RBB7_MOUSE - (Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7) || Number of peptides = 6 || ambiguous || 99.6% Confident
PSD3_MOUSE - (P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9QYF4 - (Q9QYF4) SYNCRIP protein || Number of peptides = 5 || ambiguous || 99.6% Confident
SERA_MOUSE - (Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) || Number of peptides = 4 || unambiguous || 99.6% Confident
O55201 - (O55201) Chromatin structural protein homolog Supt5hp (Similar to suppressor of Ty (S.cerevisiae) 5 homolog) || Number of peptides = 6 || unambiguous || 99.6% Confident
AMPL_MOUSE - (Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) || Number of peptides = 7 || unambiguous || 99.6% Confident
O75433 - (O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog) || Number of peptides = 4 || unambiguous || 99.6% Confident
CNBP_MOUSE - (P53996) Cellular nucleic acid binding protein (CNBP) || Number of peptides = 7 || ambiguous || 99.6% Confident
TCPQ_MOUSE - (P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta) || Number of peptides = 15 || unambiguous || 99.6% Confident
ARF1_HUMAN - (P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 || Number of peptides = 15 || ambiguous || 99.6% Confident
KPY1_HUMAN - (P14618) Pyruvate kinase, M1 isozyme (EC 2.7.1.40) (Pyruvate kinase muscle isozyme) (Cytosolic thyroid hormone-binding protein) (CTHBP) (THBP1) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9CY82 - (Q9CY82) 5730420M11Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
DYL1_HUMAN - (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) || Number of peptides = 7 || ambiguous || 99.6% Confident
TALI_MOUSE - (P26039) Talin || Number of peptides = 24 || unambiguous || 99.6% Confident
G3P_MOUSE - (P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) || Number of peptides = 104 || unambiguous || 99.6% Confident
UBA1_MOUSE - (Q02053) Ubiquitin-activating enzyme E1 1 || Number of peptides = 22 || unambiguous || 99.6% Confident
DEST_MOUSE - (Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) || Number of peptides = 8 || unambiguous || 99.6% Confident
PUR9_MOUSE - (Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] || Number of peptides = 13 || unambiguous || 99.6% Confident
DHCA_MOUSE - (P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) || Number of peptides = 9 || unambiguous || 99.6% Confident
FBL1_MOUSE - (Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q8R574 - (Q8R574) Phosphoribosyl pyrophosphate synthetase-associated protein 2 || Number of peptides = 2 || ambiguous || 99.6% Confident
UBP5_MOUSE - (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) || Number of peptides = 8 || unambiguous || 99.6% Confident
K22E_HUMAN - (P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e) || Number of peptides = 11 || unambiguous || 99.6% Confident
6PGD_MOUSE - (Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) || Number of peptides = 7 || ambiguous || 99.6% Confident
MCM3_MOUSE - (P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q924M4 - (Q924M4) RANBP9 isoform 1 || Number of peptides = 8 || ambiguous || 99.6% Confident
IMD2_MOUSE - (P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) || Number of peptides = 17 || ambiguous || 99.6% Confident
NDKA_MOUSE - (P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) || Number of peptides = 18 || unambiguous || 99.6% Confident
RS3A_MOUSE - (P97351) 40S ribosomal protein S3a || Number of peptides = 18 || ambiguous || 99.6% Confident
O88306 - (O88306) DJ-1 || Number of peptides = 7 || ambiguous || 99.6% Confident
RL2A_MOUSE - (P14115) 60S ribosomal protein L27a (L29) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q9CR86 - (Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) || Number of peptides = 7 || unambiguous || 99.6% Confident
ITH2_MOUSE - (Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) || Number of peptides = 6 || unambiguous || 99.6% Confident
P2AA_MOUSE - (P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) || Number of peptides = 5 || ambiguous || 99.6% Confident
Q63182 - (Q63182) Transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C) (Elongation factor SIII P15 subunit) (2610301I15RIK protein) (2610043E24RIK protein) || Number of peptides = 5 || ambiguous || 99.6% Confident
VINC_MOUSE - (Q64727) Vinculin (Metavinculin) || Number of peptides = 10 || unambiguous || 99.6% Confident
O35945 - (O35945) Aldehyde dehydrogenase Ahd-2-like || Number of peptides = 2 || unambiguous || 99.6% Confident
HDGF_MOUSE - (P51859) Hepatoma-derived growth factor (HDGF) || Number of peptides = 6 || ambiguous || 99.6% Confident
HBB1_MOUSE - (P02088) Hemoglobin beta-1 chain (B1) (Major) || Number of peptides = 41 || unambiguous || 99.6% Confident
PRO1_MOUSE - (P10924) Profilin I || Number of peptides = 39 || unambiguous || 99.6% Confident
Q9DCG9 - (Q9DCG9) 0610038D11Rik protein || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9DAB4 - (Q9DAB4) 1700015E05Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
MCM4_MOUSE - (P49717) DNA replication licensing factor MCM4 (CDC21 homolog) (P1-CDC21) || Number of peptides = 6 || ambiguous || 99.6% Confident
GBLP_HUMAN - (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) || Number of peptides = 27 || ambiguous || 99.6% Confident
G3B2_MOUSE - (P97379) Ras-GTPase-activating protein binding protein 2 (GAP SH3-domain binding protein 2) (G3BP-2) || Number of peptides = 3 || ambiguous || 99.6% Confident
HMG2_MOUSE - (P30681) High mobility group protein 2 (HMG-2) || Number of peptides = 21 || unambiguous || 99.6% Confident
Q9D6F9 - (Q9D6F9) Tubulin, beta 4 || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9QZM0 - (Q9QZM0) PLIC-2 || Number of peptides = 3 || unambiguous || 99.6% Confident
AOP2_MOUSE - (O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) || Number of peptides = 2 || ambiguous || 99.6% Confident
GFA1_MOUSE - (P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) || Number of peptides = 13 || unambiguous || 99.6% Confident
TRFE_MOUSE - (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) || Number of peptides = 60 || unambiguous || 99.6% Confident
ANX6_MOUSE - (P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II) || Number of peptides = 17 || unambiguous || 99.6% Confident
ADHA_MOUSE - (P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) || Number of peptides = 19 || unambiguous || 99.6% Confident
ZYX_MOUSE - (Q62523) Zyxin || Number of peptides = 5 || unambiguous || 99.6% Confident
RL6_MOUSE - (P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) || Number of peptides = 18 || unambiguous || 99.6% Confident
Q9CRY5 - (Q9CRY5) 3010001M15Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 99.6% Confident
R10A_MOUSE - (P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) || Number of peptides = 19 || ambiguous || 99.6% Confident
MCM6_MOUSE - (P97311) DNA replication licensing factor MCM6 (Mis5 homolog) || Number of peptides = 12 || unambiguous || 99.6% Confident
TCPE_MOUSE - (P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) || Number of peptides = 22 || unambiguous || 99.6% Confident
Q8VCQ8 - (Q8VCQ8) Similar to caldesmon 1 || Number of peptides = 7 || unambiguous || 99.6% Confident
Q60817 - (Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q91W83 - (Q91W83) Putative TAT protein (Transactivating regulatory protein) || Number of peptides = 8 || ambiguous || 99.6% Confident
PSE2_MOUSE - (P97372) Proteasome activator complex subunit 2 (Proteasome activator 28-beta subunit) (PA28beta) (PA28b) (Activator of multicatalytic protease subunit 2) (11S regulator complex beta subunit) (REG-beta) || Number of peptides = 1 || ambiguous || 99.6% Confident
RL5_MOUSE - (P47962) 60S ribosomal protein L5 || Number of peptides = 16 || unambiguous || 99.6% Confident
VAA1_MOUSE - (P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q91VI8 - (Q91VI8) Similar to ubiquilin 2 (Fragment) || Number of peptides = 1 || ambiguous || 99.6% Confident
FETA_MOUSE - (P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) || Number of peptides = 174 || unambiguous || 99.6% Confident
PPCE_MOUSE - (Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) || Number of peptides = 17 || unambiguous || 99.6% Confident
RS16_MOUSE - (P14131) 40S ribosomal protein S16 || Number of peptides = 4 || ambiguous || 99.6% Confident
RL4_MOUSE - (Q9D8E6) 60S ribosomal protein L4 (L1) || Number of peptides = 16 || ambiguous || 99.6% Confident
DPY3_MOUSE - (Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein) || Number of peptides = 2 || ambiguous || 99.6% Confident
HS47_MOUSE - (P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) || Number of peptides = 4 || unambiguous || 99.6% Confident
ROK_MOUSE - (Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) || Number of peptides = 20 || ambiguous || 99.6% Confident
Q8R1K5 - (Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q99LJ3 - (Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) || Number of peptides = 5 || ambiguous || 99.6% Confident
LDHL_HUMAN - (Q9BYZ2) L-lactate dehydrogenase A-like (EC 1.1.1.27) || Number of peptides = 4 || unambiguous || 99.6% Confident
CLI1_MOUSE - (Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) || Number of peptides = 5 || unambiguous || 99.6% Confident
O89112 - (O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
143G_HUMAN - (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 15 || ambiguous || 99.6% Confident
G3P1_HUMAN - (P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) || Number of peptides = 9 || unambiguous || 99.6% Confident
MK_MOUSE - (P12025) Midkine precursor (Retinoic acid-induced differentiation factor) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q99K51 - (Q99K51) Hypothetical 70.7 kDa protein || Number of peptides = 7 || ambiguous || 99.6% Confident
HBE_MOUSE - (P02104) Hemoglobin epsilon-Y2 chain || Number of peptides = 27 || unambiguous || 99.6% Confident
STN1_MOUSE - (P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) || Number of peptides = 14 || unambiguous || 99.6% Confident
UBC7_HUMAN - (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) || Number of peptides = 13 || ambiguous || 99.6% Confident
MYHB_MOUSE - (O08638) Myosin heavy chain, smooth muscle isoform (SMMHC) || Number of peptides = 19 || ambiguous || 99.6% Confident
HBB0_MOUSE - (P04443) Hemoglobin beta-H0 chain || Number of peptides = 8 || ambiguous || 99.6% Confident
Q8VDP4 - (Q8VDP4) Hypothetical 112.5 kDa protein (Fragment) || Number of peptides = 6 || unambiguous || 99.6% Confident
TCP1_MOUSE - (P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) || Number of peptides = 11 || unambiguous || 99.6% Confident
O00429 - (O00429) Dynamin-like protein || Number of peptides = 9 || ambiguous || 99.6% Confident
U5S1_MOUSE - (O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q922Y7 - (Q922Y7) Unknown (Protein for MGC:6388) || Number of peptides = 21 || ambiguous || 99.6% Confident
H33_HUMAN - (P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q) (P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9QZF4 - (Q9QZF4) Cytoplasmic linker protein 50 || Number of peptides = 2 || ambiguous || 99.6% Confident
RL7A_MOUSE - (P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) || Number of peptides = 17 || ambiguous || 99.6% Confident
HBA_MOUSE - (P01942) Hemoglobin alpha chain || Number of peptides = 71 || unambiguous || 99.6% Confident
