCb-3848, similar to Homo sapiens CGI-28 protein mRNA
*	TK251102_lung_cytoE16_2_step04.2908.2908.1	1.8219	0.0997	1406.58	3	3850.0%	3	R.SPLWLGGGVAHGPR.G
UQ6116690.3%5523.5%268300165.2(Q61166) APC-binding protein EB1 homolog
	TK251102_lung_cytoE16_2_step02.3142.3142.1	1.1669	0.0216	949.55	25	5710.0%	1	K.LTVEDLEK.E
*	TK251102_lung_cytoE16_2_step02.2965.2965.2	1.7918	0.3555	1992.97	1	3420.0%	1	R.QGQETAVAPSLVAPALSKPK.K
*	TK251102_lung_cytoE16_2_step12.1460.1460.2	2.4047	0.3685	1879.7	1	4120.0%	1	K.KPLGSSTAAPQRPIATQR.T
	TK251102_lung_cytoE16_2_step08.1165.1165.1	0.4601	0.0072	546.4	14	2500.0%	1	K.LVKGK.F
	TK251102_lung_cytoE16_2_step11.3450.3450.2	1.1493	0.1626	1821.48	3	3080.0%	1	K.GKFQDNFEFVQWFK.K
UHEPS_MOUSE90.2%111.7%416447397.4(O35453) Serine protease hepsin (EC 3.4.21.-)
	TK251102_lung_cytoE16_2_step07.1512.1512.1	1.4783	0.3192	792.64	1	6670.0%	1	R.KPGVYTK.V
UQ9D1Q690.2%3511.1%406468535.3(Q9D1Q6) 1110001E24Rik protein (RIKEN cDNA 1110001E24 gene)
*	TK251102_lung_cytoE16_2_step03.4530.4530.3	1.5033	0.2003	4270.82	22	1250.0%	1	R.YNGDNVIYKPPGRSAPDMVYLGSMTNFDVTYNWIQDK.C
	TK251102_lung_cytoE16_2_step12.2113.2113.1	1.5648	0.2193	987.99	1	5710.0%	2	R.HPLLHIQK.T
UQ9Z0P590.1%4418.9%349394716.8(Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein)
	TK251102_lung_cytoE16_2_step02.0574.0574.2	0.6259	0.1524	1564.53	17	1150.0%	1	-.MAHQTGIHATEELK.E
	TK251102_lung_cytoE16_2_step12.4780.4780.2	0.9541	0.0486	2961.58	17	1800.0%	1	K.IEIGDGAELTAEFLYDEVHPKQHAFK.Q
	TK251102_lung_cytoE16_2_step07.3707.3707.2	2.2174	0.3718	1933.96	1	4380.0%	1	K.HQTLQGLAFPLQPEAQR.A
*	TK251102_lung_cytoE16_2_step08.1366.1366.1	0.7497	0.095	864.64	6	4380.0%	1	R.GPGENGEDS.-
UICE6_MOUSE90.1%113.6%276315956.9(O08738) Caspase-6 precursor (EC 3.4.22.-) (Apoptotic protease Mch-2)
	TK251102_lung_cytoE16_2_step09.4423.4423.2	2.4347	0.352	1346.85	1	6670.0%	1	R.FFWHLTLPER.R
UQ9Z33290.1%355.4%553593357.9(Q9Z332) Keratin 6 alpha
	TK251102_lung_cytoE16_2_step09.3083.3083.3	1.2585	0.0264	2240.67	283	1620.0%	1	K.TVRQNLEPMFEQYISNLR.R
	TK251102_lung_cytoE16_2_step01.4308.4308.1	1.8358	0.2321	1305.78	3	5000.0%	2	R.SLDLDSIIAEVK.A
UQ9BY4489.9%91518.1%609678519.0(Q9BY44) CDA02
*	TK251102_lung_cytoE16_2_step03.2017.2017.1	1.4512	0.0783	1202.63	27	4000.0%	1	K.EQAATGKQLEK.N
*	TK251102_lung_cytoE16_2_step02.3711.3711.3	1.1065	0.0656	3045.53	80	1150.0%	1	R.VPWMNSHPSGFSFRDNMAPSTPLLTVR.G
*	TK251102_lung_cytoE16_2_step10.3951.3951.3	1.1755	0.0486	3343.03	41	1380.0%	1	R.NAAYYSPHGHILVLAGFGNLRGQMEVWDVK.N
*	TK251102_lung_cytoE16_2_step08.1823.1823.1	1.5513	0.0277	638.58	7	7500.0%	2	K.LHLQK.I
*	TK251102_lung_cytoE16_2_step02.4273.4273.3	2.067	0.286	2944.08	10	1800.0%	2	K.NGPIYDVVWNSSSTEFCAVYGFMPAK.A
*	TK251102_lung_cytoE16_2_step11.2998.2998.1	1.1995	0.0309	1358.01	2	3500.0%	2	K.IWHYTGSILHK.Y
UDYR_MOUSE89.9%51124.2%186214758.6(P00375) Dihydrofolate reductase (EC 1.5.1.3)
*	TK251102_lung_cytoE16_2_step04.4721.4721.2	0.8159	0.0288	2439.48	27	1580.0%	1	R.IMQEFESDTFFPEIDLGKYK.L
*	TK251102_lung_cytoE16_2_step11.3610.3610.2	1.5284	0.0663	1956.38	1	3820.0%	1	-.VRPLNCIVAVSQNMGIGK.N
*	TK251102_lung_cytoE16_2_step06.2242.2242.1	1.3734	0.0975	745.64	3	5000.0%	3	R.GAHFLAK.S
UQ91W8989.9%223.3%10391156886.5(Q91W89) Similar to mannosidase, alpha, class 2C, member 1
	TK251102_lung_cytoE16_2_step07.3751.3751.2	0.8207	0.0599	1735.82	8	2860.0%	1	R.LSQEVVLDVGCPYVR.F
	TK251102_lung_cytoE16_2_step08.3095.3095.2	2.1393	0.3794	1826.14	1	4440.0%	1	R.KPVLGQAGTLAVGTEGGLR.G
UHIC2_HUMAN89.8%4411.9%615661566.4(Q96JB3) Hypermethylated in cancer 2 protein (Hic-2) (Hic-3) (HIC1-related gene on chromosome 22)
*	TK251102_lung_cytoE16_2_step04.1843.1843.1	0.9196	0.0607	656.6	2	7000.0%	1	R.REAGPK.G
*	TK251102_lung_cytoE16_2_step09.2855.2855.3	1.2733	0.0788	2740.1	1	2070.0%	1	R.GDMGPDMELPSHSKQLLLQLNQQR.T
*	TK251102_lung_cytoE16_2_step12.1716.1716.1	1.6085	0.2403	1248.21	2	4550.0%	1	K.GAHAPQELPQAK.G
*	TK251102_lung_cytoE16_2_step12.4509.4509.3	1.3393	0.0771	3202.74	16	1330.0%	1	R.VPNGILASGAGPSGPYGEPPYPCKEEEENGK.D
USMD3_HUMAN89.7%2228.6%1261391610.3(P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) (P43331) Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3)
	TK251102_lung_cytoE16_2_step04.2413.2413.2	2.4137	0.3507	2415.69	2	3500.0%	1	K.VLHEAEGHIVTCETNTGEVYR.G
	TK251102_lung_cytoE16_2_step02.3369.3369.2	1.4724	0.0699	1743.84	1	4640.0%	1	R.FLILPDMLKNAPMLK.S
UDPOA_MOUSE89.7%81011.3%14651673395.7(P33609) DNA polymerase alpha catalytic subunit (EC 2.7.7.7)
*	TK251102_lung_cytoE16_2_step11.4994.4994.3	0.9991	0.0589	2843.36	307	740.0%	1	R.STGALLNPFSVHTPKAIPSGKPASPVLR.N
*	TK251102_lung_cytoE16_2_step08.2354.2354.3	1.3397	0.0847	3569.93	104	1170.0%	1	R.AYAPEQLQKLDNLAIDTQYYLAQQIHPVVAR.I
	TK251102_lung_cytoE16_2_step09.3635.3635.2	1.078	0.0075	1420.0	18	4090.0%	1	K.NYAFEIPDVPEK.S
*	TK251102_lung_cytoE16_2_step02.4893.4893.3	0.9244	0.075	4556.57	9	830.0%	2	R.GTTSYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVK.G
	TK251102_lung_cytoE16_2_step08.2161.2161.2	1.4627	0.0233	1485.9	1	5420.0%	1	R.FYAKPLAALVTYK.G
	TK251102_lung_cytoE16_2_step04.4548.4548.1	1.9077	0.22	1559.99	1	4170.0%	1	K.SYHLSELVQQILK.T
*	TK251102_lung_cytoE16_2_step04.3203.3203.3	1.4876	0.0077	3383.19	15	1520.0%	1	K.CLCPSCGTENIYDNVFEGSGLDMEPSLYR.C
UQ921J089.5%224.3%564643865.9(Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417)
	TK251102_lung_cytoE16_2_step02.2682.2682.2	1.522	0.042	1342.32	3	5450.0%	1	K.SAFPHLQDAQVK.L
	TK251102_lung_cytoE16_2_step11.3190.3190.2	2.0011	0.4082	1294.53	1	6360.0%	1	K.AVGHPFVIQLGR.I
UQ8R1N489.5%3310.2%374420035.4(Q8R1N4) Similar to KIAA1068 protein (Fragment)
*	TK251102_lung_cytoE16_2_step12.2131.2131.1	1.0392	0.05	791.81	2	6670.0%	1	K.DPPVLPR.I
*	TK251102_lung_cytoE16_2_step01.4479.4479.2	1.2796	0.0156	2450.49	1	2890.0%	1	R.ENYIWSQDYTDLEVRVPVPK.H
	TK251102_lung_cytoE16_2_step10.1786.1786.2	2.5674	0.3039	1265.75	1	7000.0%	1	K.LQGKPQSHELK.V
UQ9CW4689.5%4610.4%756801948.9(Q9CW46) 1300006N24Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step12.4149.4149.2	0.8149	0.0356	2656.12	69	1110.0%	1	K.AVGSSPMGSSEGLLGLGPGPNGHSHLLK.T
*	TK251102_lung_cytoE16_2_step07.4272.4272.2	1.7681	0.3823	2905.66	1	2240.0%	2	R.SGGGSGGPLSHFYSGSPTSYFTSGLQAGLK.Q
*	TK251102_lung_cytoE16_2_step12.2240.2240.2	0.9466	0.0402	2341.1	12	2250.0%	1	R.GLPGDVTNQEVHDLLSDYELK.Y
URTC1_MOUSE89.5%358.2%366392267.9(Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase)
*	TK251102_lung_cytoE16_2_step01.2708.2708.1	0.8462	0.0194	1312.76	1	5000.0%	1	R.AFVAGVLPLKVAK.D
*	TK251102_lung_cytoE16_2_step12.2629.2629.2	2.4838	0.3251	1880.51	1	4380.0%	2	R.STPGLRPQHLSGLEMVR.D
UZAP3_MOUSE89.4%351.9%13861551316.7(Q9R0I7) Nuclear protein ZAP3
	TK251102_lung_cytoE16_2_step09.2848.2848.2	2.3993	0.3475	1988.69	1	4670.0%	2	R.EQHLAQLQQLQQMHQK.Q
	TK251102_lung_cytoE16_2_step02.2195.2195.2	1.2469	0.0748	1354.87	6	4500.0%	1	R.QHLLSLQQRTK.V
UQ1504289.4%556.6%9811105245.6(Q15042) Hypothetical protein KIAA0066 (Fragment)
*	TK251102_lung_cytoE16_2_step03.3341.3341.3	1.8578	0.1322	2357.39	4	2140.0%	1	K.ETADITHALSKLTEPASVPIHK.L
*	TK251102_lung_cytoE16_2_step01.3462.3462.1	0.826	0.054	1468.03	41	3000.0%	1	K.LQMLNCCIERK.K
*	TK251102_lung_cytoE16_2_step01.4746.4746.1	1.5082	0.055	1492.72	23	3750.0%	1	K.EEESLENISSVKK.I
*	TK251102_lung_cytoE16_2_step02.1857.1857.1	1.0839	0.0468	962.42	3	5710.0%	1	K.RMGSPEER.R
*	TK251102_lung_cytoE16_2_step01.2954.2954.1	2.1306	0.0443	1385.42	3	5500.0%	1	R.DYIEEEVIDEK.G
UPSDB_HUMAN89.2%81014.2%422474646.5(O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5)
*	TK251102_lung_cytoE16_2_step03.3206.3206.2	2.4268	0.3384	1266.91	1	8000.0%	1	R.VQIEHISSLIK.L
*	TK251102_lung_cytoE16_2_step01.3328.3328.1	0.8792	0.0368	1596.21	29	3080.0%	1	R.VQIEHISSLIKLSK.A
*	TK251102_lung_cytoE16_2_step01.2066.2066.1	1.5695	0.1598	1212.21	3	5000.0%	1	R.DDPIISTHLAK.L
*	TK251102_lung_cytoE16_2_step03.3571.3571.2	1.0893	0.0659	1402.57	21	3750.0%	1	K.EQSILELGSLLAK.T
*	TK251102_lung_cytoE16_2_step01.3720.3720.1	1.1998	0.1599	1505.03	11	3640.0%	1	K.LYDNLLEQNLIR.V
*	TK251102_lung_cytoE16_2_step04.2301.2301.1	1.9504	0.126	1144.53	1	6670.0%	2	K.TYHALSNLPK.A
UUBL3_MOUSE89.1%3321.7%230261525.0(Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3)
*	TK251102_lung_cytoE16_2_step12.1549.1549.1	1.5252	0.2887	1039.7	1	6250.0%	1	R.KPFPINHGK.T
	TK251102_lung_cytoE16_2_step07.4239.4239.3	0.9886	0.1036	4569.85	195	810.0%	1	R.VTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGR.K
UQ922R889.0%229.1%440481005.1(Q922R8) Similar to protein disulfide isomerase-related protein
	TK251102_lung_cytoE16_2_step01.3331.3331.1	0.8132	0.0189	1529.67	4	3210.0%	1	K.LAAVDATVNQVLASR.Y
*	TK251102_lung_cytoE16_2_step01.4630.4630.2	1.9948	0.5035	2832.29	1	3330.0%	1	K.DGELPVEDDIDLSDVELDDLEKDEL.-
UQ96ID588.9%112.6%467518356.9(Q96ID5) Hypothetical protein
*	TK251102_lung_cytoE16_2_step12.1952.1952.1	1.4371	0.4369	1508.03	1	4090.0%	1	R.WVHSAEPTYFLR.H
UCADC_HUMAN88.9%337.1%794882744.8(P55289) Brain-cadherin precursor (BR-cadherin) (Cadherin-12) (N-cadherin 2) (Cadherin, neural type, 2)
*	TK251102_lung_cytoE16_2_step07.1298.1298.3	1.283	0.0306	2120.15	115	1620.0%	1	R.FKVLADMFGEEESYNPDK.V
*	TK251102_lung_cytoE16_2_step05.4903.4903.2	0.8168	0.0907	3184.59	3	1170.0%	1	K.GEGTVKYTLSGDGAGTVFTIDETTGDIHAIR.S
*	TK251102_lung_cytoE16_2_step03.3041.3041.1	1.4342	0.4927	817.61	1	5830.0%	1	K.HTLMTSK.E
URL32_HUMAN88.9%104019.4%1341572911.3(P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32
	TK251102_lung_cytoE16_2_step12.1824.1824.1	0.9447	0.0278	1093.76	227	3330.0%	1	-.AALRPLVKPK.I
	TK251102_lung_cytoE16_2_step09.2797.2797.2	1.3494	0.1144	946.0	2	6430.0%	1	K.HMLPSGFR.K
	TK251102_lung_cytoE16_2_step11.1893.1893.1	1.7825	0.2212	985.64	1	5710.0%	1	R.KFLVHNVK.E
	TK251102_lung_cytoE16_2_step06.2413.2413.1	1.7326	0.2134	858.56	1	7500.0%	6	K.FLVHNVK.E
UQ9JL3588.8%5179.1%406453124.4(Q9JL35) Nucleosome binding protein 1 (Nucleosome binding protein 45) (NBP-45) (GARP45 protein)
	TK251102_lung_cytoE16_2_step06.3649.3649.2	1.6579	0.076	1656.76	8	3930.0%	4	R.LSAMPVPFTPELKPK.R
	TK251102_lung_cytoE16_2_step05.3317.3317.3	1.556	0.0095	2361.42	52	2140.0%	1	K.IEEEGLNEKPGTAKSEDAEVSK.D
UQ9DC6388.7%229.6%480552275.0(Q9DC63) 1200002G09Rik protein
*	TK251102_lung_cytoE16_2_step11.4504.4504.3	2.3294	0.0888	3611.97	5	1610.0%	1	R.IYEYTSCTTFSTTSGYMEGYYTFHFLYFK.D
	TK251102_lung_cytoE16_2_step11.4316.4316.2	1.9517	0.4666	1827.68	1	4060.0%	1	K.LVVPGLLGSMALSNHYR.S
UM1A2_HUMAN88.7%5117.8%641730047.6(O60476) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) (Mannosidase alpha class 1A member 2)
*	TK251102_lung_cytoE16_2_step03.4246.4246.1	0.7999	0.1464	976.51	39	4290.0%	1	K.NKVVQEMK.I
*	TK251102_lung_cytoE16_2_step05.5313.5313.3	1.4361	0.0438	2925.52	46	1440.0%	1	K.ENKPLPPVPIPNLVGIRGGDPEDNDIR.E
	TK251102_lung_cytoE16_2_step12.3976.3976.2	2.2166	0.1942	1822.85	1	5360.0%	3	K.MDRPNGLYPNYLNPR.T
UQ9UQ3588.6%774.3%275229967612.1(Q9UQ35) RNA binding protein
*	TK251102_lung_cytoE16_2_step12.4833.4833.2	1.0771	0.0278	2603.97	6	2080.0%	1	R.APSPSSRMGQAPSQSLLPPAQDQPR.S
	TK251102_lung_cytoE16_2_step05.4727.4727.3	1.5109	0.0275	2876.79	11	1880.0%	1	K.EDLNGPFLNQLETDPSLDMKEQSTR.S
	TK251102_lung_cytoE16_2_step03.1286.1286.1	0.9486	0.029	789.52	57	4290.0%	1	R.SSSSPPPK.Q
	TK251102_lung_cytoE16_2_step10.1962.1962.1	1.0153	0.0937	634.67	123	5000.0%	1	K.TRTTR.R
*	TK251102_lung_cytoE16_2_step11.0620.0620.2	1.0166	0.1278	2714.95	5	1670.0%	1	R.TPQAPASANLVGPRSAHATAPVNIAGSR.T
	TK251102_lung_cytoE16_2_step02.2371.2371.2	1.047	0.0205	1732.45	2	3330.0%	1	R.LLPRYSHSGSSSPDTK.V
	TK251102_lung_cytoE16_2_step09.2403.2403.2	1.975	0.4412	1362.98	1	6000.0%	1	K.RPNPDILDHER.K
UQ9Z1R188.6%151711.1%21572290729.4(Q9Z1R1) BAT2
	TK251102_lung_cytoE16_2_step11.4648.4648.2	1.3391	0.139	3186.09	8	1540.0%	1	K.EFDQLDQENDDGWAGAHEEVDYTEKLK.F
	TK251102_lung_cytoE16_2_step07.3838.3838.3	1.5582	0.0822	2129.83	28	1970.0%	1	R.QRGSETGSETHESDLAPSDK.E
	TK251102_lung_cytoE16_2_step12.2363.2363.3	2.3231	0.3033	2016.92	3	2780.0%	1	R.ASSAISSDPHFEEPGPMVR.G
	TK251102_lung_cytoE16_2_step12.2265.2265.2	2.0438	0.2068	1322.98	1	6360.0%	2	R.RMPPPANLPSLK.A
	TK251102_lung_cytoE16_2_step12.1161.1161.1	0.6461	0.0836	970.11	1	4290.0%	1	K.LHHGHDPR.G
	TK251102_lung_cytoE16_2_step11.2637.2637.2	0.8348	0.0011	1394.04	32	3330.0%	1	R.EQPLPPGPIGTER.S
*	TK251102_lung_cytoE16_2_step05.3233.3233.3	1.505	0.0076	3443.68	1	1830.0%	1	K.LAWVGDVFTTTPTDPRPLTSPLRQAADEEEK.S
	TK251102_lung_cytoE16_2_step10.1391.1391.3	1.2612	0.1691	1943.97	15	1530.0%	1	K.GNDPNVSLVPKDGTGWASK.Q
	TK251102_lung_cytoE16_2_step08.5290.5290.2	0.7741	0.0171	1350.02	4	3000.0%	1	K.YSSLNLFDTYK.G
	TK251102_lung_cytoE16_2_step06.1961.1961.1	1.6314	0.181	839.74	1	6430.0%	1	R.HGLQSLGK.V
	TK251102_lung_cytoE16_2_step04.1421.1421.1	0.8002	0.0158	485.62	20	3750.0%	1	R.AGPIK.K
*	TK251102_lung_cytoE16_2_step10.1979.1979.2	2.4828	0.3795	1734.23	8	3440.0%	1	K.RPPTAPENTPSVPSGVK.S
	TK251102_lung_cytoE16_2_step10.4866.4866.3	1.9865	0.135	3980.37	7	1320.0%	1	R.SQPLYLPPGPAPPSALLSGVALKGQFLDFSALQATELGK.L
	TK251102_lung_cytoE16_2_step01.1591.1591.1	0.7569	0.0022	1160.59	96	2500.0%	1	K.LISGPLSPMSR.A
URL18_MOUSE88.5%61217.1%1872151311.8(P35980) 60S ribosomal protein L18
	TK251102_lung_cytoE16_2_step05.2660.2660.2	2.4812	0.1161	1407.6	1	6820.0%	1	R.RTNSTFNQVVLK.R
	TK251102_lung_cytoE16_2_step07.1523.1523.1	0.9713	0.0493	488.49	1	8330.0%	1	R.HFGK.A
	TK251102_lung_cytoE16_2_step08.2373.2373.2	2.1237	0.262	1141.45	3	6110.0%	3	R.TNRPPLSLSR.M
*	TK251102_lung_cytoE16_2_step01.1250.1250.1	1.4527	0.152	699.3	2	8000.0%	1	R.ILEVPK.L
UQ8TDJ688.5%996.9%30363397586.4(Q8TDJ6) Rabconnectin
*	TK251102_lung_cytoE16_2_step01.2262.2262.1	1.2306	0.1612	1274.86	3	5560.0%	1	R.EDEEHSQEDR.E
*	TK251102_lung_cytoE16_2_step08.0060.0060.2	0.8681	0.1626	2925.7	28	1350.0%	1	K.HAVKFGDTEADSSNAEEAAMQDHSTFK.S
*	TK251102_lung_cytoE16_2_step11.2065.2065.2	1.644	0.2205	1961.62	1	2780.0%	1	K.CIAGEVAIVRDPDAGEGTK.R
*	TK251102_lung_cytoE16_2_step08.3949.3949.2	0.9629	0.0185	1814.36	54	2810.0%	1	R.MWAAVFGGGVKLVVKPR.R
*	TK251102_lung_cytoE16_2_step07.4250.4250.3	2.0779	0.1359	2947.08	24	1630.0%	1	K.EDDEHQVIIKSCNPVAFSFYNYLR.T
*	TK251102_lung_cytoE16_2_step01.0924.0924.2	0.9523	0.0381	2740.08	14	1670.0%	1	K.LDHDLSLDRESEAGTGSSEHEDGER.E
*	TK251102_lung_cytoE16_2_step03.4590.4590.3	1.1836	0.0129	4610.06	2	1220.0%	1	K.EFSMHVCIFECESTGGSEWVLEQTIHLDDLVKVGSVLDSR.V
*	TK251102_lung_cytoE16_2_step04.3839.3839.3	1.5769	0.0499	2720.99	9	2080.0%	1	K.DSHHTLLHQEGMSVGSPHGSQPHSR.S
*	TK251102_lung_cytoE16_2_step10.2155.2155.2	2.2401	0.3707	2540.04	4	2000.0%	1	K.VWYPMTGWKSSIIPQDHHEVK.R
UQ6221988.5%359.9%444482287.2(Q62219) Transforming growth factor beta 1 induced transcript 1 (HIC-5)
	TK251102_lung_cytoE16_2_step07.3243.3243.2	1.5293	0.225	2058.75	3	3420.0%	2	K.GLCGSCNKPIAGQVVTALGR.A
	TK251102_lung_cytoE16_2_step02.4597.4597.2	1.2747	0.0549	2757.95	1	2390.0%	1	R.LLQELNATQFNITDEIMSQFPSSK.M
UQ921C388.4%13158.1%23042590248.4(Q921C3) WDR9 protein, form A
	TK251102_lung_cytoE16_2_step12.2056.2056.1	0.9113	0.2119	1426.75	1	4000.0%	1	K.RLDWEGNEHNR.S
	TK251102_lung_cytoE16_2_step02.0122.0122.2	0.7318	0.1298	2559.5	52	1140.0%	1	R.GRPPEMPVNYGPPPSLVEIHRGR.Q
	TK251102_lung_cytoE16_2_step06.2196.2196.1	1.0915	0.0118	898.71	4	5830.0%	1	R.QRPEVLR.S
	TK251102_lung_cytoE16_2_step08.1521.1521.1	0.9408	0.0145	693.45	89	5000.0%	1	K.AYTPNK.R
	TK251102_lung_cytoE16_2_step09.2036.2036.1	1.1722	0.0245	622.53	19	6250.0%	1	R.RGSFR.R
	TK251102_lung_cytoE16_2_step02.3579.3579.3	1.0261	0.0119	3038.8	81	1430.0%	1	R.TCAPVAVLQGHTGSITSLQFSPMAKGPQR.Y
	TK251102_lung_cytoE16_2_step12.2240.2240.3	1.0363	0.0035	3511.15	52	1130.0%	1	K.LSPWDMEPIPDNVDPPKELGASISVTSDELEK.L
	TK251102_lung_cytoE16_2_step09.3835.3835.3	1.8309	0.2136	2012.45	11	2500.0%	1	K.LTSDAEDLSLESVCTRSK.R
	TK251102_lung_cytoE16_2_step11.2970.2970.3	1.3243	0.1243	2759.4	21	1850.0%	1	-.MAEPSPARRPVPLIESELYFLIAR.Y
	TK251102_lung_cytoE16_2_step08.1217.1217.1	0.6773	0.0498	1525.11	38	2310.0%	1	R.LSLDIQSPPNIGLR.R
	TK251102_lung_cytoE16_2_step07.4056.4056.1	1.5911	0.2349	745.42	2	6670.0%	2	K.VPLSATR.K
	TK251102_lung_cytoE16_2_step06.1554.1554.1	1.0091	0.0328	1400.0	123	2000.0%	1	R.RNNIYELNPHK.E
UNMT1_MOUSE88.4%227.5%496568888.0(O70310) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97) (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase)
*	TK251102_lung_cytoE16_2_step10.3542.3542.2	2.4061	0.3324	1405.76	1	7270.0%	1	K.KDIPVVHQLLSR.Y
	TK251102_lung_cytoE16_2_step08.5237.5237.3	1.2551	0.0283	2713.25	406	1460.0%	1	R.VHLEGIFQAVYTAGVVLPKPVGTCR.Y
UQ9NVF388.3%2224.3%189203458.4(Q9NVF3) Hypothetical protein FLJ10773
*	TK251102_lung_cytoE16_2_step05.3252.3252.2	1.2826	0.0235	1884.38	18	2780.0%	1	-.MSEDNRPLTGLAAAIAGAK.L
*	TK251102_lung_cytoE16_2_step06.4042.4042.2	2.2122	0.3627	2704.56	2	2500.0%	1	K.TDTGRGNGPLPLGGSGLMEEMSALLAR.R
UUBIQ_HUMAN87.9%92919.7%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin
	TK251102_lung_cytoE16_2_step01.2291.2291.1	1.6166	0.1108	648.69	3	8000.0%	2	R.LIFAGK.Q
	TK251102_lung_cytoE16_2_step02.3161.3161.1	1.5223	0.2781	1069.69	1	6250.0%	4	K.ESTLHLVLR.L
UQ9P22987.8%449.8%660737887.1(Q9P229) Hypothetical protein KIAA1499 (Fragment)
	TK251102_lung_cytoE16_2_step09.1696.1696.1	1.0168	0.1161	609.65	34	6000.0%	1	R.HGPLGK.C
*	TK251102_lung_cytoE16_2_step05.2804.2804.1	1.6168	0.2282	1412.68	1	3640.0%	1	K.TGNQHFGYLYGR.Y
	TK251102_lung_cytoE16_2_step12.4540.4540.3	2.1942	0.0972	4322.7	2	1350.0%	1	R.LSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVR.D
	TK251102_lung_cytoE16_2_step02.2254.2254.1	1.3245	0.0334	881.27	5	5830.0%	1	K.QDGKIYR.S
UPSB6_MOUSE87.8%225.0%238254255.1(Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y)
*	TK251102_lung_cytoE16_2_step11.2652.2652.2	2.1934	0.3621	1569.56	1	5910.0%	1	K.LTPIHDHIFCCR.S
UADK_MOUSE87.7%337.5%279311037.4(P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment)
	TK251102_lung_cytoE16_2_step08.2194.2194.1	1.0041	0.102	1195.57	198	2220.0%	1	R.EQGFETKDIK.E
	TK251102_lung_cytoE16_2_step09.2753.2753.2	1.6386	0.1681	1158.26	1	7000.0%	1	R.AGHYAASVIIR.R
UMM09_HUMAN87.6%171739.8%707784276.1(P14780) 92 kDa type IV collagenase precursor (EC 3.4.24.35) (92 kDa gelatinase) (Matrix metalloproteinase-9) (MMP-9) (Gelatinase B) (GELB)
*	TK251102_lung_cytoE16_2_step01.5470.5470.2	0.7597	0.0326	3175.94	68	1110.0%	1	R.SYSACTTDGRSDGLPWCSTTANYDTDDR.F
*	TK251102_lung_cytoE16_2_step09.2344.2344.3	1.4756	0.2454	2105.68	3	2360.0%	1	R.GSRPQGPFLIADKWPALPR.K
*	TK251102_lung_cytoE16_2_step07.3140.3140.2	1.1131	5.0E-4	1962.78	3	2940.0%	1	R.FSEGRGSRPQGPFLIADK.W
*	TK251102_lung_cytoE16_2_step09.2369.2369.3	1.2671	0.0306	1922.39	36	2330.0%	1	R.MFPGVPLDTHDVFQYR.E
*	TK251102_lung_cytoE16_2_step03.2369.2369.1	1.5645	0.0855	869.63	9	5830.0%	13	K.WPALPRK.L
UQ8R0H987.4%353.5%635699725.3(Q8R0H9) Similar to golgi associated, gamma adaptin ear containing, ARF binding protein 1
*	TK251102_lung_cytoE16_2_step10.3525.3525.2	0.9965	0.066	889.31	2	6670.0%	1	R.VLFHFAR.D
*	TK251102_lung_cytoE16_2_step11.3310.3310.2	0.939	0.2544	1687.75	2	3210.0%	2	K.LPEDAIFPLPPPRPK.N
UQ9CQ1687.4%118.8%1481660511.1(Q9CQ16) Ribosomal protein L27a (Ribosmal protein L27a)
	TK251102_lung_cytoE16_2_step05.2516.2516.2	2.2956	0.3515	1579.14	1	5830.0%	1	K.RNQSFCPTVNLDK.L
UQ9BYK887.3%995.9%25672858247.4(Q9BYK8) DJ697K14.6 (Novel protein, KIAA1769)
*	TK251102_lung_cytoE16_2_step04.3104.3104.1	1.962	0.2082	1589.66	1	5000.0%	1	-.MAVWEAEQLGGLQR.G
*	TK251102_lung_cytoE16_2_step05.2836.2836.2	1.1167	0.0819	2148.21	8	2940.0%	1	R.NLALGHPEEMERWHTGNR.H
	TK251102_lung_cytoE16_2_step05.2557.2557.2	0.9817	0.0191	2411.71	30	1900.0%	1	R.AFLTFTVDPQGACNLDDALSVR.D
	TK251102_lung_cytoE16_2_step02.1918.1918.1	0.9062	0.0094	807.64	27	6000.0%	1	R.KFELDR.H
*	TK251102_lung_cytoE16_2_step01.0819.0819.2	1.0662	0.0689	2953.03	6	1670.0%	1	-.MAVWEAEQLGGLQRGDLLTPPAPDGDGR.T
	TK251102_lung_cytoE16_2_step01.2516.2516.3	0.9862	0.0105	3237.81	57	930.0%	1	R.TQDYEQMVDLVTTDDMHPFLAPAGRDLR.K
*	TK251102_lung_cytoE16_2_step06.1377.1377.2	0.9508	0.0627	1467.95	21	3330.0%	1	K.TYTLAMASLEVIR.R
	TK251102_lung_cytoE16_2_step05.4331.4331.3	0.7986	0.0575	3136.68	142	600.0%	1	R.VLNTVLTRAQSQLVVVGDAVALCSFGACGK.L
*	TK251102_lung_cytoE16_2_step07.2742.2742.1	1.1818	0.0124	691.71	45	5000.0%	1	R.GQVFLK.T
UQ9D2N187.2%111.9%423476527.4(Q9D2N1) 4632406N01Rik protein
*	TK251102_lung_cytoE16_2_step12.1727.1727.1	1.5272	0.2478	943.12	3	5710.0%	1	R.ILHVHPVK.S
UQ8TDK387.1%116.2%1301461210.0(Q8TDK3) Gm133 (Fragment)
	TK251102_lung_cytoE16_2_step06.1969.1969.1	1.5851	0.2293	924.63	3	5000.0%	1	K.EVPLPNPR.N
UQ1312987.1%220.9%19142178996.8(Q13129) RLF
*	TK251102_lung_cytoE16_2_step09.2303.2303.1	1.6011	0.2206	1301.61	1	5000.0%	1	R.RHFMSAFHLR.E
*	TK251102_lung_cytoE16_2_step07.2291.2291.1	1.1876	0.0125	860.49	2	6670.0%	1	K.YLSVHLK.A
UVAB2_MOUSE87.1%7159.6%511565515.8(P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit)
	TK251102_lung_cytoE16_2_step06.3945.3945.2	1.911	0.3773	2180.59	2	3160.0%	3	K.IPIFSAAGLPHNEIAAQICR.Q
	TK251102_lung_cytoE16_2_step07.3424.3424.2	1.568	0.0421	1594.73	1	5420.0%	1	K.RIPQSTLSEFYPR.D
	TK251102_lung_cytoE16_2_step12.1299.1299.1	0.9659	0.1501	1051.68	6	2780.0%	2	K.SAIGEGMTRK.D
	TK251102_lung_cytoE16_2_step12.2520.2520.3	1.4848	0.2258	2773.5	54	1400.0%	1	K.IPIFSAAGLPHNEIAAQICRQAGLVK.K
UDLP2_HUMAN87.0%10247.0%10191137847.0(Q9P1A6) Disks large-associated protein 2 (DAP-2) (SAP90/PSD-95-associated protein 2) (SAPAP2) (PSD-95/SAP90 binding protein 2) (Fragment)
*	TK251102_lung_cytoE16_2_step06.2634.2634.2	0.824	0.0052	1606.36	31	2670.0%	1	K.SHSLEGSSKSNANGTK.A
*	TK251102_lung_cytoE16_2_step08.3461.3461.2	0.9524	0.144	1420.16	131	3330.0%	1	K.LFTKSHSLEGSSK.S
*	TK251102_lung_cytoE16_2_step07.1924.1924.1	1.0757	0.1603	644.5	2	7500.0%	2	R.HGRFK.R
*	TK251102_lung_cytoE16_2_step04.4488.4488.3	1.161	0.1072	4353.72	3	1090.0%	1	K.SIGQRPLGEHQTQTYLQAASDVPVGHSLDPAANYNSPKFR.S
*	TK251102_lung_cytoE16_2_step04.5269.5269.3	1.6496	0.2318	4051.16	7	1280.0%	1	K.SIGQRPLGEHQTQTYLQAASDVPVGHSLDPAANYNSPK.F
	TK251102_lung_cytoE16_2_step07.1610.1610.1	1.2105	0.1234	656.6	1	7000.0%	4	K.KPPKGK.F
UQ6182387.0%3310.4%469517025.2(Q61823) MA-3 protein
	TK251102_lung_cytoE16_2_step01.4766.4766.2	2.1184	0.3653	2707.71	1	2950.0%	1	K.TLTPIIQEYFEHGDTNEVAEMLR.D
	TK251102_lung_cytoE16_2_step08.3442.3442.2	1.8994	0.0359	1594.41	2	4230.0%	1	K.LLKDLPELALDTPR.A
*	TK251102_lung_cytoE16_2_step02.3745.3745.1	0.6767	0.033	1157.99	19	2270.0%	1	R.SGVAVPTSPKGR.L
UQ9D8G686.9%226.1%560648096.2(Q9D8G6) 2010002I23Rik protein
	TK251102_lung_cytoE16_2_step05.3788.3788.3	1.2614	0.0495	2713.28	178	1310.0%	1	R.YADLYAASFINLLYYPFSYLFR.A
	TK251102_lung_cytoE16_2_step08.3825.3825.2	2.4851	0.3134	1364.54	1	7270.0%	1	R.KPLFFGEGTVLR.Q
UQ9CY2686.7%356.0%298333665.5(Q9CY26) 2700085E05Rik protein
*	TK251102_lung_cytoE16_2_step04.1361.1361.1	1.3816	6.0E-4	1203.69	4	5000.0%	1	K.ELPDIEDLMK.R
	TK251102_lung_cytoE16_2_step10.3539.3539.2	2.2414	0.3559	1082.99	1	8570.0%	2	R.FQTVHFFR.D
UQ9H6M786.5%4107.0%774844087.6(Q9H6M7) Hypothetical protein FLJ22087
	TK251102_lung_cytoE16_2_step02.2883.2883.3	1.3546	0.2407	3236.85	16	860.0%	1	K.NPALPLGTAPWTSQAYNALTSVVTSCKNFK.V
	TK251102_lung_cytoE16_2_step10.4393.4393.2	2.2314	0.3439	2647.42	4	2170.0%	3	K.LLEELGTGLIQQYKPDSTAAPDQR.A
UQ921S086.4%359.1%452510128.3(Q921S0) Similar to hypothetical protein FLJ12810
*	TK251102_lung_cytoE16_2_step06.1773.1773.1	0.9805	0.0522	842.58	23	5000.0%	2	K.EPALILGK.Q
*	TK251102_lung_cytoE16_2_step11.5169.5169.3	0.8907	0.0642	3851.78	17	940.0%	1	K.QIHTLYLDNTNCNPALVLPSRQEATQQIVQLIR.Q
UA1A1_HUMAN86.1%241.2%10231128965.5(P05023) Sodium/potassium-transporting ATPase alpha-1 chain precursor (EC 3.6.3.9) (Sodium pump 1) (Na+/K+ ATPase 1)
*	TK251102_lung_cytoE16_2_step01.2567.2567.1	1.4717	0.0766	1295.97	6	4550.0%	2	K.YEPAAVSEQGDK.K
UQ9R0E286.0%226.0%728835956.5(Q9R0E2) Lysyl hydroxylase 1 (Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1)
*	TK251102_lung_cytoE16_2_step02.3655.3655.3	1.1965	0.2126	3893.68	33	1370.0%	1	R.HTFGHLLSLDNYQTTHLHNDLWEVFSNPEDWK.E
*	TK251102_lung_cytoE16_2_step10.2305.2305.2	1.9754	0.3945	1397.28	1	5910.0%	1	R.LTHYHEGLPTTK.G
UQ9HC8286.0%449.7%838947815.6(Q9HC82) Rb-associated protein
	TK251102_lung_cytoE16_2_step06.1433.1433.1	0.9801	0.0237	617.61	7	5000.0%	1	R.KLGATK.Q
	TK251102_lung_cytoE16_2_step08.3895.3895.3	1.5235	0.0846	4021.44	99	910.0%	1	R.AQASGSAHSTPNLGHPEDSGVSAPAPGKEEGGPGPVSTPDNR.K
	TK251102_lung_cytoE16_2_step12.2261.2261.2	1.9624	0.3983	1670.25	1	5380.0%	1	R.HLISSLQNHNHQLK.G
	TK251102_lung_cytoE16_2_step02.0143.0143.3	1.217	0.2617	2073.56	9	1250.0%	1	R.VYSRGDSEPLSEAAQAHTR.E
U22A3_MOUSE85.6%227.2%250287818.8(P70122) Protein 22A3
*	TK251102_lung_cytoE16_2_step05.1797.1797.1	1.7986	0.2164	1200.66	1	7220.0%	1	K.DIHYSVKPNK.S
	TK251102_lung_cytoE16_2_step02.1937.1937.1	0.9923	0.0533	929.45	246	2860.0%	1	K.QQALEVIK.Q
URAGE_MOUSE85.4%229.4%403426696.1(Q62151) Advanced glycosylation end product-specific receptor precursor (Receptor for advanced glycosylation end products)
*	TK251102_lung_cytoE16_2_step07.2468.2468.1	2.0514	0.1399	1153.59	1	6250.0%	1	K.KPPQQLEWK.L
*	TK251102_lung_cytoE16_2_step05.3572.3572.3	2.0741	0.0124	2921.58	60	1520.0%	1	-.MPAGTAARAWVLVLALWGAVAGGQNITAR.I