Q921R2 - (Q921R2) Similar to ribosomal protein S13 || Number of peptides = 12 || ambiguous || 99.6% Confident
Q9D1P4 - (Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) || Number of peptides = 6 || unambiguous || 99.6% Confident
CLP2_MOUSE - (Q08093) Calponin H2, smooth muscle || Number of peptides = 5 || unambiguous || 99.6% Confident
Q8VDD5 - (Q8VDD5) Nonmuscle heavy chain myosin II-A || Number of peptides = 24 || unambiguous || 99.6% Confident
Q9JHU9 - (Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1) || Number of peptides = 5 || unambiguous || 99.6% Confident
GSHC_MOUSE - (P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase) || Number of peptides = 3 || unambiguous || 99.6% Confident
HS74_MOUSE - (Q61316) Heat shock 70-related protein APG-2 || Number of peptides = 4 || ambiguous || 99.6% Confident
ACTB_HUMAN - (P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) || Number of peptides = 260 || ambiguous || 99.6% Confident
143E_HUMAN - (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) || Number of peptides = 24 || ambiguous || 99.6% Confident
PTPA_MOUSE - (P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) || Number of peptides = 8 || unambiguous || 99.6% Confident
ST13_MOUSE - (Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) || Number of peptides = 7 || unambiguous || 99.6% Confident
RL7_MOUSE - (P14148) 60S ribosomal protein L7 || Number of peptides = 22 || ambiguous || 99.6% Confident
Q99JW9 - (Q99JW9) Similar to alpha-coatomer protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
LKHA_MOUSE - (P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q8VHX8 - (Q8VHX8) Filamin A (Fragment) || Number of peptides = 1 || unambiguous || 99.6% Confident
ENOA_MOUSE - (P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) || Number of peptides = 156 || unambiguous || 99.6% Confident
PUR2_MOUSE - (Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)] || Number of peptides = 14 || unambiguous || 99.6% Confident
TBA1_HUMAN - (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) || Number of peptides = 211 || ambiguous || 99.6% Confident
IF36_HUMAN - (Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6) (Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6) || Number of peptides = 4 || ambiguous || 99.6% Confident
ENPL_MOUSE - (P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) || Number of peptides = 9 || unambiguous || 99.6% Confident
143F_MOUSE - (P11576) 14-3-3 protein eta (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 2 || ambiguous || 99.6% Confident
TEBP_MOUSE - (Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9WU78 - (Q9WU78) ALG-2 interacting protein AIP1 || Number of peptides = 4 || ambiguous || 99.6% Confident
IF5A_HUMAN - (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) || Number of peptides = 45 || ambiguous || 99.6% Confident
RL8_HUMAN - (P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8 || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9QZE7 - (Q9QZE7) Translin associated protein X (Translin-associated factor X) || Number of peptides = 3 || unambiguous || 99.6% Confident
SPS1_HUMAN - (P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1) || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9QZE5 - (Q9QZE5) Coat protein gamma-cop (Coatomer protein complex, subunit gamma 1) || Number of peptides = 3 || unambiguous || 99.6% Confident
HS9A_MOUSE - (P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) || Number of peptides = 110 || unambiguous || 99.6% Confident
TF1B_MOUSE - (Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) || Number of peptides = 20 || unambiguous || 99.6% Confident
RSP4_MOUSE - (P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor) || Number of peptides = 6 || ambiguous || 99.6% Confident
UBCI_HUMAN - (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) || Number of peptides = 7 || ambiguous || 99.6% Confident
FLNA_HUMAN - (P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) || Number of peptides = 56 || unambiguous || 99.6% Confident
Q922D8 - (Q922D8) Similar to C1-tetrahydrofolate synthase || Number of peptides = 16 || unambiguous || 99.6% Confident
IF3A_MOUSE - (P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin) || Number of peptides = 17 || unambiguous || 99.6% Confident
CYTB_MOUSE - (Q62426) Cystatin B (Stefin B) || Number of peptides = 9 || unambiguous || 99.6% Confident
IMB1_MOUSE - (P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG) || Number of peptides = 7 || unambiguous || 99.6% Confident
EF11_MOUSE - (P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) || Number of peptides = 216 || ambiguous || 99.6% Confident
MLEN_MOUSE - (Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
IF4G_HUMAN - (Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) || Number of peptides = 6 || unambiguous || 99.6% Confident
IF42_MOUSE - (P10630) Eukaryotic initiation factor 4A-II (eIF-4A-II) (eIF4A-II) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9Z0P5 - (Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) || Number of peptides = 1 || ambiguous || 99.6% Confident
ACLY_MOUSE - (Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) || Number of peptides = 12 || unambiguous || 99.6% Confident
PSD1_HUMAN - (Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) || Number of peptides = 5 || unambiguous || 99.6% Confident
SYS_MOUSE - (P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) || Number of peptides = 7 || unambiguous || 99.6% Confident
MDHC_MOUSE - (P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) || Number of peptides = 4 || ambiguous || 99.6% Confident
PPP4_HUMAN - (P33172) Serine/threonine protein phosphatase 4 (EC 3.1.3.16) (Pp4) (Protein phosphatase X) (PP-X) (P33172) Serine/threonine protein phosphatase 4 (EC 3.1.3.16) (Pp4) (Protein phosphatase X) (PP-X) || Number of peptides = 2 || ambiguous || 99.6% Confident
H2AZ_HUMAN - (P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9Z1N5 - (Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1) || Number of peptides = 1 || ambiguous || 99.6% Confident
TCPH_MOUSE - (P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q921M7 - (Q921M7) Similar to hypothetical protein DKFZp566A1524 || Number of peptides = 2 || ambiguous || 99.6% Confident
NTF2_HUMAN - (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) || Number of peptides = 10 || ambiguous || 99.6% Confident
APA1_MOUSE - (Q00623) Apolipoprotein A-I precursor (Apo-AI) || Number of peptides = 15 || unambiguous || 99.6% Confident
Q922K2 - (Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment) || Number of peptides = 6 || unambiguous || 99.6% Confident
TBA1_MOUSE - (P02551) Tubulin alpha-1 chain || Number of peptides = 6 || ambiguous || 99.6% Confident
Q99K88 - (Q99K88) Hypothetical 38.1 kDa protein || Number of peptides = 13 || ambiguous || 99.6% Confident
PDX2_MOUSE - (Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) || Number of peptides = 42 || unambiguous || 99.6% Confident
Q8VCM7 - (Q8VCM7) Similar to fibrinogen, gamma polypeptide || Number of peptides = 5 || ambiguous || 99.6% Confident
PSDB_HUMAN - (O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) || Number of peptides = 15 || unambiguous || 99.6% Confident
RL32_HUMAN - (P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32 || Number of peptides = 9 || ambiguous || 99.6% Confident
IRE1_MOUSE - (P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q9Z1R2 - (Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) || Number of peptides = 9 || unambiguous || 99.6% Confident
K6PL_MOUSE - (P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) || Number of peptides = 12 || unambiguous || 99.6% Confident
RS23_HUMAN - (P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23 || Number of peptides = 11 || ambiguous || 99.6% Confident
Q91V86 - (Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9NWP1 - (Q9NWP1) Hypothetical protein FLJ20707 || Number of peptides = 1 || unambiguous || 99.6% Confident
RS1A_HUMAN - (P39027) 40S ribosomal protein S15a || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9EPL8 - (Q9EPL8) RanBP7/importin 7 || Number of peptides = 4 || ambiguous || 99.6% Confident
PAB1_MOUSE - (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q8VCI5 - (Q8VCI5) Peroxisomal farnesylated protein || Number of peptides = 2 || unambiguous || 99.6% Confident
O35737 - (O35737) Heterogeneous nuclear ribonucleoprotein H || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9D1L0 - (Q9D1L0) Ethanol induced 6 || Number of peptides = 1 || unambiguous || 99.6% Confident
LA_MOUSE - (P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9CY40 - (Q9CY40) Hemoglobin, beta adult major chain || Number of peptides = 16 || ambiguous || 99.6% Confident
K1CI_HUMAN - (P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9) || Number of peptides = 11 || unambiguous || 99.6% Confident
AAC4_MOUSE - (P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) || Number of peptides = 9 || ambiguous || 99.6% Confident
TAG2_MOUSE - (Q9WVA4) Transgelin 2 || Number of peptides = 8 || unambiguous || 99.6% Confident
HBBZ_MOUSE - (P04444) Hemoglobin beta-H1 chain (Z protein) || Number of peptides = 3 || unambiguous || 99.6% Confident
PE15_MOUSE - (Q62048) Astrocytic phosphoprotein PEA-15 || Number of peptides = 9 || ambiguous || 99.6% Confident
PRSX_HUMAN - (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) || Number of peptides = 7 || ambiguous || 99.6% Confident
O70140 - (O70140) Calcyclin binding protein (Fragment) || Number of peptides = 17 || unambiguous || 99.6% Confident
Q9CRK7 - (Q9CRK7) 9430095H01Rik protein (Fragment) || Number of peptides = 14 || ambiguous || 99.6% Confident
PRS8_HUMAN - (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) || Number of peptides = 6 || ambiguous || 99.6% Confident
Q9CSH0 - (Q9CSH0) 2810036L13Rik protein (Fragment) || Number of peptides = 9 || ambiguous || 99.6% Confident
TBB3_MOUSE - (Q9ERD7) Tubulin beta-3 || Number of peptides = 6 || ambiguous || 99.6% Confident
SYD_MOUSE - (Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) || Number of peptides = 12 || unambiguous || 99.6% Confident
FKB1_MOUSE - (P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) || Number of peptides = 13 || unambiguous || 99.6% Confident
G6PI_MOUSE - (P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) || Number of peptides = 10 || unambiguous || 99.6% Confident
TCPG_MOUSE - (P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin) || Number of peptides = 10 || unambiguous || 99.6% Confident
Q9CZD2 - (Q9CZD2) 2810018A15Rik protein || Number of peptides = 8 || ambiguous || 99.6% Confident
Q99KQ2 - (Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) || Number of peptides = 30 || unambiguous || 99.6% Confident
Q9CQ16 - (Q9CQ16) Ribosomal protein L27a (Ribosmal protein L27a) || Number of peptides = 2 || ambiguous || 99.6% Confident
ALFA_MOUSE - (P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) || Number of peptides = 9 || unambiguous || 99.6% Confident
143Z_MOUSE - (P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) || Number of peptides = 13 || unambiguous || 99.6% Confident
Q9D663 - (Q9D663) 0 day neonate skin cDNA, RIKEN full-length enriched library, clone:4632427M03, full insert sequence || Number of peptides = 4 || unambiguous || 99.6% Confident
LGUL_MOUSE - (Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) || Number of peptides = 4 || ambiguous || 99.6% Confident