USPEE_MOUSE85.2%3325.8%302339955.5(Q64674) Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY)
	TK251102_lung_cytoE16_2_step11.4968.4968.2	2.143	0.3488	2603.67	1	2860.0%	1	R.ETCSLWPGQALSLQVEQLLHHR.R
*	TK251102_lung_cytoE16_2_step12.5492.5492.2	0.9683	0.0097	2903.05	111	1140.0%	1	K.EDGILCCQGECQWLHLDLIKEMR.H
	TK251102_lung_cytoE16_2_step08.4985.4985.3	1.2539	0.0113	3772.99	130	1170.0%	1	K.QNQDAFDVIITDSSDPMGPAESLFKESYYQLMK.T
UPMGE_MOUSE85.1%51711.2%258298477.1(P15327) Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM)
*	TK251102_lung_cytoE16_2_step09.3371.3371.2	2.102	0.1214	1993.79	2	3060.0%	4	R.AVGPHQFLGNQEAIQAAIK.K
*	TK251102_lung_cytoE16_2_step11.2129.2129.1	0.9736	0.0593	1129.7	135	3330.0%	1	K.LNNDGLEEAR.N
UHS71_HUMAN85.0%2210.3%641700525.6(P08107) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2)
*	TK251102_lung_cytoE16_2_step12.5241.5241.3	1.6528	0.1197	4242.78	2	1220.0%	1	K.ELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD.-
*	TK251102_lung_cytoE16_2_step07.3684.3684.2	2.0055	0.3713	2268.86	1	2620.0%	1	K.AAAIGIDLGTTYSCVGVFQHGK.V
UQ9CWR284.8%243.0%428491267.1(Q9CWR2) 2410008A19Rik protein
*	TK251102_lung_cytoE16_2_step11.3573.3573.2	2.3857	0.3098	1439.89	2	4580.0%	2	R.AVAPLRPGELLFR.S
UQ99LC384.7%4103.1%355406037.8(Q99LC3) RIKEN cDNA 2900053E13 gene
*	TK251102_lung_cytoE16_2_step03.2510.2510.1	1.1303	0.1305	805.62	15	5000.0%	3	K.LHEYSR.V
	TK251102_lung_cytoE16_2_step10.1434.1434.1	0.6417	0.0341	571.13	33	3750.0%	1	R.ELPGR.K
URL13_MOUSE84.7%71321.4%2102417411.5(P47963) 60S ribosomal protein L13 (A52)
*	TK251102_lung_cytoE16_2_step12.2356.2356.2	2.0569	0.3215	1325.13	1	6500.0%	1	R.NGMILKPHFHK.D
*	TK251102_lung_cytoE16_2_step10.3510.3510.3	1.6336	0.0701	2315.61	2	2260.0%	1	K.GDSSAEELKLATQLTGPVMPIR.N
	TK251102_lung_cytoE16_2_step10.1443.1443.1	0.676	0.0323	628.7	36	4000.0%	3	R.KPSAPK.K
	TK251102_lung_cytoE16_2_step06.1476.1476.1	1.1587	0.0441	624.67	4	7000.0%	1	R.VAGIHK.K
UDPO2_MOUSE84.6%223.2%600662675.4(P33611) DNA polymerase alpha 70 kDa subunit (DNA polymerase subunit B)
	TK251102_lung_cytoE16_2_step09.3645.3645.2	2.2578	0.3365	1385.98	1	5000.0%	1	R.SSGSHLVFVPSLR.D
	TK251102_lung_cytoE16_2_step07.1932.1932.1	1.0838	0.0023	767.57	3	7000.0%	1	K.HILTQR.S
UGATM_MOUSE84.6%229.5%423482977.9(Q9D964) Glycine amidinotransferase, mitochondrial precursor (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT)
*	TK251102_lung_cytoE16_2_step07.4184.4184.3	1.6161	0.0625	3710.11	1	1480.0%	1	K.TPDFESTGLYSAMPRDILMVVGNEIIEAPMAWR.S
	TK251102_lung_cytoE16_2_step01.2488.2488.1	1.4937	0.2782	1033.35	1	7500.0%	1	K.YWPFYQK.N
UAFP1_HUMAN84.6%352.9%373417386.7(P53367) Arfaptin 1
*	TK251102_lung_cytoE16_2_step05.3457.3457.2	1.8454	0.0854	1142.39	13	5500.0%	1	K.SGPVILADEIK.N
UQ9CWS084.1%3310.9%285313816.0(Q9CWS0) 2410006N07Rik protein
*	TK251102_lung_cytoE16_2_step08.3389.3389.2	2.4714	0.2714	1854.58	1	4670.0%	1	K.LKDHLLIPVSNSEMEK.V
	TK251102_lung_cytoE16_2_step05.1532.1532.1	1.446	0.1499	754.52	2	5830.0%	1	R.ATHAVVR.A
	TK251102_lung_cytoE16_2_step08.2350.2350.1	1.1626	0.0147	927.65	39	5000.0%	1	R.EFFVGLSK.R
UCIN2_HUMAN84.0%442.9%20052279165.7(Q99250) Sodium channel protein, brain II alpha subunit
*	TK251102_lung_cytoE16_2_step07.3691.3691.3	1.6244	0.1968	3282.8	3	1720.0%	1	K.LNENSTPEKTDMTPSTTSPPSYDSVTKPEK.E
*	TK251102_lung_cytoE16_2_step11.2545.2545.1	0.9345	0.0721	1416.96	60	2730.0%	1	R.KQEEVSAIIIQR.A
*	TK251102_lung_cytoE16_2_step07.2012.2012.1	1.2201	0.1096	572.59	2	6250.0%	1	R.KLAIK.I
*	TK251102_lung_cytoE16_2_step05.2603.2603.1	1.6934	0.2181	1500.4	3	4090.0%	1	K.FKCCQISIEEGK.G
UQ9DAB583.8%51112.1%2242609410.1(Q9DAB5) Histone H2B
*	TK251102_lung_cytoE16_2_step01.1192.1192.1	0.848	0.0798	703.38	111	6000.0%	3	R.EKAKPK.K
*	TK251102_lung_cytoE16_2_step06.1497.1497.1	1.1705	0.0221	817.49	14	5830.0%	1	K.EKPEGEK.L
*	TK251102_lung_cytoE16_2_step10.3053.3053.2	0.9395	0.158	1725.18	6	2690.0%	1	R.EQETPEQEKPEVQR.R
UP137_MOUSE83.8%224.3%656735485.4(Q60865) GPI-anchored protein p137 (p137GPI)
*	TK251102_lung_cytoE16_2_step01.5259.5259.2	2.004	0.3632	2468.59	1	3100.0%	1	K.QGLSGVPILSEEELSLLDEFYK.L
	TK251102_lung_cytoE16_2_step05.1851.1851.1	1.1554	0.1691	832.56	3	5000.0%	1	R.REQLMR.E
UGSHP_MOUSE83.8%2210.6%226253778.1(P46412) Plasma glutathione peroxidase precursor (EC 1.11.1.9) (GSHPx-P)
	TK251102_lung_cytoE16_2_step09.4287.4287.2	2.0957	0.3495	1956.86	1	3440.0%	1	K.YVRPGGGFVPNFQLFEK.G
	TK251102_lung_cytoE16_2_step04.4759.4759.2	1.4241	0.3002	2655.95	1	1960.0%	1	K.YVRPGGGFVPNFQLFEKGDVNGEK.E
UDHSO_MOUSE83.7%226.9%375400917.0(Q64442) Sorbitol dehydrogenase (EC 1.1.1.14) (L-iditol 2-dehydrogenase) (Fragment)
	TK251102_lung_cytoE16_2_step11.2202.2202.2	2.4264	0.2986	1278.15	1	5500.0%	1	K.TLNVKPLVTHR.F
	TK251102_lung_cytoE16_2_step04.2308.2308.3	1.7498	0.1196	1561.28	7	2500.0%	1	K.GENLSLVVHGPGDIR.L
UQ9UG9483.6%2215.2%132149719.5(Q9UG94) Hypothetical protein
*	TK251102_lung_cytoE16_2_step10.2931.2931.2	1.1442	0.1381	1425.85	229	2690.0%	1	K.ALGIAQPKGMLLGR.D
*	TK251102_lung_cytoE16_2_step03.3897.3897.1	1.669	0.2171	1550.65	1	4230.0%	1	K.HPELFKALGIAQPK.G
UABCR_HUMAN83.6%573.1%22732559416.3(P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein)
*	TK251102_lung_cytoE16_2_step02.4750.4750.2	0.6748	0.0956	2259.51	57	1050.0%	1	K.DRSPEEYGITVISQPLNLTK.E
*	TK251102_lung_cytoE16_2_step02.3973.3973.1	1.4431	0.3226	1278.85	1	6000.0%	2	K.DIACSEALLER.F
*	TK251102_lung_cytoE16_2_step06.4765.4765.2	1.2363	0.1344	1968.04	1	3670.0%	1	R.NANPLYSHHECHFPNK.A
*	TK251102_lung_cytoE16_2_step11.4985.4985.2	1.6907	0.2718	2253.99	8	2050.0%	1	K.TTTLSILTGLLPPTSGTVLVGGR.D
UACBP_MOUSE83.4%2220.9%8698698.8(P31786) Acyl-CoA-binding protein (ACBP) (Diazepam binding inhibitor) (DBI) (Endozepine) (EP)
*	TK251102_lung_cytoE16_2_step08.2634.2634.3	1.2376	0.0735	2225.8	2	2650.0%	1	R.LKTQPTDEEMLFIYSHFK.Q
*	TK251102_lung_cytoE16_2_step03.4115.4115.2	1.9691	0.3745	1989.0	1	4330.0%	1	K.TQPTDEEMLFIYSHFK.Q
UQ99NA283.3%61813.7%3223478510.1(Q99NA2) BHLH factor Math6
	TK251102_lung_cytoE16_2_step04.2125.2125.2	1.3226	0.0211	1574.4	1	4230.0%	4	R.TRVHTISAAFEALR.K
*	TK251102_lung_cytoE16_2_step10.3018.3018.3	1.3431	0.1553	2943.91	1	1900.0%	1	R.DRTQPFPIATPVPASVAPAVPPGGGTDTAR.E
USPSY_MOUSE83.2%4612.0%366413135.1(P97355) Spermine synthase (EC 2.5.1.22) (Spermidine aminopropyltransferase) (SPMSY)
	TK251102_lung_cytoE16_2_step03.4121.4121.2	1.3163	0.2012	1872.09	1	4330.0%	1	K.MVTMVEIDQMVIDGCK.K
	TK251102_lung_cytoE16_2_step03.1677.1677.1	1.2105	0.1309	850.64	37	5830.0%	1	K.RLPPIVR.G
*	TK251102_lung_cytoE16_2_step05.4293.4293.2	1.5863	0.3115	2364.55	1	3000.0%	2	R.IYPHGLVLLDLQSYDSDVQGK.Q
UQ99P3183.2%3320.7%357391675.4(Q99P31) Hsp70 binding protein (RIKEN cDNA 1500019G21 gene)
	TK251102_lung_cytoE16_2_step11.4373.4373.2	1.9251	0.4269	1803.78	1	3670.0%	1	K.SAFLLQNLLVGHPEHK.G
*	TK251102_lung_cytoE16_2_step11.2510.2510.3	1.1342	0.0033	1874.53	2	2830.0%	1	K.LLQTCFSSPTDDSMDR.-
	TK251102_lung_cytoE16_2_step05.4056.4056.3	0.9604	0.1326	4564.85	27	790.0%	1	R.EGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLR.W
UQ6176983.1%10105.6%29383244289.7(Q61769) Ki-67 protein
*	TK251102_lung_cytoE16_2_step06.3256.3256.3	1.187	0.1412	2730.34	66	1460.0%	1	K.DITGFQDSFQIPDHANGPLVVVKTK.K
*	TK251102_lung_cytoE16_2_step02.4547.4547.1	1.5107	0.2376	1279.0	5	4090.0%	1	K.LDSTAGMPNSKR.M
*	TK251102_lung_cytoE16_2_step11.3656.3656.2	1.1759	0.0052	2299.4	73	2110.0%	1	K.LESVEEQVSTVMKTEEMEAK.R
	TK251102_lung_cytoE16_2_step06.1040.1040.1	0.4765	0.2554	518.1	2	2500.0%	1	R.SIPAK.V
	TK251102_lung_cytoE16_2_step09.2683.2683.1	1.065	0.0010	1419.66	108	2920.0%	1	K.QKLDFTGNSSGHK.R
*	TK251102_lung_cytoE16_2_step07.2418.2418.2	1.3566	0.358	1411.96	2	4090.0%	1	R.LVVTEEPIPQRK.T
*	TK251102_lung_cytoE16_2_step08.3935.3935.3	1.6872	0.1377	3813.29	6	1320.0%	1	K.GSFSKPEKLATAAEQTCSGLPGLSSVDISNFGDSINK.S
*	TK251102_lung_cytoE16_2_step06.3577.3577.2	1.1572	0.0105	1959.09	3	3240.0%	1	R.ASRDSFCADPDGEGQDTK.A
*	TK251102_lung_cytoE16_2_step06.1490.1490.1	1.0117	0.0676	670.62	2	7500.0%	1	R.RNQPR.T
*	TK251102_lung_cytoE16_2_step05.4724.4724.2	1.1757	0.0146	1892.23	38	2350.0%	1	K.MSLESSQAKPVKTPASTK.R
UMYHB_MOUSE82.9%10106.5%19722270265.5(O08638) Myosin heavy chain, smooth muscle isoform (SMMHC)
	TK251102_lung_cytoE16_2_step09.2809.2809.2	1.2659	0.0867	1054.7	5	5000.0%	1	K.VKPLLQVTR.Q
	TK251102_lung_cytoE16_2_step10.3362.3362.3	1.1605	0.0055	1624.57	50	2500.0%	1	K.AEMEDLVSSKDDVGK.N
	TK251102_lung_cytoE16_2_step03.2258.2258.1	1.0199	0.1055	932.6	141	3570.0%	1	R.QLVSNLEK.K
*	TK251102_lung_cytoE16_2_step06.2550.2550.3	1.4246	0.2368	2180.62	124	2080.0%	1	K.TQLEESEDDVQATEDAKLR.L
	TK251102_lung_cytoE16_2_step07.3483.3483.2	1.1439	0.0857	2285.68	23	1840.0%	1	R.ELEGHISDLQEDLDSERAAR.N
	TK251102_lung_cytoE16_2_step08.1437.1437.1	0.4586	0.0428	517.51	5	5000.0%	1	K.QAATK.S
	TK251102_lung_cytoE16_2_step09.3984.3984.2	1.3335	0.2366	2319.6	2	2630.0%	1	K.LDAFLVLEQLRCNGVLEGIR.I
	TK251102_lung_cytoE16_2_step05.1291.1291.2	0.8154	0.0264	1308.05	29	2730.0%	1	K.EQADFAIEALAK.A
	TK251102_lung_cytoE16_2_step09.3428.3428.2	1.1336	0.1828	1548.18	29	4170.0%	1	K.SKHESMISELEVR.L
	TK251102_lung_cytoE16_2_step06.1652.1652.1	1.4828	0.2726	846.32	2	6670.0%	1	R.KLQAQMK.D
UQ8R4A082.8%592.5%12031331554.7(Q8R4A0) Translocated promoter region protein (Fragment)
*	TK251102_lung_cytoE16_2_step05.1957.1957.1	1.9053	0.1992	856.5	1	6430.0%	2	K.ITHLSGVK.D
*	TK251102_lung_cytoE16_2_step05.3092.3092.3	1.2959	0.0906	2117.81	18	2340.0%	1	R.NQQLINQQKDPDTEEYR.K
	TK251102_lung_cytoE16_2_step07.2058.2058.1	1.0602	0.0223	602.6	1	6250.0%	2	R.QITLK.T
UQ9H3S782.8%554.6%16361789726.9(Q9H3S7) Protein tyrosine phosphatase HD-PTP (Protein tyrosine phosphatase TD14)
*	TK251102_lung_cytoE16_2_step05.3112.3112.1	1.536	0.2238	1567.71	1	3750.0%	1	R.EHFPQAYSVDMSR.Q
*	TK251102_lung_cytoE16_2_step05.2111.2111.3	1.3528	0.0813	1857.47	3	3210.0%	1	K.DIRDLLEEDELLEQK.F
*	TK251102_lung_cytoE16_2_step03.2411.2411.3	1.2422	0.0588	2375.84	73	1500.0%	1	R.ELIQKDDITASLVTTDHSEMK.K
*	TK251102_lung_cytoE16_2_step11.3106.3106.2	0.6849	0.0038	1706.14	85	1790.0%	1	K.VAALLERTQSTCQAR.E
*	TK251102_lung_cytoE16_2_step04.2376.2376.2	1.0587	0.0477	1314.02	13	5000.0%	1	R.ELQDAQEHDAR.G
UQ9CZ5682.8%61025.8%132141939.2(Q9CZ56) 2810405J23Rik protein
	TK251102_lung_cytoE16_2_step12.2017.2017.1	0.8918	0.153	1406.88	26	2310.0%	2	K.KGGDGIKPPPIIGR.F
	TK251102_lung_cytoE16_2_step11.2518.2518.1	0.7924	0.0277	812.66	15	4170.0%	1	R.VPVPDER.F
	TK251102_lung_cytoE16_2_step08.3358.3358.2	1.7248	0.2199	1641.48	1	4170.0%	1	R.FDFLCQYHKPASK.I
UUGDH_MOUSE82.7%4411.2%493548327.6(O70475) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc dehydrogenase) (UDP-GlcDH) (UDPGDH)
*	TK251102_lung_cytoE16_2_step12.1283.1283.1	1.3052	0.0229	1526.01	24	3330.0%	1	K.NLFFSTNIDDAIR.E
*	TK251102_lung_cytoE16_2_step04.2764.2764.3	1.532	0.0655	2143.86	7	2640.0%	1	R.IPYTPGEIPKFSLQDPPNK.K
*	TK251102_lung_cytoE16_2_step03.3375.3375.1	1.2502	0.0659	1473.84	1	4090.0%	1	R.ALCAVYEHWVPK.E
	TK251102_lung_cytoE16_2_step07.3911.3911.2	2.4779	0.1838	1295.26	1	6500.0%	1	K.MLKPAFIFDGR.R
UQ9D0U282.5%4410.3%300335506.1(Q9D0U2) 1190002C07Rik protein
	TK251102_lung_cytoE16_2_step05.3523.3523.3	1.7175	0.0278	1764.22	21	2860.0%	1	R.WGPNHAADPIITRWK.R
	TK251102_lung_cytoE16_2_step02.1558.1558.1	1.379	0.0241	955.69	7	6430.0%	1	K.ENSHNKAR.T
*	TK251102_lung_cytoE16_2_step05.1440.1440.1	1.4719	0.2842	838.47	1	6430.0%	1	K.ITHPVSGK.C
	TK251102_lung_cytoE16_2_step02.1417.1417.1	0.9873	0.0038	729.19	1	6000.0%	1	K.ENSHNK.A
UQ8R1B482.5%7714.7%9111055315.8(Q8R1B4) Similar to eukaryotic translation initiation factor 3, subunit 8 (110kD)
*	TK251102_lung_cytoE16_2_step06.4841.4841.3	1.6832	0.0505	3141.29	36	1550.0%	1	R.FFTTGSDSESESSLSGEELVTKPVSGNYGK.Q
*	TK251102_lung_cytoE16_2_step04.0050.0050.1	0.8342	5.0E-4	1484.29	167	2730.0%	1	K.GTTEEICQIYLR.R
	TK251102_lung_cytoE16_2_step06.2246.2246.1	1.4711	0.2739	937.58	1	6670.0%	1	R.ILHTYYK.F
	TK251102_lung_cytoE16_2_step04.1177.1177.1	0.8102	0.0068	671.22	54	4170.0%	1	R.GGVPLVK.E
*	TK251102_lung_cytoE16_2_step12.4004.4004.2	0.7878	0.0726	2988.06	26	1480.0%	1	R.ATQIELLQLLVQIAAENNLGVGVIVKIK.F
	TK251102_lung_cytoE16_2_step01.3832.3832.1	0.6744	0.0042	1113.1	13	2220.0%	1	K.ELLGQGLLLR.S
*	TK251102_lung_cytoE16_2_step02.4669.4669.3	1.5372	0.0199	4477.76	16	1220.0%	1	K.MEDDDEDSEDSEDEEWDTSSTSSDSDSEEEEGKQTVLASK.F
UQ99JX482.5%353.7%374425175.7(Q99JX4) Similar to dendritic cell protein
	TK251102_lung_cytoE16_2_step08.2207.2207.1	1.0041	0.0497	640.48	8	6250.0%	2	K.HTLLR.L
	TK251102_lung_cytoE16_2_step11.1229.1229.1	1.4692	0.2824	1022.03	1	6250.0%	1	K.VVVSHSTHR.T
UO7521382.3%357.1%297337338.7(O75213) Hypothetical protein
	TK251102_lung_cytoE16_2_step04.2063.2063.1	1.4987	0.236	932.65	3	6430.0%	2	K.GSYLYSLK.A
	TK251102_lung_cytoE16_2_step03.3011.3011.1	1.2896	0.0445	1508.77	13	3750.0%	1	R.KPLLWQVGHLGEK.Y
UQ9UFU882.2%101413.2%917994396.9(Q9UFU8) Hypothetical protein (Fragment)
*	TK251102_lung_cytoE16_2_step07.0102.0102.1	0.7915	0.0106	1407.33	21	1790.0%	1	K.MHGGGPSVTAGVPLK.K
*	TK251102_lung_cytoE16_2_step06.4237.4237.2	0.814	0.0713	3142.3	72	1070.0%	1	R.IHFGGLIEEDDVILLAAALRIQNMVSSGR.R
*	TK251102_lung_cytoE16_2_step08.5249.5249.2	0.8299	0.1044	1444.74	24	2270.0%	1	R.LDIDPSTITWQR.V
*	TK251102_lung_cytoE16_2_step05.3013.3013.3	1.4498	0.0638	2683.39	10	2000.0%	1	K.IALKLVGEEGFVVTEAGFGADIGMEK.F
*	TK251102_lung_cytoE16_2_step09.4783.4783.2	2.4408	0.2442	1537.48	2	5000.0%	2	K.MHGGGPSVTAGVPLKK.E
*	TK251102_lung_cytoE16_2_step10.3769.3769.3	1.8807	0.1034	3864.96	34	1180.0%	2	K.DAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADK.I
*	TK251102_lung_cytoE16_2_step12.1169.1169.1	0.8962	0.0595	1146.79	118	3330.0%	1	R.IQNMVSSGRR.W
UBAC1_MOUSE82.2%5132.2%739813745.0(P97302) Transcription regulator protein BACH1 (BTB and CNC homolog 1)
*	TK251102_lung_cytoE16_2_step01.2371.2371.2	2.2892	0.3242	1574.53	1	5000.0%	3	K.FLDSTSEQQECAR.K
	TK251102_lung_cytoE16_2_step09.5235.5235.1	0.4569	0.0018	416.47	5	5000.0%	2	K.MHK.L
UCO1C_MOUSE82.1%465.9%474531417.1(Q9WUM4) Coronin 1C (Coronin 3)
	TK251102_lung_cytoE16_2_step08.3135.3135.2	1.9178	0.3905	1207.17	1	5500.0%	1	R.VGIVAWHPTAR.N
	TK251102_lung_cytoE16_2_step05.2152.2152.1	1.3728	0.1734	887.06	3	5000.0%	2	R.HVFGQAVK.N
	TK251102_lung_cytoE16_2_step01.4076.4076.1	0.6282	0.047	1040.26	59	3120.0%	1	K.HGYIPGKNR.D
UNIBL_MOUSE82.1%574.9%749848195.9(Q8R1F1) Niban-like protein
	TK251102_lung_cytoE16_2_step07.1727.1727.1	1.0935	0.166	702.54	3	7500.0%	2	K.HNLYR.D
	TK251102_lung_cytoE16_2_step11.2321.2321.2	1.2064	0.0354	1900.73	1	3930.0%	1	K.CPTQFPLILWHPYAR.H
*	TK251102_lung_cytoE16_2_step06.2557.2557.2	2.3159	0.3047	1114.18	1	7220.0%	1	R.ARPAMEAVIR.T
	TK251102_lung_cytoE16_2_step04.1319.1319.1	1.4458	0.0161	802.33	20	5830.0%	1	K.EAAVQRK.H
UH105_MOUSE82.0%101221.2%858964935.6(Q61699) Heat-shock protein 105 kDa (Heat shock-related 100 kDa protein E7I) (HSP-E7I) (Heat shock 110 kDa protein) (42 degrees C-HSP)
	TK251102_lung_cytoE16_2_step12.0684.0684.2	1.0185	0.0030	2815.44	5	1880.0%	1	K.LMSSNSTDLPLNIECFMNDKDVSGK.M
*	TK251102_lung_cytoE16_2_step03.2661.2661.3	1.6278	0.123	3093.56	60	1440.0%	1	R.LMNDMTAVALNYGIYKQDLPNAEEKPR.V
	TK251102_lung_cytoE16_2_step07.2060.2060.1	0.8351	9.0E-4	1011.66	51	3750.0%	1	K.KVDQPPEAK.K
*	TK251102_lung_cytoE16_2_step01.4484.4484.2	0.8511	0.0145	2791.62	2	1880.0%	1	K.EDLEGKNNLGAEAPHQNGECHPNEK.G
*	TK251102_lung_cytoE16_2_step10.5749.5749.3	0.8409	0.0072	4603.6	23	710.0%	1	K.NIQQDNSEAGTQPQVQTDGQQTSQSPPSPELTSEESKTPDADK.A
*	TK251102_lung_cytoE16_2_step06.1350.1350.3	1.6397	0.0147	1845.47	4	3570.0%	1	R.NDAKNAVEECVYEFR.D
	TK251102_lung_cytoE16_2_step06.1473.1473.1	0.9241	0.1324	759.55	124	5000.0%	2	R.LQHYAK.I
	TK251102_lung_cytoE16_2_step05.3633.3633.2	1.6112	0.3198	1835.37	2	3440.0%	1	R.VNTHGIFTISTASMVEK.V
*	TK251102_lung_cytoE16_2_step02.2054.2054.2	2.1506	0.334	1689.54	1	5000.0%	1	K.NQQITHANNTVSSFK.R
UQ1529081.8%4410.8%9481071579.9(Q15290) RB protein binding protein
	TK251102_lung_cytoE16_2_step06.5004.5004.3	1.0599	0.044	4532.41	35	870.0%	1	K.GTSSIAITALMEEKGYQVPVLGTPSLLGQSLLHGQLIPTTGPVR.I
	TK251102_lung_cytoE16_2_step07.3927.3927.3	1.4069	0.0064	2121.06	158	1670.0%	1	R.EPTGVEENKTDSLFVLPSR.D
	TK251102_lung_cytoE16_2_step05.3004.3004.1	1.8382	0.1947	1076.56	5	5000.0%	1	R.EVPPPYDMK.A
	TK251102_lung_cytoE16_2_step09.3036.3036.3	1.5287	0.0531	3288.84	3	1640.0%	1	R.INTARPGGGRPGWEHSNKLGYLVSPPQQIR.R
UQ9D8X581.6%1513113.7%292335744.8(Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene)
	TK251102_lung_cytoE16_2_step05.2852.2852.2	0.9955	0.0864	1836.02	42	3210.0%	1	K.WLSFHSGYDFGYMVK.L
	TK251102_lung_cytoE16_2_step04.0038.0038.2	2.4321	0.2275	2882.14	1	2920.0%	11	K.FNLTEDMYSQDSIDLLANSGLQFQK.H
UQ9D10781.5%117.0%186209177.0(Q9D107) 2010015D08Rik protein
	TK251102_lung_cytoE16_2_step06.2677.2677.2	1.9716	0.3603	1559.5	1	5830.0%	1	K.IQHILCTGNLCTK.E
UQ9Y3J281.4%226.1%4284695710.1(Q9Y3J2) DJ222E13.3 (Novel protein) (Fragment)
*	TK251102_lung_cytoE16_2_step10.2109.2109.3	1.2795	0.0728	1494.09	2	2710.0%	1	R.SKMADISLDELIR.K
	TK251102_lung_cytoE16_2_step09.3587.3587.2	2.137	0.3272	1395.59	1	5000.0%	1	R.LVHPGVAEVVFVK.K
UQ8R2J081.4%7134.4%21442431406.7(Q8R2J0) L-type voltage-gated calcium channel Cav1.3(1a) subunit
	TK251102_lung_cytoE16_2_step04.4584.4584.2	2.1388	0.3276	2855.78	2	2710.0%	3	K.GYLDWITQVEDIDPENEEEGGEEGK.R
	TK251102_lung_cytoE16_2_step05.0014.0014.2	0.8117	0.0893	3142.75	7	1430.0%	1	R.LVAMNMPLNSDGTVMFNATLFALVRTALK.I
	TK251102_lung_cytoE16_2_step12.1459.1459.1	1.2444	0.0619	858.55	134	5000.0%	1	R.KEQGLVGK.Y
	TK251102_lung_cytoE16_2_step12.3885.3885.3	1.6649	0.0268	3011.68	43	1700.0%	1	K.GYLDWITQVEDIDPENEEEGGEEGKR.N
	TK251102_lung_cytoE16_2_step01.4511.4511.3	0.8783	0.1018	3553.07	252	670.0%	1	K.DPYPPCDVPVGEEEEEEEEDEPEVPAGPRPR.R
UQ8VDJ381.3%10148.5%12681417426.9(Q8VDJ3) Similar to lipoprotein-binding protein (Expressed sequence AA960365)
	TK251102_lung_cytoE16_2_step06.2588.2588.1	1.5333	0.0058	1590.91	8	4170.0%	1	R.ELLELASRMENER.T
*	TK251102_lung_cytoE16_2_step09.3089.3089.3	1.4745	0.0122	1910.8	205	2210.0%	1	K.DIVARLQTQASATVPIPK.E
	TK251102_lung_cytoE16_2_step05.2920.2920.2	1.2707	0.1634	1541.74	1	5830.0%	2	R.HEVLLISAEQDKR.A
	TK251102_lung_cytoE16_2_step09.3053.3053.2	1.2216	0.1643	1987.8	26	2670.0%	1	K.DLINRMDYVEINIDHK.F
	TK251102_lung_cytoE16_2_step10.1711.1711.2	1.2508	0.1125	1085.91	33	5000.0%	1	K.RELLELASR.M
*	TK251102_lung_cytoE16_2_step05.3529.3529.2	1.8727	0.2372	1847.29	1	3750.0%	2	K.ANSFTVSSVSAPSWLHR.F
	TK251102_lung_cytoE16_2_step01.4116.4116.3	1.2468	0.0456	2426.19	22	2000.0%	1	K.FPEVIINFPDPAQKSDIVQLR.G
	TK251102_lung_cytoE16_2_step06.2306.2306.1	1.4228	0.0751	984.59	9	5000.0%	1	K.LHNSLIGTK.G
UTRFL_MOUSE81.3%5113.8%707778668.6(P08071) Lactotransferrin precursor (Lactoferrin)
*	TK251102_lung_cytoE16_2_step07.1536.1536.1	0.9191	0.0166	889.48	21	4290.0%	3	R.SCHTGIGR.S
*	TK251102_lung_cytoE16_2_step06.2054.2054.1	1.1314	0.0048	1372.64	78	4000.0%	1	R.CPGEFCLFQSK.T
*	TK251102_lung_cytoE16_2_step02.1674.1674.1	0.7922	0.1855	981.28	21	2860.0%	1	K.EYVIATER.L
UAPOA_HUMAN81.2%552.5%45485013235.9(P08519) Apolipoprotein(a) precursor (EC 3.4.21.-) (Apo(a)) (Lp(a))
*	TK251102_lung_cytoE16_2_step09.0468.0468.2	0.9575	0.1513	2890.4	4	1600.0%	1	K.LSRPAVITDKVMPACLPSPDYMVTAR.T
*	TK251102_lung_cytoE16_2_step05.3229.3229.2	1.8819	0.4157	1917.18	2	3240.0%	1	R.GTDSCQGDSGGPLVCFEK.D
	TK251102_lung_cytoE16_2_step06.2984.2984.3	1.0636	0.0946	2801.91	47	1550.0%	1	R.NYCRNPDAEIRPWCYTMDPSVR.W
*	TK251102_lung_cytoE16_2_step06.2802.2802.2	0.8173	0.0473	1925.87	8	2670.0%	1	R.TPENYPNAGLTRNYCR.N
*	TK251102_lung_cytoE16_2_step02.4914.4914.3	1.2591	0.0080	4007.68	103	980.0%	1	R.TPENYPNDGLTMNYCRNPDADTGPWCFTMDPSIR.W
UQ9JK4981.2%113.4%435494868.5(Q9JK49) Erythroblast macrophage protein EMP
	TK251102_lung_cytoE16_2_step08.2235.2235.2	1.8951	0.4006	1731.71	1	5710.0%	1	R.KHFSQAEGSQLDEVR.Q
UQ8QZW781.1%2210.5%440504367.9(Q8QZW7) Similar to GABA-A receptor pi subunit (Hypothetical 50.4 kDa protein)
	TK251102_lung_cytoE16_2_step03.4167.4167.3	1.3065	1.0E-4	3963.34	46	980.0%	1	R.NVLYFILETYVPSTFLVVLSWVSFWISLDSVPAR.T
*	TK251102_lung_cytoE16_2_step08.2847.2847.1	1.8373	0.1857	1329.64	3	5000.0%	1	R.GNDSVRGLENLR.L
U2ABA_HUMAN81.0%222.0%447516926.2(Q00007) Serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alpha isoform (PP2A, subunit B, B-alpha isoform) (PP2A, subunit B, B55-alpha isoform) (PP2A, subunit B, PR55-alpha isoform) (PP2A, subunit B, R2-alpha isoform)
*	TK251102_lung_cytoE16_2_step12.2059.2059.2	2.0068	0.3469	1105.27	1	6880.0%	1	K.ILHTAWHPK.E
UITH3_MOUSE81.0%111312.6%886989776.0(Q61704) Inter-alpha-trypsin inhibitor heavy chain H3 precursor (ITI heavy chain H3)
	TK251102_lung_cytoE16_2_step03.5294.5294.1	0.3864	0.0086	433.01	26	3330.0%	1	K.ADVK.G
*	TK251102_lung_cytoE16_2_step11.2430.2430.2	1.0889	0.1385	2116.43	31	2110.0%	1	K.VFGIRPGSDPTKPDATMVVK.N
*	TK251102_lung_cytoE16_2_step08.1361.1361.3	1.2345	0.0073	1487.99	247	2270.0%	1	K.EQGYIFGDYIER.L
*	TK251102_lung_cytoE16_2_step05.1673.1673.1	1.4218	0.2164	1483.55	1	4170.0%	1	R.FAHNVVTTRAVNR.A
*	TK251102_lung_cytoE16_2_step11.0050.0050.3	1.1803	0.0062	4026.91	66	1030.0%	1	K.GHVSFKPSLDQQRSCPTCTDSLLNGDFTIVYDVNR.E
*	TK251102_lung_cytoE16_2_step07.5054.5054.2	0.9234	0.1093	2546.64	112	1430.0%	1	R.SCPTCTDSLLNGDFTIVYDVNR.E
*	TK251102_lung_cytoE16_2_step08.3973.3973.2	1.5427	0.2941	2336.95	1	3330.0%	2	R.STSIIIMLTDGDANTGESRPEK.I
*	TK251102_lung_cytoE16_2_step06.1914.1914.1	1.291	0.13	1044.49	3	5620.0%	1	R.FAHNVVTTR.A
*	TK251102_lung_cytoE16_2_step12.4109.4109.2	0.8459	0.0611	3074.19	11	1480.0%	1	R.STSIIIMLTDGDANTGESRPEKIQENVR.N
	TK251102_lung_cytoE16_2_step11.1897.1897.1	1.3486	0.1378	1498.75	33	3750.0%	1	K.GHVSFKPSLDQQR.S
UQ99K3080.9%339.7%729822297.2(Q99K30) Similar to hypothetical protein FLJ21935
*	TK251102_lung_cytoE16_2_step05.2103.2103.2	1.9331	0.3626	2474.03	1	3260.0%	1	K.HSLSSESQAPEDIAPPGSSPHANR.G
*	TK251102_lung_cytoE16_2_step06.5368.5368.2	1.0935	0.0811	3174.96	24	1380.0%	1	R.SGQAGYVPCNILAEARQEDVGAPLEQSGQK.Y
	TK251102_lung_cytoE16_2_step05.3481.3481.3	1.7339	0.1621	1999.96	8	2810.0%	1	R.ARPPSEGEFVDCFQKTK.L
UBAG1_MOUSE80.7%4411.8%355397408.5(Q60739) BAG-family molecular chaperone regulator-1 (BCL-2 binding athanogene-1) (BAG-1)
*	TK251102_lung_cytoE16_2_step03.2019.2019.1	2.0551	0.0787	1181.56	1	6110.0%	1	K.IANHLQELNK.E
	TK251102_lung_cytoE16_2_step03.1315.1315.1	0.8988	0.1239	658.19	105	3750.0%	1	K.KVRPR.S
*	TK251102_lung_cytoE16_2_step08.1471.1471.3	1.7757	0.0496	2336.37	35	2120.0%	1	K.ELSGIQQGFLAKELQAEALCK.L
*	TK251102_lung_cytoE16_2_step04.1275.1275.1	1.0681	0.0402	757.61	25	6000.0%	1	R.RPRGDR.E
UALD1_MOUSE80.7%85010.8%315358577.3(P21300) Aldose reductase-related protein 1 (EC 1.1.1.21) (AR) (Aldehyde reductase) (VAS deferens androgen-dependent protein) (MVDP) (Aldo-keto reductase family 1 member B7)
	TK251102_lung_cytoE16_2_step08.2062.2062.1	1.9008	0.03	884.72	10	5710.0%	7	R.LLNKPGLK.H
*	TK251102_lung_cytoE16_2_step07.2964.2964.3	1.6012	0.1369	3170.72	42	1500.0%	1	K.HKPVTNQIESHPYLTQEKLIQYCQSK.G
URL28_MOUSE80.4%61219.1%1361560212.0(P41105) 60S ribosomal protein L28
*	TK251102_lung_cytoE16_2_step03.1557.1557.1	1.5677	0.0759	886.64	1	6430.0%	1	R.SQKPVVVK.R
	TK251102_lung_cytoE16_2_step05.1825.1825.2	1.6388	0.0874	820.17	31	7000.0%	1	K.YRPDLR.M
	TK251102_lung_cytoE16_2_step06.1677.1677.1	1.3747	0.0392	923.66	2	5710.0%	3	R.KPATSYVR.T
	TK251102_lung_cytoE16_2_step09.1779.1779.1	0.9145	0.1381	556.53	2	8330.0%	1	R.HMIR.K
UPKL2_HUMAN80.4%4411.2%9841120356.3(Q16513) Protein kinase C-like 2 (EC 2.7.1.-) (Protein-kinase C-related kinase 2)
	TK251102_lung_cytoE16_2_step11.0708.0708.3	1.4212	0.0724	4410.05	11	1150.0%	1	R.QSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGR.S
*	TK251102_lung_cytoE16_2_step01.4060.4060.3	1.3835	0.0116	4296.15	1	1280.0%	1	R.AIPTVNHSGTFSPQAPVPTTVPVVDVRIPQLAPPASDSTVTK.L
*	TK251102_lung_cytoE16_2_step04.1795.1795.1	1.4699	0.2473	906.49	3	6670.0%	1	K.LEELHHK.L
*	TK251102_lung_cytoE16_2_step07.1158.1158.3	0.6695	0.0084	2381.59	6	750.0%	1	R.EDVSNFDDEFTSEAPILTPPR.E
UQ9D3B780.3%469.0%445519396.3(Q9D3B7) 6330404L05Rik protein
	TK251102_lung_cytoE16_2_step07.2771.2771.1	1.1578	0.0842	978.26	52	5000.0%	1	K.RPEGYNLK.D
	TK251102_lung_cytoE16_2_step05.1796.1796.1	1.8038	0.1899	1221.63	3	5000.0%	2	R.DKRPEGYNLK.D
	TK251102_lung_cytoE16_2_step10.3434.3434.3	1.547	0.021	3491.59	29	1290.0%	1	R.RVFANAHTYHINSISVNSDYETYMSADDLR.I
UDNL1_MOUSE80.3%445.6%9161022906.8(P37913) DNA ligase I (EC 6.5.1.1) (Polydeoxyribonucleotide synthase [ATP])
*	TK251102_lung_cytoE16_2_step10.1669.1669.3	1.4235	0.0906	2046.08	21	2500.0%	1	K.CADLSLSPIYPAARGLVDK.E
*	TK251102_lung_cytoE16_2_step05.1561.1561.2	1.9208	0.3767	1638.24	1	6150.0%	1	K.LKPQEEEQSKPPAR.G
	TK251102_lung_cytoE16_2_step06.1302.1302.2	0.815	0.0090	1386.83	286	1820.0%	1	R.IIPVLLEHGLER.L
	TK251102_lung_cytoE16_2_step07.2475.2475.1	1.1255	0.1198	784.51	38	5000.0%	1	R.SHNWLK.L
USEP2_MOUSE80.3%4413.0%361415266.5(P42208) Septin 2 (NEDD5 protein)
	TK251102_lung_cytoE16_2_step01.2462.2462.1	0.8867	0.0082	860.57	36	5830.0%	1	K.DQILLEK.E
*	TK251102_lung_cytoE16_2_step05.2267.2267.1	1.1029	0.1646	799.44	7	5000.0%	1	R.IIPGAAEK.I
	TK251102_lung_cytoE16_2_step03.1629.1629.1	1.1893	0.2709	767.61	1	8000.0%	1	R.HIIDNR.V
	TK251102_lung_cytoE16_2_step05.3652.3652.2	1.9234	0.377	2953.5	1	3000.0%	1	K.QQPTQFINPETPGYVGFANLPNQVHR.K
UO7020980.3%246.0%316343007.9(O70209) Alpha-actinin-2 associated LIM protein
*	TK251102_lung_cytoE16_2_step08.3122.3122.2	1.1067	0.0486	2167.88	2	2780.0%	2	K.INLEAEPQEFKPIGTAHNR.R
UENOB_MOUSE80.3%225.8%433468947.2(P21550) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (Enolase 3)
	TK251102_lung_cytoE16_2_step10.2450.2450.2	2.4256	0.207	1167.9	1	7220.0%	1	R.IGAEVYHHLK.G
	TK251102_lung_cytoE16_2_step11.3089.3089.1	1.0362	0.0087	1596.23	161	2140.0%	1	R.GNPTVEVDLHTAKGR.F
UPRI2_MOUSE80.2%338.5%505584088.3(P33610) DNA primase large subunit (EC 2.7.7.-) (DNA primase 58 kDa subunit) (P58)
*	TK251102_lung_cytoE16_2_step01.0115.0115.1	0.8298	0.0481	588.29	17	6000.0%	1	R.ILTGGK.D
*	TK251102_lung_cytoE16_2_step05.1595.1595.2	2.0178	0.1692	1835.4	2	3670.0%	1	K.EISQPETPQHKPSTQK.T
*	TK251102_lung_cytoE16_2_step11.2908.2908.2	1.9853	0.3589	2430.38	1	4250.0%	1	R.LQPLLNHLSHSYTGQDYSTQK.N
UKNG_MOUSE80.2%5516.8%661731026.5(O08677) Kininogen precursor [Contains: Bradykinin]
	TK251102_lung_cytoE16_2_step12.2531.2531.1	0.9522	0.0232	1060.83	1	4380.0%	1	R.RPPGFSPFR.S
	TK251102_lung_cytoE16_2_step11.4008.4008.3	1.0941	0.0896	4732.76	3	1160.0%	1	-.MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDFSLK.Q
	TK251102_lung_cytoE16_2_step12.5577.5577.3	1.6373	0.152	4346.18	1	1320.0%	1	K.IANFSQSCTLYSGDDLVEALPKPCPGCPRDIPVDSPELK.E
	TK251102_lung_cytoE16_2_step05.3372.3372.3	1.2097	0.0488	2374.6	10	2120.0%	1	R.QVVAGLNFDITYTIVQTNCSK.E
UQ9Y38780.1%244.8%289334256.5(Q9Y387) CGI-77 protein
*	TK251102_lung_cytoE16_2_step06.2326.2326.2	0.9709	0.3531	1605.67	29	1920.0%	2	R.HAYGLGEHYNSVTR.L
UQ8R2P480.0%115.5%183207724.9(Q8R2P4) Hypothetical 20.8 kDa protein
	TK251102_lung_cytoE16_2_step01.1460.1460.1	2.0626	0.0572	1199.81	2	6670.0%	1	R.QMNYSSLPEK.Q
UPSD4_MOUSE79.8%82019.9%376407044.8(O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein)
*	TK251102_lung_cytoE16_2_step11.0828.0828.3	1.2838	0.1635	4781.72	1	1100.0%	1	K.EEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALASQATK.D
	TK251102_lung_cytoE16_2_step08.3558.3558.3	1.7251	0.0285	1968.01	9	2660.0%	1	R.LQAQQDAVNIVCHSKTR.S
	TK251102_lung_cytoE16_2_step08.2338.2338.1	1.5788	0.082	753.51	3	7500.0%	3	R.VAHLALK.H
	TK251102_lung_cytoE16_2_step08.1603.1603.1	1.9196	0.176	822.57	1	8330.0%	3	K.LHTVQPK.G
UQ8VHQ079.7%3312.5%385437876.4(Q8VHQ0) SPI3L2
*	TK251102_lung_cytoE16_2_step12.3135.3135.2	1.9845	0.3437	1257.62	1	5500.0%	1	K.QGLFLSNVIHK.S
*	TK251102_lung_cytoE16_2_step06.3806.3806.3	1.7215	0.1752	2713.26	62	1560.0%	1	K.ELLSPGTIHSNTPLILVNAVYFKGK.W
*	TK251102_lung_cytoE16_2_step10.5453.5453.2	0.8857	0.0313	1312.29	21	2270.0%	1	K.TGTQYSLKAANR.L
UQ8R32079.6%334.1%11611328774.9(Q8R320) Similar to N-arginine dibasic convertase 1
*	TK251102_lung_cytoE16_2_step12.5533.5533.3	1.0191	0.0569	2919.94	8	1500.0%	1	K.DFKSQLFVEGLVQGNVTSTESMDFLK.Y
	TK251102_lung_cytoE16_2_step11.3564.3564.1	1.9388	0.154	1196.99	1	6110.0%	1	R.FHLISPLIQK.S
	TK251102_lung_cytoE16_2_step01.5108.5108.1	1.3422	0.0167	1417.98	1	4550.0%	1	K.YPDENGFDAFLK.K
UQ6217679.6%118.4%237253788.9(Q62176) SEB4
*	TK251102_lung_cytoE16_2_step09.3837.3837.2	1.9471	0.3562	2194.91	1	3420.0%	1	R.SLQTGFAVGVQQLHPTLIQR.T
UNEBU_HUMAN79.5%16163.9%66697732309.1(P20929) Nebulin
*	TK251102_lung_cytoE16_2_step01.4082.4082.1	0.5514	0.0175	1085.88	21	2860.0%	1	R.DWHDLIRK.G
	TK251102_lung_cytoE16_2_step02.2650.2650.2	1.3452	0.1146	2017.91	3	2780.0%	1	R.VKATSYILPSSTLSLTHAK.N
	TK251102_lung_cytoE16_2_step04.3332.3332.1	0.8741	0.0183	1485.46	12	3640.0%	1	K.KCQELVSDVDYK.N
*	TK251102_lung_cytoE16_2_step05.3715.3715.2	1.8694	0.378	2188.16	4	2650.0%	1	K.AYDLQSDAIYKSDLEWLR.G
	TK251102_lung_cytoE16_2_step12.2085.2085.2	1.0811	0.151	2069.96	80	2500.0%	1	K.AHWKWTPDRPDFLQAAK.S
	TK251102_lung_cytoE16_2_step08.1803.1803.3	1.4205	0.0964	1456.29	1	3570.0%	1	K.GNNVLGDAIPITAAK.A
	TK251102_lung_cytoE16_2_step08.1619.1619.1	1.1856	0.2442	922.51	3	5710.0%	1	K.TAKNQSDR.E
	TK251102_lung_cytoE16_2_step09.3305.3305.2	0.8394	0.0116	1417.21	369	2270.0%	1	K.FTSIVDTPEHLR.T
	TK251102_lung_cytoE16_2_step09.3537.3537.2	1.1508	0.0714	1871.94	74	2670.0%	1	R.GQKLQSQYLYVELATK.E
	TK251102_lung_cytoE16_2_step04.3012.3012.3	1.9987	0.0475	3679.81	1	2080.0%	1	R.NVIHTYNMLPDAMSFELAKNMMQIQSDNQYK.A
*	TK251102_lung_cytoE16_2_step11.4724.4724.2	0.7126	0.0324	2958.57	40	1200.0%	1	K.FTSVPDSMGMMLAQHNTKQLSDLNYK.V
	TK251102_lung_cytoE16_2_step01.3163.3163.1	1.2915	0.0378	1034.67	9	4380.0%	1	R.NTLIESDLK.Y
	TK251102_lung_cytoE16_2_step01.0364.0364.1	1.0645	0.0332	1197.68	1	5620.0%	1	K.YKEDLTWLK.G
	TK251102_lung_cytoE16_2_step11.5674.5674.2	0.9744	0.1539	3182.91	13	1790.0%	1	K.ENLQNYNLVTDTPLYVTAVQSGINASEVK.Y
	TK251102_lung_cytoE16_2_step02.2114.2114.2	0.9349	0.0294	1397.95	73	3180.0%	1	K.QGQTLVSDIDYR.N
	TK251102_lung_cytoE16_2_step08.2583.2583.3	1.4209	0.0965	2131.15	5	2210.0%	1	K.VIGEFPGVVHCLDFQKMR.S
UQ9WTM579.5%339.5%463511135.6(Q9WTM5) DNA helicase
	TK251102_lung_cytoE16_2_step12.3464.3464.2	1.0026	0.088	2241.1	3	2500.0%	1	K.EYQDAFLFNELKGETMDTS.-
	TK251102_lung_cytoE16_2_step05.3347.3347.2	1.8607	0.3811	1948.51	1	4060.0%	1	K.EVVHTVSLHEIDVINSR.T
	TK251102_lung_cytoE16_2_step12.1419.1419.1	1.0766	0.017	890.58	118	4290.0%	1	R.IGAHSHIR.G
UQ9CU9079.3%2217.2%204215139.6(Q9CU90) 5133400F09Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step11.4618.4618.3	1.9342	0.0271	3007.48	2	1980.0%	1	R.IAQLICERISYPDLEEVQTLDDTER.G
	TK251102_lung_cytoE16_2_step02.1509.1509.1	1.6711	0.1914	1082.6	1	6110.0%	1	R.LSEHATAPTR.G
UQ9CSH379.3%2214.2%267304017.6(Q9CSH3) 2810028N01Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step11.2209.2209.1	1.5154	0.2245	1460.72	1	5000.0%	1	K.HFYTFTNEHHK.E
	TK251102_lung_cytoE16_2_step02.3706.3706.3	1.2814	0.2818	3050.43	9	1540.0%	1	K.AVQEGIPAFTCEEYVKSLTANPELIDR.L
U143G_HUMAN79.1%4417.1%246281714.9(P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1)
	TK251102_lung_cytoE16_2_step04.1593.1593.1	1.206	0.2528	932.61	2	6670.0%	1	K.MKGDYYR.Y
	TK251102_lung_cytoE16_2_step11.1369.1369.1	1.5442	0.2059	1246.66	2	5560.0%	1	K.EHMQPTHPIR.L
	TK251102_lung_cytoE16_2_step01.4572.4572.2	1.7195	0.4102	2131.87	1	4440.0%	1	K.TAFDDAIAELDTLNEDSYK.D
	TK251102_lung_cytoE16_2_step11.1642.1642.1	0.927	0.0399	746.85	23	5000.0%	1	R.EQLVQK.A
UPUR6_MOUSE79.0%225.4%425470707.2(Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)]
	TK251102_lung_cytoE16_2_step06.1749.1749.2	1.5878	0.2237	1411.79	1	6250.0%	1	R.VTSAHKGPDETLR.I
*	TK251102_lung_cytoE16_2_step04.1469.1469.1	1.64	0.1957	1147.76	1	5000.0%	1	K.RNPGVQEGYK.F
URIK3_HUMAN78.8%3313.5%518569016.3(Q9Y572) Receptor-interacting serine/threonine protein kinase 3 (EC 2.7.1.-) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3)
*	TK251102_lung_cytoE16_2_step11.3833.3833.3	0.9055	0.0092	4306.32	90	790.0%	1	K.ASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNR.Q
*	TK251102_lung_cytoE16_2_step08.0110.0110.3	1.4877	0.0095	2635.5	15	1900.0%	1	R.LLKEVVLGMFYLHDQNPVLLHR.D
*	TK251102_lung_cytoE16_2_step08.2369.2369.1	1.41	0.3306	1140.72	1	4380.0%	1	R.RTIENQHSR.N
UARR1_HUMAN78.7%3314.4%418470666.2(P49407) Beta-arrestin 1 (Arrestin, beta 1)
*	TK251102_lung_cytoE16_2_step05.3751.3751.3	1.5201	0.0367	2232.64	80	1940.0%	1	K.ACGVDYEVKAFCAENLEEK.I
*	TK251102_lung_cytoE16_2_step04.4645.4645.2	1.0866	0.2263	2997.7	6	1800.0%	1	R.DFVDHIDLVDPVDGVVLVDPEYLKER.R
*	TK251102_lung_cytoE16_2_step07.3038.3038.2	1.8614	0.3663	1697.79	1	4640.0%	1	K.LKHEDTNLASSTLLR.E
UQ91XC878.7%4815.7%102111559.4(Q91XC8) Similar to death-associated protein (Hypothetical 11.2 kDa protein)
	TK251102_lung_cytoE16_2_step05.1463.1463.1	1.739	0.1857	1007.69	1	7140.0%	2	R.TQHIQQPR.K
	TK251102_lung_cytoE16_2_step07.1448.1448.1	1.4343	0.119	776.46	5	5710.0%	2	K.AGHPPAVK.A
UGSHC_MOUSE78.3%2212.9%201222827.2(P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase)
*	TK251102_lung_cytoE16_2_step05.4089.4089.2	2.2876	0.2943	1959.21	1	4060.0%	1	K.YVRPGGGFEPNFTLFEK.C
*	TK251102_lung_cytoE16_2_step11.3908.3908.1	1.4319	0.1215	1101.82	1	6250.0%	1	K.AHPLFTFLR.N
UFINC_HUMAN78.3%554.2%23862626045.7(P02751) Fibronectin precursor (FN) (Cold-insoluble globulin) (CIG)
*	TK251102_lung_cytoE16_2_step09.5276.5276.2	0.9896	0.0273	3107.64	5	1790.0%	1	R.VPHSRNSITLTNLTPGTEYVVSIVALNGR.E
	TK251102_lung_cytoE16_2_step04.2763.2763.2	1.3551	0.0491	1984.05	1	3670.0%	1	R.IGDQWDKQHDMGHMMR.C
	TK251102_lung_cytoE16_2_step05.2441.2441.1	1.5447	0.205	1402.5	1	5000.0%	1	K.HYQINQQWER.T
*	TK251102_lung_cytoE16_2_step09.0840.0840.3	1.1066	0.0957	2231.29	4	1320.0%	1	K.LDAPTNLQFVNETDSTVLVR.W
*	TK251102_lung_cytoE16_2_step03.4115.4115.3	1.3472	0.0247	2982.99	22	1700.0%	1	R.RPGGEPSPEGTTGQSYNQYSQRYHQR.T
UQ922H378.2%113.2%441486664.7(Q922H3) Similar to glutamate rich WD repeat protein GRWD (Fragment)
	TK251102_lung_cytoE16_2_step06.2784.2784.1	1.9528	0.141	1419.51	1	5000.0%	1	R.EPFLLSGGDDGALK.V
UQ922K678.2%6822.3%363406966.5(Q922K6) Unknown (Protein for MGC:7530)
*	TK251102_lung_cytoE16_2_step11.0091.0091.1	1.0458	0.1809	1487.15	49	2330.0%	1	R.TGSESSQTGASATSGR.N
*	TK251102_lung_cytoE16_2_step05.2101.2101.3	1.3687	0.2093	2855.05	1	1700.0%	1	K.EDDASASTSQSSRAASIFGGAKPVDTAAR.E
	TK251102_lung_cytoE16_2_step02.2726.2726.2	2.0458	0.3277	1533.96	3	4330.0%	1	R.AASIFGGAKPVDTAAR.E
	TK251102_lung_cytoE16_2_step08.2030.2030.1	1.6075	0.0522	741.68	3	8000.0%	2	R.LNLKPR.S
*	TK251102_lung_cytoE16_2_step02.4394.4394.2	0.8768	0.0534	2966.55	2	1550.0%	1	R.SQSSDTEQPSPTSGGGKVAAVQPPEEGPSR.K
UQ9EQ1877.9%228.7%389432565.4(Q9EQ18) SIR2L2
*	TK251102_lung_cytoE16_2_step10.2478.2478.3	1.4052	0.1024	2563.8	23	1880.0%	1	R.REHANIDAQSGSQAPNPSTTISPGK.S
*	TK251102_lung_cytoE16_2_step05.2184.2184.1	1.7128	0.1877	1175.51	1	7500.0%	1	R.KEYTMGWMK.E
UPTNC_MOUSE77.9%6811.7%775869926.2(P35831) Protein-tyrosine phosphatase, non-receptor type 12 (EC 3.1.3.48) (Protein-tyrosine phosphatase P19) (P19-PTP) (MPTP-PEST)
	TK251102_lung_cytoE16_2_step11.3117.3117.1	0.9023	0.0242	1580.4	45	3080.0%	1	K.IYPTATGEKEENVK.K
*	TK251102_lung_cytoE16_2_step12.3203.3203.2	1.6784	0.1455	2335.12	2	2500.0%	1	K.TSISTASATVSPASSAESACHRR.V
*	TK251102_lung_cytoE16_2_step08.3097.3097.2	1.8458	0.3792	2401.17	1	3180.0%	1	K.GHVTWSLHGPENATPVPDSPDGK.S
	TK251102_lung_cytoE16_2_step01.2559.2559.1	1.1871	0.0066	701.82	3	7000.0%	2	R.VKLTLK.T
*	TK251102_lung_cytoE16_2_step10.4162.4162.2	0.9927	0.1381	2930.28	2	2080.0%	1	R.YHPKPVLHMASPEQHPADLNRSYDK.S
USNX2_MOUSE77.9%339.6%519584715.1(Q9CWK8) Sorting nexin 2
	TK251102_lung_cytoE16_2_step05.3372.3372.2	1.7908	0.4644	1583.4	1	5380.0%	1	K.YLHVGYIVPPAPEK.S
	TK251102_lung_cytoE16_2_step05.5381.5381.2	1.0498	0.0068	1308.21	1	3500.0%	1	R.RFSDFLGLHSK.L
*	TK251102_lung_cytoE16_2_step05.2280.2280.3	1.1928	0.1353	3083.73	3	1350.0%	1	K.IDQLHQEQAFADFYMFSELLSDYIR.L
UO9483677.8%333.4%10961229409.1(O94836) Hypothetical protein KIAA0731 (Fragment)
*	TK251102_lung_cytoE16_2_step11.1850.1850.1	1.5132	0.2054	1236.08	1	5560.0%	1	K.FQHPSHELLK.E
*	TK251102_lung_cytoE16_2_step05.5449.5449.2	0.6292	0.0308	1149.84	13	3120.0%	1	R.YYSYGLEKK.F
*	TK251102_lung_cytoE16_2_step08.3399.3399.2	1.9952	0.3383	2035.33	1	4410.0%	1	R.HSSNPPLESHVGWVMDSR.E
UGALC_MOUSE77.4%448.1%668755036.5(P54818) Galactocerebrosidase precursor (EC 3.2.1.46) (GALCERASE) (Galactosylceramidase) (Galactosylceramide beta-galactosidase) (Galactocerebroside beta-galactosidase)
*	TK251102_lung_cytoE16_2_step12.4015.4015.2	1.0477	0.059	2924.56	4	2080.0%	1	R.VRIIASDNLWEPISSSLLLDQELWK.V
	TK251102_lung_cytoE16_2_step02.0074.0074.1	1.0784	0.1645	1481.94	92	3000.0%	1	R.EFDGIGAVSGGGATSR.L
	TK251102_lung_cytoE16_2_step09.2163.2163.1	1.0318	0.0811	544.54	1	6670.0%	1	R.LHFK.Q
*	TK251102_lung_cytoE16_2_step06.2360.2360.1	1.5935	0.1933	1095.45	3	7500.0%	1	R.WYTLTLGIK.G
UIF2A_HUMAN77.1%4613.1%314359815.1(P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A)
*	TK251102_lung_cytoE16_2_step02.3118.3118.3	1.6674	0.119	2742.34	66	1560.0%	1	R.YVMTTTTLERTEGLSVLSQAMAVIK.E
*	TK251102_lung_cytoE16_2_step07.2620.2620.2	2.2879	0.2808	1245.62	1	6500.0%	2	K.RPGYGAYDAFK.H
*	TK251102_lung_cytoE16_2_step04.1460.1460.1	1.0423	0.0569	721.58	3	7500.0%	1	R.FYQHK.F
UQ8WVJ577.0%115.5%200214634.8(Q8WVJ5) Similar to RIKEN cDNA 2310035L15 gene
*	TK251102_lung_cytoE16_2_step07.3206.3206.1	1.9683	0.1346	1180.77	2	6000.0%	1	R.QTAGQLSFSIK.V
UKF1A_MOUSE76.7%224.2%16951917246.2(P33173) Kinesin-like protein KIF1A
*	TK251102_lung_cytoE16_2_step12.3668.3668.3	2.6497	0.354	2639.56	2	2300.0%	1	R.SSSGASSPLSAEGQPSPLEAPNERQR.E
*	TK251102_lung_cytoE16_2_step11.4372.4372.3	1.169	0.1603	4731.79	1	1390.0%	1	R.SGTSQEELRIVEGQGQGADAGPSADEVNNNTCSAVPPEGLMDSPEK.A
UBS4_MOUSE76.6%336.5%677774496.4(P54729) BS4 protein
	TK251102_lung_cytoE16_2_step06.3088.3088.3	1.0009	0.0907	3637.87	42	1200.0%	1	R.YFCECKELLDTVDNYAVLQLDIVWCYFR.L
*	TK251102_lung_cytoE16_2_step07.1654.1654.1	1.7918	0.1729	682.65	1	7000.0%	1	R.LHVTGR.D
	TK251102_lung_cytoE16_2_step09.1581.1581.1	0.7722	0.1618	1016.42	113	2780.0%	1	R.GMGYSTQAAK.Q
UMAP4_HUMAN76.5%575.2%11521210195.4(P27816) Microtubule-associated protein 4 (MAP 4)
	TK251102_lung_cytoE16_2_step10.3910.3910.2	1.0708	7.0E-4	1386.39	6	3850.0%	1	K.RASPSKPASAPASR.S
	TK251102_lung_cytoE16_2_step10.2670.2670.2	1.2152	0.0911	1564.72	49	2670.0%	1	K.KPMSLASGLVPAAPPK.R
*	TK251102_lung_cytoE16_2_step07.1676.1676.1	1.5221	0.1483	1349.7	1	5000.0%	2	K.HVPGGGNVQIQNK.K
	TK251102_lung_cytoE16_2_step02.2617.2617.2	1.667	0.225	1591.68	1	5000.0%	1	K.VGSLDNVGHLPAGGAVK.T
UQ91VX276.4%333.3%11321179667.7(Q91VX2) Similar to KIAA0144 gene product
*	TK251102_lung_cytoE16_2_step04.1905.1905.1	1.0323	0.0998	736.68	1	7000.0%	1	K.HIKLPK.R
*	TK251102_lung_cytoE16_2_step09.3464.3464.2	1.7821	0.1173	1682.64	13	3000.0%	1	R.SQHTVDTTSSVPAPKK.T
*	TK251102_lung_cytoE16_2_step09.1773.1773.2	1.9034	0.344	1652.51	1	6070.0%	1	R.EKPQMPTAHAAQSQK.Q
UQ9CRT676.4%3323.1%117130545.8(Q9CRT6) 3110083O19Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step07.3766.3766.3	1.6931	0.1305	3145.12	8	1830.0%	1	K.QRPQATAEQIRLAQMISDHNDADFEEK.V
	TK251102_lung_cytoE16_2_step05.1649.1649.2	2.2743	0.2772	1299.71	1	7000.0%	1	K.QRPQATAEQIR.L
UO8819076.3%559.0%909978775.2(O88190) Cadherin-related neural recepter 3 (Fragment)
	TK251102_lung_cytoE16_2_step01.1459.1459.1	0.5497	0.0376	749.46	64	3000.0%	1	R.AIYRVK.L
	TK251102_lung_cytoE16_2_step07.3324.3324.1	1.4544	0.2493	1159.49	1	4440.0%	1	R.QEPANNQIDK.S
	TK251102_lung_cytoE16_2_step02.1646.1646.1	1.3528	0.0042	915.45	1	6430.0%	1	K.SDFITFGK.K
	TK251102_lung_cytoE16_2_step01.0979.0979.3	1.1064	0.0177	4631.1	99	900.0%	1	R.SAECSIHLEVIVDRPLQVFHVEVEVRDINDNPPVFPTTEK.N
	TK251102_lung_cytoE16_2_step05.2501.2501.2	0.8433	0.1458	2005.15	218	1470.0%	1	R.GDLLEVNLQNGILFVNSR.I
USUCA_MOUSE76.3%353.3%333349949.4(Q9WUM5) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor (EC 6.2.1.4) (Succinyl-CoA synthetase, alpha chain) (SCS-alpha)
*	TK251102_lung_cytoE16_2_step08.3849.3849.2	2.347	0.2446	1226.27	1	6000.0%	2	K.HLGLPVFNTVK.E
UKAPA_MOUSE76.3%359.4%350404398.8(P05132) cAMP-dependent protein kinase, alpha-catalytic subunit (EC 2.7.1.37) (PKA C-alpha)
*	TK251102_lung_cytoE16_2_step07.4530.4530.3	2.0153	0.2506	2718.53	70	1820.0%	1	K.DNSNLYMVMEYVAGGEMFSHLRR.I
	TK251102_lung_cytoE16_2_step05.2695.2695.1	1.3208	0.1893	1166.63	11	4440.0%	2	R.FPSHFSSDLK.D
UPL10_MOUSE76.2%447.4%660731417.2(P16381) Putative ATP-dependent RNA helicase PL10
	TK251102_lung_cytoE16_2_step04.2029.2029.2	2.0837	0.3214	1301.8	1	7780.0%	1	R.DREEALHQFR.S
	TK251102_lung_cytoE16_2_step11.3578.3578.3	1.1321	0.1847	2615.19	256	1480.0%	1	K.GADSLEDFLYHEGYACTSIHGDR.S
	TK251102_lung_cytoE16_2_step05.1565.1565.1	1.4446	0.0382	1091.49	180	5000.0%	1	R.YTRPTPVQK.H
	TK251102_lung_cytoE16_2_step08.2626.2626.1	0.8751	0.0318	791.45	1	6670.0%	1	K.HAIPIIK.E
UQ9QZJ475.8%779.9%9011006775.7(Q9QZJ4) TPR-containing protein involved in spermatogenesis TPIS
	TK251102_lung_cytoE16_2_step07.0896.0896.1	0.2905	0.0094	549.85	7	1670.0%	1	R.QYEL.-
*	TK251102_lung_cytoE16_2_step02.2623.2623.2	0.8792	0.0433	2193.07	48	1670.0%	1	R.HFHDPENHPGVEDPLPPVR.G
*	TK251102_lung_cytoE16_2_step02.2706.2706.2	0.8137	0.015	1421.96	67	3750.0%	1	R.HLDTKNDTAPPSK.G
*	TK251102_lung_cytoE16_2_step04.3209.3209.2	1.0416	0.0069	1961.59	3	2650.0%	1	K.TVLQIDCGIQLASDSANR.I
*	TK251102_lung_cytoE16_2_step04.3765.3765.2	0.6391	0.0666	2585.79	10	1360.0%	1	K.DKPAETASSFSAEEWEKIDSDLK.S
*	TK251102_lung_cytoE16_2_step03.1430.1430.2	1.7513	0.0981	1532.24	1	5000.0%	1	R.RAMAYETLEQYR.N
UNAH2_HUMAN75.8%7912.3%812915209.1(Q9UBY0) Sodium/hydrogen exchanger 2 (Na(+)/H(+) exchanger 2) (NHE-2)
*	TK251102_lung_cytoE16_2_step05.3996.3996.3	1.4827	0.0436	3421.81	25	1330.0%	1	R.SLRAPLPPMLLLLLLQVAGPVGALAETLLNAPR.A
*	TK251102_lung_cytoE16_2_step04.4163.4163.3	1.612	0.0967	2714.02	19	1550.0%	2	R.LFDHVKTGIEDVCGHWGHNFWR.D
*	TK251102_lung_cytoE16_2_step02.2383.2383.1	1.4519	0.2906	1123.59	1	4380.0%	1	R.FRTIPLTFK.D
*	TK251102_lung_cytoE16_2_step01.2691.2691.1	1.2222	0.1108	1066.89	2	5000.0%	1	R.YLSLPKNTK.L
*	TK251102_lung_cytoE16_2_step01.5019.5019.2	1.176	0.2499	3065.5	1	1720.0%	1	R.APLPPMLLLLLLQVAGPVGALAETLLNAPR.A
*	TK251102_lung_cytoE16_2_step11.3173.3173.2	1.2051	0.3113	2772.99	6	1540.0%	1	R.RTISIADGNSSDSDADAGTTVLNLQPR.A
URS2_MOUSE75.5%469.2%2933121710.2(P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein)
	TK251102_lung_cytoE16_2_step01.1844.1844.1	1.4393	0.2854	1027.32	1	5000.0%	2	R.GTGIVSAPVPK.K
	TK251102_lung_cytoE16_2_step01.1724.1724.1	0.9584	0.1223	666.97	6	7000.0%	1	R.LIPAPR.G
	TK251102_lung_cytoE16_2_step12.1389.1389.1	1.4956	0.1152	1137.68	5	5560.0%	1	K.IGKPHTVPCK.V
UQ9WVM375.5%224.2%565629615.7(Q9WVM3) Prediabetic NOD sera-reactive autoantigen
*	TK251102_lung_cytoE16_2_step03.2939.2939.3	1.5338	0.0141	1790.88	22	2500.0%	1	K.AGQERPSVASYKEVLR.Q
	TK251102_lung_cytoE16_2_step11.1056.1056.1	1.4406	0.2681	967.79	2	5710.0%	1	K.EYRNAVSK.Y
UO7048175.5%101611.4%17572002156.0(O70481) Ubiquitin-protein ligase E3 COMPONEN N-recognin (Ubiquitin-protein ligase E3-alpha)
*	TK251102_lung_cytoE16_2_step07.2356.2356.3	1.4209	0.0066	3260.89	121	1340.0%	1	R.AVDTESNLWTEGMLQMAFHILALGLLEEK.Q
*	TK251102_lung_cytoE16_2_step10.5302.5302.3	1.3574	0.042	2563.81	5	1380.0%	1	R.LHEFVPFDSFQVEVLVEYPLR.C
*	TK251102_lung_cytoE16_2_step10.3122.3122.2	0.8181	0.1518	2175.2	22	1560.0%	1	R.KLHLVWQQHCIIEEIAR.S
*	TK251102_lung_cytoE16_2_step06.4874.4874.2	1.8993	0.256	1880.14	1	3750.0%	3	R.LGSSAMNAQNIQMLLER.L
*	TK251102_lung_cytoE16_2_step04.4103.4103.3	1.0573	0.1486	4400.12	22	860.0%	1	R.CASAFFVEVSQHTDGLTGCGAPGWYLWLSLRNGITPYLR.C
*	TK251102_lung_cytoE16_2_step12.4128.4128.3	1.3916	0.015	4276.93	11	1150.0%	1	K.GEAPAVPVLFNQGMGDSTFEFHSILSFGVQSSVKYSNSIK.E
*	TK251102_lung_cytoE16_2_step11.1480.1480.2	1.3575	0.0291	1886.37	263	2860.0%	1	K.YILISKPVIWTERLR.A
*	TK251102_lung_cytoE16_2_step12.2097.2097.3	1.3955	0.1284	2616.05	7	1930.0%	1	R.CSTNFMSSTKTVVQLCGHSLETK.S
UQ8VD3675.4%112.6%546620965.9(Q8VD36) Similar to hypothetical protein FLJ12168
*	TK251102_lung_cytoE16_2_step09.3581.3581.2	1.9811	0.3298	1549.83	1	5000.0%	1	R.KHQDPDSLIAGVIR.V
UQ9DBY075.4%223.6%795859817.1(Q9DBY0) 1200010K03Rik protein
*	TK251102_lung_cytoE16_2_step02.1621.1621.1	0.9772	0.0801	825.6	91	5000.0%	1	K.FTVSVGSK.T
*	TK251102_lung_cytoE16_2_step12.2289.2289.2	1.7719	0.4479	2236.31	1	3000.0%	1	K.VSPPLSHHPLPNGQPTVLTSR.R
UQ9CWX975.4%115.0%323368139.9(Q9CWX9) 4930588A18Rik protein
*	TK251102_lung_cytoE16_2_step07.3547.3547.2	2.1449	0.3097	1663.92	4	5000.0%	1	R.EDAGDDDDKEGAIGVR.N
UQ9WVQ575.3%227.9%241269496.9(Q9WVQ5) MMRP19 (Monocyte macrophage 19)
	TK251102_lung_cytoE16_2_step11.1412.1412.1	1.4435	0.2645	1077.45	3	4500.0%	1	R.GAGAVIHTHSK.A
	TK251102_lung_cytoE16_2_step02.1914.1914.1	1.2603	0.0083	1000.43	4	6430.0%	1	K.ITHQEMIK.G
UPOSC_MOUSE75.2%245.8%274300498.3(Q9Z2Y8) Proline synthetase co-transcribed bacterial homolog protein
*	TK251102_lung_cytoE16_2_step11.3578.3578.2	1.0172	0.0179	1743.79	39	2670.0%	2	K.HGLLPSETIAVVEHIK.A
UQ9CRY674.9%334.4%723845407.6(Q9CRY6) 3000004N20Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step01.0244.0244.1	1.0805	0.052	859.68	65	5000.0%	1	K.RPESLEK.E
*	TK251102_lung_cytoE16_2_step01.2350.2350.1	1.7194	0.1732	978.99	3	6670.0%	1	K.FDFEKYK.F
*	TK251102_lung_cytoE16_2_step07.2923.2923.2	1.127	0.0269	2015.63	20	2940.0%	1	K.VTSDLNLNCVSDKIIPVK.I
URB27_HUMAN74.8%116.3%221248605.3(P51159) Ras-related protein Rab-27a (RAB-27) (GTP-binding protein Ram)
*	TK251102_lung_cytoE16_2_step08.3158.3158.1	1.4943	0.2199	1505.78	2	3850.0%	1	R.SNGHASTDQLSEEK.E
UQ99K7674.5%117.1%296311699.4(Q99K76) Hypothetical 31.2 kDa protein
	TK251102_lung_cytoE16_2_step09.3140.3140.2	2.1437	0.3038	2249.82	1	3500.0%	1	R.VLAGQTLDINMAGEPKPNRPK.G
UQ1291274.4%111.4%555620935.9(Q12912) Lymphoid-restricted membrane protein
*	TK251102_lung_cytoE16_2_step01.1695.1695.1	1.6828	0.1791	917.79	1	7140.0%	1	R.KPSLSEKK.N
UZ239_HUMAN74.4%114.1%458515347.6(Q16600) Zinc finger protein 239 (Zinc finger protein MOK-2) (HOK-2)
	TK251102_lung_cytoE16_2_step08.2263.2263.2	1.7728	0.3956	2152.24	1	2500.0%	1	K.ILNTSPDGHPYEKIHTAEK.Q
UQ9NPL874.3%41610.9%285321938.2(Q9NPL8) C3orf1 hypothetical protein
	TK251102_lung_cytoE16_2_step11.4745.4745.3	2.4095	0.1799	3008.42	1	1920.0%	4	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
UQ922B674.2%224.7%594664877.0(Q922B6) Unknown (Protein for MGC:7807)
	TK251102_lung_cytoE16_2_step12.2795.2795.2	0.8223	0.1186	2326.5	107	1050.0%	1	K.LYSGSADCTIIVWDIQNLQK.V
	TK251102_lung_cytoE16_2_step01.3154.3154.1	1.6802	0.175	955.44	4	5710.0%	1	K.MNLEAHLK.E
UABE1_HUMAN74.1%8109.7%599673148.3(Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68) (Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68)
	TK251102_lung_cytoE16_2_step08.4226.4226.2	2.3085	0.2508	1989.42	1	4410.0%	2	K.KCPFGALSIVNLPSNLEK.E
	TK251102_lung_cytoE16_2_step04.2005.2005.1	0.9893	0.0081	874.35	68	5000.0%	1	R.YCANAFK.L
	TK251102_lung_cytoE16_2_step03.3402.3402.1	0.9055	0.0394	885.63	7	5000.0%	1	K.RFILHAK.K
	TK251102_lung_cytoE16_2_step12.3453.3453.2	0.6791	0.0334	1858.15	139	1250.0%	1	K.CPFGALSIVNLPSNLEK.E
	TK251102_lung_cytoE16_2_step05.2180.2180.1	0.9804	0.0466	767.54	14	6000.0%	1	R.QLLHEK.I
	TK251102_lung_cytoE16_2_step08.2539.2539.1	1.0216	0.1533	728.52	2	5000.0%	1	R.FILHAK.K
	TK251102_lung_cytoE16_2_step02.0552.0552.3	0.8938	0.0128	2340.56	301	660.0%	1	K.ILEDDLKAIIKPQYVDQIPK.A
UQ96QC273.9%9158.9%20902267305.5(Q96QC2) Hypothetical protein KIAA0170
	TK251102_lung_cytoE16_2_step02.1466.1466.1	0.8762	0.029	986.48	13	4290.0%	1	R.EQKQLLAR.D
	TK251102_lung_cytoE16_2_step08.3483.3483.3	1.4988	0.075	3493.78	10	1360.0%	1	K.TPKPVEPAASDLEPFTPTDQSVTPEAIAQGGQSK.T
	TK251102_lung_cytoE16_2_step05.0910.0910.3	0.8232	0.0222	4564.85	7	640.0%	1	R.GAGNGVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLER.A
	TK251102_lung_cytoE16_2_step01.4184.4184.2	0.8478	0.056	3080.54	72	1430.0%	1	K.TPETVVPTAPELQISTSTDQPVTPKPTSR.T
*	TK251102_lung_cytoE16_2_step05.2757.2757.3	1.8964	0.2525	3045.27	60	1520.0%	1	K.TPETVVPAAPELQPPTSTDQPVTPEPTSR.A
	TK251102_lung_cytoE16_2_step02.4367.4367.2	1.814	0.2521	2278.78	1	3250.0%	3	K.HLAPPPLLSPLLPSIKPTVRK.T
	TK251102_lung_cytoE16_2_step05.4193.4193.2	0.9162	0.0846	2272.76	18	2000.0%	1	R.AHSEKDQPPFGDSDDSVEADK.S
UQ9H42673.8%41018.3%268291985.8(Q9H426) DJ781B1.3 (A novel protein similar to myeloblast KIAA0237 protein and rat protein NIM2) (Fragment)
*	TK251102_lung_cytoE16_2_step02.3362.3362.3	1.4353	0.0659	3515.89	22	1500.0%	1	R.LSLSASFEALAIYFPCMNSFDDEDAEGDSRR.L
*	TK251102_lung_cytoE16_2_step09.3413.3413.2	1.6082	0.1524	1961.98	5	3240.0%	3	R.QTLATTPMGDVEIGLQER.N
UIGJ_HUMAN73.7%118.0%137155944.7(P01591) Immunoglobulin J chain
*	TK251102_lung_cytoE16_2_step05.2771.2771.1	1.6452	0.1808	1322.69	4	5000.0%	1	R.NIRIIVPLNNR.E
UEZH2_MOUSE73.7%391.7%746853366.8(Q61188) Enhancer of zeste homolog 2 (ENX-1)
	TK251102_lung_cytoE16_2_step08.3683.3683.2	1.3639	0.0484	1398.72	108	3330.0%	3	K.KDETSSSSEANSR.C
UQ6226273.7%3310.8%648708148.5(Q62262) Spermatid perinuclear RNA binding protein
	TK251102_lung_cytoE16_2_step10.3055.3055.2	2.3597	0.0962	800.95	6	8330.0%	1	K.EPTLTLK.V
	TK251102_lung_cytoE16_2_step06.4108.4108.3	1.4816	0.1318	4260.5	57	900.0%	1	K.HSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNK.G
	TK251102_lung_cytoE16_2_step12.5573.5573.2	1.0159	0.1407	2958.52	130	1400.0%	1	R.DPTDALSYMTTQQKEDITHSAQHALR.L
UMK14_MOUSE73.7%3310.6%360412875.9(P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1)
	TK251102_lung_cytoE16_2_step11.4426.4426.2	1.0127	0.0686	3077.87	30	1110.0%	1	K.MNFANVFIGANPLAVDLLEKMLVLDSDK.R
	TK251102_lung_cytoE16_2_step09.2532.2532.2	2.3242	0.1215	1225.27	2	7780.0%	1	K.YIHSADIIHR.D
UQ9JHJ373.7%11656.7%404438046.1(Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene)
*	TK251102_lung_cytoE16_2_step05.4760.4760.3	2.6547	0.1625	2881.63	8	1920.0%	4	R.LLEFDSTNASEGAQPPGKPYPPYSLAK.F
UQ9QXG873.7%339.6%737803724.7(Q9QXG8) Sir2alpha protein
*	TK251102_lung_cytoE16_2_step11.0052.0052.2	0.8521	0.0014	2722.2	68	1300.0%	1	R.DNLLLTDGLLTNGFHSCESDDDDR.T
*	TK251102_lung_cytoE16_2_step01.3402.3402.3	1.0228	0.2237	3909.84	22	980.0%	1	R.NYTQNIDTLEQVAGIQRILQCHGSFATASCLICK.Y