ACTA_HUMAN - (P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) || Number of peptides = 64 || ambiguous || 99.6% Confident
Q9D0E1 - (Q9D0E1) 2610023M21Rik protein || Number of peptides = 2 || unambiguous || 99.6% Confident
LDHA_MOUSE - (P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) || Number of peptides = 37 || unambiguous || 99.6% Confident
DCUP_MOUSE - (P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD) || Number of peptides = 1 || unambiguous || 99.6% Confident
FSC1_HUMAN - (Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) || Number of peptides = 15 || ambiguous || 99.6% Confident
ALBU_MOUSE - (P07724) Serum albumin precursor || Number of peptides = 86 || unambiguous || 99.6% Confident
TKT_MOUSE - (P40142) Transketolase (EC 2.2.1.1) (TK) (P68) || Number of peptides = 28 || unambiguous || 99.6% Confident
RL30_HUMAN - (P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 || Number of peptides = 9 || ambiguous || 99.6% Confident
Q91YZ8 - (Q91YZ8) Hypothetical 67.9 kDa protein || Number of peptides = 4 || ambiguous || 99.6% Confident
PCB1_HUMAN - (Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) || Number of peptides = 9 || unambiguous || 99.6% Confident
RL15_MOUSE - (Q9CZM2) 60S ribosomal protein L15 || Number of peptides = 13 || unambiguous || 99.6% Confident
Q921J0 - (Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) || Number of peptides = 10 || ambiguous || 99.6% Confident
COF1_MOUSE - (P18760) Cofilin, non-muscle isoform || Number of peptides = 103 || unambiguous || 99.6% Confident
PSE1_MOUSE - (P97371) Proteasome activator complex subunit 1 (Proteasome activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) || Number of peptides = 2 || unambiguous || 99.6% Confident
O08972 - (O08972) Hypothetical 25.4 kDa protein || Number of peptides = 1 || ambiguous || 99.6% Confident
Q9CVB6 - (Q9CVB6) 2210023N03Rik protein (Fragment) || Number of peptides = 8 || ambiguous || 99.6% Confident
Q923D2 - (Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein) || Number of peptides = 1 || unambiguous || 99.6% Confident
Q9DCC4 - (Q9DCC4) 1110058B13Rik protein || Number of peptides = 2 || ambiguous || 99.6% Confident
IF41_HUMAN - (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) || Number of peptides = 23 || ambiguous || 99.6% Confident
TERA_MOUSE - (Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] || Number of peptides = 26 || ambiguous || 99.6% Confident
RL21_MOUSE - (O09167) 60S ribosomal protein L21 || Number of peptides = 10 || unambiguous || 99.6% Confident
PIMT_MOUSE - (P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) || Number of peptides = 2 || ambiguous || 99.6% Confident
A2HS_MOUSE - (P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) || Number of peptides = 10 || unambiguous || 99.6% Confident
PRSA_MOUSE - (O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1) || Number of peptides = 6 || ambiguous || 99.6% Confident
PDX5_MOUSE - (P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) || Number of peptides = 2 || unambiguous || 99.6% Confident
RB5B_HUMAN - (P35239) Ras-related protein Rab-5B (P35239) Ras-related protein Rab-5B || Number of peptides = 2 || ambiguous || 99.6% Confident
Q922P1 - (Q922P1) RIKEN cDNA 2010012F05 gene || Number of peptides = 3 || ambiguous || 99.6% Confident
COPP_MOUSE - (O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) || Number of peptides = 5 || ambiguous || 99.6% Confident
HP28_HUMAN - (Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q91WK2 - (Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD) || Number of peptides = 5 || unambiguous || 99.6% Confident
MPK2_MOUSE - (Q63932) Dual specificity mitogen-activated protein kinase kinase 2 (EC 2.7.1.-) (MAP kinase kinase 2) (MAPKK 2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK2) || Number of peptides = 2 || unambiguous || 99.6% Confident
RL24_HUMAN - (P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30) || Number of peptides = 6 || ambiguous || 99.6% Confident
S24B_HUMAN - (O95487) Protein transport protein Sec24B (SEC24-related protein B) || Number of peptides = 1 || unambiguous || 99.6% Confident
RFA2_MOUSE - (Q62193) Replication protein A 32 kDa subunit (RP-A) (RF-A) (Replication factor-A protein 2) || Number of peptides = 4 || unambiguous || 99.6% Confident
K2C1_HUMAN - (P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) || Number of peptides = 13 || unambiguous || 99.6% Confident
MIF_MOUSE - (P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) || Number of peptides = 6 || unambiguous || 99.6% Confident
EF2_MOUSE - (P58252) Elongation factor 2 (EF-2) || Number of peptides = 97 || unambiguous || 99.6% Confident
RS7_HUMAN - (P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) || Number of peptides = 7 || ambiguous || 99.6% Confident
HS7C_MOUSE - (P08109) Heat shock cognate 71 kDa protein || Number of peptides = 121 || unambiguous || 99.6% Confident
O35499 - (O35499) Nuclear autoantigenic sperm protein || Number of peptides = 26 || unambiguous || 99.6% Confident
O09132 - (O09132) A6 gene product || Number of peptides = 6 || ambiguous || 99.6% Confident
TPIS_MOUSE - (P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) || Number of peptides = 18 || unambiguous || 99.6% Confident
PL10_MOUSE - (P16381) Putative ATP-dependent RNA helicase PL10 || Number of peptides = 12 || unambiguous || 99.6% Confident
Q8VEE9 - (Q8VEE9) Similar to proteasome (Prosome, macropain) 26S subunit, non-ATPase, 5 || Number of peptides = 3 || unambiguous || 99.6% Confident
TBBX_HUMAN - (P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain || Number of peptides = 160 || ambiguous || 99.6% Confident
MCM7_MOUSE - (Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) || Number of peptides = 16 || unambiguous || 99.6% Confident
Q9DAR7 - (Q9DAR7) 1700001E16Rik protein (RIKEN cDNA 1700001E16 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
O00301 - (O00301) KSRP || Number of peptides = 10 || unambiguous || 99.6% Confident
CSE1_MOUSE - (Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) || Number of peptides = 9 || ambiguous || 99.6% Confident
LAS1_MOUSE - (Q61792) LIM and SH3 domain protein 1 (LASP-1) (MLN 50) || Number of peptides = 7 || ambiguous || 99.6% Confident
HBB2_MOUSE - (P02089) Hemoglobin beta-2 chain (B2) (Minor) || Number of peptides = 7 || unambiguous || 99.6% Confident
RIR1_MOUSE - (P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain) || Number of peptides = 14 || unambiguous || 99.6% Confident
WDR1_HUMAN - (O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1) || Number of peptides = 5 || unambiguous || 99.6% Confident
TCPB_MOUSE - (P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) || Number of peptides = 27 || ambiguous || 99.6% Confident
HXB5_MOUSE - (P09079) Homeobox protein Hox-B5 (Hox-2.1) (MU-1) (H24.1) || Number of peptides = 1 || ambiguous || 99.6% Confident
Q921L0 - (Q921L0) Similar to phosphatidylinositol binding clathrin assembly protein || Number of peptides = 3 || ambiguous || 99.6% Confident
Q9CSP7 - (Q9CSP7) 2700017M01Rik protein (Fragment) || Number of peptides = 3 || ambiguous || 99.6% Confident
R23B_MOUSE - (P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58) || Number of peptides = 6 || unambiguous || 99.6% Confident
Q9D0K4 - (Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase) || Number of peptides = 3 || unambiguous || 99.6% Confident
CABA_MOUSE - (Q99020) CARG-binding factor-A (CBF-A) || Number of peptides = 8 || ambiguous || 99.6% Confident
NPM_MOUSE - (Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38) || Number of peptides = 5 || ambiguous || 99.6% Confident
CGC8_MOUSE - (Q9D187) Hypothetical protein CGI-128 homolog || Number of peptides = 1 || ambiguous || 99.6% Confident
MAP4_MOUSE - (P27546) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 10 || unambiguous || 99.6% Confident
WDRC_MOUSE - (Q9JJA4) WD-repeat protein 12 (YTM1 homolog) || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9CQM9 - (Q9CQM9) Thioredoxin-like 2 || Number of peptides = 9 || unambiguous || 99.6% Confident
RS3_MOUSE - (P17073) 40S ribosomal protein S3 || Number of peptides = 25 || unambiguous || 99.6% Confident
WDR1_MOUSE - (O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) || Number of peptides = 7 || unambiguous || 99.6% Confident
Q9D7G0 - (Q9D7G0) 2310010D17Rik protein || Number of peptides = 7 || ambiguous || 99.6% Confident
ALDR_MOUSE - (P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) || Number of peptides = 13 || ambiguous || 99.6% Confident
Q8VBT9 - (Q8VBT9) RIKEN cDNA 1190006K01 gene (Similar to alveolar soft part sarcoma chromosome region, candidate 1) || Number of peptides = 2 || unambiguous || 99.6% Confident
Q9CWK1 - (Q9CWK1) 2410026J11Rik protein || Number of peptides = 1 || ambiguous || 99.6% Confident
GIPC_MOUSE - (Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) || Number of peptides = 4 || unambiguous || 99.6% Confident
HS9B_MOUSE - (P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) || Number of peptides = 91 || ambiguous || 99.6% Confident
PDX1_MOUSE - (P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) || Number of peptides = 34 || unambiguous || 99.6% Confident
CRKL_MOUSE - (P47941) Crk-like protein || Number of peptides = 3 || ambiguous || 99.6% Confident
HS71_HUMAN - (P08107) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) || Number of peptides = 4 || unambiguous || 99.6% Confident
VIME_MOUSE - (P20152) Vimentin || Number of peptides = 11 || unambiguous || 99.6% Confident
Q8R016 - (Q8R016) Similar to bleomycin hydrolase || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9D1A2 - (Q9D1A2) 0610010E05Rik protein (RIKEN cDNA 0610010E05 gene) || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9R0C4 - (Q9R0C4) Intermediate filament protein nestin || Number of peptides = 10 || unambiguous || 99.6% Confident
R37A_HUMAN - (P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a || Number of peptides = 12 || ambiguous || 99.6% Confident
DDB1_HUMAN - (Q16531) DNA damage binding protein 1 (Damage-specific DNA binding protein 1) (DDB p127 subunit) (DDBa) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (Xeroderma pigmentosum group E complementing protein) (XPCe) (X-associated protein 1) (XAP-1) || Number of peptides = 2 || unambiguous || 99.6% Confident
CYPH_MOUSE - (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) || Number of peptides = 46 || unambiguous || 99.6% Confident
Q9CYG6 - (Q9CYG6) 5730478E03Rik protein || Number of peptides = 5 || ambiguous || 99.6% Confident
Q9DAW9 - (Q9DAW9) 1600014M03Rik protein || Number of peptides = 10 || ambiguous || 99.6% Confident
NDKB_MOUSE - (Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18) || Number of peptides = 13 || unambiguous || 99.6% Confident
FKB4_MOUSE - (P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) || Number of peptides = 15 || unambiguous || 99.6% Confident
HBAZ_MOUSE - (P06467) Hemoglobin zeta chain || Number of peptides = 48 || unambiguous || 99.6% Confident
Q9D107 - (Q9D107) 2010015D08Rik protein || Number of peptides = 3 || ambiguous || 99.6% Confident
PMG1_MOUSE - (Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) || Number of peptides = 17 || ambiguous || 99.6% Confident
P137_MOUSE - (Q60865) GPI-anchored protein p137 (p137GPI) || Number of peptides = 2 || unambiguous || 99.6% Confident
APT_MOUSE - (P08030) Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q9CQ60 - (Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
APA4_MOUSE - (P06728) Apolipoprotein A-IV precursor (Apo-AIV) || Number of peptides = 11 || unambiguous || 99.6% Confident
KPY2_MOUSE - (P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) || Number of peptides = 118 || unambiguous || 99.6% Confident
Q9CWI5 - (Q9CWI5) Ribosomal protein L15 || Number of peptides = 7 || ambiguous || 99.6% Confident
SH3L_MOUSE - (Q9JJU8) SH3 domain-binding glutamic acid-rich-like protein || Number of peptides = 4 || unambiguous || 99.6% Confident
VDP_MOUSE - (Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment) || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9CR16 - (Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9CWI4 - (Q9CWI4) Esterase 10 || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9EQR0 - (Q9EQR0) Fatty acid synthase || Number of peptides = 34 || unambiguous || 99.6% Confident
TRXB_MOUSE - (Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR) || Number of peptides = 10 || unambiguous || 99.6% Confident
TCPD_MOUSE - (P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) || Number of peptides = 15 || unambiguous || 99.6% Confident
GTP1_MOUSE - (P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) || Number of peptides = 7 || ambiguous || 99.6% Confident
PCB2_MOUSE - (Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) || Number of peptides = 5 || ambiguous || 99.6% Confident
GAL1_MOUSE - (Q9R0N0) Galactokinase (EC 2.7.1.6) (Galactose kinase) || Number of peptides = 4 || unambiguous || 99.6% Confident
ZIN_MOUSE - (P58404) Zinedin || Number of peptides = 2 || unambiguous || 99.6% Confident
DYHC_MOUSE - (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) || Number of peptides = 24 || unambiguous || 99.6% Confident
RAN_HUMAN - (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) || Number of peptides = 35 || ambiguous || 99.6% Confident
CAN2_MOUSE - (O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80) || Number of peptides = 11 || unambiguous || 99.6% Confident
Q9DCB7 - (Q9DCB7) 3100001N19Rik protein || Number of peptides = 4 || ambiguous || 99.6% Confident
Q9CXZ2 - (Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence || Number of peptides = 3 || ambiguous || 99.6% Confident
NED4_MOUSE - (P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) || Number of peptides = 24 || unambiguous || 99.6% Confident
CLH1_HUMAN - (Q00610) Clathrin heavy chain 1 (CLH-17) || Number of peptides = 42 || unambiguous || 99.6% Confident
LEG1_MOUSE - (P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) || Number of peptides = 12 || ambiguous || 99.6% Confident
Q91VW3 - (Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3 || Number of peptides = 1 || unambiguous || 99.6% Confident
HMG1_MOUSE - (P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) || Number of peptides = 69 || ambiguous || 99.6% Confident
Q9UEV9 - (Q9UEV9) Actin-binding protein homolog ABP-278 || Number of peptides = 12 || ambiguous || 99.6% Confident
RLA0_MOUSE - (P14869) 60S acidic ribosomal protein P0 (L10E) || Number of peptides = 9 || unambiguous || 99.6% Confident
RHOA_MOUSE - (Q9QUI0) Transforming protein RhoA || Number of peptides = 9 || ambiguous || 99.6% Confident
PDI_MOUSE - (P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) || Number of peptides = 17 || ambiguous || 99.6% Confident
SODC_MOUSE - (P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) || Number of peptides = 14 || unambiguous || 99.6% Confident
Q9CQ99 - (Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) || Number of peptides = 4 || unambiguous || 99.6% Confident
Q99PC3 - (Q99PC3) CGI-74-like SR-rich protein || Number of peptides = 6 || ambiguous || 99.6% Confident
ENOB_HUMAN - (P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) || Number of peptides = 18 || unambiguous || 99.6% Confident
Q9EPZ2 - (Q9EPZ2) ELAC2 || Number of peptides = 1 || unambiguous || 99.6% Confident
PSB6_MOUSE - (Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y) || Number of peptides = 10 || unambiguous || 99.6% Confident
MY9B_HUMAN - (Q13459) Myosin IXb (Unconventional myosin-9b) || Number of peptides = 6 || unambiguous || 99.6% Confident
T172_HUMAN - (O14981) TBP-associated factor 172 (TAF-172) (TAF(II)170) || Number of peptides = 4 || unambiguous || 99.6% Confident
CAP1_MOUSE - (P40124) Adenylyl cyclase-associated protein 1 (CAP 1) || Number of peptides = 14 || unambiguous || 99.6% Confident
PGK1_MOUSE - (P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) || Number of peptides = 24 || unambiguous || 99.6% Confident
YB1_MOUSE - (P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) || Number of peptides = 10 || ambiguous || 99.6% Confident
Q8VDM4 - (Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2) || Number of peptides = 15 || unambiguous || 99.6% Confident
Q921Q5 - (Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1 || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9WV39 - (Q9WV39) Damage-specific DNA binding protein 1 || Number of peptides = 5 || ambiguous || 99.6% Confident
RL1X_MOUSE - (P11249) 60S ribosomal protein L18a || Number of peptides = 15 || ambiguous || 99.6% Confident
PSA5_MOUSE - (Q9Z2U1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome zeta chain) (EC 3.4.25.1) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) || Number of peptides = 4 || unambiguous || 99.6% Confident
PSD4_MOUSE - (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) || Number of peptides = 8 || unambiguous || 99.6% Confident
Q91VH9 - (Q91VH9) Eukaryotic translation termination factor 1 || Number of peptides = 3 || ambiguous || 99.6% Confident
RS29_HUMAN - (P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 || Number of peptides = 2 || ambiguous || 99.6% Confident
Q9NXW1 - (Q9NXW1) Hypothetical protein FLJ20030 || Number of peptides = 3 || unambiguous || 99.6% Confident
Q9CSM4 - (Q9CSM4) 60S ribosomal protein L27 (Fragment) || Number of peptides = 4 || ambiguous || 99.6% Confident
DJA1_MOUSE - (P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) || Number of peptides = 6 || ambiguous || 99.5% Confident
ANM1_MOUSE - (Q9JIF0) Protein arginine N-methyltransferase 1 (EC 2.1.1.-) || Number of peptides = 13 || ambiguous || 99.5% Confident
P2G4_MOUSE - (P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) || Number of peptides = 9 || ambiguous || 99.5% Confident
ENOA_HUMAN - (P06733) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase) || Number of peptides = 3 || unambiguous || 99.5% Confident
PHS2_MOUSE - (Q9WUB3) Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) || Number of peptides = 4 || ambiguous || 99.5% Confident
FKB3_MOUSE - (Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) || Number of peptides = 1 || unambiguous || 99.5% Confident
O15250 - (O15250) Aminopeptidase P-like (EC 3.4.11.9) (XAA-PRO aminopeptidase) (X-PRO aminopeptidase) (Proline aminopeptidase) (Aminoacylproline aminopeptidase) (Soluble aminopeptidase P) || Number of peptides = 1 || unambiguous || 99.5% Confident
ATOX_MOUSE - (O08997) Copper transport protein ATOX1 (Metal transport protein ATX1) || Number of peptides = 1 || unambiguous || 99.5% Confident
RADI_MOUSE - (P26043) Radixin || Number of peptides = 3 || ambiguous || 99.5% Confident
Q8R3C0 - (Q8R3C0) Similar to hypothetical protein FLJ13081 || Number of peptides = 9 || unambiguous || 99.5% Confident
Q8VDW0 - (Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family || Number of peptides = 6 || unambiguous || 99.4% Confident
H4_HUMAN - (P02304) Histone H4 (P02304) Histone H4 || Number of peptides = 5 || ambiguous || 99.4% Confident
RS4_HUMAN - (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) || Number of peptides = 27 || ambiguous || 99.4% Confident
THIO_MOUSE - (P10639) Thioredoxin (ATL-derived factor) (ADF) || Number of peptides = 10 || unambiguous || 99.4% Confident
IF37_MOUSE - (O70194) Eukaryotic translation initiation factor 3 subunit 7 (eIF-3 zeta) (eIF3 p66) || Number of peptides = 2 || ambiguous || 99.4% Confident
FSC1_MOUSE - (Q61553) Fascin (Singed-like protein) || Number of peptides = 15 || unambiguous || 99.4% Confident
PIG1_HUMAN - (P19174) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1 (EC 3.1.4.11) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9CQ92 - (Q9CQ92) 2010003O14Rik protein (RIKEN cDNA 2010003O14 gene) || Number of peptides = 3 || unambiguous || 99.4% Confident
RO60_MOUSE - (O08848) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP) || Number of peptides = 3 || unambiguous || 99.4% Confident
PRS6_MOUSE - (P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21) || Number of peptides = 5 || ambiguous || 99.4% Confident
BTF3_MOUSE - (Q64152) Transcription factor BTF3 (RNA polymerase B transcription factor 3) || Number of peptides = 7 || ambiguous || 99.4% Confident
RL17_MOUSE - (Q9CPR4) 60S ribosomal protein L17 (L23) || Number of peptides = 6 || ambiguous || 99.4% Confident
MCA1_MOUSE - (P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] || Number of peptides = 1 || ambiguous || 99.4% Confident
PSA3_MOUSE - (O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) || Number of peptides = 6 || ambiguous || 99.4% Confident
Q9D4W4 - (Q9D4W4) 6330577E15Rik protein || Number of peptides = 1 || unambiguous || 99.4% Confident
ICAL_MOUSE - (P51125) Calpain inhibitor (Calpastatin) || Number of peptides = 5 || unambiguous || 99.4% Confident
PUR6_MOUSE - (Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)] || Number of peptides = 8 || unambiguous || 99.4% Confident
Q99J99 - (Q99J99) Similar to thiosulfate sulfurtransferase (Rhodanese) || Number of peptides = 4 || unambiguous || 99.4% Confident
Q9Z1K1 - (Q9Z1K1) HS1 binding protein 3 || Number of peptides = 3 || unambiguous || 99.4% Confident
Q99LE6 - (Q99LE6) Similar to ATP-binding cassette, sub-family F (GCN20), member 2 || Number of peptides = 3 || ambiguous || 99.4% Confident
PSD7_MOUSE - (P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) || Number of peptides = 12 || ambiguous || 99.4% Confident
2A5E_MOUSE - (Q61151) Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon isoform (PP2A, B subunit, B' epsilon isoform) (PP2A, B subunit, B56 epsilon isoform) (PP2A, B subunit, PR61 epsilon isoform) (PP2A, B subunit, R5 epsilon isoform) (Fragment) || Number of peptides = 3 || ambiguous || 99.4% Confident
PUR1_HUMAN - (Q06203) Amidophosphoribosyltransferase precursor (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (ATASE) (GPAT) || Number of peptides = 2 || unambiguous || 99.4% Confident
G25B_HUMAN - (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) || Number of peptides = 6 || ambiguous || 99.4% Confident
IF32_MOUSE - (Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1) || Number of peptides = 8 || ambiguous || 99.4% Confident
Q9D7G7 - (Q9D7G7) 0710008K08Rik protein || Number of peptides = 2 || ambiguous || 99.4% Confident
SYW_MOUSE - (P32921) Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tryptophan--tRNA ligase) (TrpRS) || Number of peptides = 3 || unambiguous || 99.4% Confident
TCPY_MOUSE - (Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) || Number of peptides = 3 || unambiguous || 99.4% Confident
Q9CQ19 - (Q9CQ19) Transient receptor protein 2 || Number of peptides = 1 || ambiguous || 99.4% Confident
RAC1_HUMAN - (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) || Number of peptides = 5 || ambiguous || 99.4% Confident