*	TK251102_lung_cytoE16_2_step09.2068.2068.2	1.7865	0.3783	1523.72	1	5000.0%	1	K.LSEITEKPPRPQK.E
UTCPG_MOUSE73.6%337.3%545606306.7(P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin)
	TK251102_lung_cytoE16_2_step04.1367.1367.1	1.6326	0.1779	1129.83	1	6000.0%	1	R.KVQSGNINAAK.T
*	TK251102_lung_cytoE16_2_step08.3323.3323.3	1.7121	0.0547	2130.52	2	2640.0%	1	K.GISDLAQHYLMRANVTAIR.R
	TK251102_lung_cytoE16_2_step01.1468.1468.1	1.9074	0.06	1122.86	2	5560.0%	1	R.EIQVQHPAAK.S
UQ9D8R773.6%116.6%122130339.7(Q9D8R7) 1810043M20Rik protein
*	TK251102_lung_cytoE16_2_step06.1961.1961.1	1.6314	0.181	839.74	1	6430.0%	1	R.HGLQSIGK.V
UQ9998473.6%247.3%413469337.0(Q99984) mRNA expressed in osteoblast
*	TK251102_lung_cytoE16_2_step09.3035.3035.3	2.7641	0.2836	3593.93	1	1810.0%	2	R.CSRQGCTITMAYIDYNMIVAFMLGNYINLR.E
UO8865373.6%1112.9%124135537.3(O88653) MEK binding partner 1 (Mitogen-activated protein kinase kinase 1 interacting protein 1)
	TK251102_lung_cytoE16_2_step11.3198.3198.2	1.77	0.3813	1720.32	1	5330.0%	1	K.KLPSVEGLHAIVVSDR.D
UQ922W273.6%3512.3%416475106.1(Q922W2) Unknown (Protein for MGC:7055)
	TK251102_lung_cytoE16_2_step02.4907.4907.3	1.4167	0.2089	4679.86	5	1120.0%	1	R.VTPLGYVLPSHVTEEMLWECKQLGAHSPSTLLTTLMFFNTK.Y
	TK251102_lung_cytoE16_2_step06.1852.1852.1	1.2046	0.1499	1052.58	2	5000.0%	2	K.ALGIHQTGQK.V
URPB3_HUMAN73.5%114.4%275314414.9(P19387) DNA-directed RNA polymerase II 33 kDa polypeptide (EC 2.7.7.6) (RPB3) (RNA polymerase II subunit 3) (RPB33) (RPB31)
*	TK251102_lung_cytoE16_2_step07.2750.2750.1	1.7659	0.1649	1511.68	1	5000.0%	1	R.HTVYPKPEEWPK.S
UQ9CX6373.4%112.0%252268517.7(Q9CX63) 6030468B19Rik protein
	TK251102_lung_cytoE16_2_step03.2030.2030.1	1.8451	0.1294	595.54	1	8750.0%	1	R.IPLPR.A
UQ924S973.4%113.3%152169494.9(Q924S9) Dscr6 protein
	TK251102_lung_cytoE16_2_step03.2030.2030.1	1.8451	0.1294	595.54	1	8750.0%	1	R.LPLPR.G
UQ9NYJ173.4%2220.8%96113096.7(Q9NYJ1) E2IG2
*	TK251102_lung_cytoE16_2_step03.2030.2030.1	1.8451	0.1294	595.54	1	8750.0%	1	R.LPIPR.M
*	TK251102_lung_cytoE16_2_step04.1259.1259.3	1.6431	0.0423	1804.15	1	3750.0%	1	K.KDDEEEDPLDQLISR.S
UQ8VI3773.3%393.2%557608126.3(Q8VI37) Paxillin alpha
*	TK251102_lung_cytoE16_2_step10.2657.2657.2	2.1452	0.3009	1958.61	1	4710.0%	3	R.YAHQQPPSPLPVYSSSAK.N
UTPP2_HUMAN73.0%557.9%12491384496.4(P29144) Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase)
*	TK251102_lung_cytoE16_2_step01.1727.1727.1	0.8047	0.0011	844.61	56	5000.0%	1	K.VLTFAYK.H
*	TK251102_lung_cytoE16_2_step07.3880.3880.3	1.5076	0.013	2679.24	14	1730.0%	1	R.GTQLMNGTSMSSPNACGGIALILSGLK.A
*	TK251102_lung_cytoE16_2_step07.0098.0098.2	0.8775	0.0887	3180.19	3	1920.0%	1	R.NYKEAQEYGSFGTAEMLNYSVNIYDDR.N
*	TK251102_lung_cytoE16_2_step10.3082.3082.2	0.8208	0.1302	2252.7	21	1500.0%	1	K.GTLTEAFPVLGGKAIEFCIAR.W
*	TK251102_lung_cytoE16_2_step11.3394.3394.2	2.1097	0.3026	1952.46	1	4380.0%	1	K.KADVIPVHYYLIPPPTK.T
US11Y_HUMAN73.0%1110.6%104115098.6(Q9UDP3) Putative S100 calcium-binding protein H_NH0456N16.1
*	TK251102_lung_cytoE16_2_step03.4233.4233.1	1.6316	0.1715	1309.62	1	5500.0%	1	R.CIQSLIAVFQK.Y
UQ91VR672.9%6824.0%499540295.3(Q91VR6) Similar to siah binding protein 1, FBP interacting repressor, pyrimidine tr
	TK251102_lung_cytoE16_2_step03.4338.4338.3	2.3787	0.1179	2797.37	2	2080.0%	1	K.AVTPPMPLLTPATPGGLPPAAAVAAAAATAK.I
	TK251102_lung_cytoE16_2_step04.3665.3665.2	1.346	0.1527	2365.08	9	2140.0%	2	K.VGRPSNIGQAQPIIDQLAEEAR.A
	TK251102_lung_cytoE16_2_step09.4421.4421.3	1.4572	0.0153	2509.41	14	2500.0%	1	R.NMVDPKDIDDDLEGEVTEECGK.F
	TK251102_lung_cytoE16_2_step05.2524.2524.2	1.8038	0.3477	2209.36	1	2780.0%	1	K.QTIAHQQQQLTNLQMAAQR.Q
*	TK251102_lung_cytoE16_2_step01.3119.3119.3	1.2828	0.0321	2799.86	31	1800.0%	1	-.MENGQSTGTKLGLPPLTPEQQEALQK.A
UAMPB_MOUSE72.8%5516.2%650723435.3(Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV)
*	TK251102_lung_cytoE16_2_step11.2022.2022.2	1.7945	0.3451	1902.29	1	4710.0%	1	R.RPLHSAQAVDVASASSFR.A
*	TK251102_lung_cytoE16_2_step11.1805.1805.2	0.95	0.1266	1356.71	4	3080.0%	1	-.MESGGPGNYSGAAR.R
*	TK251102_lung_cytoE16_2_step02.2333.2333.1	1.4663	0.0119	1151.44	5	5000.0%	1	K.VKDFLQSQGK.Q
*	TK251102_lung_cytoE16_2_step01.3468.3468.3	1.7185	0.0942	2749.26	55	2050.0%	1	K.GYCFVSYLAHLVGDQDQFDKFLK.A
	TK251102_lung_cytoE16_2_step10.5478.5478.3	1.6641	0.122	4714.66	1	1220.0%	1	R.SLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRR.I
UOL7E_MOUSE72.5%115.4%112121528.4(Q60886) Olfactory receptor 7E (M3) (Fragment)
*	TK251102_lung_cytoE16_2_step05.3009.3009.1	1.3987	0.3407	747.51	4	7000.0%	1	-.NPLLYK.V
USYEP_HUMAN72.5%132112.3%14401630267.7(P07814) Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)]
*	TK251102_lung_cytoE16_2_step02.2089.2089.1	0.8569	0.0056	771.57	167	3330.0%	1	K.ARVAPEK.K
*	TK251102_lung_cytoE16_2_step07.1451.1451.3	1.2638	0.0358	1754.91	233	1730.0%	1	R.DLPIKLNQWCNVVR.W
*	TK251102_lung_cytoE16_2_step02.3906.3906.2	0.9444	0.1669	1973.79	3	2650.0%	1	K.THVADFAPEVAWVTRSGK.T
*	TK251102_lung_cytoE16_2_step07.1734.1734.1	1.0658	0.0771	706.63	4	6000.0%	2	R.RDTGEK.L
*	TK251102_lung_cytoE16_2_step05.2895.2895.1	1.3852	0.1381	975.54	1	5830.0%	3	K.FNHWELK.G
*	TK251102_lung_cytoE16_2_step03.0008.0008.3	1.2008	0.0189	4622.97	2	1100.0%	1	K.TGQEYKPGNPPAEIGQNISSNSSASILESKSLYDEVAAQGEVVR.K
*	TK251102_lung_cytoE16_2_step01.2319.2319.1	0.7866	0.0302	1195.72	22	3330.0%	1	K.QLLSLKAEYK.E
*	TK251102_lung_cytoE16_2_step01.3679.3679.2	1.0753	0.2503	2267.81	9	1580.0%	1	K.THMVVANTMEDFQKILDSGK.I
*	TK251102_lung_cytoE16_2_step11.3164.3164.3	1.1391	0.0126	4538.19	2	910.0%	1	R.TIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDK.E
*	TK251102_lung_cytoE16_2_step04.2004.2004.1	1.1207	0.0341	996.96	20	5000.0%	1	K.KVIDPVAPR.Y
UQ96PJ372.5%111.7%422467357.1(Q96PJ3) IFGP2 (Fragment)
*	TK251102_lung_cytoE16_2_step08.2101.2101.1	1.4804	0.2217	934.64	1	7500.0%	1	R.RVEMMLR.K
UA1T2_MOUSE72.5%594.4%413459145.5(P22599) Alpha-1-antitrypsin 1-2 precursor (Serine protease inhibitor 1-2) (Alpha-1 protease inhibitor 2) (Alpha-1-antiproteinase) (AAT)
	TK251102_lung_cytoE16_2_step10.3129.3129.2	2.306	0.2247	976.08	1	7140.0%	1	R.LVQIHIPR.L
	TK251102_lung_cytoE16_2_step02.2021.2021.1	1.6333	0.021	1241.62	1	5560.0%	2	K.MQHLEQTLNK.E
UQ9D8V372.5%1111.5%7886765.2(Q9D8V3) 1810030J04Rik protein
*	TK251102_lung_cytoE16_2_step04.3207.3207.1	1.4303	0.2776	1042.82	1	6880.0%	1	R.KVEILTALR.K
UP7038872.5%554.7%13121534876.9(P70388) RAD50
	TK251102_lung_cytoE16_2_step09.0886.0886.1	0.8918	0.174	855.71	1	4290.0%	1	R.KIAQQAAK.L
	TK251102_lung_cytoE16_2_step10.3526.3526.2	0.9657	0.1545	2353.44	2	2750.0%	1	K.YICTGDFPPGTKGNTFVHDPK.V
*	TK251102_lung_cytoE16_2_step04.1900.1900.1	1.428	0.28	1285.57	2	4000.0%	1	R.RDEMLGLVPVR.Q
*	TK251102_lung_cytoE16_2_step10.1489.1489.1	0.8871	0.0942	764.57	8	5000.0%	1	R.LDTVTSK.I
*	TK251102_lung_cytoE16_2_step09.2909.2909.3	1.4335	0.0303	1740.05	3	3210.0%	1	R.LLNQEKAELLVEQGR.L
UQ9UNI572.5%391.7%11511281436.5(Q9UNI5) Zinc finger protein FOG-2
	TK251102_lung_cytoE16_2_step09.2456.2456.2	2.2894	0.2572	2273.82	3	2630.0%	3	R.CDIFPGIVSKHLETSLTINK.C
UQ96B3371.9%2217.2%268289837.3(Q96B33) Similar to RIKEN cDNA 2310014B08 gene (Fragment)
*	TK251102_lung_cytoE16_2_step07.1607.1607.1	2.0149	0.023	824.5	5	6670.0%	1	R.KPKPKPK.V
*	TK251102_lung_cytoE16_2_step03.5313.5313.3	1.5031	0.1458	4364.68	1	1450.0%	1	R.CWQDEPNFVLAGLSGVVLFVAGLLGLIPVSWYNHFLGDR.D
UFYV1_MOUSE71.9%998.1%20522330506.8(Q9Z1T6) FYVE finger-containing phosphoinositide kinase (EC 2.7.1.68) (1-phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) (p235)
	TK251102_lung_cytoE16_2_step05.1416.1416.1	1.0094	0.0109	1079.61	3	5620.0%	1	R.KMAQVFDLK.G
*	TK251102_lung_cytoE16_2_step03.3621.3621.2	1.529	0.0067	1886.09	72	2350.0%	1	R.NSAEEGLPANSALDNRPK.S
*	TK251102_lung_cytoE16_2_step01.4686.4686.2	1.0982	0.1414	2076.83	42	2060.0%	1	R.ARGGEFSQNIWNPFVHSK.D
	TK251102_lung_cytoE16_2_step03.1926.1926.1	1.1711	0.055	1128.34	27	5000.0%	1	R.LYYAGEFHK.M
*	TK251102_lung_cytoE16_2_step11.4560.4560.3	1.522	0.0088	4488.48	25	1090.0%	1	R.TSIHSDAHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIR.T
*	TK251102_lung_cytoE16_2_step05.3545.3545.2	0.9257	0.0132	1872.01	124	2500.0%	1	K.FMGYTGDLRACTYCR.K
*	TK251102_lung_cytoE16_2_step01.3374.3374.1	2.0084	0.0192	978.35	3	6430.0%	1	R.EPFLLTEK.G
*	TK251102_lung_cytoE16_2_step02.4274.4274.3	1.3265	0.0225	2933.26	30	1500.0%	1	R.NIFLEDDLAWQSLIHPDSSNSALSTR.L
*	TK251102_lung_cytoE16_2_step10.2558.2558.3	1.3022	0.0416	2448.3	6	2270.0%	1	R.GEEGASQEQVSGSSLPQDPECPR.E
UO1471071.9%115.0%360402557.6(O14710) Cell cycle progression 2 protein
	TK251102_lung_cytoE16_2_step03.3893.3893.2	2.309	0.216	2201.08	2	3240.0%	1	R.LEDKCLELVEHFGPNELR.K
UPPI2_MOUSE71.5%465.9%270313566.9(P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta)
	TK251102_lung_cytoE16_2_step07.2102.2102.1	1.0212	0.0252	673.56	12	5000.0%	1	K.IYHLK.S
	TK251102_lung_cytoE16_2_step12.2019.2019.2	2.161	0.2877	1025.06	1	8750.0%	1	K.RGPLGPNWK.K
	TK251102_lung_cytoE16_2_step05.1975.1975.1	1.8545	0.025	890.45	1	6670.0%	2	K.IYHLKSK.V
UAD24_MOUSE71.4%4413.8%761850405.8(Q9R160) ADAM 24 precursor (EC 3.4.24.-) (A disintegrin and metalloproteinase domain 24) (Testase 1)
*	TK251102_lung_cytoE16_2_step06.5022.5022.3	1.1889	0.0693	4716.56	6	1120.0%	1	R.ENECDLPEWCNGTSHECPEDLFVQDGTSCPGDGYCYEKR.C
*	TK251102_lung_cytoE16_2_step07.4294.4294.2	1.0766	0.039	1916.82	2	2670.0%	1	R.GDRFGNCGFINNEYVR.C
*	TK251102_lung_cytoE16_2_step11.3726.3726.3	1.7765	0.3259	4379.22	2	1090.0%	1	K.QHCHCDVGWSPPNCQETGTGGSIDSGSPGNEVYEDEVVSK.K
*	TK251102_lung_cytoE16_2_step11.1780.1780.1	1.8778	0.1252	1469.66	1	5000.0%	1	K.RCNSHDVHCQR.V
UQ9Z24771.4%222.1%570629965.2(Q9Z247) FK506 binding protein 9 precursor (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS)
*	TK251102_lung_cytoE16_2_step03.3023.3023.2	2.0311	0.2773	1428.62	1	5910.0%	1	R.YHYVGTFLDGQK.F
UO3586471.0%2210.2%334375496.5(O35864) 38 kDa MOV34 ISOLOGUE (Kip1 C-terminus interacting protein-2) (COP9 (Constitutive photomorphogenic), subunit 5) (Arabidopsis)
	TK251102_lung_cytoE16_2_step11.0028.0028.2	0.9105	0.0326	3142.42	6	1480.0%	1	K.YWVNTLSSSSLLTNADYTTGQVFDLSEK.L
	TK251102_lung_cytoE16_2_step08.1913.1913.1	1.4324	0.2409	846.36	2	6000.0%	1	K.DHHYFK.Y
UQ9NS8770.9%667.5%13881601596.0(Q9NS87) Kinesin-like protein 2
*	TK251102_lung_cytoE16_2_step06.0115.0115.2	0.7069	0.0284	2516.37	23	1300.0%	1	K.SIVESCMSGYNGTIFAYGQTGSGK.T
	TK251102_lung_cytoE16_2_step10.1970.1970.2	0.8208	0.0394	1519.77	50	2080.0%	1	K.ELSSVKLEYSSFK.T
*	TK251102_lung_cytoE16_2_step05.2273.2273.2	1.7845	0.3458	1236.52	1	5910.0%	1	K.TAIIANVHPGSR.C
	TK251102_lung_cytoE16_2_step06.1861.1861.1	1.5472	0.1076	1201.66	1	6670.0%	1	K.KQEVDILDLK.E
*	TK251102_lung_cytoE16_2_step10.4521.4521.2	1.0823	0.0139	1801.63	79	2000.0%	1	K.ANLNLENLLEATKACK.R
*	TK251102_lung_cytoE16_2_step11.5205.5205.3	1.2629	0.0376	3053.19	13	1790.0%	1	K.GVFVVGAVEQVVTSAAEAYQVLSGGWRNR.R
UK1CI_HUMAN70.9%7916.1%622619875.2(P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9)
*	TK251102_lung_cytoE16_2_step01.0547.0547.1	1.0071	0.0401	685.5	114	4170.0%	1	K.GPAAIQK.N
*	TK251102_lung_cytoE16_2_step04.3803.3803.2	1.782	0.3485	1841.03	1	5670.0%	1	R.HGVQELEIELQSQLSK.K
*	TK251102_lung_cytoE16_2_step02.3602.3602.2	0.9751	0.0063	2096.49	9	1880.0%	1	R.QEIECQNQEYSLLLSIK.M
*	TK251102_lung_cytoE16_2_step03.0024.0024.2	0.9157	0.1101	3181.52	2	1860.0%	1	R.VCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G
*	TK251102_lung_cytoE16_2_step08.1485.1485.1	1.0093	0.177	812.66	14	5000.0%	2	K.KGPAAIQK.N
*	TK251102_lung_cytoE16_2_step05.3912.3912.2	0.8931	0.0084	1792.76	12	2270.0%	1	R.GGSGGSYGGGGSGGGYGGGSGSR.G
USCP1_MOUSE70.7%7711.9%9931159625.8(Q62209) Synaptonemal complex protein 1 (SCP-1 protein)
*	TK251102_lung_cytoE16_2_step07.3142.3142.3	1.5033	0.1299	3582.3	1	2030.0%	1	K.QKPFTLFVPPRLSSSQVSAVKPQTAGGDSNYFK.T
*	TK251102_lung_cytoE16_2_step09.3727.3727.2	2.0409	0.04	1365.68	1	7500.0%	1	K.QVEEMKTELEK.E
*	TK251102_lung_cytoE16_2_step03.1754.1754.1	1.5083	0.201	1308.49	1	6500.0%	1	K.ATTCTLEELLR.T
	TK251102_lung_cytoE16_2_step01.0608.0608.1	1.3817	0.1228	589.55	2	7500.0%	1	K.ILESK.C
*	TK251102_lung_cytoE16_2_step08.2969.2969.3	1.6801	0.1842	1692.19	200	1960.0%	1	K.CTEGDFGVPFTMSSR.E
*	TK251102_lung_cytoE16_2_step01.5803.5803.3	1.1026	0.0469	4782.93	12	1010.0%	1	K.TAFEFDVNSDSSETADLLSLVSEEDVSNRLYDNNPPDSHLLVK.T
UQ9D2Z470.4%117.3%234266616.1(Q9D2Z4) 9130010J17Rik protein
*	TK251102_lung_cytoE16_2_step07.4274.4274.2	2.0113	0.3124	1985.71	1	4690.0%	1	R.RQPESPLQLLTPTYITK.K
UQ96PW170.4%111.4%772851515.6(Q96PW1) Hypothetical protein KIAA1927 (Fragment)
*	TK251102_lung_cytoE16_2_step03.2095.2095.1	1.9921	0.0758	1394.59	1	6000.0%	1	K.YTPEEEQELEK.R
UQ9CQE070.2%112.9%245282997.3(Q9CQE0) 2410015A17Rik protein
	TK251102_lung_cytoE16_2_step10.2851.2851.1	1.4002	0.3084	896.52	3	6670.0%	1	K.CFLTAMR.E
UQ8R3C070.2%798.3%642728915.6(Q8R3C0) Similar to hypothetical protein FLJ13081
*	TK251102_lung_cytoE16_2_step02.5419.5419.3	1.3984	0.1329	2161.96	2	2060.0%	1	K.LQHINPLLPTCLNKEESR.S
	TK251102_lung_cytoE16_2_step11.2889.2889.1	1.4842	0.1411	1281.73	3	5000.0%	2	R.IIQHLVPASFR.L
*	TK251102_lung_cytoE16_2_step07.2476.2476.1	1.2649	0.2629	700.49	1	6000.0%	1	R.VLHFGK.Y
*	TK251102_lung_cytoE16_2_step11.3172.3172.2	2.1223	0.2816	1661.71	1	5770.0%	1	K.LQHINPLLPTCLNK.E
	TK251102_lung_cytoE16_2_step02.2531.2531.1	0.7614	0.0015	1194.68	17	2500.0%	1	K.FRIYLTLLR.F
*	TK251102_lung_cytoE16_2_step02.0070.0070.1	1.0046	0.0257	1067.85	97	3750.0%	1	K.QKEQHPGSR.Q
UQ96A4970.1%4163.7%352399334.5(Q96A49) SYAP1
*	TK251102_lung_cytoE16_2_step01.1590.1590.1	1.267	0.062	1469.19	18	3330.0%	4	R.EQDLPLAEAVRPK.T
UQ91VS869.6%351.6%10651212978.4(Q91VS8) Similar to KIAA0793 gene product
	TK251102_lung_cytoE16_2_step08.2165.2165.1	1.5629	0.0892	622.68	1	7500.0%	2	R.KLSFK.R
*	TK251102_lung_cytoE16_2_step03.3587.3587.1	0.9775	0.1105	1295.72	37	3640.0%	1	R.TSLHALTVDLPK.Q
UQ9DC9269.6%3510.1%318349907.0(Q9DC92) 0710008M05Rik protein (Non-canonical ubiquitin conjugating enzyme 1)
	TK251102_lung_cytoE16_2_step08.2165.2165.1	1.5629	0.0892	622.68	1	7500.0%	2	R.QISFK.A
	TK251102_lung_cytoE16_2_step11.4820.4820.2	1.5722	0.0138	2982.71	2	2120.0%	1	R.IVLPPEYPMKPPSIILLTANGRFEVGK.K
UQ8VE7169.6%466.2%662729468.5(Q8VE71) Hypothetical 72.9 kDa protein (Fragment)
*	TK251102_lung_cytoE16_2_step07.3262.3262.3	1.2333	0.0639	2735.96	8	1770.0%	1	R.LTVLREYAYDVPTSVEGSVQNGLPK.S
*	TK251102_lung_cytoE16_2_step01.3859.3859.1	0.7345	0.0159	1185.47	52	2500.0%	1	K.SRPGSNEGHSR.S
	TK251102_lung_cytoE16_2_step08.2165.2165.1	1.5629	0.0892	622.68	1	7500.0%	2	K.QLSFK.C
UQ9NU6169.3%797.3%12931441298.0(Q9NU61) DJ93K22.1 (Novel protein (contains DKFZP564B116))
	TK251102_lung_cytoE16_2_step07.1639.1639.1	1.0423	0.0758	920.49	94	3570.0%	1	R.QVSALHHK.D
	TK251102_lung_cytoE16_2_step01.1571.1571.1	1.8904	0.1151	1148.0	2	5000.0%	1	R.SLDVLSDGVLK.D
	TK251102_lung_cytoE16_2_step08.1706.1706.1	1.0516	0.0799	609.52	14	5000.0%	1	K.KVSFK.G
	TK251102_lung_cytoE16_2_step05.1969.1969.1	1.2193	0.0993	1137.59	1	6430.0%	1	K.QCRWAYPR.Q
	TK251102_lung_cytoE16_2_step12.3375.3375.3	1.6327	0.0286	2596.95	12	1700.0%	1	R.SDSSGGYNLSDIIQSPSSTGLLKSGK.T
	TK251102_lung_cytoE16_2_step08.0046.0046.3	1.5209	4.0E-4	4204.66	23	1180.0%	2	K.NTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSR.S
UQ923Q269.2%335.8%10561183067.2(Q923Q2) DM544J17.1 (Novel protein similar to rat RhoGap) (Fragment)
*	TK251102_lung_cytoE16_2_step01.2372.2372.1	0.8147	1.0E-4	1546.81	122	2500.0%	1	R.TGSISLGRQQGPGMR.E
*	TK251102_lung_cytoE16_2_step02.2285.2285.1	1.6234	0.1594	950.38	1	5620.0%	1	K.KVGDGHPLK.L
*	TK251102_lung_cytoE16_2_step01.4583.4583.3	1.0822	0.0486	4177.26	2	1320.0%	1	R.WSSFQLSHQPQPSPATPHISSQTAAQLNLLQRFSLLR.L
UQ9D8X269.2%227.4%217253469.6(Q9D8X2) 1810023B24Rik protein
*	TK251102_lung_cytoE16_2_step04.1867.1867.1	1.6214	0.1584	943.56	1	5830.0%	1	R.RLEQLER.K
	TK251102_lung_cytoE16_2_step01.3175.3175.1	1.0822	0.0092	1073.91	10	5000.0%	1	R.LSQLKQLLK.K
UQ9CW1569.1%117.8%205239419.3(Q9CW15) 2810470J21Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step07.4420.4420.2	2.126	0.2721	1844.07	4	3000.0%	1	K.TLGHNLLVSELYNQLK.F
UQ9DAW969.1%229.4%330364295.7(Q9DAW9) 1600014M03Rik protein
	TK251102_lung_cytoE16_2_step03.4358.4358.2	2.2827	0.1478	2331.81	1	3420.0%	1	K.KVNESSLNWPQLENIGNFIK.A
	TK251102_lung_cytoE16_2_step01.4799.4799.1	0.6745	0.0638	1190.86	140	2000.0%	1	K.GFHTTIDIGVK.Y
UQ8WZ7469.1%668.4%16631810507.9(Q8WZ74) Cortactin-binding protein 2 (Hypothetical protein KIAA1758)
*	TK251102_lung_cytoE16_2_step10.3153.3153.2	1.0367	0.097	2250.54	350	1320.0%	1	K.SGRFSLPTWNKPDLSTEGMK.N
*	TK251102_lung_cytoE16_2_step05.5185.5185.3	1.1469	0.2613	4790.99	45	850.0%	1	R.IPAHGNSFNEEESESSVFDLDGGEESPEGISKPVVPADLINHANR.E
*	TK251102_lung_cytoE16_2_step09.2099.2099.1	0.9859	0.0304	982.6	150	3750.0%	1	K.RSSSSSNTR.Q
*	TK251102_lung_cytoE16_2_step06.0052.0052.2	1.1539	0.2617	3068.97	1	1920.0%	1	R.SIRSITLGNVPWSVGQSFAQSPWDFMR.K
*	TK251102_lung_cytoE16_2_step12.3015.3015.3	1.7031	0.1527	2186.62	27	1900.0%	1	R.QASYGDLIGASVPAFPPPSANK.I
*	TK251102_lung_cytoE16_2_step11.4257.4257.2	1.9707	0.3105	1966.23	1	3750.0%	1	K.SELRMLLSVMEGELEAR.D
UR35A_MOUSE69.1%61810.9%1101254010.9(O55142) 60S ribosomal protein L35a
	TK251102_lung_cytoE16_2_step04.1277.1277.2	1.0903	0.2543	1228.59	5	3640.0%	3	K.NNTVTPGGKPNK.T
UPSDC_MOUSE68.9%337.0%456528777.1(Q9D8W5) 26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit p55)
	TK251102_lung_cytoE16_2_step06.2644.2644.2	1.5936	0.0859	1613.57	1	5380.0%	1	R.AIYDTPCIQAESDK.W
	TK251102_lung_cytoE16_2_step04.1805.1805.1	1.1145	0.0683	785.4	2	5000.0%	1	K.TTHLIAK.E
	TK251102_lung_cytoE16_2_step08.3074.3074.2	2.2601	0.2233	1244.62	1	6000.0%	1	R.LAGVINFQRPK.D
UQ99NH268.8%443.4%13331490607.8(Q99NH2) PAR-3 180 kDa isoform
	TK251102_lung_cytoE16_2_step02.2151.2151.1	0.8311	0.0315	803.5	4	5000.0%	1	K.QNTAGSPK.T
	TK251102_lung_cytoE16_2_step05.1853.1853.2	1.2699	0.0038	1336.29	47	3640.0%	1	K.QNTAGSPKTCDR.K
	TK251102_lung_cytoE16_2_step09.1708.1708.3	1.6294	0.0823	1666.97	16	2500.0%	1	R.QDVPPSPSQVARLNR.L
*	TK251102_lung_cytoE16_2_step08.4705.4705.2	2.2838	0.0793	1963.3	3	4410.0%	1	R.ISHSLYSGIEGLDESPTR.N
UMC3A_HUMAN68.7%9119.4%19802184036.4(O60318) 80 kda MCM3-associated protein (GANP protein)
*	TK251102_lung_cytoE16_2_step04.4912.4912.2	1.1706	0.2614	3069.4	3	1900.0%	1	K.FMGDEGSVDDTSSDAGGIQTLSLFNSLSSK.G
*	TK251102_lung_cytoE16_2_step12.4017.4017.3	1.073	0.1836	4453.62	17	1080.0%	1	K.VLQAVQWLVSHCPHSLDLCCQTLIQYVEDGIGHEFSGR.F
*	TK251102_lung_cytoE16_2_step01.5764.5764.2	0.7706	0.1084	2736.02	335	770.0%	1	K.KPGDGEVSPSTEDAPFQHSPLGKAAGR.T
*	TK251102_lung_cytoE16_2_step08.2831.2831.2	1.863	0.3149	2027.59	5	2890.0%	1	R.KLTVSVGEIVNGGPLPPVPR.H
*	TK251102_lung_cytoE16_2_step03.3739.3739.2	1.1404	0.03	1906.71	1	3330.0%	1	R.ETCSQELKNAVETDQR.V
*	TK251102_lung_cytoE16_2_step09.3512.3512.3	1.3318	0.1549	2591.51	1	1930.0%	2	R.NKGVFCASEAEFQGYNVLLSLNK.G
*	TK251102_lung_cytoE16_2_step03.5130.5130.3	1.1953	0.0215	1811.11	31	1410.0%	1	R.ALAPSAECPIAEENLAR.G
*	TK251102_lung_cytoE16_2_step03.1283.1283.3	1.2834	0.2415	1790.6	15	2000.0%	1	R.EQLQLSEATGTCLGER.L
UQ9CRS268.5%3313.7%586664786.4(Q9CRS2) 4432404J10Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step05.1873.1873.1	1.5026	0.1981	1274.71	1	5000.0%	1	R.DQVLHEHIQR.L
	TK251102_lung_cytoE16_2_step09.4543.4543.3	1.1152	0.0296	4383.05	15	1180.0%	1	K.VQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIK.A
*	TK251102_lung_cytoE16_2_step02.4177.4177.3	1.2308	0.1146	2978.78	60	1420.0%	1	R.RPGNEELPPAAATGATSLVAAPHSSSSSPSK.D
URLA1_MOUSE68.3%2219.3%114114754.3(P47955) 60S acidic ribosomal protein P1
*	TK251102_lung_cytoE16_2_step01.4595.4595.2	1.9379	0.3081	1676.83	1	4330.0%	1	K.AAGVSVEPFWPGLFAK.A
	TK251102_lung_cytoE16_2_step01.1979.1979.1	1.5792	0.0090	672.83	3	7000.0%	1	K.INALIK.A
UQ9D9F868.0%3319.7%279317515.9(Q9D9F8) 1700081O04Rik protein
*	TK251102_lung_cytoE16_2_step05.3553.3553.2	1.1707	0.0276	1985.76	27	2500.0%	1	K.NNQEHTLKYNLNIASIN.-
*	TK251102_lung_cytoE16_2_step05.2780.2780.1	1.9238	0.0834	1477.66	5	4580.0%	1	R.ITAEEMSAVLEER.D
*	TK251102_lung_cytoE16_2_step08.2814.2814.3	2.2061	0.2438	2889.24	1	2920.0%	1	K.NYEPVISHQVIPDLNKETSVAYLQK.E
UTRFM_MOUSE67.9%337.7%738812936.1(Q9R0R1) Melanotransferrin precursor (Membrane-bound transferrin-like protein p97) (MTf)
*	TK251102_lung_cytoE16_2_step03.4333.4333.2	1.0141	0.0498	2412.79	13	2370.0%	1	R.TVVCVMEVQWCTISDAEQQK.C
*	TK251102_lung_cytoE16_2_step08.2038.2038.1	1.7565	0.1367	1152.73	5	5620.0%	1	K.YHSQDLLFK.D
*	TK251102_lung_cytoE16_2_step03.2569.2569.3	0.9986	6.0E-4	3122.64	42	1570.0%	1	K.EHGLKPVVGEVYDQDIGTSYYAVAVVRR.N
UPRVA_MOUSE67.9%248.3%109117995.2(P32848) Parvalbumin alpha
	TK251102_lung_cytoE16_2_step08.4771.4771.1	1.9641	0.0247	1099.63	3	5620.0%	2	K.FFQMVGLKK.K
UQ9Z0H967.6%227.8%128147289.8(Q9Z0H9) Ubiquitin/60S ribosomal fusion protein (Ubiquitin A-52 residue ribosomal protein fusion product 1)
	TK251102_lung_cytoE16_2_step08.1622.1622.2	1.8285	0.3139	1198.38	2	6670.0%	1	K.CGHTNNLRPK.K
UMEI1_MOUSE67.6%227.4%390430026.3(Q60954) Homeobox protein Meis1 (Myeloid ecotropic viral integration site-1)
	TK251102_lung_cytoE16_2_step09.3744.3744.2	0.8496	0.1707	1456.13	35	1820.0%	1	R.RIVQPMIDQSNR.A
	TK251102_lung_cytoE16_2_step11.3853.3853.2	1.8206	0.3148	2112.13	1	3750.0%	1	R.AWLFQHLTHPYPSEEQK.K
UQ8R2Y667.5%5715.9%320354248.1(Q8R2Y6) Hypothetical 35.4 kDa protein
	TK251102_lung_cytoE16_2_step08.1643.1643.1	1.3191	0.3372	794.57	4	6670.0%	2	R.LPNVHSK.T
	TK251102_lung_cytoE16_2_step03.1890.1890.1	1.2651	0.124	731.56	5	6000.0%	1	R.QDDILK.R
	TK251102_lung_cytoE16_2_step10.2066.2066.1	1.1629	0.1394	1294.72	1	5000.0%	1	R.VLSTVHTHSSVK.N
	TK251102_lung_cytoE16_2_step09.3764.3764.3	1.1625	0.0531	3082.4	40	1700.0%	1	-.MPMYQVKPYHGGSAPLRVELPTCMYR.L
UQ96NA867.4%4412.9%513558268.9(Q96NA8) Hypothetical protein FLJ31164
*	TK251102_lung_cytoE16_2_step04.5303.5303.2	1.0902	0.0748	2023.93	91	1760.0%	1	K.TFSCQALPSEGFSLEPPR.A
*	TK251102_lung_cytoE16_2_step01.3790.3790.2	0.694	0.0263	1552.26	15	2330.0%	1	K.DGEGDLGPAGTPIVPR.A
*	TK251102_lung_cytoE16_2_step08.3533.3533.2	2.2756	0.0584	1919.62	2	4690.0%	1	K.HHQLLFGTGLLKAEPTR.R
*	TK251102_lung_cytoE16_2_step09.2960.2960.2	1.4934	0.0913	1777.44	54	2860.0%	1	R.KPNFCPQETEVLVSK.V
UQ9CQI267.4%448.1%9241020426.7(Q9CQI2) Lipin 1
	TK251102_lung_cytoE16_2_step10.2425.2425.2	1.7466	0.1305	1672.65	1	4290.0%	1	K.QVGVSLNRIFTVNPK.G
	TK251102_lung_cytoE16_2_step06.2162.2162.1	1.4143	0.2529	907.99	1	7140.0%	1	R.FGKMGVLR.S
	TK251102_lung_cytoE16_2_step11.4568.4568.2	1.2987	0.0131	3028.82	2	1920.0%	1	K.TPDKMNFQAIHSESSDTFSDQSPTMAR.G
	TK251102_lung_cytoE16_2_step11.3900.3900.3	1.6172	0.0072	2636.37	76	1770.0%	1	K.VIISDIDGTITRSDTLGHILPTLGK.D
UQ8WWL267.4%5712.0%728809257.5(Q8WWL2) Spir-2 protein (Fragment)
*	TK251102_lung_cytoE16_2_step12.4456.4456.2	1.7001	0.0732	2996.89	1	2290.0%	1	K.HLWLEFSHPVESLALTVEEVMDVRR.V
*	TK251102_lung_cytoE16_2_step04.2885.2885.3	1.0773	0.0098	3262.08	40	1000.0%	1	R.EPEAAEPATMVVPLASSEAQTVQSLGFAIYR.A
*	TK251102_lung_cytoE16_2_step04.2135.2135.1	1.9427	0.1716	898.61	6	6670.0%	2	K.QRSLHEK.I
*	TK251102_lung_cytoE16_2_step12.3631.3631.2	1.7397	0.0841	2495.97	10	1960.0%	1	R.GEGWAARGFGSLPCILNACSGDAK.S
UQ9UIF867.2%10128.0%19722208646.3(Q9UIF8) Bromodomain adjacent to zinc finger domain 2B
*	TK251102_lung_cytoE16_2_step10.4031.4031.3	1.6793	0.0044	2621.87	23	1900.0%	1	K.EEMFETSGDSLNCSNTDHCEQK.E
*	TK251102_lung_cytoE16_2_step09.4093.4093.3	1.4944	0.1565	2453.25	18	2000.0%	1	R.IHQPLPLAFESQTHSFQSQQK.Q
	TK251102_lung_cytoE16_2_step10.1850.1850.1	0.7379	7.0E-4	920.61	9	4290.0%	1	K.QAFPSQLK.K
*	TK251102_lung_cytoE16_2_step12.1021.1021.3	2.175	0.3889	4037.45	1	1620.0%	1	K.LSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGR.A
	TK251102_lung_cytoE16_2_step05.4915.4915.2	0.6324	0.0038	2651.29	1	2080.0%	1	K.HTSVIQSTGLVSNVKPLSLVNQAKK.E
*	TK251102_lung_cytoE16_2_step07.4055.4055.1	1.4605	0.2066	814.64	1	5830.0%	1	R.AGHNMRK.Y
	TK251102_lung_cytoE16_2_step09.3111.3111.2	1.1513	0.2201	1681.81	3	3000.0%	1	R.LLSAAVCDPGLITGYK.A
*	TK251102_lung_cytoE16_2_step06.1405.1405.1	0.8818	0.1395	624.61	46	5000.0%	1	K.KLHVK.G
	TK251102_lung_cytoE16_2_step05.0056.0056.2	1.0446	0.0523	1876.23	45	2500.0%	2	K.VIAALSNPKATSSSPAHPK.Q
URET3_MOUSE67.1%2410.3%136154605.4(P02695) Retinoic acid-binding protein I, cellular (CRABP-I)
	TK251102_lung_cytoE16_2_step09.2373.2373.2	1.7238	0.4538	1448.71	1	5000.0%	2	K.VAVAAASKPHVEIR.Q
URRA_MOUSE67.1%224.3%462507357.9(P11416) Retinoic acid receptor alpha (RAR-alpha)
	TK251102_lung_cytoE16_2_step08.1927.1927.1	1.0507	0.0516	812.51	8	5000.0%	1	K.FSELSTK.C
	TK251102_lung_cytoE16_2_step04.1629.1629.2	2.2508	0.2144	1501.45	1	5830.0%	1	K.VDMLQEPLLEALK.V
USBP1_HUMAN67.1%112.8%472523136.6(Q13228) Selenium-binding protein 1
	TK251102_lung_cytoE16_2_step05.4664.4664.2	1.8734	0.3135	1668.44	1	5000.0%	1	R.FLYFSNWLHGDLR.Q
UQ9CXG367.1%227.5%492572446.1(Q9CXG3) 3732410E19Rik protein
*	TK251102_lung_cytoE16_2_step03.4241.4241.2	1.0836	0.2657	3051.23	3	1960.0%	1	K.NPNQDIYREMGFGHYEEEESCWEK.Q
*	TK251102_lung_cytoE16_2_step11.2613.2613.1	1.572	0.164	1555.76	1	4580.0%	1	R.ERDGHYSNSHKPK.Y
UQ9UI4567.0%10107.0%20392294797.0(Q9UI45) PHD finger protein 3
*	TK251102_lung_cytoE16_2_step09.3691.3691.3	1.1223	0.0925	1552.88	1	2500.0%	1	K.QCHKPQQQAPAMK.T
*	TK251102_lung_cytoE16_2_step04.2220.2220.2	0.8358	0.1178	2217.62	6	1940.0%	1	K.QCHKPQQQAPAMKTNSHVK.E
*	TK251102_lung_cytoE16_2_step03.3031.3031.2	0.6832	0.0556	1732.04	494	2000.0%	1	R.NSQSSSVSYLESKSVK.S
*	TK251102_lung_cytoE16_2_step11.2352.2352.1	1.8399	0.1053	1360.71	1	4550.0%	1	K.IVAAKYEVIHSK.T
*	TK251102_lung_cytoE16_2_step09.3208.3208.1	1.1243	0.1902	709.69	1	6000.0%	1	K.KPHGNR.F
*	TK251102_lung_cytoE16_2_step02.3151.3151.1	1.2355	0.2033	1094.5	161	4380.0%	1	R.RPITKITHK.G
*	TK251102_lung_cytoE16_2_step11.1917.1917.1	1.3437	0.1624	1134.65	1	6250.0%	1	R.FYSDSHHLK.R
*	TK251102_lung_cytoE16_2_step07.4808.4808.3	1.7296	0.054	3530.23	4	1320.0%	1	K.VDNISESTDKSAEIETSVVGSSSISAGSLTSLSLR.G
*	TK251102_lung_cytoE16_2_step07.4580.4580.3	1.5696	0.0491	2905.4	3	1980.0%	1	K.QRNKPQQNLQEDLPTAVEPLMEVTK.Q
*	TK251102_lung_cytoE16_2_step02.1145.1145.1	0.8773	0.1512	1262.48	21	3000.0%	1	K.SKHTKPVIHSK.Q
UQ9EQ0067.0%5257.8%230259425.1(Q9EQ00) cAMP-dependent protein kinase regulatory subunit
*	TK251102_lung_cytoE16_2_step07.3935.3935.2	2.1338	0.1185	1943.9	4	3530.0%	5	K.FLALGCSSLGRTLNTAMK.N
UHMMR_HUMAN66.9%222.5%724840315.8(O75330) Hyaluronan mediated motility receptor (Intracellular hyaluronic acid binding protein) (Receptor for hyaluronan-mediated motility) (CD168 antigen)
*	TK251102_lung_cytoE16_2_step01.2792.2792.1	0.9007	0.0503	852.81	94	5000.0%	1	K.QEGMEMK.L
*	TK251102_lung_cytoE16_2_step01.2951.2951.1	1.939	0.0171	1330.88	5	5500.0%	1	K.NLRILSLELMK.L
UQ9CZF166.9%117.7%221255745.5(Q9CZF1) 2810005O12Rik protein
*	TK251102_lung_cytoE16_2_step08.3550.3550.2	2.2442	0.1976	1837.67	1	4690.0%	1	K.HDAADESLVDQSAALHR.R
UPGCV_HUMAN66.9%8104.3%33963728214.5(P13611) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP)
*	TK251102_lung_cytoE16_2_step07.3790.3790.2	2.2513	0.1974	1400.51	5	5910.0%	2	K.KPTENIIIDLDK.E
*	TK251102_lung_cytoE16_2_step05.5251.5251.2	0.9863	0.2099	1910.26	10	2190.0%	1	R.GFSTGFPLEEDFSGDFR.E
*	TK251102_lung_cytoE16_2_step12.0456.0456.2	0.9421	0.1387	3077.53	8	1430.0%	1	K.EVAGTLSPHVETTFSTEPTGLVLSTVMDR.V
*	TK251102_lung_cytoE16_2_step10.2042.2042.3	2.159	0.1444	2545.32	1	3100.0%	1	K.ILVEGISTVIYPSLQTEMTHRR.E
*	TK251102_lung_cytoE16_2_step01.3647.3647.3	1.3538	0.1232	4262.47	22	1090.0%	1	R.EYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTK.F
*	TK251102_lung_cytoE16_2_step02.2105.2105.2	1.3239	0.0212	1218.98	3	4500.0%	1	R.VVAENITQTSR.E
*	TK251102_lung_cytoE16_2_step07.4247.4247.2	1.2759	0.0265	1899.69	1	4000.0%	1	R.TTKITEGTTQEEFPWK.E
UQ9CWR166.8%223.2%371408565.5(Q9CWR1) 2410008B13Rik protein
*	TK251102_lung_cytoE16_2_step08.5362.5362.2	0.6331	0.0526	1328.9	32	2000.0%	1	K.NEILHLILPLR.L
*	TK251102_lung_cytoE16_2_step12.4368.4368.2	1.7272	0.4221	1460.12	1	5000.0%	1	K.KNEILHLILPLR.L
UHAT1_HUMAN66.8%2213.1%419495135.7(O14929) Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48)
*	TK251102_lung_cytoE16_2_step03.4409.4409.3	1.7028	0.082	3826.42	7	1380.0%	1	R.LQTFLMWFIETASFIDVDDERWHYFLVFEK.Y
*	TK251102_lung_cytoE16_2_step12.4019.4019.2	1.7484	0.4062	2762.52	1	3120.0%	1	R.VSQMLILTPFQGQGHGAQLLETVHR.Y
UTR16_MOUSE66.7%3310.8%417446864.6(Q9Z0W1) Tumor necrosis factor receptor superfamily member 16 precursor (Low-affinity nerve growth factor receptor) (NGF receptor) (Low affinity neurotrophin receptor p75NTR)
*	TK251102_lung_cytoE16_2_step12.1063.1063.3	1.1469	0.0197	1587.09	1	2710.0%	1	R.EEVEKLLNGDTWR.H
*	TK251102_lung_cytoE16_2_step04.2931.2931.1	1.4763	0.203	1367.75	2	4580.0%	1	K.GDGNLYSSLPLTK.R
*	TK251102_lung_cytoE16_2_step10.5294.5294.3	1.4517	0.2121	2013.31	1	2920.0%	1	R.LRLLLLLLLLLGVSFGGAK.E
UCA1B_MOUSE66.5%778.9%18041809635.2(Q61245) Collagen alpha 1(XI) chain precursor
	TK251102_lung_cytoE16_2_step09.2603.2603.2	1.7165	0.3891	1688.69	2	3530.0%	1	K.GENGDVGPMGPPGPPGPR.G
*	TK251102_lung_cytoE16_2_step04.3711.3711.3	2.0708	0.3151	4218.58	23	1010.0%	1	R.GPQGPNGADGPQGPPGSIGSVGVVGDKGEPGEAGNPGPPGEAGSGGLK.G
*	TK251102_lung_cytoE16_2_step03.1325.1325.3	1.2925	0.0453	1382.2	2	3040.0%	1	K.GDRGLPGSQGSPGAK.G
	TK251102_lung_cytoE16_2_step11.1417.1417.1	1.4323	0.1844	969.36	18	4500.0%	1	K.GEAGAEGPPGK.T
	TK251102_lung_cytoE16_2_step10.1469.1469.1	0.9872	0.0209	724.56	12	6250.0%	1	K.EYEER.T
*	TK251102_lung_cytoE16_2_step03.4062.4062.1	1.0449	0.0177	1137.51	166	2730.0%	1	K.GARGIAGKPGPR.G
*	TK251102_lung_cytoE16_2_step11.2534.2534.3	1.1658	0.087	4726.57	13	830.0%	1	K.TGPVGPQGPSGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPLGPPGLPGLK.G
UQ8R3E666.5%339.2%338381175.5(Q8R3E6) Similar to chromosome 14 open reading frame 3
*	TK251102_lung_cytoE16_2_step06.1704.1704.1	1.0377	0.0854	599.49	4	6250.0%	1	K.HIAMK.W
*	TK251102_lung_cytoE16_2_step03.1401.1401.1	1.1982	0.0312	913.45	16	5000.0%	1	K.SQAKPVGVK.I
	TK251102_lung_cytoE16_2_step09.4615.4615.2	1.7436	0.402	1964.88	1	3120.0%	1	K.SWPEGHFATITLTFIDK.N
UETFB_MOUSE66.5%5721.8%252273108.4(Q9DCW4) Electron transfer flavoprotein beta-subunit (Beta-ETF)
*	TK251102_lung_cytoE16_2_step06.3414.3414.3	2.0996	0.0496	3027.69	106	1380.0%	1	R.TALAMGADRGIHVEIPGAQAESLGPLQVAR.V
*	TK251102_lung_cytoE16_2_step01.1768.1768.1	1.3744	0.0528	1078.49	26	4000.0%	1	K.AGDLGVDLTSK.V
*	TK251102_lung_cytoE16_2_step05.3897.3897.2	1.5862	0.2297	1429.98	3	3460.0%	1	R.VKPDKSGVVTDGVK.H
*	TK251102_lung_cytoE16_2_step03.3387.3387.2	0.7495	0.0298	2143.65	35	1500.0%	2	R.GIHVEIPGAQAESLGPLQVAR.V
UQ99K4166.5%7139.1%10171075855.3(Q99K41) Similar to elastin microfibril interface located protein
*	TK251102_lung_cytoE16_2_step06.2653.2653.2	2.0566	0.2886	1724.85	1	4330.0%	3	R.TCGQICSGAPGEQDSR.V
*	TK251102_lung_cytoE16_2_step08.2979.2979.2	0.8772	0.0128	1971.88	64	2190.0%	1	R.QLQESCSVCLTGLDGFR.Q
*	TK251102_lung_cytoE16_2_step06.3470.3470.3	1.3417	0.158	2847.0	1	2000.0%	1	R.TCGQICSGAPGEQDSRVNEILSALER.R
*	TK251102_lung_cytoE16_2_step11.4498.4498.2	1.3664	0.198	3042.65	3	1720.0%	1	R.GYSLYTGGTGALSPGGPQAQNSPRPASRHR.N
	TK251102_lung_cytoE16_2_step07.4522.4522.2	1.3718	0.1603	2192.68	2	3950.0%	1	R.FRGLEEGQAQAGQCPSLEGR.L
UFMO5_MOUSE66.4%4103.8%532598988.7(P97872) Dimethylaniline monooxygenase [N-oxide forming] 5 (EC 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5)
*	TK251102_lung_cytoE16_2_step10.2510.2510.1	0.9811	0.1116	942.6	3	5000.0%	3	R.IIAGLVKVK.G
*	TK251102_lung_cytoE16_2_step08.2733.2733.2	1.25	0.1241	1443.9	236	4000.0%	1	K.EFDLLKYIQFK.T
UVEGD_MOUSE66.3%2212.6%358409096.7(P97946) Vascular endothelial growth factor D precursor (VEGF-D) (c-fos induced growth factor) (FIGF)
	TK251102_lung_cytoE16_2_step05.1740.1740.1	1.5252	0.1709	1042.55	2	5710.0%	1	R.HPYSIIRR.S
*	TK251102_lung_cytoE16_2_step09.4372.4372.3	1.0427	0.0229	4355.48	81	1040.0%	1	K.TTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISK.Q
UQ9DC1566.0%4411.1%603659517.5(Q9DC15) 1200007E24Rik protein
*	TK251102_lung_cytoE16_2_step10.3261.3261.3	1.7692	0.1137	2872.15	1	2210.0%	1	R.LASDTTDDDDALAEILQANDLLTQGVR.L
*	TK251102_lung_cytoE16_2_step12.2453.2453.2	2.2423	0.176	2078.39	2	3820.0%	1	R.RPGHALPDQQALQVVYER.C
	TK251102_lung_cytoE16_2_step07.3010.3010.1	1.1562	0.0701	1132.54	341	3890.0%	1	K.ILPPPSPWPK.S
	TK251102_lung_cytoE16_2_step06.3690.3690.2	1.0698	0.0658	1404.22	2	4550.0%	1	R.FLNELIKVLSPK.Y
UO6027965.8%467.2%768826816.1(O60279) Hypothetical protein KIAA0527 (Fragment)
*	TK251102_lung_cytoE16_2_step03.3537.3537.3	1.7362	0.2818	2626.57	65	1790.0%	1	K.DEAEAHIDYEDNFPDDRSVSFR.E
*	TK251102_lung_cytoE16_2_step07.4908.4908.3	2.5262	0.4659	2860.96	1	2170.0%	2	K.HLFWFPAEAFHKPGLEKEVDDDTK.K
*	TK251102_lung_cytoE16_2_step04.3271.3271.1	0.8236	0.0244	968.55	27	4380.0%	1	K.LVPGEPETK.V
UO9520565.7%225.9%255281418.8(O95205) Zinc finger protein
	TK251102_lung_cytoE16_2_step10.1689.1689.1	1.4041	0.0806	698.5	3	7000.0%	1	K.FAHPPK.S
	TK251102_lung_cytoE16_2_step12.1856.1856.1	1.9249	0.014	1107.64	8	5620.0%	1	K.YLHPPTHLK.T
UMAP2_MOUSE65.7%556.7%18281989804.9(P20357) Microtubule-associated protein 2 (MAP 2)
*	TK251102_lung_cytoE16_2_step12.2427.2427.2	1.6088	0.3062	2357.81	1	3810.0%	1	K.APHWTSASLTEAAAHPHSPEMK.D
*	TK251102_lung_cytoE16_2_step06.3896.3896.3	1.2047	0.0948	3690.47	173	830.0%	1	K.AIELKFEVAQELTLSSEAPQEADSFMGVESGHIK.E
*	TK251102_lung_cytoE16_2_step06.3320.3320.2	0.6811	0.0027	2828.57	18	1040.0%	1	K.EESYESSGEHESLTMESLKPDEGKK.E
	TK251102_lung_cytoE16_2_step09.1999.1999.2	2.1294	0.262	1659.31	1	4380.0%	1	K.VGSLDNAHHVPGGGNVK.I
*	TK251102_lung_cytoE16_2_step01.4775.4775.2	0.7273	0.0251	2650.87	177	1040.0%	1	K.LEGAGSATIAEVEMPFYEDKSGMSK.Y
UQ99JQ465.6%115.6%197229749.4(Q99JQ4) Hypothetical 23.0 kDa protein (Fragment)
*	TK251102_lung_cytoE16_2_step06.2234.2234.1	1.5469	0.1616	1178.69	2	5000.0%	1	K.ETRLATAMAGR.T
UQ96M0165.5%224.7%443523797.9(Q96M01) Hypothetical protein FLJ32940
*	TK251102_lung_cytoE16_2_step10.4809.4809.2	2.2515	0.1137	1538.54	2	5910.0%	1	R.QYMEEIIKNIQK.L
*	TK251102_lung_cytoE16_2_step11.1052.1052.1	0.5529	0.081	1047.08	28	1880.0%	1	R.QVSVDCADR.G
UMEPA_MOUSE65.5%4107.1%747841976.2(P28825) Meprin A alpha-subunit precursor (EC 3.4.24.18) (Endopeptidase-2) (MEP-1)
	TK251102_lung_cytoE16_2_step09.4720.4720.2	2.2373	0.0157	1963.48	4	4120.0%	1	K.NQTSSAINGSVIWDRPSK.V
	TK251102_lung_cytoE16_2_step04.5208.5208.3	2.1717	0.3323	3780.3	1	1690.0%	3	R.CQAMHVHGSLLGLLIGCIAGLIFLTFVTFSTTNGK.L
UQ9DA1065.5%116.0%184209234.7(Q9DA10) 1700023I07Rik protein
*	TK251102_lung_cytoE16_2_step09.3659.3659.2	2.2561	0.0184	1365.74	1	7500.0%	1	R.EEENYLSPQEK.K
UO7027465.5%118.4%167191278.4(O70274) MPRL-2
	TK251102_lung_cytoE16_2_step06.2816.2816.2	2.2505	0.0287	1586.1	1	8460.0%	1	R.FLITHNPTNATLNK.F
UO7520665.5%487.1%367400035.8(O75206) Hypothetical protein
	TK251102_lung_cytoE16_2_step08.4699.4699.2	1.9504	0.1635	2016.86	1	4410.0%	2	K.LCSALTLSGLVEVKELQR.E
	TK251102_lung_cytoE16_2_step02.1601.1601.1	1.4339	0.1252	934.7	16	5710.0%	2	R.EQMSSQPK.S
UQ8VCN965.4%4412.6%341381255.3(Q8VCN9) Similar to tubulin-specific chaperone c
*	TK251102_lung_cytoE16_2_step06.1445.1445.1	1.1182	0.0842	586.79	4	5000.0%	1	R.VHTTK.D
*	TK251102_lung_cytoE16_2_step06.1228.1228.3	0.6916	0.0314	1700.63	383	1000.0%	1	R.QGQAALAQLQAVLTER.R
*	TK251102_lung_cytoE16_2_step05.1469.1469.1	0.9157	0.112	740.16	21	5000.0%	1	R.FAFKAR.K
*	TK251102_lung_cytoE16_2_step01.4462.4462.2	1.771	0.3212	2011.55	1	4330.0%	1	R.SKNNWDQVDDFNWLAR.N
UZO3_MOUSE65.4%339.0%905993246.8(Q9QXY1) Tight junction protein ZO-3 (Zonula occludens 3 protein) (Zona occludens 3 protein) (Tight junction protein 3)
*	TK251102_lung_cytoE16_2_step12.3771.3771.3	1.1561	0.066	4732.75	3	1160.0%	1	K.AVIQQQQARPIWTAEDQLNSSSEDLDLTGHGLAASSGDLSCDSR.T
*	TK251102_lung_cytoE16_2_step02.1995.1995.1	1.5122	0.1786	1174.12	4	5000.0%	1	R.GFGIAVSGGHDR.A
*	TK251102_lung_cytoE16_2_step07.3940.3940.3	1.307	0.0156	2888.37	5	1880.0%	1	R.VGDSFYIRTHFELEPSPPYGLGFTR.G
UPESC_MOUSE65.4%5134.3%584677966.8(Q9EQ61) Pescadillo homolog 1
*	TK251102_lung_cytoE16_2_step01.2346.2346.1	1.709	0.0262	1567.87	1	4170.0%	3	K.DIKFLLHEPIVNK.F
	TK251102_lung_cytoE16_2_step07.3695.3695.2	1.0578	0.0508	1420.46	11	3640.0%	2	K.QRLAQEEESEAK.R
UZ334_HUMAN65.2%243.5%680796499.2(Q9HCZ1) Zinc finger protein 334
*	TK251102_lung_cytoE16_2_step03.4749.4749.2	1.8914	0.0911	2847.68	2	2610.0%	2	K.ENLYECSEHGHAVSKNSHLIVHQR.T
UARF5_HUMAN65.2%113.9%179203986.8(P26437) ADP-ribosylation factor 5 (P26437) ADP-ribosylation factor 5
	TK251102_lung_cytoE16_2_step10.2565.2565.2	1.8422	0.3052	837.47	1	9170.0%	1	K.LGLQHLR.S
UQ8VD7165.2%393.7%272296976.0(Q8VD71) Similar to hypothetical protein FLJ12438
*	TK251102_lung_cytoE16_2_step03.2937.2937.1	1.7653	0.1275	1242.6	5	3890.0%	3	K.RHMLDPLDSR.R
UPM17_MOUSE65.1%5516.6%626659805.8(Q60696) Melanocyte protein Pmel 17 precursor (Silver locus protein)
*	TK251102_lung_cytoE16_2_step05.3723.3723.3	1.5113	0.0225	2130.03	5	2630.0%	1	R.AQFPKCHMVALTAAPASGLR.A
	TK251102_lung_cytoE16_2_step04.0040.0040.2	1.8309	0.3001	1903.07	4	3120.0%	1	K.EACMDISSPGCQPPAQR.L
*	TK251102_lung_cytoE16_2_step09.4876.4876.2	1.8847	0.2508	2752.78	1	3180.0%	1	R.QLYPEWTEVQGSNCWRGGQVSLR.V
*	TK251102_lung_cytoE16_2_step05.2500.2500.2	0.8017	0.1345	1784.77	74	1880.0%	1	K.CHMVALTAAPASGLRAR.G
*	TK251102_lung_cytoE16_2_step12.4704.4704.3	0.9779	0.1062	4744.89	2	850.0%	1	K.HFLRNHPLIFALQLHDPSGYLAEADLSYTWDFGDGTGTLISR.A
UQ9CYT164.9%228.1%419464616.0(Q9CYT1) DNA segment, KIST 1
	TK251102_lung_cytoE16_2_step01.3194.3194.2	1.96	0.2896	1982.51	1	3530.0%	1	R.LWQVQSRLGSGSSASVYR.V
	TK251102_lung_cytoE16_2_step07.4326.4326.2	1.4855	0.0415	1813.27	15	3000.0%	1	K.LIDFGLSFKEGNQDVK.Y
UQ9HCM064.7%448.7%726811018.3(Q9HCM0) Hypothetical protein KIAA1552 (Fragment)
	TK251102_lung_cytoE16_2_step11.2776.2776.1	1.6447	0.149	1572.74	1	4620.0%	1	G.HCHPPDLGGLEALR.Q
*	TK251102_lung_cytoE16_2_step07.2988.2988.2	1.2522	0.0013	1839.46	42	2670.0%	1	R.TPFGGRLLVLESFLYK.Q
*	TK251102_lung_cytoE16_2_step08.5149.5149.3	1.4137	0.0731	2130.76	16	2020.0%	1	K.LPSLALPEGLGEPQGPEGPGGR.V
	TK251102_lung_cytoE16_2_step03.2631.2631.3	1.6724	0.0163	1440.48	27	2750.0%	1	R.FLVHESFLYRK.E
UQ9D15764.4%3314.8%366410007.8(Q9D157) 0610025K21Rik protein
*	TK251102_lung_cytoE16_2_step05.4769.4769.3	1.086	0.1111	2696.5	180	870.0%	1	K.EHHFEAIALVEKALQTTYGTNAPR.M
*	TK251102_lung_cytoE16_2_step11.2093.2093.1	1.5272	0.158	1543.52	1	5000.0%	1	R.WMYHHSQLQGTR.G
*	TK251102_lung_cytoE16_2_step08.3711.3711.2	1.4641	0.0067	1986.87	6	2940.0%	1	R.LWAPSPARYGAGHMEMGR.R
UQ9D0H264.2%243.2%496539175.6(Q9D0H2) 2610017G09Rik protein
*	TK251102_lung_cytoE16_2_step03.3115.3115.1	1.098	0.076	1575.84	30	2000.0%	2	R.LGPAPVPVGPLSPESR.L
UQ9CS6964.2%3311.8%374390505.2(Q9CS69) 5730455C01Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step09.2161.2161.1	0.8684	0.0188	1228.63	37	2860.0%	1	K.GSTGSAGGSSGSSTK.N
	TK251102_lung_cytoE16_2_step11.1814.1814.3	1.2288	0.019	1803.25	12	1880.0%	1	K.NIWVSGLSSNTKAADLK.N
	TK251102_lung_cytoE16_2_step02.4593.4593.1	1.5017	0.1806	1448.72	2	4550.0%	1	K.DYEMNPNHKDGK.K
UQ96N7964.2%4410.9%624675628.7(Q96N79) Hypothetical protein FLJ31289
*	TK251102_lung_cytoE16_2_step08.3522.3522.2	0.8457	0.1444	2317.89	184	1300.0%	1	R.ARPPSGSSKATDLGGTSQAGTSQR.F
*	TK251102_lung_cytoE16_2_step11.0837.0837.2	1.0758	0.1615	3078.87	8	1500.0%	1	R.NLVPTTPGESTAPAQVSTLPQSPAALSSSNR.A
*	TK251102_lung_cytoE16_2_step08.3663.3663.2	1.2169	0.1325	1403.42	30	4170.0%	1	R.ASLEDAPVDDLTR.K
UQ9DCB764.2%5911.9%1591826210.1(Q9DCB7) 3100001N19Rik protein
	TK251102_lung_cytoE16_2_step05.3716.3716.2	1.6682	0.3418	1355.81	1	5910.0%	2	K.LVAIVDVIDQNR.A
	TK251102_lung_cytoE16_2_step01.1303.1303.1	1.1982	0.0145	722.47	12	7000.0%	1	R.YVEVGR.V
	TK251102_lung_cytoE16_2_step04.1717.1717.1	0.9843	0.0248	880.49	32	3330.0%	2	R.RYVEVGR.V
UQ9EPU664.2%91113.8%11891266626.8(Q9EPU6) Pumilio 1
	TK251102_lung_cytoE16_2_step07.2451.2451.2	1.8115	0.3006	1660.49	1	5380.0%	1	R.WPTGDNIHAEHQVR.S
*	TK251102_lung_cytoE16_2_step04.4315.4315.3	1.7632	0.0276	4205.65	3	1350.0%	1	R.DSAWGTSDHSVSHPIMVQRRPGQSFHVNSEVNSVLSPR.S
*	TK251102_lung_cytoE16_2_step09.2977.2977.2	1.3988	0.0749	1850.21	7	2630.0%	2	R.QHGEQLGGGGSGGGGYNTSK.H
	TK251102_lung_cytoE16_2_step12.4964.4964.2	0.8866	0.1201	2827.42	25	1300.0%	1	R.YPNLQLREIAGHIMEFSQDQHGSR.F
	TK251102_lung_cytoE16_2_step08.3162.3162.3	1.7149	0.0575	2572.31	13	2020.0%	1	R.EIAGHIMEFSQDQHGSRFIQLK.L
	TK251102_lung_cytoE16_2_step06.3689.3689.2	1.0373	0.054	1876.82	19	2670.0%	1	R.IRGHVLSLALQMYGCR.V
	TK251102_lung_cytoE16_2_step09.3889.3889.3	1.2912	0.0092	2986.39	3	1900.0%	1	R.TERAVLIDEVCTMNDGPHSALYTMMK.D
*	TK251102_lung_cytoE16_2_step09.2623.2623.3	1.2643	0.1018	2457.19	123	1750.0%	1	R.VIQKALEFIPSDQQVINEMVR.E
UQ9CTH264.2%2222.2%1441574310.0(Q9CTH2) 1110008J20Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step01.3614.3614.2	0.7174	0.0769	2255.11	3	1590.0%	1	K.RESSTVGGGSGDEANSATPPSHR.R
	TK251102_lung_cytoE16_2_step06.2488.2488.1	1.678	0.1445	1038.66	1	6880.0%	1	R.VWSPPSVHK.V
UQ9CSL164.2%3311.4%437488047.6(Q9CSL1) 2510006G12Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step12.3067.3067.2	1.8054	0.307	1917.91	1	3750.0%	1	R.QLHQELPAHGVPLINHL.-
*	TK251102_lung_cytoE16_2_step06.2033.2033.1	1.0281	0.1318	801.48	14	5000.0%	1	R.LYHALGK.T
	TK251102_lung_cytoE16_2_step04.5272.5272.3	1.1057	0.0592	2776.06	43	1500.0%	1	K.AVHFGLPYLASLGIQSLVQQRAFAGK.T
UO8890364.1%449.8%641707876.3(O88903) SH3 domain-containing adapter protein
*	TK251102_lung_cytoE16_2_step02.2473.2473.3	1.239	0.1257	1528.05	67	2310.0%	1	R.TQNVEVTKPDVDGK.I
*	TK251102_lung_cytoE16_2_step09.3052.3052.2	1.518	0.1355	2450.91	2	2610.0%	1	K.SSLSTPSSASKVNTAAFLTPLELK.A
*	TK251102_lung_cytoE16_2_step12.1163.1163.1	0.8977	0.0779	741.14	4	5000.0%	1	K.KPTAPTK.A
	TK251102_lung_cytoE16_2_step06.2721.2721.2	1.7445	0.345	1865.51	5	3240.0%	1	R.ISTYGLPAGGIQPHPQTK.A
UQ9QYY064.1%338.1%695767935.7(Q9QYY0) GRB2-associated binding protein 1
*	TK251102_lung_cytoE16_2_step11.3989.3989.2	1.7322	0.3434	2515.97	1	2380.0%	1	K.VKPAPLDIKPLSEWEELQAPVR.S
*	TK251102_lung_cytoE16_2_step01.3188.3188.2	0.9923	0.0761	3069.42	18	1430.0%	1	K.IKSVLTAGGVSGEELDENYVPMNPNSPPR.Q
	TK251102_lung_cytoE16_2_step01.0636.0636.1	1.0364	0.0752	574.47	46	6250.0%	1	R.SPITR.S
UQ8R55064.1%224.1%709781707.6(Q8R550) Ruk(xl) protein
*	TK251102_lung_cytoE16_2_step06.3558.3558.2	1.7305	0.3441	2453.67	2	2500.0%	1	K.APEKPMHDVSSGNALLSSETILR.T
*	TK251102_lung_cytoE16_2_step08.0146.0146.2	0.6315	0.1709	3125.75	122	710.0%	1	K.DLLSNKAPEKPMHDVSSGNALLSSETILR.T
UCO1B_MOUSE64.1%227.2%484539125.8(Q9WUM3) Coronin 1B (Coronin 2)
*	TK251102_lung_cytoE16_2_step09.3391.3391.2	1.7138	0.3419	1251.56	1	6000.0%	1	R.VGIITWHPTAR.N
*	TK251102_lung_cytoE16_2_step05.3877.3877.3	1.4108	0.13	2972.99	35	1410.0%	1	R.YFEITDEPPYIHFLNTFTSKEPQR.G
UMSLN_HUMAN64.0%336.8%628690456.4(Q13421) Mesothelin precursor (CAK1 antigen)
	TK251102_lung_cytoE16_2_step04.1239.1239.3	0.839	0.0242	1867.84	43	1720.0%	1	R.QLLGFPCAEVSGLSTER.V
	TK251102_lung_cytoE16_2_step12.1733.1733.2	0.9593	0.1809	1328.0	211	4090.0%	1	R.LLPAALACWGVR.G
	TK251102_lung_cytoE16_2_step01.4376.4376.1	1.7883	0.1124	1478.09	1	4620.0%	1	K.IQSFLGGAPTEDLK.A
UQ99NF063.9%4414.2%697756736.4(Q99NF0) MLN51 protein
*	TK251102_lung_cytoE16_2_step11.5596.5596.3	0.9359	0.0166	4342.16	4	1150.0%	1	K.TGNWEAPVDSTTGGLEQDVAQLNIAEQSWSPSQPSFLQPR.E
*	TK251102_lung_cytoE16_2_step10.2453.2453.2	1.7951	0.3017	1599.73	1	4640.0%	1	R.TSFRPVEVAGQHGGR.S
*	TK251102_lung_cytoE16_2_step05.1781.1781.3	1.0946	0.0768	2522.65	25	1500.0%	1	K.AAEEVPPPSEGLASTATVPETTPAAK.T
	TK251102_lung_cytoE16_2_step10.3410.3410.3	1.7618	0.0151	1892.31	1	3240.0%	1	R.QSGDGQESTEPVENKVGK.K
UQ99LI063.9%228.2%547626545.4(Q99LI0) Similar to thyroid hormone receptor interactor 10
	TK251102_lung_cytoE16_2_step11.1284.1284.2	1.7981	0.3063	2837.08	2	2040.0%	1	R.HARPPDPPTTAPPDSSSSSTNSGSQDNK.E
	TK251102_lung_cytoE16_2_step02.2681.2681.2	0.8469	0.0199	1868.43	471	1880.0%	1	K.QGAEGYVPTSYLRVTLN.-
UODBA_MOUSE63.9%228.6%442503718.1(P50136) 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase component alpha chain (E1)) (BCKDH E1-alpha)
*	TK251102_lung_cytoE16_2_step09.4637.4637.2	1.7027	0.3416	2447.11	1	2750.0%	1	K.LKPNPSLLFSDVYQEMPAQLR.R
	TK251102_lung_cytoE16_2_step09.2384.2384.3	1.1603	0.0391	2072.07	262	2030.0%	1	R.SMTLLNTMDRILYESQR.E
UCES2_HUMAN63.8%9219.5%14841642157.0(Q9BXF3) Cat eye syndrome critical region protein 2
*	TK251102_lung_cytoE16_2_step01.5367.5367.3	1.4935	0.1487	4566.97	12	1120.0%	1	R.TPYYACPQSFSDWQRPLHPQGSPSGPPASQPPPPRSLFSDK.N
*	TK251102_lung_cytoE16_2_step06.4193.4193.3	1.0678	0.1122	3010.42	301	1250.0%	1	R.HGGAPARPPDFPESSEIPPSHMYRSYK.Y
*	TK251102_lung_cytoE16_2_step10.1317.1317.2	0.6735	0.0601	1086.57	156	1500.0%	1	K.NVSSIPGKTGK.R
*	TK251102_lung_cytoE16_2_step10.4001.4001.3	1.4526	0.1114	2763.49	3	2050.0%	1	R.VEPLGEDNSGALYWYFYGTRMYK.E
*	TK251102_lung_cytoE16_2_step09.4379.4379.2	1.7205	0.0752	2228.19	11	2650.0%	4	R.DITPQTFHSYLEDIINYR.W
*	TK251102_lung_cytoE16_2_step06.3584.3584.3	1.6327	0.059	2493.82	12	2380.0%	1	R.WMSDHLSIKPVKQEETPVLTR.I
USKD1_HUMAN63.7%113.6%444492867.2(O75351) SKD1 protein (Vacuolar sorting protein 4b)
	TK251102_lung_cytoE16_2_step10.1798.1798.2	1.8637	0.2954	1710.02	1	4330.0%	1	K.AQKPVKEGQPSPADEK.G
UQ96G9063.7%1129.7%3740358.3(Q96G90) Hypothetical protein
*	TK251102_lung_cytoE16_2_step12.1864.1864.1	1.5262	0.1588	1311.59	1	5000.0%	1	R.QMVNLIYAACK.H
UQ9WVN763.5%225.7%719793356.7(Q9WVN7) Protein kinase Myak-S
	TK251102_lung_cytoE16_2_step05.4095.4095.3	2.2159	0.1129	3727.59	1	1720.0%	1	K.SSSSSGEGDYQLVQHEILCSMTNSYEVLEFLGR.G
	TK251102_lung_cytoE16_2_step01.0274.0274.1	1.779	0.1034	1023.77	4	6430.0%	1	R.EYIDLLKK.M
UQ9UH8763.5%111.3%594683616.4(Q9UH87) Transposase-like protein
	TK251102_lung_cytoE16_2_step11.1370.1370.1	1.679	0.1323	949.6	1	6430.0%	1	R.EKLSAFVR.K
UQ9CZN063.4%4413.8%630676174.6(Q9CZN0) 2700049A03Rik protein
*	TK251102_lung_cytoE16_2_step01.0872.0872.2	0.6645	0.0070	2232.45	70	950.0%	1	R.QRAAATSVPGDLSGTETNLLAR.V
*	TK251102_lung_cytoE16_2_step09.3577.3577.2	2.2041	0.0507	1922.14	5	3530.0%	1	R.VEKGSDMPAVMLVSTPTR.T
*	TK251102_lung_cytoE16_2_step11.5332.5332.3	1.4714	0.0342	3027.7	37	1540.0%	1	R.ELLVSQQEEDLDNSVGELSEGQRLVLK.A
*	TK251102_lung_cytoE16_2_step10.4423.4423.3	1.586	0.2101	4047.71	1	1600.0%	1	R.AAATSVPGDLSGTETNLLARVCAPVATPQPTPPCSPSPVR.E
UQ6128563.2%333.9%741834839.1(Q61285) ALDR protein (ATP-binding cassette, sub-family D (ALD), member 2)
	TK251102_lung_cytoE16_2_step04.4524.4524.2	1.7334	0.3386	1901.98	1	3420.0%	1	R.GASPIGPTLLAGLVVYATAK.V
	TK251102_lung_cytoE16_2_step05.1877.1877.3	1.429	0.044	2242.11	3	2390.0%	1	R.GASPIGPTLLAGLVVYATAKVLK.A
*	TK251102_lung_cytoE16_2_step05.1512.1512.1	1.1733	0.0148	722.51	33	6000.0%	1	K.QPGHRK.A
UQ9GZP463.1%395.7%211241785.8(Q9GZP4) AD039 (Hypothetical protein) (HT014)
*	TK251102_lung_cytoE16_2_step08.2586.2586.1	1.2436	0.3156	1396.96	1	3180.0%	3	R.VHQVTPQTHFIS.-
UCSN2_HUMAN63.1%336.1%443515975.5(Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15) (Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15)
	TK251102_lung_cytoE16_2_step04.2455.2455.1	1.0286	0.1863	711.45	48	5000.0%	1	R.YTALDK.W
	TK251102_lung_cytoE16_2_step10.3901.3901.2	1.4115	0.1301	957.4	1	6430.0%	1	R.IHIPFISK.E
	TK251102_lung_cytoE16_2_step11.3601.3601.2	1.7666	0.3192	1406.32	1	6250.0%	1	K.SAIPHPLIMGVIR.E
UQ9D3K663.0%468.4%569609414.6(Q9D3K6) 9130005N14Rik protein
	TK251102_lung_cytoE16_2_step03.3662.3662.2	1.824	0.2966	1700.07	1	4410.0%	2	K.SLLSSASATVGHGLTAVK.E
	TK251102_lung_cytoE16_2_step05.1788.1788.1	1.1577	0.1338	693.59	14	6000.0%	1	K.DIFVAK.E
	TK251102_lung_cytoE16_2_step05.3892.3892.3	1.4025	0.0955	2715.75	9	2070.0%	1	K.VAELILHGQEEEKPAQDQARVLIK.L
UQ9D9A263.0%3321.3%235257535.5(Q9D9A2) 1700121J11Rik protein
*	TK251102_lung_cytoE16_2_step09.3144.3144.3	1.3379	0.0912	2786.62	11	2080.0%	1	R.QFDDAVSITVAIVIVVTVAFVQEYR.S
*	TK251102_lung_cytoE16_2_step12.2620.2620.3	1.6889	0.2394	2349.5	12	2360.0%	1	R.AFHGWNEFDISEDEPLWKK.Y
	TK251102_lung_cytoE16_2_step08.2281.2281.1	1.4826	0.1829	913.51	5	7500.0%	1	K.KYISQFK.N
U7B2_MOUSE62.9%242.8%212238665.8(P12961) Neuroendocrine protein 7B2 precursor (Secretogranin V)
	TK251102_lung_cytoE16_2_step03.2047.2047.1	1.5815	0.1553	793.55	1	8000.0%	2	K.KLLYEK.M
UQ8VDZ662.9%225.7%367417985.8(Q8VDZ6) Hypothetical 41.8 kDa protein
	TK251102_lung_cytoE16_2_step08.3507.3507.2	2.1721	0.224	1582.5	1	5770.0%	1	K.RSELPIAELTGHTR.T
	TK251102_lung_cytoE16_2_step08.2495.2495.1	1.7577	0.0276	901.65	14	6670.0%	1	R.RLQTLLR.Q
UHP28_HUMAN62.8%113.3%181206308.9(Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1)
*	TK251102_lung_cytoE16_2_step08.1762.1762.1	1.4064	0.268	656.58	1	8000.0%	1	K.MHLAGK.T
UQ9H9P562.8%242.6%232252157.2(Q9H9P5) Hypothetical protein FLJ12623
	TK251102_lung_cytoE16_2_step06.1972.1972.1	1.1753	0.04	700.68	3	7000.0%	2	R.QLALQK.K
USOS1_MOUSE62.8%683.9%13191508836.9(Q62245) Son of sevenless protein homolog 1 (SOS-1) (mSOS-1)
*	TK251102_lung_cytoE16_2_step07.2046.2046.1	1.0493	0.0732	1217.65	15	3330.0%	1	R.HPKPLPRFPK.K
*	TK251102_lung_cytoE16_2_step04.4999.4999.2	0.78	0.0795	2504.61	5	2080.0%	1	R.SASVSSISLSKGTDEVPVPPPVPPR.R
	TK251102_lung_cytoE16_2_step06.1972.1972.1	1.1753	0.04	700.68	3	7000.0%	2	K.QLAIKK.M
*	TK251102_lung_cytoE16_2_step01.2434.2434.1	0.93	0.0586	1144.92	42	3330.0%	1	K.TEEGNPEVLR.R
	TK251102_lung_cytoE16_2_step07.2012.2012.1	1.2201	0.1096	572.59	2	6250.0%	1	K.QLAIK.K
UACDM_MOUSE62.8%485.7%421464818.4(P45952) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor (EC 1.3.99.3) (MCAD)
*	TK251102_lung_cytoE16_2_step09.2457.2457.2	1.541	0.1909	1470.01	1	5360.0%	2	R.TRPTVAAGAVGLAQR.A
*	TK251102_lung_cytoE16_2_step05.2701.2701.1	1.6305	0.0289	1009.55	16	5620.0%	2	R.TQHSKAAHK.Q
UQ9P01562.5%2214.2%2963342010.0(Q9P015) HSPC145 (HSPC145 protein)
	TK251102_lung_cytoE16_2_step06.1781.1781.2	1.7779	0.3009	2823.66	1	2710.0%	1	R.LQYLIDLGRVDPSQPIDLTQLVNGR.G
	TK251102_lung_cytoE16_2_step07.1952.1952.2	1.3312	0.0012	1746.61	78	2500.0%	1	R.GLPRVSLANLKPNPGSK.K
UQ9P2P662.5%794.2%18201979636.3(Q9P2P6) Hypothetical protein KIAA1300 (Fragment)
*	TK251102_lung_cytoE16_2_step07.1307.1307.3	1.0448	0.0323	1286.28	198	1940.0%	1	R.DFCCVCVEAK.E
*	TK251102_lung_cytoE16_2_step02.2919.2919.1	0.9788	0.0985	950.61	2	5710.0%	1	K.RQPLVIAR.L
*	TK251102_lung_cytoE16_2_step08.2361.2361.3	1.38	0.0447	2480.66	250	1620.0%	1	K.QEQSPPQPPNDHSQDSEWSKR.E