Q9CS25 - (Q9CS25) 2810406C15Rik protein (Fragment) || Number of peptides = 4 || ambiguous || 99.4% Confident
TAL1_MOUSE - (Q93092) Transaldolase (EC 2.2.1.2) || Number of peptides = 5 || unambiguous || 99.4% Confident
EF1D_MOUSE - (P57776) Elongation factor 1-delta (EF-1-delta) || Number of peptides = 5 || unambiguous || 99.4% Confident
Q9CR49 - (Q9CR49) Hemoglobin Y, beta-like embryonic chain || Number of peptides = 4 || unambiguous || 99.4% Confident
PYRG_MOUSE - (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) || Number of peptides = 10 || unambiguous || 99.4% Confident
RS11_HUMAN - (P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11 || Number of peptides = 10 || ambiguous || 99.4% Confident
Q99KN9 - (Q99KN9) Similar to KIAA0171 gene product (Fragment) || Number of peptides = 3 || unambiguous || 99.4% Confident
TCPZ_MOUSE - (P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) || Number of peptides = 4 || unambiguous || 99.4% Confident
TSN_MOUSE - (Q62348) Translin || Number of peptides = 7 || unambiguous || 99.4% Confident
RL26_HUMAN - (Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26 || Number of peptides = 12 || ambiguous || 99.4% Confident
Q99L52 - (Q99L52) Hypothetical 34.3 kDa protein || Number of peptides = 1 || unambiguous || 99.4% Confident
Q924D2 - (Q924D2) Myosin light chain kinase (Fragment) || Number of peptides = 9 || unambiguous || 99.4% Confident
O35864 - (O35864) 38 kDa MOV34 ISOLOGUE (Kip1 C-terminus interacting protein-2) (COP9 (Constitutive photomorphogenic), subunit 5) (Arabidopsis) || Number of peptides = 5 || ambiguous || 99.4% Confident
AAC1_HUMAN - (P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein) || Number of peptides = 5 || ambiguous || 99.4% Confident
Q9P229 - (Q9P229) Hypothetical protein KIAA1499 (Fragment) || Number of peptides = 4 || unambiguous || 99.4% Confident
KPCI_MOUSE - (Q62074) Protein kinase C, iota type (EC 2.7.1.-) (nPKC-iota) (Protein kinase C lambda) || Number of peptides = 1 || ambiguous || 99.3% Confident
HS71_MOUSE - (P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) || Number of peptides = 15 || ambiguous || 99.3% Confident
TCTP_MOUSE - (P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein) || Number of peptides = 12 || unambiguous || 99.3% Confident
PGK1_HUMAN - (P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) || Number of peptides = 5 || unambiguous || 99.3% Confident
SYEP_HUMAN - (P07814) Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)] || Number of peptides = 7 || unambiguous || 99.3% Confident
RS12_MOUSE - (P09388) 40S ribosomal protein S12 || Number of peptides = 3 || unambiguous || 99.3% Confident
ROA2_MOUSE - (O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) || Number of peptides = 8 || ambiguous || 99.3% Confident
Q9CV31 - (Q9CV31) 2310014J01Rik protein (Fragment) || Number of peptides = 4 || ambiguous || 99.3% Confident
RL3_MOUSE - (P27659) 60S ribosomal protein L3 (J1 protein) || Number of peptides = 17 || unambiguous || 99.3% Confident
ROA1_MOUSE - (P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) || Number of peptides = 7 || ambiguous || 99.3% Confident
KINH_MOUSE - (Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) || Number of peptides = 4 || unambiguous || 99.3% Confident
Q9D0X8 - (Q9D0X8) 1110055E19Rik protein || Number of peptides = 2 || ambiguous || 99.3% Confident
Q9DAJ6 - (Q9DAJ6) 1500026J17Rik protein || Number of peptides = 5 || ambiguous || 99.3% Confident
DPY2_MOUSE - (O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) || Number of peptides = 14 || unambiguous || 99.3% Confident
Q9CX86 - (Q9CX86) 3010025E17Rik protein || Number of peptides = 6 || ambiguous || 99.3% Confident
Q9CU90 - (Q9CU90) 5133400F09Rik protein (Fragment) || Number of peptides = 11 || ambiguous || 99.3% Confident
Q96A55 - (Q96A55) Hypothetical protein || Number of peptides = 2 || unambiguous || 99.3% Confident
Q9R1T2 - (Q9R1T2) mRNA similar to human SUA1, complete CDS (2400010M20RIK protein) || Number of peptides = 3 || unambiguous || 99.2% Confident
RL2B_HUMAN - (P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a || Number of peptides = 6 || ambiguous || 99.2% Confident
Q93052 - (Q93052) LIPOMA PREFERRED partner (LPP) || Number of peptides = 3 || unambiguous || 99.2% Confident
DCT2_MOUSE - (Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) || Number of peptides = 3 || unambiguous || 99.2% Confident
RL10_MOUSE - (P45634) 60S ribosomal protein L10 (QM protein homolog) || Number of peptides = 10 || ambiguous || 99.2% Confident
Q8R1Q8 - (Q8R1Q8) Hypothetical 56.6 kDa protein || Number of peptides = 3 || unambiguous || 99.2% Confident
Q91YE4 - (Q91YE4) 67 kDa polymerase-associated factor PAF67 || Number of peptides = 6 || ambiguous || 99.2% Confident
Q9JK23 - (Q9JK23) Leucine rich protein || Number of peptides = 2 || unambiguous || 99.2% Confident
RS10_MOUSE - (P09900) 40S ribosomal protein S10 || Number of peptides = 10 || unambiguous || 99.2% Confident
Q9DC46 - (Q9DC46) 1200003I18Rik protein || Number of peptides = 3 || unambiguous || 99.2% Confident
Q9CY91 - (Q9CY91) G1 to phase transition 2 || Number of peptides = 8 || ambiguous || 99.1% Confident
PSB5_MOUSE - (O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6) || Number of peptides = 8 || ambiguous || 99.1% Confident
GUAA_HUMAN - (P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase) || Number of peptides = 5 || unambiguous || 99.1% Confident
GLYG_MOUSE - (Q9R062) Glycogenin-1 (EC 2.4.1.186) || Number of peptides = 5 || unambiguous || 99.1% Confident
ALFA_HUMAN - (P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1) || Number of peptides = 2 || unambiguous || 99.1% Confident
STN2_MOUSE - (P55821) Stathmin 2 (SCG10 protein) (Superior cervical ganglion-10 protein) || Number of peptides = 4 || ambiguous || 99.1% Confident
KCRB_MOUSE - (Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) || Number of peptides = 16 || unambiguous || 99.1% Confident
Q8R0B2 - (Q8R0B2) Hypothetical 26.4 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 99.1% Confident
SKD1_MOUSE - (P46467) SKD1 protein (Vacuolar sorting protein 4b) || Number of peptides = 4 || ambiguous || 99.1% Confident
Q9CXT4 - (Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence || Number of peptides = 7 || ambiguous || 99.1% Confident
Q91X94 - (Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) || Number of peptides = 3 || ambiguous || 99.1% Confident
GYG2_HUMAN - (O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) || Number of peptides = 3 || unambiguous || 99.1% Confident
Q9D184 - (Q9D184) 2810434B10Rik protein || Number of peptides = 1 || ambiguous || 99.1% Confident
Q9WTQ5 - (Q9WTQ5) SSECKS (PKC binding protein SSECKS) || Number of peptides = 7 || unambiguous || 99.1% Confident
PRS4_HUMAN - (Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) || Number of peptides = 10 || ambiguous || 99.1% Confident
Q922W2 - (Q922W2) Unknown (Protein for MGC:7055) || Number of peptides = 4 || ambiguous || 99.1% Confident
Q9DCS7 - (Q9DCS7) 0610011D08Rik protein || Number of peptides = 3 || ambiguous || 99.1% Confident
Q8R4X3 - (Q8R4X3) SWAN || Number of peptides = 6 || unambiguous || 99.1% Confident
PEBB_MOUSE - (Q08024) Core-binding factor, beta subunit (CBF-beta) (Polyomavirus enhancer binding protein 2 beta subunit) (PEBP2-beta) (PEA2-beta) (SL3-3 enhancer factor 1 beta subunit) (SL3/AKV core-binding factor beta subunit) || Number of peptides = 4 || ambiguous || 99.1% Confident
PSA6_MOUSE - (Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) || Number of peptides = 3 || ambiguous || 99.1% Confident
Q9EQ30 - (Q9EQ30) Ran binding protein 5 (Fragment) || Number of peptides = 7 || unambiguous || 99.1% Confident
HNT1_MOUSE - (P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) || Number of peptides = 6 || unambiguous || 99.0% Confident
Q9Z1A1 - (Q9Z1A1) TFG protein (Trk-fused gene) || Number of peptides = 3 || unambiguous || 99.0% Confident
UNRI_MOUSE - (Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) || Number of peptides = 6 || unambiguous || 99.0% Confident
TBBQ_HUMAN - (Q99867) Tubulin beta-4q chain || Number of peptides = 2 || unambiguous || 99.0% Confident
Q9D029 - (Q9D029) DNA segment, Chr 7, Wayne state University 128, expressed (Unknown) (Protein for MGC:19443) || Number of peptides = 5 || unambiguous || 98.9% Confident
Q91Z53 - (Q91Z53) Similar to glyoxylate reductase/hydroxypyruvate reductase || Number of peptides = 2 || unambiguous || 98.9% Confident
K1CJ_HUMAN - (P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) || Number of peptides = 3 || unambiguous || 98.9% Confident
CALM_HUMAN - (P02593) Calmodulin (P02593) Calmodulin || Number of peptides = 6 || ambiguous || 98.9% Confident
O70365 - (O70365) Golgi autoantigen golgin subtype a4 || Number of peptides = 4 || unambiguous || 98.9% Confident
O88568 - (O88568) Heterogenous nuclear ribonucleoprotein U || Number of peptides = 7 || unambiguous || 98.9% Confident
Q60864 - (Q60864) MSTI1 || Number of peptides = 7 || unambiguous || 98.8% Confident
RL44_HUMAN - (P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a) || Number of peptides = 2 || ambiguous || 98.8% Confident
Q9CVA3 - (Q9CVA3) 2210415M20Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 98.8% Confident
CAZ1_MOUSE - (P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment) || Number of peptides = 2 || ambiguous || 98.8% Confident
2AAA_HUMAN - (P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) || Number of peptides = 6 || ambiguous || 98.7% Confident
DYNA_MOUSE - (O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) || Number of peptides = 10 || unambiguous || 98.6% Confident
Q9NYE5 - (Q9NYE5) Gamma-filamin || Number of peptides = 17 || ambiguous || 98.6% Confident
RS8_HUMAN - (P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8 || Number of peptides = 11 || ambiguous || 98.6% Confident
MOES_MOUSE - (P26041) Moesin (Membrane-organizing extension spike protein) || Number of peptides = 8 || unambiguous || 98.6% Confident
P97315 - (P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) || Number of peptides = 7 || ambiguous || 98.6% Confident
Q9CSN8 - (Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) || Number of peptides = 5 || ambiguous || 98.6% Confident
Q9D6E6 - (Q9D6E6) 2900073G15Rik protein || Number of peptides = 3 || ambiguous || 98.6% Confident
Q9ERD3 - (Q9ERD3) Telokin || Number of peptides = 1 || ambiguous || 98.6% Confident
RL27_HUMAN - (P08526) 60S ribosomal protein L27 || Number of peptides = 6 || unambiguous || 98.6% Confident
O55181 - (O55181) RBP associated molecule RAM14-1 || Number of peptides = 4 || unambiguous || 98.6% Confident
FAS_MOUSE - (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) || Number of peptides = 13 || unambiguous || 98.6% Confident
Q8R0U6 - (Q8R0U6) Hypothetical 26.5 kDa protein (Fragment) || Number of peptides = 1 || ambiguous || 98.6% Confident
CBG_MOUSE - (Q06770) Corticosteroid-binding globulin precursor (CBG) (Transcortin) || Number of peptides = 6 || unambiguous || 98.6% Confident
RL9_MOUSE - (P51410) 60S ribosomal protein L9 || Number of peptides = 7 || ambiguous || 98.6% Confident
RL28_MOUSE - (P41105) 60S ribosomal protein L28 || Number of peptides = 7 || unambiguous || 98.6% Confident
PSA2_MOUSE - (P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) || Number of peptides = 2 || ambiguous || 98.6% Confident