*	TK251102_lung_cytoE16_2_step07.2399.2399.2	1.3989	0.1268	1564.45	1	4230.0%	2	K.DVVETTRSPESVSR.S
*	TK251102_lung_cytoE16_2_step12.2977.2977.2	1.3291	0.0256	2745.6	22	1670.0%	1	R.VIYLAQVELGAPGFPPQLLSSFIKR.Q
UQ9H7U362.2%7722.5%387426506.4(Q9H7U3) Hypothetical protein FLJ14257
	TK251102_lung_cytoE16_2_step05.1640.1640.1	1.1229	0.047	785.6	18	6000.0%	1	R.QKQPER.L
	TK251102_lung_cytoE16_2_step09.4488.4488.2	1.317	0.0172	1996.84	111	2060.0%	1	K.VEEPSKYGVVVCEADTGR.I
	TK251102_lung_cytoE16_2_step02.5315.5315.2	0.6644	0.0080	2080.07	4	1840.0%	1	R.ISMSHEEEPLGTAGPLALAR.D
	TK251102_lung_cytoE16_2_step11.3521.3521.2	1.2027	0.1017	1936.19	8	2860.0%	1	R.SHSWLESCIVGWRCR.V
	TK251102_lung_cytoE16_2_step03.2525.2525.2	1.8073	0.2955	1422.26	2	5000.0%	1	R.FVEKPQVFVSNK.I
	TK251102_lung_cytoE16_2_step09.3621.3621.3	0.9666	0.0145	2522.84	3	2170.0%	1	R.LGIRISMSHEEEPLGTAGPLALAR.D
	TK251102_lung_cytoE16_2_step10.2451.2451.1	1.2642	0.1499	1306.78	1	4550.0%	1	R.HHGQEGSILVTK.V
UQ0790062.2%334.4%11561253536.0(Q07900) M130 antigen cytoplasmic variant 2 precursor
*	TK251102_lung_cytoE16_2_step02.1471.1471.1	1.0221	0.0217	917.78	129	4290.0%	1	R.QRLAVSSR.G
*	TK251102_lung_cytoE16_2_step10.3017.3017.2	1.7993	0.2917	1862.39	1	4670.0%	1	R.GNESALWDCKHDGWGK.H
*	TK251102_lung_cytoE16_2_step12.5051.5051.2	0.8482	0.0814	3150.04	8	1350.0%	1	R.LEVRFQGEWGTICDDGWDSYDAAVACK.Q
UQ9H08961.9%465.9%658752266.3(Q9H089) Hypothetical protein FLJ11301
*	TK251102_lung_cytoE16_2_step01.1078.1078.2	1.2133	0.0134	943.91	16	3890.0%	1	R.RAPAGGSLGR.A
*	TK251102_lung_cytoE16_2_step08.3646.3646.2	1.9599	0.2814	1940.85	2	3750.0%	1	K.ENVILINKADLLTAEQR.S
*	TK251102_lung_cytoE16_2_step07.1013.1013.1	0.8521	0.178	1423.19	2	2270.0%	2	K.MNSDEIKMQLGR.N
UQ91WJ861.9%102415.5%651685407.9(Q91WJ8) Similar to far upstream element (FUSE) binding protein 1
*	TK251102_lung_cytoE16_2_step12.2176.2176.2	1.698	0.4722	2493.33	1	3330.0%	2	K.KVPPQNDSFGAQLPPMHQQQSR.S
	TK251102_lung_cytoE16_2_step09.4652.4652.2	1.1815	0.1092	1778.14	35	2860.0%	1	K.LFTIRGTPQQIDYAR.Q
	TK251102_lung_cytoE16_2_step07.1059.1059.1	1.1796	0.1057	1524.02	11	2810.0%	4	R.SVQAGNPGGPGPGGRGR.G
*	TK251102_lung_cytoE16_2_step11.2584.2584.2	0.8257	0.1825	2584.16	6	1110.0%	1	-.MADYSTVPPPSSGSAGGGGGGVVNDAFK.D
	TK251102_lung_cytoE16_2_step04.1153.1153.2	1.0646	0.0213	1352.03	6	4170.0%	1	K.IQIAPDSGGLPER.S
	TK251102_lung_cytoE16_2_step02.1394.1394.1	1.0031	0.1924	679.43	3	6000.0%	1	R.DQGGFR.E
UHXK4_HUMAN61.8%113.0%465521915.2(P35557) Hexokinase D (EC 2.7.1.1) (Hexokinase type IV) (HK IV) (HK4) (Glucokinase)
*	TK251102_lung_cytoE16_2_step01.3622.3622.1	1.7255	0.1135	1360.01	1	4620.0%	1	K.ASGAEGNNVVGLLR.D
UFOLC_MOUSE61.7%4612.4%587649078.3(P48760) Folylpolyglutamate synthase, mitochondrial precursor (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (FPGS)
*	TK251102_lung_cytoE16_2_step01.0896.0896.3	1.1632	0.1797	4600.17	4	1220.0%	1	K.LLQPCQFDYAVFCPNVTEVSSIGNADQQNFTVTLDQVLLR.C
*	TK251102_lung_cytoE16_2_step01.4307.4307.2	0.9011	0.0462	2103.34	5	1880.0%	1	R.WQLPLAPVFRPTPHMRR.G
*	TK251102_lung_cytoE16_2_step08.4406.4406.2	1.941	0.2759	1826.67	2	4670.0%	2	R.TLNTLQTNASYLEQVK.R
UQ96RI661.6%226.2%633722736.9(Q96RI6) Unconventional myosin 1G valine form (Fragment)
	TK251102_lung_cytoE16_2_step01.0279.0279.1	1.5186	0.1641	587.69	1	7500.0%	1	K.DVLLK.S
	TK251102_lung_cytoE16_2_step12.1976.1976.3	0.7627	0.0346	4019.16	13	610.0%	1	R.DGKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEK.L
UNCA1_MOUSE61.6%462.2%11151193514.8(P13595) Neural cell adhesion molecule 1, 180 kDa isoform precursor (N-CAM 180) (NCAM-180)
*	TK251102_lung_cytoE16_2_step07.2904.2904.3	1.7742	0.2959	1988.88	52	2500.0%	1	R.EPSAPKLEGQMGEDGNSIK.V
	TK251102_lung_cytoE16_2_step01.0279.0279.1	1.5186	0.1641	587.69	1	7500.0%	1	R.DVILK.K
*	TK251102_lung_cytoE16_2_step08.1333.1333.1	1.6537	0.0783	629.56	6	7000.0%	2	R.EPSAPK.L
UQ9ERM461.6%2212.7%205235985.3(Q9ERM4) Mg53d08.r1 (Fragment)
	TK251102_lung_cytoE16_2_step01.0279.0279.1	1.5186	0.1641	587.69	1	7500.0%	1	R.DVLIK.R
*	TK251102_lung_cytoE16_2_step04.4613.4613.2	0.6764	0.0054	2351.46	18	1250.0%	1	K.LSFEQGSSEFVPVVVNRSVLR.S
UEGF_HUMAN61.6%445.5%12071339465.9(P01133) Pro-epidermal growth factor precursor (EGF) [Contains: Epidermal growth factor (Urogastrone)]
*	TK251102_lung_cytoE16_2_step11.0601.0601.2	0.7215	0.0055	3189.03	1	1670.0%	1	R.IDTEGTNYEQLVVDAGVSVIMDFHYNEK.R
*	TK251102_lung_cytoE16_2_step12.2671.2671.3	1.3452	0.1027	1743.37	14	1560.0%	1	R.ADLDGVGVKALLETSEK.I
*	TK251102_lung_cytoE16_2_step08.2911.2911.1	1.5087	0.1625	1327.82	2	5000.0%	1	K.ITAVSLDVLDKR.L
*	TK251102_lung_cytoE16_2_step12.2949.2949.2	0.5024	0.039	991.88	75	1250.0%	1	R.HAGHGQQQK.V
UKFP3_MOUSE61.6%221.8%793912915.1(P70188) Kinesin-associated protein 3 (KAP3)
	TK251102_lung_cytoE16_2_step09.3491.3491.1	1.0315	0.0817	1187.56	5	4380.0%	1	K.MLFECSDER.I
	TK251102_lung_cytoE16_2_step01.0279.0279.1	1.5186	0.1641	587.69	1	7500.0%	1	R.DVIIK.E
UKI67_HUMAN61.6%16465.3%32563587479.4(P46013) Antigen KI-67
*	TK251102_lung_cytoE16_2_step07.1490.1490.1	0.6621	0.0095	856.3	10	4170.0%	1	K.RQPQTPK.E
*	TK251102_lung_cytoE16_2_step02.3659.3659.3	1.5013	0.1057	3919.98	2	1530.0%	1	K.QFQGTDSGEEPLLPTSESFGGNVFFSAQNAAKQPSDK.C
*	TK251102_lung_cytoE16_2_step08.3746.3746.1	1.8432	0.0566	1344.53	1	5000.0%	6	K.QESGSEIHVEVK.A
*	TK251102_lung_cytoE16_2_step02.3437.3437.1	1.4163	0.0288	1314.33	105	3180.0%	1	K.VEVKEELLAVGK.L
*	TK251102_lung_cytoE16_2_step01.2080.2080.1	1.3388	0.2762	1352.96	1	4170.0%	1	K.SSPELEDTATSSK.R
*	TK251102_lung_cytoE16_2_step06.3776.3776.3	1.1422	0.085	2021.14	148	1880.0%	1	K.QMLDPANYGTGMERWPR.T
*	TK251102_lung_cytoE16_2_step11.2912.2912.3	1.3485	0.0942	3414.26	3	1550.0%	1	K.EEAQSLEDLAGFKELFQTPDHTEESTTDDK.T
*	TK251102_lung_cytoE16_2_step12.1976.1976.2	0.7337	0.1326	2679.78	70	600.0%	1	K.SRPKSGGSGHAVAEPASPEQELDQNK.G
*	TK251102_lung_cytoE16_2_step08.2977.2977.1	1.1193	0.0322	849.47	24	5830.0%	1	R.CAENPKK.A
*	TK251102_lung_cytoE16_2_step09.2259.2259.2	0.7826	0.0381	1448.05	38	3330.0%	1	K.VPGDEDKGINVFR.E
UQ9BSS261.4%241.6%506559726.8(Q9BSS2) Hypothetical protein (Fragment)
*	TK251102_lung_cytoE16_2_step08.1775.1775.1	1.4982	0.0137	804.56	1	7140.0%	2	R.GTKSGAER.Q
UQ9DAR961.4%4436.4%209234388.5(Q9DAR9) 1700001D09Rik protein
*	TK251102_lung_cytoE16_2_step08.3721.3721.2	2.1934	0.0847	1663.28	4	4290.0%	1	K.DTGNQLVITISCLVK.E
*	TK251102_lung_cytoE16_2_step02.3598.3598.3	1.8622	0.0733	2645.01	35	2050.0%	1	-.MEFLLLLSLALFSDAMVMDEKVK.S
*	TK251102_lung_cytoE16_2_step05.4679.4679.2	0.5786	0.1423	2350.93	11	1000.0%	1	K.VKSGVELETASAVCVYDAYYK.D
*	TK251102_lung_cytoE16_2_step04.3779.3779.3	1.0052	0.0056	2234.32	58	1530.0%	1	R.GYFRDSCNIIAFTPNSTNR.V
UIMB1_MOUSE61.4%576.6%876971524.8(P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG)
	TK251102_lung_cytoE16_2_step01.4880.4880.2	0.9353	0.0481	1660.14	3	2860.0%	2	R.AAVENLPTFLVELSR.V
	TK251102_lung_cytoE16_2_step02.0869.0869.3	1.0374	0.0781	1573.48	5	1920.0%	1	K.SNEILTAIIQGMRK.E
	TK251102_lung_cytoE16_2_step03.2910.2910.2	1.2255	0.3026	1671.69	1	3930.0%	1	R.ESCLEAYTGIVQGLK.G
	TK251102_lung_cytoE16_2_step03.4439.4439.2	1.9154	0.2794	1614.65	1	5000.0%	1	K.YMEAFKPFLGIGLK.N
UO4330461.3%6189.7%756853036.8(O43304) Hypothetical protein KIAA0420 (Fragment)
*	TK251102_lung_cytoE16_2_step01.5296.5296.3	0.7057	0.0168	4728.69	6	760.0%	1	K.FLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGLVPK.S
*	TK251102_lung_cytoE16_2_step06.3681.3681.2	2.124	0.0322	1400.32	1	6000.0%	4	R.FLRAHDFHLDK.A
*	TK251102_lung_cytoE16_2_step09.3613.3613.2	1.2284	0.1051	2069.86	20	2650.0%	1	K.IAGVEHVVFVQTNILNWK.E
UMSE5_HUMAN61.1%113.6%391402957.2(Q00587) Serum protein MSE55
*	TK251102_lung_cytoE16_2_step11.2784.2784.1	1.8642	0.046	1574.72	1	4620.0%	1	R.LTADMISHPLGDFR.H
UQ8TEC661.1%2231.1%151166988.8(Q8TEC6) Hypothetical protein FLJ23651
*	TK251102_lung_cytoE16_2_step12.3345.3345.3	1.7103	0.0939	3443.92	31	1500.0%	1	R.SPALTFTVLWPSCPLVPIVLGLNPGFCPCAR.S
*	TK251102_lung_cytoE16_2_step10.1645.1645.2	1.8882	0.2777	1744.68	1	4330.0%	1	R.SSGECNHSGHIIEGTR.W
UO7566361.1%228.5%272314445.9(O75663) DJ69E11.3 (Yeast YPR037W and WORM C02C2.6 PREDICTED proteins like)
*	TK251102_lung_cytoE16_2_step06.1621.1621.1	1.2614	0.3049	629.64	1	7500.0%	1	K.THIMK.S
*	TK251102_lung_cytoE16_2_step05.3708.3708.2	1.8853	0.2778	1935.87	1	3820.0%	1	R.IQHGSGFGIEFNATDALR.C
UQ9BQ5061.1%2212.5%279306216.8(Q9BQ50) 3'-5' exonuclease TREX2-like protein
*	TK251102_lung_cytoE16_2_step04.1624.1624.1	1.8628	0.0175	1423.63	5	3640.0%	1	R.SRCSPTLCSSLR.T
	TK251102_lung_cytoE16_2_step07.4671.4671.2	1.3296	0.1225	2482.89	1	2730.0%	1	R.AEPSAAHSAEGDVHTLLLIFLHR.A
UQ9H43061.1%664.2%18892152256.1(Q9H430) DJ756N5.1.1 (Continues in Em:AL133324 as dJ1161H23.3 ) (Fragment)
	TK251102_lung_cytoE16_2_step10.2090.2090.3	1.3285	0.2068	2528.98	3	2610.0%	1	K.SEIQAALEEAEGALELEETKTLR.I
	TK251102_lung_cytoE16_2_step08.1795.1795.2	1.2847	0.0483	1124.83	25	4440.0%	1	R.HEATVAALRR.K
	TK251102_lung_cytoE16_2_step08.2974.2974.1	1.3829	0.0455	919.73	9	5560.0%	1	R.ATSAAAALDK.K
	TK251102_lung_cytoE16_2_step10.1789.1789.1	1.8567	0.0211	1264.6	1	5560.0%	1	R.KLEDECTELK.K
	TK251102_lung_cytoE16_2_step02.3430.3430.2	1.0717	0.0517	1629.73	4	3330.0%	1	R.QGFPNRLLYTDFR.Q
	TK251102_lung_cytoE16_2_step11.2813.2813.2	1.1778	0.0383	1389.11	98	3750.0%	1	R.GKALAAQSLEELR.R
UZN41_HUMAN61.0%221.9%821937288.8(P51814) Zinc finger protein 41
	TK251102_lung_cytoE16_2_step09.1727.1727.1	1.8333	0.0497	1072.62	1	7500.0%	1	K.IHTGQKPYK.C
*	TK251102_lung_cytoE16_2_step04.1042.1042.1	0.4864	0.0050	812.74	23	1670.0%	1	K.LVPSIKR.L
UQ8TD2361.0%111.6%568662238.7(Q8TD23) TRAF6-binding zinc finger protein
*	TK251102_lung_cytoE16_2_step09.1727.1727.1	1.8333	0.0497	1072.62	1	7500.0%	1	K.LHTGKKPYK.C
UZF38_MOUSE61.0%448.5%555630427.2(Q07231) Zinc finger protein 38 (Zfp-38) (CtFIN51) (Transcription factor RU49)
	TK251102_lung_cytoE16_2_step03.2705.2705.2	1.2296	0.1457	1549.03	9	3850.0%	1	R.TVIPMIPANKYGSR.S
	TK251102_lung_cytoE16_2_step09.1760.1760.1	1.8356	0.0514	1074.41	1	7500.0%	1	R.LHTGEKPYK.C
	TK251102_lung_cytoE16_2_step05.2893.2893.1	1.2902	0.0039	1246.43	1	6110.0%	1	K.CCPTLELSHK.H
	TK251102_lung_cytoE16_2_step09.2445.2445.3	1.1089	0.0827	1811.23	36	2690.0%	1	R.VLCCEWLQPEIHTK.E
UZ287_MOUSE61.0%111.2%759866658.0(Q9EQB9) Zinc finger protein ZNF287 (Zinc finger protein SKAT-2)
	TK251102_lung_cytoE16_2_step09.1727.1727.1	1.8333	0.0497	1072.62	1	7500.0%	1	K.IHTGKKPYK.C
UZN43_HUMAN61.0%334.2%803934889.2(P17038) Zinc finger protein 43 (Zinc protein HTF6) (Zinc finger protein KOX27)
*	TK251102_lung_cytoE16_2_step10.3683.3683.2	1.4819	0.0471	1541.14	10	3330.0%	1	K.AFNQYSNLTTHNK.I
	TK251102_lung_cytoE16_2_step09.1760.1760.1	1.8356	0.0514	1074.41	1	7500.0%	1	K.IHTGEQPYK.C
	TK251102_lung_cytoE16_2_step09.3409.3409.2	1.0264	0.118	1410.93	38	3640.0%	1	K.AFNQFSNLTTHK.R
UZFP2_MOUSE61.0%229.2%347398558.8(P08043) Zinc finger protein 2 (Zfp-2) (mKR2 protein)
	TK251102_lung_cytoE16_2_step09.1760.1760.1	1.8356	0.0514	1074.41	1	7500.0%	1	R.IHTGEKPYK.C
	TK251102_lung_cytoE16_2_step02.2889.2889.3	1.1909	0.0984	2661.65	49	1820.0%	1	R.SSLTVHQVIHTGEKPYECTECGK.A
UTS24_MOUSE60.8%142612.2%19442160856.4(P53995) Protein TSG24 (Meiotic check point regulator)
	TK251102_lung_cytoE16_2_step08.3589.3589.2	1.0179	0.3035	1685.82	173	2190.0%	1	K.GHEMTSIGLLLGVSAAK.L
*	TK251102_lung_cytoE16_2_step02.4439.4439.3	0.9265	0.0663	4697.1	11	760.0%	1	K.FAKDFMNYLSAPNASVTGPYNLETCLSVVLLSLAMVMAGSGNLK.V
	TK251102_lung_cytoE16_2_step03.4799.4799.2	0.8648	0.0156	2567.82	77	1090.0%	1	K.EGDTINVDVTCPGATLALAMIYLK.T
	TK251102_lung_cytoE16_2_step02.4306.4306.3	1.059	0.0030	2475.73	16	1900.0%	1	K.EDPMGWQSLLAQTVANRNSEAR.A
*	TK251102_lung_cytoE16_2_step04.1961.1961.1	1.3387	0.0325	1231.39	1	5500.0%	1	R.FNLSSHSQSPK.R
*	TK251102_lung_cytoE16_2_step06.3197.3197.2	1.6095	0.2619	2013.6	1	4120.0%	1	R.FAGSENLSAFSCLHKFAK.D
*	TK251102_lung_cytoE16_2_step06.3890.3890.2	1.2729	0.0448	1618.78	2	4230.0%	4	K.RGLFINSEFLPVVK.C
*	TK251102_lung_cytoE16_2_step02.1294.1294.2	0.7659	0.0218	1531.11	21	2690.0%	1	K.TQLIFGSVTNIHAK.D
*	TK251102_lung_cytoE16_2_step01.5431.5431.1	0.8936	0.188	929.9	13	4170.0%	1	R.QHTYPKR.G
	TK251102_lung_cytoE16_2_step09.4881.4881.3	1.1256	0.1183	3858.27	36	960.0%	1	K.HAELANEYAGFLMALGLNGHLTKLATLNIHDYLTK.G
*	TK251102_lung_cytoE16_2_step11.4846.4846.3	1.0232	0.041	4005.1	5	1180.0%	1	R.CSSSHEVPPSLPREPLPTMFSMLHPLDEITPLVCK.S
UO0897260.8%5119.4%244253686.1(O08972) Hypothetical 25.4 kDa protein
	TK251102_lung_cytoE16_2_step03.1583.1583.1	1.1413	0.0386	929.78	1	5710.0%	3	R.RPEVDGVR.K
	TK251102_lung_cytoE16_2_step02.1773.1773.1	1.1868	0.091	796.58	1	5710.0%	1	R.EHGVLGGK.L
	TK251102_lung_cytoE16_2_step06.2001.2001.1	1.1354	0.0309	856.64	9	5830.0%	1	R.CSHALIR.G
UQ9Y3T060.5%119.2%98111748.6(Q9Y3T0) Hypothetical protein (Fragment)
*	TK251102_lung_cytoE16_2_step07.4770.4770.1	1.8263	0.0255	1099.65	1	6880.0%	1	K.QFIHLIAKK.F
ULSM5_HUMAN60.5%246.7%9098064.5(Q9Y4Y9) U6 snRNA-associated Sm-like protein LSm5
*	TK251102_lung_cytoE16_2_step07.2466.2466.1	1.6776	0.0704	742.51	2	8000.0%	2	R.IHIVMK.S
UQ923C360.5%241.5%520563829.1(Q923C3) Similar to regulator of differentiation (In S. pombe) 1
	TK251102_lung_cytoE16_2_step07.2078.2078.1	1.5089	0.1772	948.6	31	5710.0%	2	K.HQAVQLPR.E
UPLD2_MOUSE60.4%449.4%9331061687.4(P97813) Phospholipase D2 (EC 3.1.4.4) (PLD 2) (Choline phosphatase 2) (Phosphatidylcholine-hydrolyzing phospholipase D2) (PLD1C) (mPLD2)
*	TK251102_lung_cytoE16_2_step03.4282.4282.3	1.129	0.0633	3915.59	5	860.0%	1	R.ALREYVAVESLATVSPSLAQSELAHIQGHLVHFPLK.F
*	TK251102_lung_cytoE16_2_step11.1922.1922.3	1.414	0.0554	2080.78	70	1940.0%	1	K.VLMSLLPLARFAVTHSPAR.E
*	TK251102_lung_cytoE16_2_step09.2211.2211.1	1.598	0.1385	985.47	1	5620.0%	1	R.FAVTHSPAR.E
*	TK251102_lung_cytoE16_2_step03.4818.4818.3	0.9066	0.087	3827.48	13	780.0%	1	K.NLFPYGDYLNSSQLHMEPDEVDTLREGEDPADR.M
URS6_HUMAN60.4%81424.1%2492868110.8(P10660) 40S ribosomal protein S6 (Phosphoprotein NP33) (P10660) 40S ribosomal protein S6 (Phosphoprotein NP33)
	TK251102_lung_cytoE16_2_step06.1761.1761.1	1.1534	0.0801	572.55	4	7500.0%	1	R.IALKK.Q
	TK251102_lung_cytoE16_2_step09.2013.2013.1	0.771	0.0292	733.59	2	5000.0%	3	R.RLSSLR.A
	TK251102_lung_cytoE16_2_step01.2198.2198.1	1.1411	0.2299	1284.88	1	4090.0%	1	K.DIPGLTDTTVPR.R
	TK251102_lung_cytoE16_2_step01.2403.2403.1	1.3288	0.0976	1335.83	1	5000.0%	1	K.LNISFPATGCQK.L
	TK251102_lung_cytoE16_2_step11.1916.1916.2	0.8818	0.0872	1958.93	118	1760.0%	1	R.GCIVDANLSVLNLVIVKK.G
	TK251102_lung_cytoE16_2_step08.2990.2990.1	1.6065	0.1403	851.57	1	6670.0%	1	R.KLFNLSK.E
UO7513060.2%9810.9%846992135.8(O75130) Hypothetical protein KIAA0635
*	TK251102_lung_cytoE16_2_step05.2464.2464.1	1.1976	0.0040	940.55	2	7140.0%	9	R.RQLDAAHK.E
UQ9Y37360.2%3310.7%373400578.4(Q9Y373) CGI-63 protein
	TK251102_lung_cytoE16_2_step12.2040.2040.1	1.8583	2.0E-4	1102.65	8	5620.0%	1	K.KDHSPDQFK.E
*	TK251102_lung_cytoE16_2_step12.1875.1875.1	0.9694	0.1814	1238.48	12	2270.0%	1	R.GVVYGHHGDPAK.V
	TK251102_lung_cytoE16_2_step07.4582.4582.2	1.6234	0.0783	2226.86	20	1940.0%	1	K.SLGAEHVITEEELRRPEMK.N
ULGR6_HUMAN60.1%4410.3%828893026.0(Q9HBX8) Leucine-rich repeat-containing G protein-coupled receptor 6
	TK251102_lung_cytoE16_2_step07.2467.2467.1	1.095	0.0198	1136.63	224	3500.0%	1	K.GNLALSQAFSK.D
*	TK251102_lung_cytoE16_2_step12.3589.3589.3	1.1723	0.1675	4650.13	1	1250.0%	1	K.ILMLQNNQLGGIPAEALWELPSLQSLDLNYNKLQEFPVAIR.T
	TK251102_lung_cytoE16_2_step07.2122.2122.1	1.4275	0.211	895.56	3	5710.0%	1	K.RPLGLLAR.Q
*	TK251102_lung_cytoE16_2_step12.3196.3196.2	0.6971	0.0131	3024.95	6	1880.0%	1	R.DLSMNNLTELQPGLFHHLRFLEELR.L
UQ9D7L560.0%114.1%217243065.8(Q9D7L5) 2310003M01Rik protein
*	TK251102_lung_cytoE16_2_step02.1451.1451.1	1.4316	0.2057	833.3	2	5000.0%	1	K.GAQSAGSPR.K
UCYA8_MOUSE60.0%573.9%12491401556.9(P97490) Adenylate cyclase, type VIII (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Ca(2+)/calmodulin activated adenylyl cyclase)
	TK251102_lung_cytoE16_2_step04.1557.1557.1	1.1519	0.1125	1574.54	1	4620.0%	1	R.KSEVVMNVLDVLTK.L
	TK251102_lung_cytoE16_2_step07.1683.1683.1	1.7606	0.0498	599.39	5	7500.0%	2	R.IHISK.A
*	TK251102_lung_cytoE16_2_step10.2849.2849.3	1.5239	0.0482	2086.9	4	2350.0%	1	K.QLLNENSNSGIIKSHYNR.R
	TK251102_lung_cytoE16_2_step06.3085.3085.1	0.5323	0.0544	1594.58	38	1360.0%	1	R.FDRLAHEHHCLR.I
UQ9JLT460.0%240.9%528570598.5(Q9JLT4) Thioredoxin reductase 2, mitochondrial precursor (EC 1.6.4.5)
*	TK251102_lung_cytoE16_2_step07.1683.1683.1	1.7606	0.0498	599.39	5	7500.0%	2	K.LHISK.R
UQ9CXP560.0%242.6%189206269.8(Q9CXP5) 3110043A19Rik protein
	TK251102_lung_cytoE16_2_step07.1683.1683.1	1.7606	0.0498	599.39	5	7500.0%	2	R.LHLSK.S
UP7021259.9%115.7%193227339.7(P70212) Hypothetical 22.7 kDa protein
	TK251102_lung_cytoE16_2_step03.1730.1730.1	1.5681	0.1455	1331.5	2	5000.0%	1	R.FRASNYQSTTR.V
UQ9D7W859.9%115.3%171200479.3(Q9D7W8) 2210019E14Rik protein
*	TK251102_lung_cytoE16_2_step12.1996.1996.1	1.7819	0.0886	1032.09	1	6250.0%	1	R.HHLLAAVNR.Q
UQ9DB5159.8%114.6%194225135.2(Q9DB51) 1500011L16Rik protein
	TK251102_lung_cytoE16_2_step04.1724.1724.1	1.3625	0.3161	933.59	3	5620.0%	1	R.SFGTGTHVK.L
UM3K2_HUMAN59.8%9656.6%618695388.3(Q9Y2U5) Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.1.-) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2)
*	TK251102_lung_cytoE16_2_step07.4138.4138.2	1.4833	0.1337	2483.67	10	2110.0%	8	K.YTRQILEGVHYLHSNMILHR.D
*	TK251102_lung_cytoE16_2_step11.3872.3872.2	0.8383	0.0080	2276.46	8	2000.0%	1	K.SVTGTPYWMSPEVISGQGYGR.K
UODC_HUMAN59.7%3329.8%299333039.5(Q9BQT8) Mitochondrial 2-oxodicarboxylate carrier
*	TK251102_lung_cytoE16_2_step07.0108.0108.3	0.9753	0.0132	4284.7	2	980.0%	1	K.LLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANR.N
*	TK251102_lung_cytoE16_2_step03.3978.3978.3	2.6081	0.2745	2849.73	1	2210.0%	1	R.EASRQIVAGGSAGLVEICLMHPLDVVK.T
*	TK251102_lung_cytoE16_2_step07.4174.4174.2	1.4085	0.0247	2365.01	2	3160.0%	1	R.TCFKTMATVYQEEGILALYK.G
UQ8VGJ759.3%396.5%309345598.9(Q8VGJ7) Olfactory receptor MOR136-11
*	TK251102_lung_cytoE16_2_step04.3517.3517.2	1.2005	0.1351	2322.18	33	2110.0%	3	-.MRMDNESTVSEFILLGLPIR.A
URFL1_HUMAN59.3%6823.3%288322677.1(O75677) Ret finger protein-like 1
	TK251102_lung_cytoE16_2_step11.1441.1441.1	0.9489	0.0207	626.39	30	6250.0%	1	R.ESVHR.K
*	TK251102_lung_cytoE16_2_step01.6022.6022.2	0.7131	0.0047	3056.62	98	1040.0%	1	K.CINSLQKEPHGEDLLCCCCSMVSQK.N
*	TK251102_lung_cytoE16_2_step07.3702.3702.2	1.861	0.2567	1987.06	1	4060.0%	2	R.FDVSICILGSPRFTCGR.H
*	TK251102_lung_cytoE16_2_step05.1783.1783.2	1.1691	0.0489	1796.18	5	3000.0%	1	R.LSASTVPLTFLFVDRK.L
*	TK251102_lung_cytoE16_2_step04.1940.1940.2	1.744	0.3095	2081.92	1	3610.0%	1	R.DGSRLSASTVPLTFLFVDR.K
URBB4_MOUSE59.2%4610.2%461517715.1(Q60972) Chromatin assembly factor 1 subunit C (CAF-1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF-I 48 kDa subunit) (CAF-Ip48) (Retinoblastoma binding protein p48) (Retinoblastoma-binding protein 4) (RBBP-4)
	TK251102_lung_cytoE16_2_step01.3023.3023.1	1.338	0.3323	1471.87	1	4580.0%	1	K.TPSSDVLVFDYTK.H
	TK251102_lung_cytoE16_2_step09.1459.1459.3	1.6735	0.3046	2129.54	100	1910.0%	1	K.EAAFDDAVEERVINEEYK.I
	TK251102_lung_cytoE16_2_step09.1728.1728.2	1.9134	0.2506	1806.41	1	4000.0%	2	K.HPSKPDPSGECNPDLR.L
UQ96AQ859.1%51115.3%359396949.6(Q96AQ8) Similar to RIKEN cDNA 6230416A05 gene
	TK251102_lung_cytoE16_2_step06.3336.3336.2	0.6526	0.0162	1451.08	4	2500.0%	1	-.MDCGSVGGQRTQR.L
*	TK251102_lung_cytoE16_2_step12.2481.2481.3	0.9508	0.0819	3168.73	3	1250.0%	1	R.SSAWRCSPGVAAAAGALPQYHGPAPALVSCR.R
	TK251102_lung_cytoE16_2_step08.4337.4337.2	2.17	0.1816	1312.06	1	5000.0%	3	K.ILEANMDIVYK.D
UELO2_MOUSE59.1%115.8%292342079.3(Q9JLJ4) Elongation of very long chain fatty acids protein 2
*	TK251102_lung_cytoE16_2_step08.4323.4323.2	1.8633	0.273	1814.12	1	4060.0%	1	K.NGFPKAHLIVANGMTDK.K
UGTO1_HUMAN59.0%113.7%241275666.6(P78417) Glutathione transferase omega 1 (EC 2.5.1.18) (GSTO 1-1)
*	TK251102_lung_cytoE16_2_step03.3422.3422.1	1.5289	0.1532	1225.59	3	5620.0%	1	K.NKPEWFFKK.N
UCG99_MOUSE58.9%227.0%244281526.9(Q9CQE8) Hypothetical protein CGI-99 homolog
	TK251102_lung_cytoE16_2_step03.3125.3125.1	1.4739	0.0257	1022.44	15	6430.0%	1	R.LLHIEELR.E
	TK251102_lung_cytoE16_2_step03.2062.2062.1	1.4597	0.1717	1084.58	1	6250.0%	1	R.NIHSSDWPK.F
UUSF2_MOUSE58.7%4415.3%346369545.2(Q64705) Upstream stimulatory factor 2 (Upstream transcription factor 2) (Major late transcription factor 2)
	TK251102_lung_cytoE16_2_step11.2290.2290.1	1.4709	0.1683	1413.76	2	4000.0%	1	R.QTNQRMQETFK.E
*	TK251102_lung_cytoE16_2_step01.4652.4652.2	1.0569	0.0636	2347.09	21	1520.0%	1	-.MDMLDPGLDPASSATAAAAASHDK.G
*	TK251102_lung_cytoE16_2_step09.1561.1561.2	1.1824	0.0458	1212.06	19	4000.0%	1	R.TESNGGQVTYR.V
	TK251102_lung_cytoE16_2_step07.2011.2011.1	1.7255	0.0376	887.53	1	7500.0%	1	R.QQIEELK.N
UPTN_MOUSE58.6%113.6%168188699.6(P20935) Pleiotrophin precursor (PTN) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding growth factor 8) (HBGF-8) (Osteoblast specific factor 1) (OSF-1) (Heparin-binding neutrophic factor) (HBNF)
	TK251102_lung_cytoE16_2_step03.1738.1738.1	1.8114	0.0043	760.58	1	8000.0%	1	K.KEKPEK.K
URP1_MOUSE58.5%885.5%20952343867.5(P56716) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein homolog)
*	TK251102_lung_cytoE16_2_step04.1561.1561.1	1.2003	0.0493	811.61	64	4170.0%	1	R.MITSNDK.K
*	TK251102_lung_cytoE16_2_step10.1122.1122.1	0.8111	0.0803	1525.75	40	1670.0%	1	R.HSITRLEELEDGK.S
	TK251102_lung_cytoE16_2_step01.2831.2831.1	1.2977	0.0813	941.6	14	5830.0%	1	K.KFQLYLK.K
*	TK251102_lung_cytoE16_2_step05.3599.3599.1	0.9097	0.0415	804.84	5	5000.0%	1	K.QMGVKLK.S
	TK251102_lung_cytoE16_2_step08.4358.4358.2	1.3787	0.0814	2578.64	3	2500.0%	1	R.NVSVGEEFAGNVIGDLCDQLYFK.S
	TK251102_lung_cytoE16_2_step12.3563.3563.3	1.3328	0.0415	2921.94	84	1560.0%	1	K.CNYFNFPHGSDSEPFGEDFPDAQNK.T
	TK251102_lung_cytoE16_2_step08.4050.4050.2	1.8483	0.2697	2402.83	5	2500.0%	1	R.VSSDNPGMYGNADTTSVDTLIDK.N
*	TK251102_lung_cytoE16_2_step01.0236.0236.1	1.274	0.0361	1203.74	50	3500.0%	1	R.HSNITHPVVAK.R
UZN30_HUMAN58.5%1122.0%5057719.0(P17039) Zinc finger protein 30 (Zinc finger protein KOX28) (Fragment)
	TK251102_lung_cytoE16_2_step06.1730.1730.2	2.1776	0.1331	1363.96	2	6500.0%	1	R.IHTGKKPYECK.E
UQ8WX4258.4%445.9%12981425726.9(Q8WX42) BA100C15.1 (Novel protein) (Fragment)
*	TK251102_lung_cytoE16_2_step07.1352.1352.1	0.9886	0.0602	656.52	1	7500.0%	1	K.EHEDK.D
	TK251102_lung_cytoE16_2_step06.1922.1922.1	1.4576	0.171	1214.59	1	6000.0%	1	R.GEGRPRSIVSR.R
*	TK251102_lung_cytoE16_2_step10.4341.4341.3	1.7759	0.1188	4785.42	2	1160.0%	1	K.SPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFMGEAHPVVFSR.Y
*	TK251102_lung_cytoE16_2_step03.2743.2743.2	1.3287	0.0855	2036.05	3	2940.0%	1	K.QQQILEEQGLGKPKSKPK.K
UQ9Y2J558.4%224.0%802917299.2(Q9Y2J5) Hypothetical protein KIAA0990 (Chondroitin synthase)
*	TK251102_lung_cytoE16_2_step03.3421.3421.1	1.393	0.28	994.44	1	6430.0%	1	K.YSNTEIHK.E
*	TK251102_lung_cytoE16_2_step02.1014.1014.2	0.9969	0.0788	2843.58	39	1300.0%	1	R.EEILEWEFLTGKYLYSAVDGQPPR.R
UDRG1_MOUSE58.4%113.0%367405128.9(P32233) Developmentally regulated GTP-binding protein 1 (DRG 1) (Nedd3 protein)
	TK251102_lung_cytoE16_2_step07.2590.2590.1	1.3863	0.2629	1214.68	3	5500.0%	1	R.LNSKPPNIGFK.K
UQ96PV758.3%4410.5%514560089.6(Q96PV7) Hypothetical protein KIAA1931 (Fragment)
*	TK251102_lung_cytoE16_2_step05.2396.2396.1	1.5749	0.1315	876.51	1	6670.0%	1	R.KEELPMK.G
*	TK251102_lung_cytoE16_2_step05.1693.1693.2	1.4916	0.0052	1557.57	1	4290.0%	1	R.GPPPGIVPENGLVRR.L
*	TK251102_lung_cytoE16_2_step03.3231.3231.2	1.2452	0.0778	2339.75	4	2750.0%	1	K.DSIRASFSVCELSMDSNGFSK.E
*	TK251102_lung_cytoE16_2_step11.1736.1736.1	1.1724	0.0024	1214.76	1	4000.0%	1	R.VSGSREPRPAR.E
UQ9ESJ558.3%223.7%10241125796.9(Q9ESJ5) GluR-delta2 philic-protein
*	TK251102_lung_cytoE16_2_step03.2609.2609.1	1.5394	0.1416	1054.61	4	5620.0%	1	K.EVVEILSHK.K
*	TK251102_lung_cytoE16_2_step02.3499.3499.3	1.7313	0.0557	3056.06	8	1700.0%	1	K.SFGFTLRGHGPVWIESVLPGSPAENASLK.S
UQ9CQC658.2%228.8%419480435.9(Q9CQC6) 1200015E15Rik protein (KIAA0005 gene product)
	TK251102_lung_cytoE16_2_step12.5504.5504.2	1.359	0.0654	2832.11	44	1540.0%	1	R.YAETLFDILVAGGMLAPGGTLADDMMR.T
	TK251102_lung_cytoE16_2_step05.1520.1520.1	1.3861	0.2608	1142.67	3	5560.0%	1	K.QQKPTLSGQR.F
UM2OM_MOUSE58.2%3323.3%313340249.9(Q9CR62) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)
*	TK251102_lung_cytoE16_2_step12.0565.0565.3	1.5376	0.1729	4466.02	2	1220.0%	1	K.QFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTR.I
*	TK251102_lung_cytoE16_2_step06.2914.2914.2	2.1797	0.0866	1545.96	3	4000.0%	1	-.AATASPGAGRMDGKPR.T
	TK251102_lung_cytoE16_2_step05.3444.3444.3	1.6823	0.1777	2130.8	1	3120.0%	1	R.YEGFFSLWKGFTPYYAR.L
UNAC1_MOUSE58.2%448.1%9701080355.0(P70414) Sodium/calcium exchanger 1 precursor (Na(+)/Ca(2+)-exchange protein 1)
*	TK251102_lung_cytoE16_2_step12.3487.3487.2	2.1277	0.2159	2765.89	1	2730.0%	1	K.HPEKEIEQLIELANYQVLSQQQK.S
*	TK251102_lung_cytoE16_2_step01.4090.4090.2	1.0058	0.1409	2999.63	63	1150.0%	1	R.GGGEDFEDTCGEPEFQNDEIVKTISVK.V
	TK251102_lung_cytoE16_2_step07.1411.1411.3	1.2767	0.0933	2237.34	24	1970.0%	1	K.GVILPIWEPQDPSFGDKIAR.A
*	TK251102_lung_cytoE16_2_step02.2599.2599.1	0.7402	0.0355	1142.52	1	4380.0%	1	K.EMYGQPIFR.K
UQ9P1H658.1%1132.1%7888878.8(Q9P1H6) PRO1410
*	TK251102_lung_cytoE16_2_step06.0010.0010.2	1.6841	0.3819	2897.5	1	2290.0%	1	K.LVWPSLFFSSGIPIMHMLVLIVTHR.F
UQ9CWF258.1%113.8%445499534.9(Q9CWF2) 2410129E14Rik protein
	TK251102_lung_cytoE16_2_step01.4644.4644.2	1.6834	0.3823	1860.51	1	3750.0%	1	K.MSATFIGNSTAIQELFK.R
USNPH_HUMAN58.0%114.8%538579905.9(O15079) Syntaphilin
*	TK251102_lung_cytoE16_2_step08.3562.3562.3	2.5233	0.3246	2976.66	1	2100.0%	1	R.FPASNTYEKLLCGMEAGVQASCMQER.A
UMDR1_HUMAN58.0%222.7%12801414629.0(P08183) Multidrug resistance protein 1 (P-glycoprotein 1) (CD243 antigen)
*	TK251102_lung_cytoE16_2_step11.1650.1650.1	0.9454	0.0714	808.0	31	4170.0%	1	K.ELLAYAK.A
*	TK251102_lung_cytoE16_2_step08.3197.3197.3	2.5343	0.3242	2875.18	1	2210.0%	1	K.ILLLDEATSALDTESEAVVQVALDKAR.K
UPP1A_HUMAN57.8%338.5%330375126.3(P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A)
	TK251102_lung_cytoE16_2_step08.2654.2654.3	1.3583	0.1067	2114.28	139	2060.0%	1	K.TFTDCFNCLPIAAIVDEK.I
	TK251102_lung_cytoE16_2_step02.1475.1475.2	1.8096	0.2742	1158.79	1	6670.0%	1	R.GNHECASINR.I
UQ8WWB557.6%3319.7%315359576.4(Q8WWB5) Similar to RIKEN cDNA 2700059L22 gene
*	TK251102_lung_cytoE16_2_step08.3062.3062.3	1.1977	0.0111	1784.9	67	2860.0%	1	K.IVHDHSEKPLKIELK.V
*	TK251102_lung_cytoE16_2_step11.2661.2661.2	2.1696	0.1841	1911.85	6	3120.0%	1	R.SSTMSNPDHFPQLLLPK.D
*	TK251102_lung_cytoE16_2_step06.3284.3284.3	1.7492	0.1569	3377.91	1	2070.0%	1	K.VELPGINSVSLCDLSVSEDDLLIEVSEKYR.L
UGTA1_MOUSE57.2%227.7%222254779.0(P13745) Glutathione S-transferase Ya chain (EC 2.5.1.18) (GST class-alpha)
	TK251102_lung_cytoE16_2_step01.2568.2568.1	1.2017	0.072	860.59	72	5000.0%	1	R.ISSLPNVK.K
	TK251102_lung_cytoE16_2_step09.2200.2200.1	1.4195	0.2197	1060.67	1	6250.0%	1	K.KFLQPGSQR.K
UQ9H0V057.2%225.0%302342814.8(Q9H0V0) Hypothetical protein
	TK251102_lung_cytoE16_2_step06.2173.2173.1	1.4186	0.2197	1017.28	4	4500.0%	1	R.LQRVGGGGGSK.Y
	TK251102_lung_cytoE16_2_step01.0715.0715.1	0.8093	0.0762	832.17	18	4170.0%	1	K.EAGRLQR.V
UQ9H9L657.2%3516.4%293320546.9(Q9H9L6) Hypothetical protein FLJ12668
*	TK251102_lung_cytoE16_2_step11.4349.4349.3	2.3361	0.1158	3009.81	3	2200.0%	2	K.ALPLPMACTLSQFLASNRYYFTVQSK.D
*	TK251102_lung_cytoE16_2_step05.3192.3192.3	1.1115	0.1154	2400.54	115	1790.0%	1	K.VANSEAMILDKNLESVNSPIEK.S
UQ96JG957.2%6127.9%7728128310.1(Q96JG9) Hypothetical protein KIAA1858 (Fragment)
*	TK251102_lung_cytoE16_2_step11.2490.2490.2	1.7531	0.2929	2101.51	3	2940.0%	3	K.GWPETLERPVDPVTHPIR.G
*	TK251102_lung_cytoE16_2_step04.2456.2456.3	1.6031	0.038	1791.02	1	3380.0%	1	R.VAMPGSAPGPGEDRPPPR.G
*	TK251102_lung_cytoE16_2_step03.2670.2670.1	1.8323	0.1277	1204.63	12	5000.0%	1	K.EQFDRHMNK.H
*	TK251102_lung_cytoE16_2_step12.2213.2213.3	1.6297	0.1175	1860.28	6	3500.0%	1	R.RWPTSGCTTSTCVSTR.S
UQ9P28057.1%337.6%526602619.4(Q9P280) Hypothetical protein KIAA1448 (Fragment)
*	TK251102_lung_cytoE16_2_step10.1770.1770.1	1.208	0.034	908.53	3	6670.0%	1	R.RQNVPHR.F
*	TK251102_lung_cytoE16_2_step03.1345.1345.1	1.3956	0.2305	611.16	3	7500.0%	1	K.VHIDK.L
	TK251102_lung_cytoE16_2_step06.2976.2976.3	1.1948	0.0737	3262.86	9	1110.0%	1	R.HIHQHRQSYCNYNTGGQLEGNAATSYQK.Q
UO5477457.1%111.5%11991350817.4(O54774) MBLVR
	TK251102_lung_cytoE16_2_step05.3433.3433.2	1.7678	0.2757	1966.52	1	4120.0%	1	K.VTTLPGHIQAVYVQNVVK.L
UQ9Z1K757.1%10126.4%22742431378.9(Q9Z1K7) APC2 protein
*	TK251102_lung_cytoE16_2_step08.2410.2410.2	1.895	0.0416	1302.15	9	4500.0%	1	K.QRALEAELDTR.H
	TK251102_lung_cytoE16_2_step07.4139.4139.2	0.6734	0.0761	2213.55	229	1050.0%	1	K.DEDVPHILRSTLPATALPLR.V
*	TK251102_lung_cytoE16_2_step10.2767.2767.2	1.7632	0.2841	1612.53	2	3930.0%	1	R.SLPVPVYMLVPAPAR.G
*	TK251102_lung_cytoE16_2_step04.2149.2149.1	0.9773	0.0832	1125.53	6	5000.0%	1	K.MMAGESTMLR.G
*	TK251102_lung_cytoE16_2_step08.3626.3626.2	1.7017	0.1707	1973.44	3	2780.0%	2	K.TPSSSSSQTSPASQPLPRR.S
*	TK251102_lung_cytoE16_2_step12.4419.4419.2	1.2701	0.0325	1781.41	9	2940.0%	1	R.ASGSTSLPVSIPAPQRGR.S
	TK251102_lung_cytoE16_2_step07.2451.2451.3	1.7466	0.1216	2490.23	8	2050.0%	1	R.YAGMTLTNLTFGDVANKATLCAR.R
*	TK251102_lung_cytoE16_2_step04.1501.1501.1	1.1115	0.0969	839.68	45	5000.0%	1	R.AGIPGAPGAK.D
	TK251102_lung_cytoE16_2_step08.2599.2599.3	1.4882	0.0271	2090.89	1	2760.0%	1	K.MIAMGSAAALRNLLAHRPAK.Y
UPUR1_HUMAN57.0%338.3%517573996.8(Q06203) Amidophosphoribosyltransferase precursor (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (ATASE) (GPAT)
*	TK251102_lung_cytoE16_2_step09.3193.3193.3	1.634	0.2161	2873.32	122	1560.0%	1	K.TSETEGWVVSSESCSFLSIGARYYR.E
*	TK251102_lung_cytoE16_2_step03.4910.4910.1	0.7209	0.0101	1007.95	26	3570.0%	1	R.TFIQPNMR.L
*	TK251102_lung_cytoE16_2_step04.3108.3108.1	1.3807	0.2683	1155.67	1	5560.0%	1	K.KFGVLSDNFK.G
UQ9Y5R357.0%114.1%386451348.9(Q9Y5R3) N-acetylglucosamine 6-O-sulfotransferase (L-selectin ligand sulfotransferase GST-3)
*	TK251102_lung_cytoE16_2_step09.3029.3029.2	2.014	0.2618	1883.31	1	3330.0%	1	K.DPSLNLHIVHLVRDPR.A
UO8844257.0%559.7%11281282665.1(O88442) Aortic carboxypeptidase-like protein ACLP
	TK251102_lung_cytoE16_2_step03.4287.4287.3	1.4459	0.028	2878.26	20	1700.0%	1	R.GIKGVVTDEQGIPIANATISVSGINHGVK.T
*	TK251102_lung_cytoE16_2_step09.3985.3985.2	1.6924	0.3217	1226.88	4	5500.0%	1	R.ADVEVPPEKNK.D
	TK251102_lung_cytoE16_2_step02.4329.4329.2	0.7596	0.0247	1914.77	21	1790.0%	1	K.FPHESELPREWENNK.E
*	TK251102_lung_cytoE16_2_step11.0730.0730.2	1.0891	0.093	2950.2	32	1400.0%	1	R.EILAMNGNRPILGVDPSRPMTPQQRR.M
*	TK251102_lung_cytoE16_2_step07.3643.3643.3	2.1766	0.2048	3353.77	1	1940.0%	1	R.YTAGIHGNEVLGRELLLLLMQYLCQEYR.D
URB5B_HUMAN56.8%5722.8%215237078.1(P35239) Ras-related protein Rab-5B (P35239) Ras-related protein Rab-5B
	TK251102_lung_cytoE16_2_step08.3034.3034.2	2.0597	0.2431	1301.49	1	7220.0%	2	R.YHSLAPMYYR.G
	TK251102_lung_cytoE16_2_step01.3876.3876.3	1.4542	0.2021	4261.0	1	1420.0%	1	R.MVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAK.K
	TK251102_lung_cytoE16_2_step07.2871.2871.3	1.2772	0.0173	2915.15	9	1770.0%	1	K.RMVEYEEAQAYADDNSLLFMETSAK.T
UTRHY_HUMAN56.7%663.5%18982472175.7(Q07283) Trichohyalin
*	TK251102_lung_cytoE16_2_step09.2160.2160.1	1.5249	0.1436	792.75	1	6670.0%	1	R.EFGAVLR.R
*	TK251102_lung_cytoE16_2_step03.1870.1870.1	0.8121	0.1022	1196.5	99	2860.0%	1	R.QEWERQYR.K
	TK251102_lung_cytoE16_2_step12.3176.3176.1	0.9666	0.0432	1107.86	50	4290.0%	1	K.FREEEQLR.Q
*	TK251102_lung_cytoE16_2_step08.2489.2489.1	1.1984	0.1188	1143.32	10	4380.0%	1	R.RQEGQQQLR.Q
*	TK251102_lung_cytoE16_2_step10.2506.2506.2	1.0792	0.1024	2330.24	9	2220.0%	1	R.ERAQQLQEEEDGLQEDQER.R
*	TK251102_lung_cytoE16_2_step07.2458.2458.3	1.3144	0.0284	1922.01	5	3000.0%	1	R.QEQERELAEGEEQSEK.Q
UKF1B_MOUSE56.7%555.8%18162040795.6(Q60575) Kinesin-like protein KIF1B
	TK251102_lung_cytoE16_2_step02.2791.2791.2	1.0989	0.0303	1713.25	13	3210.0%	1	R.HDEAFSTEPLKNNGR.G
	TK251102_lung_cytoE16_2_step01.5294.5294.1	1.3754	0.2718	1291.19	1	4000.0%	1	R.DLLWGNAVYLK.E
*	TK251102_lung_cytoE16_2_step11.2842.2842.3	1.5262	0.0133	3368.85	7	1770.0%	1	R.DPSVSSFSSSTLTPSSTCPSLVDSRSSSMDQK.T
*	TK251102_lung_cytoE16_2_step08.4671.4671.2	1.0716	0.1338	2321.69	20	2050.0%	1	R.AQGLGDIIDIDPLIDDYSGSGGK.Y
	TK251102_lung_cytoE16_2_step01.3578.3578.2	0.7486	0.0337	2775.42	30	1520.0%	1	R.FEAVWDSSLHNSLLLNRVTPYGEK.I
UQ9ET4756.7%225.9%871945157.7(Q9ET47) Espin
*	TK251102_lung_cytoE16_2_step04.3739.3739.2	1.6726	0.3441	2278.17	5	3000.0%	1	R.GIPGARAADLQSYMDMLNPEK.S
*	TK251102_lung_cytoE16_2_step08.4082.4082.3	1.1358	0.0099	3219.31	79	1380.0%	1	R.ARNGATPAHDAAATGYLSCLQWLLTQGGCR.V
UVIS3_MOUSE56.5%113.6%192222075.5(P35333) Visinin-like protein 3 (VILIP-3) (Neural visinin-like protein 3) (NVL-3) (NVP-3) (Hippocalcin-like protein 1)
	TK251102_lung_cytoE16_2_step05.2567.2567.1	1.3842	0.2376	905.55	1	6670.0%	1	K.FAEHVFR.T
UTYB0_HUMAN56.2%3914.0%4348945.3(P13472) Thymosin beta-10
*	TK251102_lung_cytoE16_2_step01.0619.0619.1	1.7223	0.0935	675.45	3	8000.0%	3	K.NTLPTK.E
UQ9NZM956.2%337.2%8981054337.3(Q9NZM9) Serine/threonine kinase
*	TK251102_lung_cytoE16_2_step08.4233.4233.3	2.0143	0.2512	4029.62	1	1390.0%	1	K.DDPEELFIGLHEIGHGSFGAVYFATNAHTNEVVAIKK.M
	TK251102_lung_cytoE16_2_step12.5392.5392.2	1.0023	0.021	2457.28	4	2140.0%	1	R.NGPLNESQEDEEDSEHGTSLNR.E
	TK251102_lung_cytoE16_2_step04.1621.1621.1	1.7929	0.0224	761.59	3	8000.0%	1	R.EELNKK.R
UQ8VI7556.1%554.7%10821192755.0(Q8VI75) RANBP4
*	TK251102_lung_cytoE16_2_step05.2875.2875.2	1.6631	0.3938	1868.55	1	4060.0%	1	K.QHTDSFHTALGSLPNDK.A
*	TK251102_lung_cytoE16_2_step10.4153.4153.2	1.345	0.0988	1860.44	141	2330.0%	1	R.YVRPDDVSLARMLVPK.V
	TK251102_lung_cytoE16_2_step09.1545.1545.1	0.8265	0.0097	712.5	15	5000.0%	1	R.ERHDR.V
*	TK251102_lung_cytoE16_2_step03.2002.2002.2	1.1757	0.1374	1477.98	1	3330.0%	1	K.LLGLLLPLLARER.H
	TK251102_lung_cytoE16_2_step07.1344.1344.1	0.9191	0.1886	682.54	2	5000.0%	1	R.HDRVR.D
UQ8VHA656.0%61216.5%467507006.0(Q8VHA6) SOCS box protein ASB-18
*	TK251102_lung_cytoE16_2_step08.4993.4993.3	1.5996	0.0581	4374.01	1	1410.0%	1	R.GALHEACLGNHTACARLLLQHGADPDLLNSEGLAPLHLCR.T
*	TK251102_lung_cytoE16_2_step02.3501.3501.3	1.588	0.1903	2663.99	1	2100.0%	1	K.ADPNASPGGRGALHEACLGNHTACAR.L
*	TK251102_lung_cytoE16_2_step04.0040.0040.3	2.7257	0.2208	2854.1	2	2310.0%	3	R.ELLEHGATVQLEGGPGRDTPLHVAAQR.G
UQ9D4X455.6%113.9%152174605.5(Q9D4X4) 4930544L10Rik protein
	TK251102_lung_cytoE16_2_step01.1334.1334.1	1.7943	0.0377	733.52	2	8000.0%	1	K.EKVDLK.R
UQ9D5G155.6%4168.4%154178419.5(Q9D5G1) 4930444P10Rik protein
*	TK251102_lung_cytoE16_2_step04.1384.1384.1	1.3262	0.0764	1533.81	2	3330.0%	4	K.RLLHTDAEIPPIR.I
UCES5_HUMAN55.6%4418.0%423463218.1(Q9BXW7) Cat eye syndrome critical region protein 5 precursor
*	TK251102_lung_cytoE16_2_step05.3216.3216.1	1.4882	0.043	1086.73	27	5000.0%	1	R.VIPAALKAFR.R
*	TK251102_lung_cytoE16_2_step11.4616.4616.2	1.9131	0.26	3049.54	3	2120.0%	1	R.DLCFSPGLMEASHVVNDVNEAVQLVFR.K
*	TK251102_lung_cytoE16_2_step12.2333.2333.3	1.2626	0.1128	2579.17	37	1790.0%	1	R.NVVTVDELRMAFPLLDMVDLER.R
*	TK251102_lung_cytoE16_2_step07.3655.3655.2	1.3197	0.0709	1826.29	26	2810.0%	1	R.VPVVFVTNAGNILQHSK.A
UNME4_MOUSE55.5%798.9%13231429088.3(Q03391) Glutamate [NMDA] receptor subunit epsilon 4 precursor (N-methyl D-aspartate receptor subtype 2D) (NR2D) (NMDAR2D)
*	TK251102_lung_cytoE16_2_step07.2083.2083.2	1.9041	0.2606	1682.12	5	3530.0%	1	R.AKGTGPPGGAALADGFHR.Y
*	TK251102_lung_cytoE16_2_step09.3081.3081.3	1.2001	0.0787	2118.67	3	2240.0%	2	R.YYGPIEPQGLGLGEARAAPR.G
	TK251102_lung_cytoE16_2_step07.1896.1896.3	0.8601	0.0168	1964.71	106	2080.0%	1	R.SPGLDVRPVALVLNGSDPR.S
*	TK251102_lung_cytoE16_2_step10.2311.2311.2	1.4028	0.1669	1416.12	22	3750.0%	1	R.LAFEDESPPAPSR.W
	TK251102_lung_cytoE16_2_step06.4045.4045.2	0.9053	0.0623	2015.83	25	1760.0%	1	R.LAHTIGFSYDLYLVTNGK.H
	TK251102_lung_cytoE16_2_step11.1314.1314.3	1.446	0.0212	3384.82	1	1550.0%	1	K.IDGVWNGMIGEVFYQRADMAIGSLTINEER.S
UPTNB_MOUSE55.4%6612.8%585668167.0(P35235) Protein-tyrosine phosphatase, non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase SYP)
	TK251102_lung_cytoE16_2_step07.4263.4263.3	1.5037	0.0465	3734.74	34	1180.0%	1	K.QESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIR.E
	TK251102_lung_cytoE16_2_step12.2219.2219.1	1.4344	0.1266	1068.91	1	5620.0%	1	R.WFHGHLSGK.E
	TK251102_lung_cytoE16_2_step09.1881.1881.1	1.3643	0.2688	1089.48	1	6250.0%	1	R.KGHEYTNIK.Y
	TK251102_lung_cytoE16_2_step10.3118.3118.1	1.0409	0.0809	852.54	6	5710.0%	1	K.YDVGGGER.F
	TK251102_lung_cytoE16_2_step08.2673.2673.1	0.9741	0.0882	815.55	25	5000.0%	1	K.HGSFLVR.E
	TK251102_lung_cytoE16_2_step07.2167.2167.1	1.1188	0.078	855.81	56	4170.0%	1	K.VTHVMIR.C
UQ96DT655.3%112.0%458524976.0(Q96DT6) Putative autophagy-related cysteine endopeptidase
	TK251102_lung_cytoE16_2_step12.2789.2789.2	1.8598	0.2657	1084.51	2	6250.0%	1	R.FSTEEFVLL.-
UQ9P2P555.1%778.7%15811766505.4(Q9P2P5) Hypothetical protein KIAA1301 (Fragment)
*	TK251102_lung_cytoE16_2_step09.3867.3867.3	1.6825	0.1831	1911.44	1	3170.0%	1	R.DHLLEDAFNQIMGYSR.K
*	TK251102_lung_cytoE16_2_step08.1750.1750.1	1.0009	0.1149	764.44	7	4290.0%	1	K.GYGQGPGK.L
*	TK251102_lung_cytoE16_2_step05.4908.4908.2	1.6967	0.3041	2921.14	1	2040.0%	1	R.AVSETESLDQGSEPSQVSSETEPSDPAR.T
*	TK251102_lung_cytoE16_2_step11.1613.1613.3	1.4177	0.0211	3145.08	1	1830.0%	1	R.ATTPCITVKNPAVMMGAEGMEGGASGNLHSR.K
*	TK251102_lung_cytoE16_2_step01.4059.4059.1	0.8109	0.0932	1277.23	295	2000.0%	1	R.KLVSFTLSDLR.A
*	TK251102_lung_cytoE16_2_step08.4454.4454.2	1.1247	0.0823	1956.89	6	2940.0%	1	R.TSSTLEIDTEELTSTSSR.T
*	TK251102_lung_cytoE16_2_step03.4285.4285.3	1.5524	0.1452	2920.49	71	1600.0%	1	R.LVSVFDARELELVIAGTAEIDLSDWR.N
UACE_MOUSE55.1%331.4%13121509486.6(P09470) Angiotensin-converting enzyme, somatic isoform precursor (EC 3.4.15.1) (ACE) (Dipeptidyl carboxypeptidase I) (Kininase II)
	TK251102_lung_cytoE16_2_step08.0848.0848.1	1.0369	0.0268	566.1	3	8330.0%	1	R.KDFR.I
	TK251102_lung_cytoE16_2_step04.2163.2163.1	0.8408	0.0346	930.34	41	3570.0%	1	R.AILPFFPK.Y
	TK251102_lung_cytoE16_2_step01.2644.2644.1	1.4217	0.2029	889.91	3	5830.0%	1	K.YVEFSNK.I
UGA6S_HUMAN55.0%112.5%522580266.7(P34059) N-acetylgalactosamine-6-sulfatase precursor (EC 3.1.6.4) (N-acetylgalactosamine-6-sulfate sulfatase) (Galactose-6-sulfate sulfatase) (GalNAc6S sulfatase) (Chondroitinsulfatase) (Chondroitinase)
*	TK251102_lung_cytoE16_2_step11.0039.0039.1	1.3464	0.2994	1345.94	1	5000.0%	1	R.GDTLMAATLGQHK.A
UQ9DBE055.0%357.3%493551456.6(Q9DBE0) Adult male liver cDNA, RIKEN full-length enriched library, clone:1300015E02, full insert sequence
*	TK251102_lung_cytoE16_2_step07.2459.2459.1	1.1262	0.0191	955.69	23	5620.0%	1	R.LSQVAPVLK.E
*	TK251102_lung_cytoE16_2_step04.4847.4847.2	1.7174	0.2774	2841.58	1	2500.0%	2	R.TLDGDPVAVEALLQDVFGIVVDEAILK.G
UCOPA_HUMAN55.0%101012.7%12241383317.7(P53621) Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) [Contains: Xenin (Xenopsin-related peptide); Proxenin]
*	TK251102_lung_cytoE16_2_step10.2731.2731.3	1.5634	0.0162	1765.43	148	2320.0%	1	K.VSFLYLITGNLEKLR.K
*	TK251102_lung_cytoE16_2_step05.5085.5085.2	0.9518	0.1321	1239.57	9	3180.0%	1	K.GFFEGTIASKGK.G
*	TK251102_lung_cytoE16_2_step03.3802.3802.1	1.1186	0.0818	1281.02	1	4440.0%	1	K.ALDDKNCWEK.L
*	TK251102_lung_cytoE16_2_step10.1617.1617.1	1.0025	0.0533	697.63	22	5000.0%	1	R.RDHDR.F
*	TK251102_lung_cytoE16_2_step08.2453.2453.2	1.1991	0.0166	2059.28	209	1470.0%	1	K.ETFDPEKETIPDIDPNAK.L
*	TK251102_lung_cytoE16_2_step02.2886.2886.3	1.6031	0.1133	2362.4	59	1970.0%	1	K.LGEVALLQGNHQIVEMCYQR.T
*	TK251102_lung_cytoE16_2_step02.2950.2950.2	1.2509	0.1062	1454.2	86	2920.0%	1	K.QQPLFVSGGDDYK.I
*	TK251102_lung_cytoE16_2_step02.3559.3559.3	1.4178	0.0507	4169.22	14	1140.0%	1	R.CLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIR.V
*	TK251102_lung_cytoE16_2_step08.3081.3081.1	1.2042	0.2322	841.6	1	6670.0%	1	R.MHSLLIK.N
*	TK251102_lung_cytoE16_2_step03.4234.4234.2	1.7015	0.2854	2255.06	1	3500.0%	1	R.GVNWAAFHPTMPLIVSGADDR.Q
UQ9CWN355.0%6813.4%779885308.6(Q9CWN3) 2410016C14Rik protein
*	TK251102_lung_cytoE16_2_step03.3479.3479.3	1.5671	0.0243	2509.99	39	1970.0%	1	R.IYSKEFWSQCMPDHVIPEIK.R
	TK251102_lung_cytoE16_2_step02.4317.4317.3	1.7729	0.2078	4199.52	2	1390.0%	2	R.ENTAYIQAIVKVTMDIHLNEMAGDILVFLTGQFEIEK.S
	TK251102_lung_cytoE16_2_step09.2285.2285.1	1.0795	0.1294	900.62	26	5830.0%	1	R.CLFSAFR.V
*	TK251102_lung_cytoE16_2_step06.2765.2765.2	1.7261	0.2868	1560.2	1	5000.0%	1	K.LHELNAHDLSSVAR.R
	TK251102_lung_cytoE16_2_step02.4229.4229.3	1.1641	0.0523	2922.37	224	1400.0%	1	R.TFCTMDGRGSPVHIHPSSALHEQETK.L
UQ924X955.0%465.8%9341005085.0(Q924X9) Type II cAMP-dependent protein kinase anchoring protein Ht31 (Fragment)
*	TK251102_lung_cytoE16_2_step06.3414.3414.2	1.3075	0.0542	2018.8	8	2350.0%	2	K.THEDTTGQCGAETEEPEK.I
*	TK251102_lung_cytoE16_2_step02.3195.3195.2	0.8754	0.0971	1477.7	3	2920.0%	1	K.QMTPSLPEAFLDK.G
*	TK251102_lung_cytoE16_2_step06.1822.1822.3	1.6503	0.1316	2596.95	1	2160.0%	1	K.QLENAYTESACAFLPGETPQIEK.T
UBRD2_HUMAN54.9%3311.0%801880619.1(P25440) Bromodomain-containing protein 2 (RING3 protein)
	TK251102_lung_cytoE16_2_step11.5060.5060.2	1.6714	0.3214	2210.96	4	2500.0%	1	K.SLHSAGPPLLAVTAAPPAQPLAK.K
	TK251102_lung_cytoE16_2_step09.4667.4667.3	1.3208	0.1832	4242.05	36	1090.0%	1	R.KPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGR.V
	TK251102_lung_cytoE16_2_step07.4608.4608.3	1.6217	0.2214	2009.02	57	1770.0%	1	K.ASGSGGGSAALGPSGFGPSGGSGTK.L
UGDFF_HUMAN54.9%226.8%308341689.6(Q99988) Growth/differentiation factor 15 precursor (GDF-15) (Placental bone morphogenic protein) (Placental TGF-beta) (Macrophage inhibitory cytokine-1) (MIC-1) (Prostate differentiation factor) (NSAID-regulated protein 1) (NRG-1)
	TK251102_lung_cytoE16_2_step11.3292.3292.2	1.6732	0.3228	1828.03	2	3670.0%	1	R.RQLSLARPQAPALHLR.L
	TK251102_lung_cytoE16_2_step08.1525.1525.1	1.0739	0.0791	625.6	1	8750.0%	1	R.LHTVR.A
UITA5_MOUSE54.7%222.8%10531150566.0(P11688) Integrin alpha-5 precursor (Fibronectin receptor alpha subunit) (Integrin alpha-F) (VLA-5) (CD49e)
	TK251102_lung_cytoE16_2_step06.2461.2461.2	0.7134	0.0736	1789.94	106	2000.0%	1	R.AHGSSILACAPLYSWR.T
*	TK251102_lung_cytoE16_2_step03.3335.3335.1	1.3639	0.2351	1411.89	3	3330.0%	1	K.GSRILESSLYSAK.G
UQ96AE754.6%555.0%11411295586.6(Q96AE7) Similar to hypothetical protein FLJ10890
	TK251102_lung_cytoE16_2_step06.2397.2397.1	1.2906	0.1123	876.61	1	6670.0%	1	K.EDPDCIK.A
*	TK251102_lung_cytoE16_2_step03.3162.3162.1	1.472	0.152	1573.69	1	4580.0%	1	R.LGWPSPDECLKLR.W
	TK251102_lung_cytoE16_2_step06.3786.3786.3	0.902	0.0766	2314.86	125	1050.0%	1	K.SSPVAHSILWIWGRDSDAYR.D
	TK251102_lung_cytoE16_2_step10.2169.2169.2	1.3887	0.0562	1080.43	4	5000.0%	1	K.NISGALEAFR.Q
	TK251102_lung_cytoE16_2_step03.2441.2441.1	1.2138	0.1224	811.7	6	5000.0%	1	K.KPKGDHK.K
UQ9GZS054.6%5516.4%605688524.7(Q9GZS0) Dynein axonemal intermediate chain
*	TK251102_lung_cytoE16_2_step06.2310.2310.1	1.4675	0.1484	982.56	5	5000.0%	1	R.ESSIMWTK.Y
*	TK251102_lung_cytoE16_2_step01.4214.4214.1	1.3053	0.121	1461.27	15	3640.0%	1	K.TINVFRDPQEIK.R
*	TK251102_lung_cytoE16_2_step08.2687.2687.3	1.0724	0.0354	1620.45	189	2690.0%	1	K.RAATHLSWHPDGNR.K
*	TK251102_lung_cytoE16_2_step06.4658.4658.3	1.4095	0.0064	2734.66	10	2050.0%	1	K.YHMAYLTDAAWSPVRPTVFFTTR.M
*	TK251102_lung_cytoE16_2_step11.0020.0020.3	1.1809	0.0264	4509.76	8	1160.0%	1	K.EADAIKLTPVPQQPSPEEDQVVEEGEEAAGEEGDEEVEEDLA.-
UQ9CYN854.6%2219.3%145161889.3(Q9CYN8) 5730403H22Rik protein
	TK251102_lung_cytoE16_2_step09.2677.2677.1	1.4717	0.1516	1271.66	5	4500.0%	1	K.KDNQTLSHSLK.M
	TK251102_lung_cytoE16_2_step04.3263.3263.2	0.8518	0.1965	1922.12	22	2810.0%	1	R.HQGLQEKLAEEMLGLAR.S
UQ8TET954.6%113.9%2042143111.2(Q8TET9) FLJ00072 protein (Fragment)
*	TK251102_lung_cytoE16_2_step03.1661.1661.1	1.468	0.1477	993.42	1	5710.0%	1	R.RETGFPER.D
UQ9D51654.6%3312.5%385438808.1(Q9D516) 4930527D15Rik protein
	TK251102_lung_cytoE16_2_step06.4002.4002.3	1.1313	0.036	2416.83	9	1810.0%	1	K.EERWDMEDNEQVLTTEHEK.K
	TK251102_lung_cytoE16_2_step08.2230.2230.1	1.1532	0.0252	813.6	10	5830.0%	1	R.RLAALLR.L
	TK251102_lung_cytoE16_2_step07.3642.3642.2	1.6449	0.3791	2322.11	2	2380.0%	1	K.LCQGRRPPPSSTGTVGDLGIVR.R
UO7049554.5%558.7%89710116711.9(O70495) Plenty-of-prolines-101
*	TK251102_lung_cytoE16_2_step06.4794.4794.1	1.3687	0.0315	1530.04	29	3080.0%	1	R.HRPSSPATPPPKTR.H
	TK251102_lung_cytoE16_2_step12.3075.3075.3	1.7076	0.0841	2699.74	18	2050.0%	1	R.VTEILGFEDDVVIEFIFNQLEVK.N
	TK251102_lung_cytoE16_2_step05.1912.1912.1	1.4423	0.1674	1266.13	5	3890.0%	1	K.QLKFAECLEK.K
*	TK251102_lung_cytoE16_2_step05.3832.3832.2	1.1905	0.0117	2555.48	1	2290.0%	1	K.KPPAPPSPVQSQSPSTNWSPAVPAK.K
	TK251102_lung_cytoE16_2_step10.2519.2519.1	0.9789	0.1074	768.46	9	6000.0%	1	R.RRPSPR.R
UQ9D6U554.5%4620.2%173197596.2(Q9D6U5) 2310057C03Rik protein
	TK251102_lung_cytoE16_2_step09.4108.4108.3	1.8161	0.0339	3023.97	1	2120.0%	1	K.EAQAAMEGLNGQDLMGQPISVDWCFVR.G
	TK251102_lung_cytoE16_2_step06.2638.2638.1	1.4421	0.1592	995.49	1	6430.0%	2	K.NIHLNLDR.R
UQ1625654.4%114.8%1682016510.5(Q16256) WT1
*	TK251102_lung_cytoE16_2_step03.2071.2071.1	1.5847	0.1165	1042.43	1	6430.0%	1	R.FFRSDQLK.R
UQ8TAA054.4%11677.6%778890929.0(Q8TAA0) Similar to PRAM-1 protein, PML-RARA target gene encoding an adaptor molecule-1
*	TK251102_lung_cytoE16_2_step01.5726.5726.3	1.538	0.186	2867.8	12	1670.0%	1	K.TGVCHLRLEPPDTSQVSNLLLYILK.V
*	TK251102_lung_cytoE16_2_step11.4669.4669.3	1.6824	0.0946	2672.65	1	2390.0%	8	R.LEPPDTSQVSNLLLYILKVLDSGR.T
*	TK251102_lung_cytoE16_2_step01.3254.3254.1	0.4615	0.1164	1102.67	29	1250.0%	1	R.ATHEDQKFK.K
*	TK251102_lung_cytoE16_2_step07.2338.2338.2	0.681	0.0069	2089.35	29	1390.0%	1	K.TPVSSLRPEPPETGESHLR.P
UZEP1_HUMAN54.3%13157.7%27172972187.9(P15822) Zinc finger protein 40 (Human immunodeficiency virus type I enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex binding protein 1) (MBP-1) (Positive regulatory domain II binding factor 1) (PRDII-BF1)
*	TK251102_lung_cytoE16_2_step11.2000.2000.1	0.9586	0.1919	1417.87	50	1920.0%	1	K.QNGETPGIIAEASK.S
*	TK251102_lung_cytoE16_2_step10.3407.3407.3	1.3456	0.1199	2693.62	13	1880.0%	1	K.DQKTSAYTDWTVSASNPNPLGLPTK.V
*	TK251102_lung_cytoE16_2_step10.1705.1705.2	0.8267	0.0195	1164.03	31	4440.0%	1	K.QNYIPVKNGK.Q
*	TK251102_lung_cytoE16_2_step01.1728.1728.1	0.6578	0.0494	1316.89	136	1670.0%	1	K.VLNPPAPAGDHAR.L
*	TK251102_lung_cytoE16_2_step10.0006.0006.2	1.0213	0.1044	3015.37	1	1670.0%	1	R.SKSFDCGSITPPQTTPLTELQPPSSPSR.V
*	TK251102_lung_cytoE16_2_step09.4180.4180.2	1.8036	0.2686	2368.35	2	2890.0%	2	R.SDQQHKNIQLQNSHIHLVAR.G
*	TK251102_lung_cytoE16_2_step11.4354.4354.3	2.4027	0.1192	3050.57	5	2070.0%	1	R.LPPAAAEHSPQTAAGMPSVASPHPDPQEQK.Q
*	TK251102_lung_cytoE16_2_step10.5330.5330.2	1.0701	0.1985	3109.62	1	1850.0%	1	R.TDNSECISSHCGTTSPSYTNTAFDVLLK.A
*	TK251102_lung_cytoE16_2_step04.2836.2836.1	1.1518	0.0964	985.81	26	5830.0%	1	K.QRFSYER.S
*	TK251102_lung_cytoE16_2_step06.1354.1354.3	1.0773	0.0362	1487.83	169	2080.0%	1	R.MTVLSTAQSDYNR.K
*	TK251102_lung_cytoE16_2_step11.3137.3137.2	0.692	0.0433	2402.11	2	1580.0%	1	R.LIRQHNIQVPEILVTEEPDR.D
*	TK251102_lung_cytoE16_2_step05.5437.5437.2	1.1273	0.1903	2803.75	1	2400.0%	1	K.SFDCGSITPPQTTPLTELQPPSSPSR.V
UCA1H_HUMAN54.2%446.4%15161538415.7(P39060) Collagen alpha 1(XVIII) chain precursor [Contains: Endostatin]
*	TK251102_lung_cytoE16_2_step07.0012.0012.2	1.0093	0.2072	3099.05	14	1500.0%	1	R.GLELEPGAGLFVAQAGGADPDKFQGVIAELK.V
*	TK251102_lung_cytoE16_2_step06.2692.2692.1	1.03	0.0020	954.47	64	3890.0%	1	R.EGIAGPQGPK.G
*	TK251102_lung_cytoE16_2_step01.3728.3728.3	1.7852	0.063	3293.61	30	1210.0%	1	R.DPQVSPMHCLDEEGDDSDGAFGDSGSGLGDAR.E
*	TK251102_lung_cytoE16_2_step12.2392.2392.2	2.1295	0.1459	2618.63	1	2390.0%	1	R.GTDNEVAALQPPVVQLHDSNPYPR.R
UIM9A_MOUSE54.1%119.0%89103447.2(Q9WV98) Mitochondrial import inner membrane translocase subunit TIM9 A
	TK251102_lung_cytoE16_2_step08.1998.1998.1	1.3973	0.2204	811.57	5	5710.0%	1	K.AGLLGQPR.-
UO7512754.0%71111.1%727812858.4(O75127) Hypothetical protein KIAA0632 (Fragment)
*	TK251102_lung_cytoE16_2_step05.2448.2448.2	1.0798	0.1387	1535.9	17	3640.0%	2	R.MCLDVFKEIIHK.G
*	TK251102_lung_cytoE16_2_step03.0150.0150.3	1.0452	0.0704	2296.53	145	1840.0%	1	R.GLVPNLQTFCNLAIGCHRPK.D
*	TK251102_lung_cytoE16_2_step05.2445.2445.3	2.0128	0.1342	2454.52	1	2380.0%	1	R.LQPMESNYTVLIGGCGRVGYLK.K
*	TK251102_lung_cytoE16_2_step01.2812.2812.1	1.4237	0.1864	1235.88	2	4500.0%	1	R.DSYNLLLVAAR.D
*	TK251102_lung_cytoE16_2_step03.3065.3065.2	1.7001	0.0074	1609.48	26	3330.0%	2	K.LGDLEGAKALLPVLAK.R
UA2HS_HUMAN53.9%3312.5%367393255.7(P02765) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Alpha-2-Z-globulin) (Ba-alpha-2-glycoprotein) (PRO2743)
*	TK251102_lung_cytoE16_2_step08.4199.4199.3	1.461	0.0897	2930.7	117	1600.0%	1	K.SLVLLLCLAQLWGCHSAPHGPGLIYR.Q
*	TK251102_lung_cytoE16_2_step10.2549.2549.1	1.2052	0.0156	813.52	14	5000.0%	1	K.FSVVYAK.C
*	TK251102_lung_cytoE16_2_step01.0571.0571.1	1.5215	0.1291	1466.58	2	4170.0%	1	K.CDSSPDSAEDVRK.V
UTRL3_HUMAN53.9%444.6%10171166816.1(Q9HCF6) Long transient receptor potential channel 3 (LTrpC3) (Fragment)
*	TK251102_lung_cytoE16_2_step11.2237.2237.2	0.9223	0.0837	1726.53	50	2500.0%	1	R.DFGQLAVELLDQSYK.Q
*	TK251102_lung_cytoE16_2_step01.0984.0984.2	0.9442	0.1215	1489.78	14	2080.0%	1	K.LSRTSAFQSFESK.H
*	TK251102_lung_cytoE16_2_step04.1849.1849.2	2.1516	0.033	1414.31	2	5000.0%	1	K.VEDLTCCHPER.E
*	TK251102_lung_cytoE16_2_step06.1826.1826.1	1.402	0.0113	969.66	2	6430.0%	1	R.FNSSNDER.I
UERR2_HUMAN53.9%5524.6%500556198.2(O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor, beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2)
*	TK251102_lung_cytoE16_2_step03.3870.3870.3	1.0093	0.1456	3791.17	15	1210.0%	1	R.QHVHFLTPLPPPPSVAWVGTAQAGYHLEVFLPQR.A
*	TK251102_lung_cytoE16_2_step01.5094.5094.2	2.0145	0.2454	2501.52	1	2950.0%	1	R.LDSESSPYLSLQISPPAKKPLTK.I
*	TK251102_lung_cytoE16_2_step02.5153.5153.3	1.3116	0.0597	4397.16	10	1180.0%	1	K.HIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDK.L
*	TK251102_lung_cytoE16_2_step12.2813.2813.2	0.8331	0.0042	1903.25	39	2190.0%	1	R.KSYEDCASGIMEDSAIK.C
*	TK251102_lung_cytoE16_2_step11.3474.3474.2	0.9791	0.1479	2998.9	2	2200.0%	1	K.SYEDCASGIMEDSAIKCEYMLNAIPK.R