UBIQ_HUMAN - (P02248) Ubiquitin (P02248) Ubiquitin || Number of peptides = 12 || ambiguous || 98.6% Confident
Q9CQX8 - (Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) || Number of peptides = 1 || unambiguous || 98.6% Confident
Q9H853 - (Q9H853) Hypothetical protein FLJ13940 || Number of peptides = 6 || unambiguous || 98.5% Confident
RL12_MOUSE - (P35979) 60S ribosomal protein L12 || Number of peptides = 6 || ambiguous || 98.5% Confident
PSB3_MOUSE - (Q9R1P1) Proteasome subunit beta type 3 (EC 3.4.25.1) (Proteasome theta chain) (Proteasome chain 13) (Proteasome component C10-II) || Number of peptides = 4 || unambiguous || 98.5% Confident
RL11_MOUSE - (Q9CXW4) 60S ribosomal protein L11 || Number of peptides = 4 || ambiguous || 98.5% Confident
RNT1_MOUSE - (Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) || Number of peptides = 5 || unambiguous || 98.4% Confident
ADDA_MOUSE - (Q9QYC0) Alpha adducin (Erythrocyte adducin alpha subunit) || Number of peptides = 6 || unambiguous || 98.3% Confident
Q60949 - (Q60949) Tbc1 || Number of peptides = 1 || ambiguous || 98.3% Confident
Q91V41 - (Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) || Number of peptides = 5 || unambiguous || 98.3% Confident
MCM2_MOUSE - (P97310) DNA replication licensing factor MCM2 || Number of peptides = 17 || unambiguous || 98.3% Confident
PSB1_MOUSE - (O09061) Proteasome subunit beta type 1 (EC 3.4.25.1) (Proteasome component C5) (Macropain subunit C5) (Multicatalytic endopeptidase complex subunit C5) (Proteasome gamma chain) || Number of peptides = 3 || unambiguous || 98.3% Confident
ZO1_MOUSE - (P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) || Number of peptides = 10 || unambiguous || 98.3% Confident
MYO6_MOUSE - (Q64331) Myosin VI || Number of peptides = 4 || unambiguous || 98.2% Confident
Q91V31 - (Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence) || Number of peptides = 2 || ambiguous || 98.2% Confident
SMD1_HUMAN - (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) || Number of peptides = 3 || ambiguous || 98.2% Confident
Q9DBY6 - (Q9DBY6) 1200009K13Rik protein || Number of peptides = 20 || ambiguous || 98.2% Confident
TPM1_MOUSE - (P58771) Tropomyosin 1 alpha chain (Alpha-tropomyosin) || Number of peptides = 8 || ambiguous || 98.2% Confident
DNPE_MOUSE - (Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21) || Number of peptides = 4 || unambiguous || 98.2% Confident
SNXC_MOUSE - (O70493) Sorting nexin 12 (SDP8 protein) || Number of peptides = 3 || unambiguous || 98.2% Confident
Q9CYZ2 - (Q9CYZ2) 2810411G23Rik protein (RIKEN cDNA 2810411G23 gene) || Number of peptides = 2 || ambiguous || 98.2% Confident
DDX3_MOUSE - (Q62167) DEAD-box protein 3 (DEAD-box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1PAS1 related sequence 2) || Number of peptides = 1 || unambiguous || 98.1% Confident
Q9CZ56 - (Q9CZ56) 2810405J23Rik protein || Number of peptides = 3 || ambiguous || 98.0% Confident
KC21_MOUSE - (Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37) || Number of peptides = 4 || ambiguous || 98.0% Confident
G3BP_MOUSE - (P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) || Number of peptides = 14 || unambiguous || 97.9% Confident
SERC_MOUSE - (Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) || Number of peptides = 13 || unambiguous || 97.9% Confident
Q9CRE7 - (Q9CRE7) 2410174K12Rik protein (Fragment) || Number of peptides = 8 || unambiguous || 97.9% Confident
Q9DBY0 - (Q9DBY0) 1200010K03Rik protein || Number of peptides = 2 || unambiguous || 97.9% Confident
RBB9_MOUSE - (O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) || Number of peptides = 1 || unambiguous || 97.9% Confident
O88598 - (O88598) NEDD8-conjugating enzyme (Ubiquitin-activating enzyme E1C) (NEDD8 activating enzyme) || Number of peptides = 4 || unambiguous || 97.8% Confident
Q91VJ3 - (Q91VJ3) Similar to Adenosin kinase || Number of peptides = 4 || unambiguous || 97.8% Confident
A1B1_MOUSE - (O35643) Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta large chain) || Number of peptides = 5 || unambiguous || 97.8% Confident
Q922K6 - (Q922K6) Unknown (Protein for MGC:7530) || Number of peptides = 3 || unambiguous || 97.7% Confident
SAHH_MOUSE - (P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) || Number of peptides = 13 || unambiguous || 97.6% Confident
CAH2_MOUSE - (P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) || Number of peptides = 5 || ambiguous || 97.6% Confident
Q9JL35 - (Q9JL35) Nucleosome binding protein 1 (Nucleosome binding protein 45) (NBP-45) (GARP45 protein) || Number of peptides = 1 || ambiguous || 97.6% Confident
DD15_MOUSE - (O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15) || Number of peptides = 6 || ambiguous || 97.5% Confident
RL19_HUMAN - (P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19 || Number of peptides = 7 || ambiguous || 97.4% Confident
O08794 - (O08794) Alpha glucosidase II, alpha subunit || Number of peptides = 6 || unambiguous || 97.3% Confident
PSDD_MOUSE - (Q9WVJ2) 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) || Number of peptides = 2 || ambiguous || 97.2% Confident
RPBY_MOUSE - (O08740) DNA-directed RNA polymerase II 13.3 kDa polypeptide (EC 2.7.7.6) (RPB11) (RPB14) || Number of peptides = 1 || ambiguous || 97.2% Confident
ADK_MOUSE - (P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment) || Number of peptides = 3 || ambiguous || 97.2% Confident
RL38_MOUSE - (Q9JJI8) 60S ribosomal protein L38 || Number of peptides = 2 || ambiguous || 97.2% Confident
RS17_MOUSE - (P06584) 40S ribosomal protein S17 || Number of peptides = 6 || ambiguous || 97.2% Confident
CLUS_MOUSE - (Q06890) Clusterin precursor (Sulfated glycoprotein 2) (SGP-2) (Clustrin) (Apolipoprotein J) (Apo-J) || Number of peptides = 1 || unambiguous || 97.1% Confident
Q9CT05 - (Q9CT05) 2610027H02Rik protein (Fragment) || Number of peptides = 6 || unambiguous || 97.1% Confident
UBP4_MOUSE - (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15) (Ubiquitin thiolesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) || Number of peptides = 3 || ambiguous || 97.0% Confident
Q925K4 - (Q925K4) Copine 1 protein (Fragment) || Number of peptides = 3 || ambiguous || 97.0% Confident
PSD6_MOUSE - (Q99JI4) 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit S10) (p42A) || Number of peptides = 6 || ambiguous || 97.0% Confident
Q9Z1F9 - (Q9Z1F9) ARX || Number of peptides = 11 || unambiguous || 96.9% Confident
Q9Z1Y4 - (Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) || Number of peptides = 5 || unambiguous || 96.9% Confident
A1T1_MOUSE - (P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) || Number of peptides = 6 || ambiguous || 96.9% Confident
PEBP_MOUSE - (P70296) Phosphatidylethanolamine-binding protein (PEBP) || Number of peptides = 4 || unambiguous || 96.8% Confident
Q9WVQ5 - (Q9WVQ5) MMRP19 (Monocyte macrophage 19) || Number of peptides = 1 || unambiguous || 96.8% Confident
Q8R1B4 - (Q8R1B4) Similar to eukaryotic translation initiation factor 3, subunit 8 (110kD) || Number of peptides = 3 || ambiguous || 96.8% Confident
Q9CZP2 - (Q9CZP2) 1110025F24Rik protein || Number of peptides = 1 || unambiguous || 96.8% Confident
PFTA_MOUSE - (Q61239) Protein farnesyltransferase alpha subunit (EC 2.5.1.-) (CAAX farnesyltransferase alpha subunit) (RAS proteins prenyltransferase alpha) (FTase-alpha) || Number of peptides = 4 || unambiguous || 96.8% Confident
PDA3_MOUSE - (P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) || Number of peptides = 4 || unambiguous || 96.8% Confident
PPI1_MOUSE - (P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) || Number of peptides = 4 || ambiguous || 96.7% Confident
EF1G_MOUSE - (Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) || Number of peptides = 9 || unambiguous || 96.5% Confident
O88544 - (O88544) COP9 complex subunit 4 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 4) (ARABIDOPSIS) || Number of peptides = 5 || ambiguous || 96.5% Confident
Y153_HUMAN - (Q14166) Hypothetical protein KIAA0153 || Number of peptides = 3 || unambiguous || 96.5% Confident
MAP4_HUMAN - (P27816) Microtubule-associated protein 4 (MAP 4) || Number of peptides = 4 || unambiguous || 96.4% Confident
Q9CWJ1 - (Q9CWJ1) 2410043M02Rik protein || Number of peptides = 2 || ambiguous || 96.4% Confident
TAGL_MOUSE - (P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27) || Number of peptides = 4 || unambiguous || 96.3% Confident
FUMH_MOUSE - (P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) || Number of peptides = 3 || unambiguous || 96.3% Confident
PA1B_MOUSE - (Q61206) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) || Number of peptides = 4 || ambiguous || 96.3% Confident
KAC_MOUSE - (P01837) Ig kappa chain C region || Number of peptides = 4 || ambiguous || 96.3% Confident
Q922B6 - (Q922B6) Unknown (Protein for MGC:7807) || Number of peptides = 4 || ambiguous || 96.3% Confident
PAK2_HUMAN - (Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) || Number of peptides = 3 || unambiguous || 96.3% Confident
RS18_HUMAN - (P25232) 40S ribosomal protein S18 (KE-3) (KE3) (P25232) 40S ribosomal protein S18 (KE-3) (KE3) || Number of peptides = 8 || ambiguous || 96.3% Confident
Q8VC30 - (Q8VC30) Similar to DKFZP586B1621 protein || Number of peptides = 5 || unambiguous || 96.2% Confident
GDIB_MOUSE - (P50397) Rab GDP dissociation inhibitor beta (Rab GDI beta) (GDI-2) || Number of peptides = 3 || ambiguous || 96.1% Confident
SEP7_MOUSE - (O55131) Septin 7 (CDC10 protein homolog) || Number of peptides = 4 || ambiguous || 96.1% Confident
CDC2_MOUSE - (P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) || Number of peptides = 4 || ambiguous || 96.0% Confident
Q9NPL8 - (Q9NPL8) C3orf1 hypothetical protein || Number of peptides = 9 || ambiguous || 96.0% Confident
PHS3_HUMAN - (P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) || Number of peptides = 4 || unambiguous || 95.9% Confident
RL31_HUMAN - (P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31 || Number of peptides = 4 || ambiguous || 95.9% Confident
TRAL_MOUSE - (Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) || Number of peptides = 4 || unambiguous || 95.9% Confident
Q9JJT9 - (Q9JJT9) Phosphorylated adaptor for RNA export || Number of peptides = 1 || unambiguous || 95.9% Confident
Q9D8X5 - (Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) || Number of peptides = 9 || ambiguous || 95.9% Confident
QOR_MOUSE - (P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin) || Number of peptides = 5 || unambiguous || 95.8% Confident
Q96IX3 - (Q96IX3) Peptidylprolyl isomerase A (Cyclophilin A) || Number of peptides = 2 || unambiguous || 95.7% Confident
S11Y_HUMAN - (Q9UDP3) Putative S100 calcium-binding protein H_NH0456N16.1 || Number of peptides = 3 || unambiguous || 95.6% Confident
PYR1_HUMAN - (P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] || Number of peptides = 7 || unambiguous || 95.6% Confident
LIS1_MOUSE - (P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) || Number of peptides = 4 || ambiguous || 95.6% Confident
Q9JM14 - (Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C) || Number of peptides = 1 || ambiguous || 95.6% Confident
UBL3_MOUSE - (Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3) || Number of peptides = 2 || unambiguous || 95.6% Confident
P97825 - (P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) || Number of peptides = 6 || unambiguous || 95.6% Confident
Q9P2E6 - (Q9P2E6) Hypothetical protein KIAA1401 (Fragment) || Number of peptides = 2 || unambiguous || 95.5% Confident
PDL1_MOUSE - (O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) || Number of peptides = 4 || unambiguous || 95.4% Confident
Q9CRK9 - (Q9CRK9) 9430077D24Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 95.3% Confident
RS20_HUMAN - (P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 || Number of peptides = 4 || ambiguous || 95.2% Confident
COPE_MOUSE - (O89079) Coatomer epsilon subunit (Epsilon-coat protein) (Epsilon-COP) (Fragment) || Number of peptides = 3 || ambiguous || 95.0% Confident
TYB0_HUMAN - (P13472) Thymosin beta-10 || Number of peptides = 3 || unambiguous || 95.0% Confident
NUCL_MOUSE - (P09405) Nucleolin (Protein C23) || Number of peptides = 12 || unambiguous || 95.0% Confident
Q99LT1 - (Q99LT1) Hypothetical 39.2 kDa protein (Fragment) || Number of peptides = 3 || unambiguous || 95.0% Confident
Q91ZP1 - (Q91ZP1) Fibrinogen B-beta-chain (Fragment) || Number of peptides = 1 || unambiguous || 94.9% Confident
SYG_MOUSE - (Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) || Number of peptides = 3 || ambiguous || 94.9% Confident
R11A_MOUSE - (Q9JLX1) Ras-related protein Rab-11A || Number of peptides = 3 || unambiguous || 94.9% Confident
RS16_HUMAN - (P17008) 40S ribosomal protein S16 || Number of peptides = 8 || unambiguous || 94.9% Confident
S23B_MOUSE - (Q9D662) Protein transport protein Sec23B (SEC23-related protein B) || Number of peptides = 2 || unambiguous || 94.9% Confident
R13A_MOUSE - (P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen) || Number of peptides = 10 || unambiguous || 94.9% Confident
K6A1_MOUSE - (P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) || Number of peptides = 5 || unambiguous || 94.9% Confident
DNL1_MOUSE - (P37913) DNA ligase I (EC 6.5.1.1) (Polydeoxyribonucleotide synthase [ATP]) || Number of peptides = 6 || unambiguous || 94.9% Confident
Q8VDM6 - (Q8VDM6) Similar to E1B-55 kDa-associated protein 5 || Number of peptides = 8 || unambiguous || 94.9% Confident
Q9D1J1 - (Q9D1J1) 1110005F07Rik protein || Number of peptides = 2 || unambiguous || 94.8% Confident
AMPB_MOUSE - (Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV) || Number of peptides = 4 || unambiguous || 94.7% Confident
IF2G_MOUSE - (Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X) || Number of peptides = 6 || unambiguous || 94.5% Confident
CAPB_MOUSE - (P47757) F-actin capping protein beta subunit (CapZ beta) || Number of peptides = 1 || ambiguous || 94.4% Confident
GCAA_MOUSE - (P01863) Ig gamma-2A chain C region, A allele || Number of peptides = 2 || ambiguous || 94.4% Confident
MGD1_MOUSE - (Q9QYH6) Melanoma-associated antigen D1 (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) (Dlxin-1) || Number of peptides = 3 || unambiguous || 94.4% Confident
PCNA_MOUSE - (P17918) Proliferating cell nuclear antigen (PCNA) (Cyclin) || Number of peptides = 2 || ambiguous || 94.4% Confident
CTE1_MOUSE - (O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) || Number of peptides = 6 || unambiguous || 94.4% Confident
O54807 - (O54807) Ankhzn protein || Number of peptides = 1 || ambiguous || 94.4% Confident
Q9UG94 - (Q9UG94) Hypothetical protein || Number of peptides = 2 || unambiguous || 94.4% Confident
SNX3_MOUSE - (O70492) Sorting nexin 3 (SDP3 protein) || Number of peptides = 1 || ambiguous || 94.3% Confident
SMD2_HUMAN - (P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) (P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) || Number of peptides = 1 || ambiguous || 94.3% Confident
Q9ER67 - (Q9ER67) Hypothetical 65.4 kDa protein || Number of peptides = 4 || ambiguous || 94.3% Confident
CRTC_MOUSE - (P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) || Number of peptides = 6 || unambiguous || 94.3% Confident
Q99PC9 - (Q99PC9) Protein phosphatase 2 regulatory subunit B56 delta isoform || Number of peptides = 4 || ambiguous || 94.1% Confident
Q9ULH5 - (Q9ULH5) Hypothetical protein KIAA1245 (Fragment) || Number of peptides = 1 || unambiguous || 93.9% Confident
Q9CUZ0 - (Q9CUZ0) 2900010D03Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 93.7% Confident
Q9CYW1 - (Q9CYW1) 0610027F08Rik protein || Number of peptides = 1 || unambiguous || 93.4% Confident
Q9BWX2 - (Q9BWX2) Protein kinase NYD-SP5 || Number of peptides = 5 || unambiguous || 93.4% Confident
RS5_MOUSE - (P97461) 40S ribosomal protein S5 || Number of peptides = 5 || ambiguous || 93.3% Confident
Q921C3 - (Q921C3) WDR9 protein, form A || Number of peptides = 5 || ambiguous || 93.3% Confident
Q99LF4 - (Q99LF4) Hypothetical 55.2 kDa protein || Number of peptides = 4 || unambiguous || 93.0% Confident
IMD1_MOUSE - (P50096) Inosine-5'-monophosphate dehydrogenase 1 (EC 1.1.1.205) (IMP dehydrogenase 1) (IMPDH-I) (IMPD 1) || Number of peptides = 5 || unambiguous || 92.9% Confident
LDHB_MOUSE - (P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H) || Number of peptides = 1 || ambiguous || 92.9% Confident
143B_MOUSE - (Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) || Number of peptides = 20 || unambiguous || 92.8% Confident
143S_MOUSE - (O70456) 14-3-3 protein sigma (Stratifin) || Number of peptides = 2 || ambiguous || 92.8% Confident
WDR5_HUMAN - (Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) (Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) || Number of peptides = 1 || ambiguous || 92.8% Confident
Q9D870 - (Q9D870) 2010110O17Rik protein || Number of peptides = 1 || ambiguous || 92.7% Confident
Q99JY3 - (Q99JY3) Similar to hypothetical protein FLJ11110 || Number of peptides = 1 || unambiguous || 92.7% Confident
CYPB_MOUSE - (P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) || Number of peptides = 2 || ambiguous || 92.6% Confident
VAB2_MOUSE - (P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) || Number of peptides = 1 || ambiguous || 92.6% Confident
COPA_HUMAN - (P53621) Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) [Contains: Xenin (Xenopsin-related peptide); Proxenin] || Number of peptides = 7 || unambiguous || 92.3% Confident
PRS7_MOUSE - (P46471) 26S protease regulatory subunit 7 (MSS1 protein) || Number of peptides = 13 || ambiguous || 92.3% Confident
RS24_HUMAN - (P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19) || Number of peptides = 13 || ambiguous || 92.3% Confident
RET1_MOUSE - (Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI) || Number of peptides = 3 || ambiguous || 92.2% Confident
Q61043 - (Q61043) Ninein || Number of peptides = 5 || unambiguous || 92.2% Confident
SYK_MOUSE - (Q99MN1) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase) (LysRS) || Number of peptides = 4 || unambiguous || 92.2% Confident
H105_MOUSE - (Q61699) Heat-shock protein 105 kDa (Heat shock-related 100 kDa protein E7I) (HSP-E7I) (Heat shock 110 kDa protein) (42 degrees C-HSP) || Number of peptides = 4 || unambiguous || 92.1% Confident
EZRI_MOUSE - (P26040) Ezrin (p81) (Cytovillin) (Villin 2) || Number of peptides = 11 || ambiguous || 92.0% Confident
Q9EPX1 - (Q9EPX1) Thimet oligopeptidase (EC 3.4.24.15) || Number of peptides = 8 || unambiguous || 92.0% Confident
RTC1_MOUSE - (Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase) || Number of peptides = 4 || unambiguous || 92.0% Confident
O08817 - (O08817) CW17 protein || Number of peptides = 3 || ambiguous || 92.0% Confident
LSM4_MOUSE - (Q9QXA5) U6 snRNA-associated Sm-like protein LSm4 || Number of peptides = 2 || ambiguous || 91.8% Confident
Q91ZH1 - (Q91ZH1) DM505L19.1 (Novel protein) (Fragment) || Number of peptides = 8 || unambiguous || 91.7% Confident
SPCN_MOUSE - (P16546) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) (Fragment) || Number of peptides = 4 || unambiguous || 91.5% Confident
AAC2_MOUSE - (Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) || Number of peptides = 4 || ambiguous || 91.4% Confident
P97398 - (P97398) NIPI-like protein || Number of peptides = 7 || unambiguous || 91.3% Confident
Q9CWW8 - (Q9CWW8) 2410002G23Rik protein || Number of peptides = 6 || unambiguous || 91.2% Confident
Q99JX4 - (Q99JX4) Similar to dendritic cell protein || Number of peptides = 5 || ambiguous || 91.2% Confident
Q9DBC7 - (Q9DBC7) 1300018C22Rik protein (Protein kinase, cAMP dependent regulatory, type 1, alpha) (RIKEN cDNA 1300018C22 gene) || Number of peptides = 3 || ambiguous || 91.1% Confident
Q9D224 - (Q9D224) A030010B05Rik protein || Number of peptides = 1 || unambiguous || 91.1% Confident
SPEE_MOUSE - (Q64674) Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) || Number of peptides = 6 || unambiguous || 91.1% Confident
PYR5_MOUSE - (P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] || Number of peptides = 3 || unambiguous || 91.0% Confident
PYR5_HUMAN - (P11172) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] || Number of peptides = 1 || unambiguous || 91.0% Confident
MK04_HUMAN - (P31152) Mitogen-activated protein kinase 4 (EC 2.7.1.-) (Extracellular signal-regulated kinase 4) (ERK-4) (MAP kinase isoform p63) (p63-MAPK) || Number of peptides = 2 || unambiguous || 90.9% Confident
143T_MOUSE - (P35216) 14-3-3 protein tau (14-3-3 protein theta) || Number of peptides = 9 || unambiguous || 90.8% Confident
Q9H1B7 - (Q9H1B7) Polyglutamine-containing protein || Number of peptides = 4 || unambiguous || 90.7% Confident
Q923R9 - (Q923R9) Sterolin 2 (Fragment) || Number of peptides = 1 || unambiguous || 90.5% Confident
2A5E_HUMAN - (Q16537) Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon isoform (PP2A, B subunit, B' epsilon isoform) (PP2A, B subunit, B56 epsilon isoform) (PP2A, B subunit, PR61 epsilon isoform) (PP2A, B subunit, R5 epsilon isoform) || Number of peptides = 2 || unambiguous || 90.5% Confident
TYSY_MOUSE - (P07607) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase) || Number of peptides = 1 || unambiguous || 90.4% Confident
Q9Z2X1 - (Q9Z2X1) Ribonucleoprotein F || Number of peptides = 2 || ambiguous || 90.4% Confident
PIP3_HUMAN - (Q01970) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 3 (EC 3.1.4.11) (PLC-beta-3) (Phospholipase C-beta-3) || Number of peptides = 3 || unambiguous || 90.3% Confident
CDK4_MOUSE - (P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) || Number of peptides = 4 || unambiguous || 90.1% Confident
Q91WQ3 - (Q91WQ3) Similar to tyrosyl-tRNA synthetase (Hypothetical 59.1 kDa protein) (Expressed sequence AL024047) || Number of peptides = 7 || unambiguous || 90.1% Confident
RL18_MOUSE - (P35980) 60S ribosomal protein L18 || Number of peptides = 5 || unambiguous || 89.9% Confident
SPCO_MOUSE - (Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) || Number of peptides = 8 || unambiguous || 89.7% Confident
GDIC_MOUSE - (Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) || Number of peptides = 4 || ambiguous || 89.5% Confident
Q9CZK1 - (Q9CZK1) 1300012C15Rik protein || Number of peptides = 2 || ambiguous || 89.2% Confident
GBB1_HUMAN - (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) || Number of peptides = 3 || ambiguous || 89.2% Confident
O88493 - (O88493) Type VI collagen alpha 3 subunit || Number of peptides = 6 || unambiguous || 89.1% Confident
GR78_MOUSE - (P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) || Number of peptides = 9 || ambiguous || 88.9% Confident
Q9CZM5 - (Q9CZM5) 2700050M05Rik protein || Number of peptides = 3 || ambiguous || 88.8% Confident