URL27_HUMAN53.9%51310.4%1351566710.6(P08526) 60S ribosomal protein L27
*	TK251102_lung_cytoE16_2_step03.2794.2794.1	1.2684	0.2024	826.71	47	4290.0%	3	K.VVLVLAGR.Y
*	TK251102_lung_cytoE16_2_step08.1747.1747.1	1.1304	0.0713	709.55	7	6000.0%	2	K.FMKPGK.V
UQ9CQZ053.8%2412.4%153173909.6(Q9CQZ0) 0610012C09Rik protein (Similar to HSPC160 protein)
	TK251102_lung_cytoE16_2_step06.3916.3916.2	1.6958	0.2887	2341.47	3	2500.0%	2	R.LLTHWEQMDYGLQFTSSRK.F
USNX1_HUMAN53.7%114.8%522590705.1(Q13596) Sorting nexin 1
*	TK251102_lung_cytoE16_2_step03.4786.4786.2	1.6667	0.3219	3020.24	1	3540.0%	1	K.IEQLHQEQANNDFFLLAELLSDYIR.L
UCDNB_MOUSE53.7%3320.8%197222107.0(P46414) Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)
*	TK251102_lung_cytoE16_2_step04.3091.3091.2	1.8711	0.243	1588.49	1	5000.0%	1	R.QAVPLIGSQANSEDR.H
*	TK251102_lung_cytoE16_2_step12.2993.2993.2	1.622	0.3723	1916.76	1	4640.0%	1	R.KWNFDFQNHKPLEGR.Y
	TK251102_lung_cytoE16_2_step09.3360.3360.2	1.0306	0.0194	1420.23	15	4000.0%	1	K.HCRDMEEASQR.K
UGLUC_MOUSE53.7%3338.3%180209065.6(P55095) Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP); Glucagon; Glucagon-like peptide 1 (GLP1); Glucagon-like peptide 2 (GLP2)]
	TK251102_lung_cytoE16_2_step12.5572.5572.2	1.6275	0.3611	2911.32	1	2000.0%	1	R.HDEFERHAEGTFTSDVSSYLEGQAAK.E
*	TK251102_lung_cytoE16_2_step03.4669.4669.3	1.9406	0.0066	3442.15	1	1900.0%	1	R.HADGSFSDEMSTILDNLATRDFINWLIQTK.I
	TK251102_lung_cytoE16_2_step06.2842.2842.2	1.0375	0.122	1513.71	15	3750.0%	1	K.RHSQGTFTSDYSK.Y
UQ9BYZ453.6%7274.7%12521455737.8(Q9BYZ4) PRTD-NY2
*	TK251102_lung_cytoE16_2_step06.2205.2205.1	1.032	0.0295	840.45	5	5000.0%	5	R.KLQALHK.E
	TK251102_lung_cytoE16_2_step11.2273.2273.3	2.0512	0.2082	2681.52	5	2120.0%	1	R.EAQMTIFGVLFKFWPQFCEFR.K
*	TK251102_lung_cytoE16_2_step08.4401.4401.3	1.3314	0.1336	3798.3	42	1250.0%	1	K.EIYMKIQPPFEDLFDTAEEYILLLLLEPWTK.M
UQ9NZ7153.6%110.9%14001523748.3(Q9NZ71) Helicase-like protein NHL (BK3184A7.3.5) (LOC51750), isoform 5 (Hypothetical protein KIAA1088)
*	TK251102_lung_cytoE16_2_step02.3693.3693.1	1.4027	0.2085	1277.57	2	4090.0%	1	R.SGRNTHLPLAGR.R
UFABB_MOUSE53.6%3290227.5%131147625.6(P51880) Fatty acid-binding protein, brain (B-FABP) (Brain lipid-binding protein) (BLBP)
	TK251102_lung_cytoE16_2_step01.1150.1150.1	0.9889	0.0274	486.61	5	8330.0%	1	K.VVIR.T
*	TK251102_lung_cytoE16_2_step02.2369.2369.2	1.0044	0.0521	1857.96	39	2060.0%	1	R.QVGNVTKPTVIISQEGGK.V
*	TK251102_lung_cytoE16_2_step10.3499.3499.1	0.9509	0.0159	1524.53	1	2690.0%	30	K.MVVTLTFGDIVAVR.C
UQ9CWQ953.5%2214.4%153175458.8(Q9CWQ9) 2410008J01Rik protein
	TK251102_lung_cytoE16_2_step10.2679.2679.2	2.119	0.1504	1098.19	1	8120.0%	1	K.MVVMHPMPR.V
	TK251102_lung_cytoE16_2_step08.4039.4039.2	1.37	0.18	1562.39	1	5000.0%	1	R.TVHSLACLLTQYR.V
UQ9BS4053.3%1116.7%222257695.8(Q9BS40) Latexin protein
	TK251102_lung_cytoE16_2_step05.4845.4845.3	2.7747	0.0269	4472.47	2	1810.0%	1	R.NDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTK.V
UQ6162753.3%335.9%10091122446.7(Q61627) Glutamate receptor delta-1 subunit precursor
	TK251102_lung_cytoE16_2_step08.3378.3378.3	1.0918	0.0105	2313.5	13	1750.0%	1	K.VVTVLEEPFVMVAENILGQPK.R
*	TK251102_lung_cytoE16_2_step05.4259.4259.2	1.9779	0.2436	2621.99	1	3180.0%	1	K.DDRVFQLAVSDLSLNDDILQSEK.I
	TK251102_lung_cytoE16_2_step01.0831.0831.3	1.1832	0.0707	1792.52	33	1830.0%	1	K.STKPWNGGRSMLDTIK.K
UQ9P2B853.3%352.2%17952008534.8(Q9P2B8) Hypothetical protein KIAA1429 (Fragment)
*	TK251102_lung_cytoE16_2_step09.4303.4303.2	1.7815	0.2661	2224.63	5	2630.0%	2	K.ENSGAIEASVKLTELLDLYR.E
*	TK251102_lung_cytoE16_2_step10.2371.2371.3	1.3331	0.0516	2068.18	13	2500.0%	1	R.DSPPPPPPPPPPPQPQPSLK.R
UUBP7_HUMAN53.3%557.8%11021282725.6(Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15) (Ubiquitin thiolesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus associated ubiquitin-specific protease)
*	TK251102_lung_cytoE16_2_step06.3968.3968.3	1.5289	0.1622	2331.15	1	2500.0%	1	K.VTFEVFVQADAPHGVAWDSKK.H
*	TK251102_lung_cytoE16_2_step01.3500.3500.2	0.7818	0.0548	2058.04	20	1880.0%	1	R.LNTDPMLLQFFKSQGYR.D
*	TK251102_lung_cytoE16_2_step04.2597.2597.2	1.78	0.2633	1748.49	1	3930.0%	1	R.VFYELQHSDKPVGTK.K
*	TK251102_lung_cytoE16_2_step04.4337.4337.2	0.9767	0.0321	2586.33	12	2050.0%	1	K.NSSLAEFVQSLSQTMGFPQDQIR.L
*	TK251102_lung_cytoE16_2_step09.1644.1644.2	0.9859	0.0494	1232.2	1	5560.0%	1	K.LRLLEIVSYK.I
UCTNB_MOUSE53.3%448.8%781854715.9(Q02248) Beta-catenin
	TK251102_lung_cytoE16_2_step12.3081.3081.3	1.1912	0.1374	2909.7	49	1150.0%	1	R.IVIRGLNTIPLFVQLLYSPIENIQR.V
	TK251102_lung_cytoE16_2_step02.3943.3943.2	1.4642	0.0649	1900.08	33	2810.0%	1	R.MEEIVEGCTGALHILAR.D
	TK251102_lung_cytoE16_2_step01.3703.3703.1	1.3055	0.2928	1565.96	6	3460.0%	1	K.MMVCQVGGIEALVR.T
	TK251102_lung_cytoE16_2_step10.2787.2787.2	1.777	0.2686	1449.98	2	4580.0%	1	R.NLALCPANHAPLR.E
UQ9CS1253.3%4421.0%385429207.0(Q9CS12) C430040P13Rik protein (Fragment)
	TK251102_lung_cytoE16_2_step02.4111.4111.3	1.2909	0.1267	4778.56	8	1050.0%	1	R.LDYVLGDRALVIDTFQASFLLPEVMGSDHCPVGAVLNVSCVPAK.Q
	TK251102_lung_cytoE16_2_step10.4866.4866.2	2.1451	0.0438	2653.92	2	2500.0%	1	R.DVLTEPLAIVEGYNSYFSFSRSR.S
	TK251102_lung_cytoE16_2_step12.2700.2700.1	1.0875	0.0214	1079.66	91	4380.0%	1	R.ALLTQHKIR.T
*	TK251102_lung_cytoE16_2_step04.1065.1065.1	0.577	0.2213	447.68	4	5000.0%	1	K.SQGGP.-
UQ9C0C453.3%336.6%9631067358.0(Q9C0C4) Hypothetical protein KIAA1739 (Fragment)
*	TK251102_lung_cytoE16_2_step11.0657.0657.3	0.9674	0.1527	2844.01	111	900.0%	1	R.FSQTGIQDFLTLTLTEPTGLLYVGAR.E
*	TK251102_lung_cytoE16_2_step07.3676.3676.3	1.512	0.0269	2711.42	9	2050.0%	1	K.AVSLGPWVHLIEELQLFDQEPMR.S
*	TK251102_lung_cytoE16_2_step03.2801.2801.2	2.1262	0.0283	1682.43	1	4640.0%	1	R.DLPAEQPGSFLYDAR.L
UNX2A_HUMAN53.2%444.4%17121849815.9(Q9P2S2) Neurexin 2-alpha precursor (Neurexin II-alpha)
*	TK251102_lung_cytoE16_2_step11.0108.0108.2	0.5727	0.0512	2321.38	110	1000.0%	1	R.FTLSCAEPATLQLDTPVADDR.W
*	TK251102_lung_cytoE16_2_step12.3952.3952.2	1.6181	0.3521	1927.77	1	3820.0%	1	R.YARWAGAASSGELSFSLR.T
*	TK251102_lung_cytoE16_2_step05.4225.4225.3	1.4718	0.1112	2125.14	2	2220.0%	1	R.WRPTPPPLLLLLLLALAAR.A
*	TK251102_lung_cytoE16_2_step04.2144.2144.2	1.2146	0.1418	2159.03	358	1760.0%	1	R.EGWNRFICDCIGTGFLGR.V
UCOPP_MOUSE53.0%113.8%9051024495.3(O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102)
*	TK251102_lung_cytoE16_2_step11.2005.2005.3	2.3603	0.4931	3668.99	1	1890.0%	1	K.GFQPSRPTAQQEPDGKPASSPVIMASQTTHKEEK.S
UQ9NYU152.9%223.3%15161747606.9(Q9NYU1) UDP-glucose:glycoprotein glucosyltransferase 2 precursor
*	TK251102_lung_cytoE16_2_step05.4113.4113.3	1.8782	0.2042	4287.7	1	1740.0%	1	K.FLDIPESPLLILNMITPEGWLVETVHSNCDLDNIHLK.D
*	TK251102_lung_cytoE16_2_step01.4910.4910.1	1.4974	0.1409	1523.62	2	3750.0%	1	R.NNVVPRINTLILR.T
UACTZ_HUMAN52.8%11837.4%376426146.6(P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1) (P42024) Alpha-centractin (Centractin) (Centrosome-associated actin homolog) (Actin-RPV) (ARP1)
	TK251102_lung_cytoE16_2_step12.2279.2279.2	1.5986	0.4419	2219.87	1	3750.0%	1	R.TLFSNIVLSGGSTLFKGFGDR.L
	TK251102_lung_cytoE16_2_step09.1877.1877.1	0.4493	0.0031	411.4	2	5000.0%	1	K.HVR.V
	TK251102_lung_cytoE16_2_step10.5383.5383.1	0.6295	0.088	429.54	21	3330.0%	9	K.LAPK.D
USHK2_HUMAN52.8%464.5%12531348005.6(Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)
*	TK251102_lung_cytoE16_2_step10.3653.3653.3	2.0981	0.1393	2049.3	1	3820.0%	2	K.MRPSLDAGFPTVTRQNTR.G
*	TK251102_lung_cytoE16_2_step01.2555.2555.1	1.3782	0.2324	1445.27	1	4230.0%	1	K.SAGLLMVHTVDATK.L
*	TK251102_lung_cytoE16_2_step11.2233.2233.3	1.2602	0.0291	2622.41	16	1850.0%	1	K.DKPEEIVPASKPSRAAENMAVEPR.V
UBCKD_MOUSE52.8%5721.1%412465888.9(O55028) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial precursor (EC 2.7.1.115) (Branched-chain alpha-ketoacid dehydrogenase kinase) (BCKDHKIN) (BCKD-kinase)
	TK251102_lung_cytoE16_2_step04.2319.2319.1	1.3711	0.2276	870.9	2	6670.0%	2	R.QLLDDHK.D
	TK251102_lung_cytoE16_2_step12.0739.0739.2	1.0499	0.0438	3116.94	8	1540.0%	1	R.LGIRMLATHHLALHEDKPDFVGIICTR.L
	TK251102_lung_cytoE16_2_step10.5270.5270.2	1.4874	0.0928	2520.63	4	2500.0%	1	R.FPFIPMPLDYILPELLKNAMR.A
*	TK251102_lung_cytoE16_2_step05.3649.3649.3	1.1071	0.0196	3538.97	62	1210.0%	1	K.TVTSFYNQSAIDVAAEKPSVRLTPTMMLYSGR.S
UCLUS_MOUSE52.8%113.6%448516565.7(Q06890) Clusterin precursor (Sulfated glycoprotein 2) (SGP-2) (Clustrin) (Apolipoprotein J) (Apo-J)
*	TK251102_lung_cytoE16_2_step12.3044.3044.2	1.6094	0.3609	1921.99	1	4670.0%	1	R.ELHDPHYFSPIGFPHK.R
UQ9CRW052.6%51113.6%228261465.3(Q9CRW0) 2310026E23Rik protein (Fragment)
*	TK251102_lung_cytoE16_2_step03.0151.0151.1	1.5274	0.1148	869.69	1	6430.0%	3	R.KPSEAAHK.S
*	TK251102_lung_cytoE16_2_step12.3416.3416.1	0.9098	0.0357	1467.37	16	2690.0%	1	R.GPEELGAEPESPPR.A
*	TK251102_lung_cytoE16_2_step07.2571.2571.1	0.8949	0.0157	1124.63	7	3120.0%	1	R.SRLDFDNQK.V
UQ9264452.4%226.0%249277279.1(Q92644) Gonadotropin-releasing hormone receptor
*	TK251102_lung_cytoE16_2_step01.4043.4043.1	1.3354	0.4086	1571.13	3	3570.0%	1	K.NHLHPDTGPSSGPPR.T
UPM34_HUMAN52.4%114.2%3073456710.1(O43808) Peroxisomal membrane protein PMP34 (34 kDa peroxisomal membrane protein) (Solute carrier family 25, member 17)
*	TK251102_lung_cytoE16_2_step03.3183.3183.2	1.6233	0.3348	1412.17	3	5000.0%	1	K.ALWVKGQHSTTGK.D
UAGM1_MOUSE52.4%5510.3%542594536.2(Q9CYR6) Phosphoacetylglucosamine mutase (EC 5.4.2.3) (PAGM) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase)
*	TK251102_lung_cytoE16_2_step05.2888.2888.1	1.7485	0.0594	1431.8	1	4620.0%	1	R.SVKVDCANGIGALK.L
	TK251102_lung_cytoE16_2_step01.1116.1116.1	0.7224	0.0104	616.52	91	5000.0%	1	R.QLKVK.V
	TK251102_lung_cytoE16_2_step12.1141.1141.1	0.8534	0.0062	671.45	30	6250.0%	1	K.HLHHK.A
*	TK251102_lung_cytoE16_2_step10.3186.3186.1	0.9506	0.0419	1486.09	18	1820.0%	1	R.TNAQHLDHIMFR.M
*	TK251102_lung_cytoE16_2_step12.1685.1685.3	1.1626	0.0238	2129.59	7	2240.0%	1	R.SALHAKPQGLILQYGTAGFR.T
UCU32_HUMAN52.4%1110.7%2062136011.2(P57056) Putative protein C21orf32
*	TK251102_lung_cytoE16_2_step09.3712.3712.2	1.5958	0.3657	2164.74	1	2860.0%	1	K.GGVDPTASLLKGGVDPTVSHVR.K
UDDX9_MOUSE52.4%12147.4%13801495826.9(O70133) ATP-dependent RNA helicase A (Nuclear DNA helicase II) (NDH II) (DEAD-box protein 9) (mHEL-5)
*	TK251102_lung_cytoE16_2_step05.2079.2079.2	1.642	0.2522	1085.35	1	5620.0%	1	K.LAHFEPSQR.Q
	TK251102_lung_cytoE16_2_step04.1716.1716.1	1.2673	0.0099	695.46	3	7000.0%	1	R.NALIHK.S
	TK251102_lung_cytoE16_2_step03.2611.2611.1	0.9046	0.0097	826.39	18	5000.0%	1	R.ELLPVKK.F
*	TK251102_lung_cytoE16_2_step11.1026.1026.1	0.7491	0.0879	1071.3	163	2780.0%	1	R.RISAVAVAER.V
*	TK251102_lung_cytoE16_2_step06.1960.1960.1	0.9895	0.033	1119.52	13	4000.0%	1	R.GYGGGYFGQGR.G
	TK251102_lung_cytoE16_2_step04.1817.1817.1	1.4121	0.1173	787.77	2	6670.0%	1	R.KLEAGIR.G
*	TK251102_lung_cytoE16_2_step04.4208.4208.2	0.8664	0.0098	1980.18	57	2190.0%	1	R.QLYHLGCIEAYSGLTKK.K
	TK251102_lung_cytoE16_2_step06.3494.3494.1	1.4036	0.0427	1223.66	1	4500.0%	2	R.TPLHEIALSIK.L
*	TK251102_lung_cytoE16_2_step11.1485.1485.1	1.4229	0.1807	1434.68	1	4090.0%	1	K.HLENNSHFGSHR.Y
	TK251102_lung_cytoE16_2_step07.3423.3423.2	1.9822	0.1724	1464.59	1	6360.0%	1	R.YQILPLHSQIPR.E
UQ9D76852.2%225.1%273307008.9(Q9D768) 2010009L17Rik protein
	TK251102_lung_cytoE16_2_step12.2687.2687.1	1.7641	0.0161	1515.65	1	4230.0%	1	K.DGGGMKTPIQLQLR.R
	TK251102_lung_cytoE16_2_step08.5387.5387.1	0.6321	0.1062	561.68	12	4000.0%	1	K.DGGGMK.T
UQ9DCZ752.2%116.2%339376354.8(Q9DCZ7) WD40 protein Ciao1
	TK251102_lung_cytoE16_2_step08.3630.3630.2	1.6199	0.3257	2384.42	1	3500.0%	1	K.HVVWHPSQELLASASYDDTVK.L
UGRF1_HUMAN52.1%229.4%424480005.7(Q12849) G-rich sequence factor-1 (GRSF-1)
*	TK251102_lung_cytoE16_2_step07.3980.3980.2	1.6433	0.3149	1639.24	4	3750.0%	1	R.ASLLPQSLAAAAAVPTR.S
*	TK251102_lung_cytoE16_2_step05.3896.3896.3	1.1463	0.0493	2814.2	22	1820.0%	1	R.MYMGQRYVEVYEINNEDVDALMK.S
UH11_MOUSE52.1%119.4%2122165410.9(P43275) Histone H1.1 (H1 VAR.3) (H1A)
*	TK251102_lung_cytoE16_2_step12.3689.3689.2	1.6598	0.3005	2014.55	1	3160.0%	1	R.KKPAGPSVSELIVQAVSSSK.E
UQ1517052.0%41022.3%1571830711.2(Q15170) Transcription factor S-II-related protein (PP21)
*	TK251102_lung_cytoE16_2_step01.3932.3932.1	1.2689	0.0147	1254.93	2	4500.0%	3	R.WSTLPKSSPPR.S
	TK251102_lung_cytoE16_2_step08.3811.3811.3	1.5516	0.0237	2731.8	12	2070.0%	1	R.GDIHGRNLSNEEMIQAADELEEMK.R
UO7516252.0%334.3%12081386046.9(O75162) Hypothetical protein KIAA0675
*	TK251102_lung_cytoE16_2_step08.2895.2895.3	1.2908	0.0343	3268.13	7	1470.0%	1	R.EVAANSQNGEEIVPALTLRFLITQLEAALR.N
*	TK251102_lung_cytoE16_2_step04.3417.3417.1	1.7241	0.0597	996.46	4	6430.0%	1	K.LQRQIHAK.D
*	TK251102_lung_cytoE16_2_step06.2996.2996.2	1.0176	0.0617	1642.06	9	3080.0%	1	K.DEYITIENLGASYR.K
UHXK2_MOUSE51.7%333.9%9171025356.1(O08528) Hexokinase type II (EC 2.7.1.1) (HK II)
*	TK251102_lung_cytoE16_2_step11.2053.2053.1	0.6981	0.0145	1237.55	2	2500.0%	1	K.MAKAELLFQGK.L
	TK251102_lung_cytoE16_2_step10.2070.2070.3	1.1641	0.0032	2075.94	57	2500.0%	1	K.GDFLALDLGGTNFRVLLVR.V
*	TK251102_lung_cytoE16_2_step04.1403.1403.1	1.6633	0.0921	724.6	1	8000.0%	1	R.LHKAVR.R
UZ174_HUMAN51.7%113.7%407464559.6(Q15697) Zinc finger protein 174 (AW-1)
*	TK251102_lung_cytoE16_2_step12.2097.2097.2	1.8447	0.244	1744.37	2	3930.0%	1	R.SLSNRLQHLGHQPTR.S
UZRF1_MOUSE51.7%4411.7%514595118.6(P54103) Zuotin related factor-1
	TK251102_lung_cytoE16_2_step02.1343.1343.1	0.6834	0.2452	458.17	6	5000.0%	1	K.NVPK.L
	TK251102_lung_cytoE16_2_step04.3083.3083.3	1.9254	0.1559	2428.58	2	3030.0%	1	K.ELSEESEDEELQLEEFPMLK.T
	TK251102_lung_cytoE16_2_step10.3210.3210.2	1.8305	0.2529	1578.45	1	6540.0%	1	K.NQDHYAVLGLGHVR.Y
	TK251102_lung_cytoE16_2_step11.3538.3538.3	1.3743	0.2316	2459.53	1	2020.0%	1	K.LCDRLELASLQGLNEILASSTR.E
URS28_HUMAN51.6%1117.4%69784110.7(P25112) 40S ribosomal protein S28 (P25112) 40S ribosomal protein S28
	TK251102_lung_cytoE16_2_step01.3767.3767.1	1.3378	0.2471	1362.1	1	5450.0%	1	R.EGDVLTLLESER.E
UQ9CX9851.6%4105.6%501573218.0(Q9CX98) 8430436A10Rik protein
*	TK251102_lung_cytoE16_2_step10.3813.3813.2	1.8	0.1179	2482.78	7	2140.0%	3	R.APSLTDKAQMPYTEATIMEVQR.L
*	TK251102_lung_cytoE16_2_step07.1431.1431.1	1.3796	0.1777	658.49	1	7000.0%	1	R.HFGLGK.L
UNO56_MOUSE51.6%5516.7%580644499.1(Q9D6Z1) Nucleolar protein Nop56 (Nucleolar protein 5A)
*	TK251102_lung_cytoE16_2_step09.4604.4604.3	1.2751	5.0E-4	2793.54	18	1600.0%	1	R.LAALALASSENSSTPEECEEVNEKSK.K
*	TK251102_lung_cytoE16_2_step10.4357.4357.3	1.1411	0.0516	4631.9	8	1120.0%	1	-.MVLLHVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGK.F
	TK251102_lung_cytoE16_2_step01.2196.2196.1	1.4283	0.1604	1233.89	3	5560.0%	1	R.QSLHTYLRSK.M
*	TK251102_lung_cytoE16_2_step07.0079.0079.2	0.8336	0.2126	1715.5	62	1670.0%	1	K.EAVVQAEEAAAEITRK.L
	TK251102_lung_cytoE16_2_step01.0499.0499.1	0.5597	0.0016	416.29	5	6670.0%	1	K.SSPK.E
UPLD1_HUMAN51.6%335.3%10741241848.8(Q13393) Phospholipase D1 (EC 3.1.4.4) (PLD 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D1) (hPLD1)
*	TK251102_lung_cytoE16_2_step10.2789.2789.3	2.0423	0.2471	2526.25	185	1700.0%	1	K.LFHPSSESEQGLTRPHADTGSIR.S
*	TK251102_lung_cytoE16_2_step01.2394.2394.1	1.4311	0.1653	1565.97	1	3460.0%	1	K.EVELALGINSEYTK.R
*	TK251102_lung_cytoE16_2_step01.5770.5770.3	1.1456	0.0562	2246.37	1	1840.0%	1	R.FGSYAAIQENALAKWYVNAK.G
UQ9WVN651.5%228.3%315355608.9(Q9WVN6) MOR 5'beta3 (Olfactory receptor MOR1-2)
	TK251102_lung_cytoE16_2_step11.4622.4622.3	2.6725	0.2169	3057.29	2	2000.0%	1	R.SHVLSHAFCLHQDVIKLACADITFNR.L
UCC37_MOUSE51.5%448.2%379445935.3(Q61081) Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37)
	TK251102_lung_cytoE16_2_step01.5743.5743.1	0.9464	0.0959	914.51	5	5000.0%	1	R.QFFTKIK.T
	TK251102_lung_cytoE16_2_step11.2872.2872.1	0.8995	0.0254	1045.58	24	4290.0%	1	K.TFVEKYEK.Q
	TK251102_lung_cytoE16_2_step02.1613.1613.1	1.0549	0.0382	1033.56	7	5000.0%	1	K.SMVNTKPEK.A
*	TK251102_lung_cytoE16_2_step12.2244.2244.2	2.0224	0.2317	899.81	1	9170.0%	1	K.HFGMLHR.W
UPKL1_HUMAN51.4%7911.6%9421039906.3(Q16512) Protein kinase C-like 1 (EC 2.7.1.-) (Protein-kinase C-related kinase 1) (Protein kinase C-like PKN) (Serine-threonine protein kinase N)
*	TK251102_lung_cytoE16_2_step09.4793.4793.3	1.4837	0.2015	4608.03	1	1280.0%	2	R.LDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTCSATNLSR.V
*	TK251102_lung_cytoE16_2_step09.2857.2857.3	1.1979	0.0884	2996.68	63	1480.0%	1	R.SWSLLEQLGLAGADLAAPGVQQQLELER.E
*	TK251102_lung_cytoE16_2_step01.2022.2022.3	1.5634	0.1346	4165.55	5	1180.0%	1	-.MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELER.E
*	TK251102_lung_cytoE16_2_step06.2478.2478.3	1.1702	0.0063	3281.04	1	1550.0%	1	R.SWSLLEQLGLAGADLAAPGVQQQLELERER.L
	TK251102_lung_cytoE16_2_step07.1915.1915.1	1.0516	0.1069	758.69	121	4170.0%	1	K.KGDIVAR.D
*	TK251102_lung_cytoE16_2_step04.3125.3125.2	1.5705	0.3447	1796.98	1	4690.0%	1	R.LLREELAAASSAAFSTR.L
UR22A_MOUSE51.3%1142.9%4956665.1(P35285) Ras-related protein Rab-22A (RAB-14) (Fragment)
	TK251102_lung_cytoE16_2_step10.3337.3337.2	1.6001	0.3181	2330.75	1	3500.0%	1	R.FVEDSFDPNINPTIGASFMTK.T
UREST_HUMAN51.1%555.2%14271609895.4(P30622) Restin (Cytoplasmic linker protein-170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament associated protein)
*	TK251102_lung_cytoE16_2_step09.1300.1300.1	0.373	0.0225	658.0	9	2000.0%	1	K.QADKAK.A
*	TK251102_lung_cytoE16_2_step08.2270.2270.2	2.092	0.2127	1384.61	2	5450.0%	1	K.HLEIEKNAESSK.A
*	TK251102_lung_cytoE16_2_step12.5180.5180.3	1.2591	0.0173	2992.05	4	1920.0%	1	R.RLESNKPAGDVDMSLSLLQEISSLQEK.L
*	TK251102_lung_cytoE16_2_step10.1661.1661.3	1.2979	0.113	1767.68	14	2500.0%	1	K.ELLTVENQKMEEFR.K
*	TK251102_lung_cytoE16_2_step08.4059.4059.2	1.5502	0.1301	1785.8	5	4290.0%	1	R.EENSGLLQELEELRK.Q
UQ9Z10451.0%5528.7%317358709.3(Q9Z104) SMARCE1-related protein (HMG domain protein HMGX2) (High mobility group 20 B)
	TK251102_lung_cytoE16_2_step02.4291.4291.3	1.3427	0.2155	4463.64	78	850.0%	1	R.TLALQQQLQAVRQALTASFASLPVPGTGETPTLGTLDFYMAR.L
	TK251102_lung_cytoE16_2_step03.2639.2639.1	1.4713	0.1331	869.73	1	5000.0%	1	K.KILPNGPK.A
	TK251102_lung_cytoE16_2_step10.4294.4294.2	1.0037	0.0364	1834.08	59	2190.0%	1	K.KEDSSSGLMNTLLNGHK.G
*	TK251102_lung_cytoE16_2_step03.3647.3647.2	1.1409	0.153	1693.19	6	2650.0%	1	-.MSHGPRQPGAATAPAGGK.T
*	TK251102_lung_cytoE16_2_step01.0550.0550.1	0.9106	5.0E-4	687.39	3	5000.0%	1	K.LQPAEK.Q
UQ9GZW250.9%1120.8%130136827.0(Q9GZW2) Hypothetical protein FLJ23544
*	TK251102_lung_cytoE16_2_step10.3103.3103.2	1.7938	0.2467	2728.96	5	2120.0%	1	K.TGAAASCVLQGAPDAFPLGLEVDLVPR.A
UQ91Y5850.9%668.6%10641237698.6(Q91Y58) DNA-dependent ATPase SNF2L
*	TK251102_lung_cytoE16_2_step12.2123.2123.3	1.5285	0.0127	2490.5	119	1790.0%	1	R.EEAIDAFNAPNSSKFIFMLSTR.A
*	TK251102_lung_cytoE16_2_step01.3167.3167.1	0.7897	0.0208	1527.0	2	3330.0%	1	K.QKLGTVEWIEPPK.R
	TK251102_lung_cytoE16_2_step06.2224.2224.1	0.62	0.0766	795.69	33	4170.0%	1	K.IYLGLSK.M
*	TK251102_lung_cytoE16_2_step02.3774.3774.2	1.6803	0.2839	1837.57	1	3530.0%	1	-.MEPDTATEAATVAVSDAR.A
	TK251102_lung_cytoE16_2_step04.2117.2117.2	1.4794	0.0267	925.33	4	7140.0%	1	R.IGQKKPVR.V
	TK251102_lung_cytoE16_2_step07.0112.0112.2	0.7795	0.0558	2692.15	91	1360.0%	1	R.NIPGPHMVLVPKSTLHNWMNEFK.R
UQ96IJ650.9%112.6%420462917.2(Q96IJ6) GDP-mannose pyrophosphorylase A
*	TK251102_lung_cytoE16_2_step07.4034.4034.1	1.4378	0.1531	1359.76	2	5500.0%	1	R.YQDTHPERLAK.H
UQ96DK150.8%247.3%372427038.8(Q96DK1) Hypothetical protein FLJ25287
*	TK251102_lung_cytoE16_2_step12.4739.4739.2	1.5918	0.028	3005.19	17	1350.0%	2	R.GEQQGSMENEPVALEETQKTDPAMEPR.F
UQ8WUF050.8%2215.2%276305807.2(Q8WUF0) Nit protein 2
	TK251102_lung_cytoE16_2_step06.4290.4290.2	1.0028	0.0724	2000.43	7	2650.0%	1	R.LALIQLQISSIKSDNVTR.A
	TK251102_lung_cytoE16_2_step12.5493.5493.2	1.6247	0.3001	2568.22	2	2170.0%	1	K.LSEVAKECSIYLIGGSIPEEDAGK.L
UQ8TF2450.8%113.4%384404917.5(Q8TF24) Hypothetical protein KIAA1978 (Fragment)
*	TK251102_lung_cytoE16_2_step12.2947.2947.2	1.7391	0.2599	1575.38	1	4580.0%	1	R.CFLVYSERTGQSK.G
UQ99MR950.7%463.9%10891214655.1(Q99MR9) Type 1 protein phosphatase targeting subunit RGL/GM
*	TK251102_lung_cytoE16_2_step02.2686.2686.2	0.9927	0.0143	1289.8	2	6000.0%	1	K.ETAFDPHEGRK.D
*	TK251102_lung_cytoE16_2_step11.2572.2572.1	1.7649	0.0477	981.82	8	6670.0%	2	K.RDFYHSR.S
*	TK251102_lung_cytoE16_2_step05.3612.3612.2	1.0301	0.0191	2731.57	44	1740.0%	1	K.NFQSVFQTQEGHMGYPKISTEGDK.A
UPSB4_MOUSE50.7%4417.8%264291165.7(P99026) Proteasome subunit beta type 4 precursor (EC 3.4.25.1) (Proteasome beta chain) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome chain 3)
*	TK251102_lung_cytoE16_2_step01.2316.2316.2	1.3156	0.2356	1570.94	1	3210.0%	1	R.AGHWAGGPAPGQFYR.I
	TK251102_lung_cytoE16_2_step08.3157.3157.2	1.7595	0.1567	983.85	1	7860.0%	1	R.AIHSWLTR.A
*	TK251102_lung_cytoE16_2_step01.5216.5216.2	1.6271	0.2994	2603.1	1	2610.0%	1	K.GVEIEGPLSAQTNWDIAHMISGFE.-
UCTNS_MOUSE50.7%116.5%367422038.8(P57757) Cystinosin
*	TK251102_lung_cytoE16_2_step09.3281.3281.3	2.6504	0.2261	3003.09	1	2070.0%	1	K.FGLGVFTIFFDVVFFIQHFYLYRK.K
UQ9D3S550.7%2213.1%366416666.4(Q9D3S5) 4933437F05Rik protein
*	TK251102_lung_cytoE16_2_step09.3275.3275.2	1.5552	0.2224	1722.2	58	3000.0%	1	R.GTCPYNNLGGVILNVK.W
*	TK251102_lung_cytoE16_2_step03.3431.3431.3	2.6277	0.2251	3791.08	1	1690.0%	1	K.LLLPMHLESCTTDPESCPQFNLTDFMSKSYVK.N
UZO2_MOUSE50.7%443.9%11671316166.8(Q9Z0U1) Tight junction protein ZO-2 (Zonula occludens 2 protein) (Zona occludens 2 protein) (Tight junction protein 2)
*	TK251102_lung_cytoE16_2_step06.2024.2024.3	1.6699	0.0796	1786.15	3	3500.0%	1	K.RPVVLFGPIADIAMER.L
*	TK251102_lung_cytoE16_2_step11.2736.2736.2	2.1039	0.1793	1898.22	5	3210.0%	1	-.MEEVIWEQYTVTLQK.D
	TK251102_lung_cytoE16_2_step01.5954.5954.1	0.6273	0.0879	794.57	29	4000.0%	1	R.YRDTEL.-
	TK251102_lung_cytoE16_2_step02.1675.1675.1	0.946	0.0197	947.41	65	4380.0%	1	R.MGATPTPFK.S
UQ96DU750.6%151973.5%683752075.1(Q96DU7) Inositol 1,4,5-trisphosphate 3-kinase C
*	TK251102_lung_cytoE16_2_step07.4607.4607.2	1.0516	0.1642	2080.92	79	1880.0%	1	R.YMQWRETMSSTSTLGFR.I
*	TK251102_lung_cytoE16_2_step06.2481.2481.1	1.1851	0.0192	940.62	13	5000.0%	14	R.ERPRPRK.D
UQ9JJ6350.5%558.9%752827305.3(Q9JJ63) Brain cDNA, clone MNCb-4173
*	TK251102_lung_cytoE16_2_step08.2463.2463.3	1.2866	0.1003	2130.24	1	2500.0%	1	-.MSSGSSLGSLASSRGSLNTSSR.G
*	TK251102_lung_cytoE16_2_step05.3312.3312.2	1.0065	0.1171	1816.13	73	2140.0%	1	R.SQTFSPGERSQYICR.L
	TK251102_lung_cytoE16_2_step07.2011.2011.1	1.7255	0.0376	887.53	1	7500.0%	1	R.QKLEELK.A
*	TK251102_lung_cytoE16_2_step10.1442.1442.3	1.2499	0.0779	2000.39	11	1880.0%	1	R.TKVHPPTESVLYNDVFR.V
	TK251102_lung_cytoE16_2_step06.1262.1262.1	0.7519	0.0712	785.94	145	5000.0%	1	R.QHPFVR.N
UUBL1_MOUSE50.5%113.1%223248385.2(Q9R0P9) Ubiquitin carboxyl-terminal hydrolase isozyme L1 (EC 3.4.19.12) (UCH-L1) (Ubiquitin thiolesterase L1) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5)
	TK251102_lung_cytoE16_2_step07.2011.2011.1	1.7255	0.0376	887.53	1	7500.0%	1	K.KQIEELK.G
UQ8WXA650.5%110.3%23162625165.4(Q8WXA6) AF15q14 isoform 2
*	TK251102_lung_cytoE16_2_step07.2011.2011.1	1.7255	0.0376	887.53	1	7500.0%	1	R.QKIEELK.L
UQ9P2F650.2%553.5%11941330158.0(Q9P2F6) Hypothetical protein KIAA1391 (Fragment)
*	TK251102_lung_cytoE16_2_step01.1007.1007.1	0.8093	0.0108	644.4	8	6250.0%	1	K.MSHLR.D
*	TK251102_lung_cytoE16_2_step01.1830.1830.1	1.0125	0.0061	800.62	3	7000.0%	1	K.YNNNFK.I
*	TK251102_lung_cytoE16_2_step02.1497.1497.1	1.034	0.1309	795.7	49	4290.0%	1	R.LAGGSCTK.K
*	TK251102_lung_cytoE16_2_step02.2157.2157.1	0.8411	0.011	1136.63	430	3000.0%	1	K.QSLVTGTDVSK.K
*	TK251102_lung_cytoE16_2_step11.2804.2804.1	1.3963	0.1826	1520.8	3	3640.0%	1	R.RCSEPNIEDQNR.K
UQ8R3L850.2%2221.8%147162366.5(Q8R3L8) Hypothetical 16.2 kDa protein
	TK251102_lung_cytoE16_2_step09.4432.4432.2	1.0868	0.3017	2281.9	1	3000.0%	1	K.VRVVPPTTTSGGLIMTSDYQR.S
*	TK251102_lung_cytoE16_2_step10.3666.3666.1	1.6857	0.0814	1365.76	1	5500.0%	1	R.EFLTEEEPDEK.G
UQ9D8N850.2%118.1%209233066.4(Q9D8N8) 1810054D07Rik protein
*	TK251102_lung_cytoE16_2_step06.3390.3390.2	1.5888	0.3111	1899.07	1	3750.0%	1	K.SGLEECAEALNLFLSNK.F
UT10A_HUMAN50.1%226.6%468500617.0(O00220) Tumor necrosis factor receptor superfamily member 10A precursor (Death receptor 4) (TNF-related apoptosis-inducing ligand receptor 1) (TRAIL receptor-1) (TRAIL-R1)
*	TK251102_lung_cytoE16_2_step11.0092.0092.2	0.9416	0.0728	1842.13	11	2860.0%	1	K.FANIVPFDSWDQLMR.Q
*	TK251102_lung_cytoE16_2_step01.2339.2339.1	1.743	0.0907	1569.6	8	3330.0%	1	R.AGTAGPGDALYAMLMK.W
UQ9H84550.1%61214.3%621687608.0(Q9H845) Hypothetical protein FLJ13950
*	TK251102_lung_cytoE16_2_step07.3963.3963.3	1.5812	0.0883	2971.31	4	1850.0%	1	K.VWITNGGLANIFTVFAKTEVVDSDGSVK.D
*	TK251102_lung_cytoE16_2_step08.3410.3410.3	2.4133	0.3809	4017.19	1	1590.0%	3	K.EVFPFPEVSQDELNEINQFLGPVEKFFTEEVDSR.K
*	TK251102_lung_cytoE16_2_step08.2914.2914.3	1.8606	0.2977	2776.26	2	1920.0%	1	K.LASGEHIAAFCLTEPASGSDAASIRSR.A
UQ6228550.0%111.7%642708404.9(Q62285) Uromodulin
*	TK251102_lung_cytoE16_2_step05.1805.1805.1	1.4088	0.1761	1414.65	2	4000.0%	1	R.FRCGNFIDQTR.V
ProteinsPeptide IDsCopies
Unfiltered219745226253478
Filtered13151049974667