UBPE_MOUSE - (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15) (Ubiquitin thiolesterase 14) (Ubiquitin-specific processing protease 14) (Deubiquitinating enzyme 14) || Number of peptides = 3 || unambiguous || 88.8% Confident
Q8R3E6 - (Q8R3E6) Similar to chromosome 14 open reading frame 3 || Number of peptides = 1 || ambiguous || 88.4% Confident
Q8VD78 - (Q8VD78) Hypothetical 50.8 kDa protein || Number of peptides = 4 || unambiguous || 88.3% Confident
Q9QXD8 - (Q9QXD8) LIM domains containing protein 1 || Number of peptides = 2 || unambiguous || 87.6% Confident
Q96GV2 - (Q96GV2) Hypothetical protein || Number of peptides = 1 || unambiguous || 87.4% Confident
CFAI_HUMAN - (P05156) Complement factor I precursor (EC 3.4.21.45) (C3B/C4B inactivator) || Number of peptides = 5 || unambiguous || 87.1% Confident
CKS1_HUMAN - (P33551) Cyclin-dependent kinases regulatory subunit 1 (CKS-1) (Sid1334) (PNAS-16 / PNAS-143) (P33551) Cyclin-dependent kinases regulatory subunit 1 (CKS-1) (Sid1334) (PNAS-16 / PNAS-143) || Number of peptides = 4 || ambiguous || 87.0% Confident
Q9DBQ4 - (Q9DBQ4) 1200016L19Rik protein || Number of peptides = 5 || unambiguous || 87.0% Confident
Q61480 - (Q61480) TRAF5 || Number of peptides = 4 || ambiguous || 86.9% Confident
Q9Y6F5 - (Q9Y6F5) Serine phosphatase FCP1a || Number of peptides = 6 || unambiguous || 86.9% Confident
IF2A_HUMAN - (P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) || Number of peptides = 1 || unambiguous || 86.7% Confident
RL13_MOUSE - (P47963) 60S ribosomal protein L13 (A52) || Number of peptides = 5 || unambiguous || 86.7% Confident
O60311 - (O60311) Hypothetical protein KIAA0565 (Fragment) || Number of peptides = 8 || unambiguous || 86.6% Confident
MK01_MOUSE - (P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) || Number of peptides = 9 || ambiguous || 86.6% Confident
PSA1_MOUSE - (Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) || Number of peptides = 15 || unambiguous || 86.5% Confident
AATC_MOUSE - (P05201) Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-1) || Number of peptides = 3 || unambiguous || 86.5% Confident
PTB_MOUSE - (P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) || Number of peptides = 4 || ambiguous || 86.4% Confident
Q9UNI5 - (Q9UNI5) Zinc finger protein FOG-2 || Number of peptides = 2 || ambiguous || 86.3% Confident
Q91WJ8 - (Q91WJ8) Similar to far upstream element (FUSE) binding protein 1 || Number of peptides = 4 || unambiguous || 86.1% Confident
RL23_HUMAN - (P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) || Number of peptides = 12 || ambiguous || 86.0% Confident
MO25_MOUSE - (Q06138) MO25 protein || Number of peptides = 2 || ambiguous || 85.7% Confident
Q61166 - (Q61166) APC-binding protein EB1 homolog || Number of peptides = 4 || unambiguous || 85.7% Confident
O88179 - (O88179) Guanine nucleotide regulatory protein (Fragment) || Number of peptides = 5 || unambiguous || 85.6% Confident
CTB2_MOUSE - (P56546) C-terminal binding protein 2 (CtBP2) || Number of peptides = 2 || unambiguous || 85.3% Confident
IF2B_MOUSE - (Q99L45) Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 beta subunit) (eIF-2-beta) || Number of peptides = 3 || ambiguous || 85.2% Confident
CO3_MOUSE - (P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] || Number of peptides = 8 || unambiguous || 85.0% Confident
TRFL_MOUSE - (P08071) Lactotransferrin precursor (Lactoferrin) || Number of peptides = 6 || unambiguous || 85.0% Confident
RS25_HUMAN - (P25111) 40S ribosomal protein S25 (P25111) 40S ribosomal protein S25 || Number of peptides = 2 || ambiguous || 84.8% Confident
Q9D512 - (Q9D512) 4930528G08Rik protein || Number of peptides = 1 || ambiguous || 84.7% Confident
PP1A_HUMAN - (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) || Number of peptides = 4 || ambiguous || 84.6% Confident
PGM5_HUMAN - (Q15124) Phosphoglucomutase-like protein 5 (Phosphoglucomutase-related protein) (PGM-RP) (Aciculin) || Number of peptides = 2 || unambiguous || 84.0% Confident
GAT3_MOUSE - (P23772) Trans-acting T-cell specific transcription factor GATA-3 || Number of peptides = 1 || unambiguous || 84.0% Confident
O75145 - (O75145) Hypothetical protein KIAA0654 (Fragment) || Number of peptides = 4 || unambiguous || 84.0% Confident
Q9DD21 - (Q9DD21) 0610006A11Rik protein || Number of peptides = 2 || ambiguous || 83.8% Confident
UBL5_MOUSE - (Q9WUP7) Ubiquitin carboxyl-terminal hydrolase isozyme L5 (EC 3.4.19.12) (UCH-L5) (Ubiquitin thiolesterase L5) (Ubiquitin C-terminal hydrolase UCH37) || Number of peptides = 1 || ambiguous || 83.8% Confident
Q8TDG4 - (Q8TDG4) DNA helicase HEL308 || Number of peptides = 15 || unambiguous || 83.7% Confident
Q9CZ05 - (Q9CZ05) 2810423G08Rik protein || Number of peptides = 1 || ambiguous || 83.6% Confident
O35753 - (O35753) TIP49 protein (RUVB-like protein 1) || Number of peptides = 4 || ambiguous || 83.6% Confident
Q9JID5 - (Q9JID5) Acetyltransferase Tubedown-1 || Number of peptides = 2 || unambiguous || 83.5% Confident
Q9BQR6 - (Q9BQR6) A20-binding inhibitor of NF-kappaB activation-2 || Number of peptides = 2 || unambiguous || 83.4% Confident
Q9JJF4 - (Q9JJF4) Brain cDNA, clone MNCb-5873, similar to AF151022 HSPC188 (Homo sapiens) || Number of peptides = 2 || unambiguous || 82.9% Confident
Q9QY37 - (Q9QY37) Protein with characteristics of a rhoGAP || Number of peptides = 6 || unambiguous || 82.9% Confident
Q9JK31 - (Q9JK31) ATFa-associated factor || Number of peptides = 4 || unambiguous || 82.7% Confident
Q9Y405 - (Q9Y405) Hypothetical protein (Fragment) || Number of peptides = 2 || unambiguous || 82.7% Confident
Q9CY26 - (Q9CY26) 2700085E05Rik protein || Number of peptides = 3 || ambiguous || 82.7% Confident
Q9CSU0 - (Q9CSU0) 2610304G08Rik protein (Fragment) || Number of peptides = 2 || ambiguous || 82.6% Confident
FRAP_MOUSE - (Q9JLN9) FKBP-rapamycin associated protein (FRAP) || Number of peptides = 14 || ambiguous || 82.5% Confident
KC2B_HUMAN - (P13862) Casein kinase II beta chain (CK II) (Phosvitin) (G5a) (P13862) Casein kinase II beta chain (CK II) (Phosvitin) (G5a) || Number of peptides = 4 || ambiguous || 82.5% Confident
Q9UFU8 - (Q9UFU8) Hypothetical protein (Fragment) || Number of peptides = 6 || unambiguous || 82.4% Confident
P2CA_MOUSE - (P49443) Protein phosphatase 2C alpha isoform (EC 3.1.3.16) (PP2C-alpha) (IA) (Protein phosphatase 1A) || Number of peptides = 1 || ambiguous || 82.0% Confident
BAG1_MOUSE - (Q60739) BAG-family molecular chaperone regulator-1 (BCL-2 binding athanogene-1) (BAG-1) || Number of peptides = 1 || unambiguous || 81.8% Confident
Q9Z332 - (Q9Z332) Keratin 6 alpha || Number of peptides = 3 || ambiguous || 81.7% Confident
SNX5_MOUSE - (Q9D8U8) Sorting nexin 5 || Number of peptides = 2 || ambiguous || 81.7% Confident
RL29_MOUSE - (P47915) 60S ribosomal protein L29 || Number of peptides = 6 || unambiguous || 81.2% Confident
AA27_MOUSE - (P56873) Sjogren's syndrome/scleroderma autoantigen 1 homolog (Autoantigen p27 homolog) || Number of peptides = 2 || ambiguous || 81.1% Confident
S23A_MOUSE - (Q01405) Protein transport protein Sec23A (SEC23-related protein A) (Fragment) || Number of peptides = 3 || unambiguous || 81.0% Confident
MTAP_MOUSE - (Q9CQ65) 5'-methylthioadenosine phosphorylase (EC 2.4.2.28) (MTA phosphorylase) (MTAPase) || Number of peptides = 5 || unambiguous || 80.3% Confident
S24C_HUMAN - (P53992) Protein transport protein Sec24C (SEC24-related protein C) || Number of peptides = 2 || ambiguous || 80.3% Confident
NUEM_HUMAN - (Q16795) NADH-ubiquinone oxidoreductase 39 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-39KD) (CI-39KD) || Number of peptides = 5 || unambiguous || 80.3% Confident
MYG1_MOUSE - (Q9JK81) MYG1 protein (Gamm1 protein) || Number of peptides = 3 || unambiguous || 80.1% Confident
Q9CQR6 - (Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit) || Number of peptides = 2 || ambiguous || 79.6% Confident
DSC2_MOUSE - (P55292) Desmocollin 2A/2B precursor (Epithelial type 2 desmocollin) || Number of peptides = 6 || unambiguous || 79.6% Confident
Q96SF9 - (Q96SF9) BA395N17.1 (Hypothetical protein KIAA0918) || Number of peptides = 2 || ambiguous || 79.6% Confident
Q9D9F5 - (Q9D9F5) 1700082G03Rik protein || Number of peptides = 1 || ambiguous || 79.5% Confident
Q9EQC8 - (Q9EQC8) Papillary renal cell carcinoma-associated protein || Number of peptides = 1 || unambiguous || 79.5% Confident
SEP2_MOUSE - (P42208) Septin 2 (NEDD5 protein) || Number of peptides = 5 || ambiguous || 79.5% Confident
O70565 - (O70565) Cp27 protein || Number of peptides = 4 || ambiguous || 79.5% Confident
PESC_MOUSE - (Q9EQ61) Pescadillo homolog 1 || Number of peptides = 3 || unambiguous || 79.4% Confident
Q9BYS3 - (Q9BYS3) Rab interacting lysosomal protein || Number of peptides = 7 || ambiguous || 79.2% Confident
Q8QZV7 - (Q8QZV7) Similar to hypothetical protein FLJ10637 || Number of peptides = 3 || ambiguous || 79.2% Confident
Q9H1H9 - (Q9H1H9) Kinesin-like protein RBKIN1 || Number of peptides = 3 || ambiguous || 79.1% Confident
TRL3_HUMAN - (Q9HCF6) Long transient receptor potential channel 3 (LTrpC3) (Fragment) || Number of peptides = 3 || unambiguous || 78.8% Confident
ARS1_MOUSE - (O54984) Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) || Number of peptides = 2 || ambiguous || 78.4% Confident
TLR7_HUMAN - (Q9NYK1) Toll-like receptor 7 precursor || Number of peptides = 4 || unambiguous || 78.3% Confident
IF4H_MOUSE - (Q9WUK2) Eukaryotic translation initiation factor 4H (eIF-4H) (Williams-Beuren syndrome chromosome region 1 protein homolog) || Number of peptides = 2 || ambiguous || 78.3% Confident
Q8R3Y8 - (Q8R3Y8) Hypothetical 30.2 kDa protein || Number of peptides = 2 || unambiguous || 78.3% Confident
TPMT_MOUSE - (O55060) Thiopurine S-methyltransferase (EC 2.1.1.67) (Thiopurine methyltransferase) || Number of peptides = 2 || unambiguous || 78.1% Confident
IDE_MOUSE - (Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) || Number of peptides = 4 || unambiguous || 78.0% Confident
P97293 - (P97293) MAP kinase kinase 3B (Mitogen activated protein kinase kinase 3) || Number of peptides = 1 || unambiguous || 77.8% Confident
SPCN_HUMAN - (Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) || Number of peptides = 7 || unambiguous || 77.6% Confident
Q9CTD4 - (Q9CTD4) 6030455P07Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 77.4% Confident
BAG3_MOUSE - (Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) || Number of peptides = 1 || unambiguous || 77.2% Confident
Q9Z2E5 - (Q9Z2E5) Transcription factor MATH5 || Number of peptides = 1 || unambiguous || 77.1% Confident
Q9CRI0 - (Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) || Number of peptides = 3 || ambiguous || 77.0% Confident
ENOG_MOUSE - (P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2) || Number of peptides = 13 || ambiguous || 77.0% Confident
Q9EPK6 - (Q9EPK6) Sil1 protein precursor || Number of peptides = 7 || unambiguous || 76.9% Confident
TIE2_HUMAN - (Q02763) Angiopoietin 1 receptor precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor TIE-2) (Tyrosine-protein kinase receptor TEK) (P140 TEK) (Tunica interna endothelial cell kinase) (CD202b antigen) || Number of peptides = 30 || unambiguous || 76.7% Confident
Q8TE00 - (Q8TE00) DERP13 (Dermal papilla derived protein 13) || Number of peptides = 2 || ambiguous || 76.7% Confident
Q8TEC4 - (Q8TEC4) Hypothetical protein FLJ23656 || Number of peptides = 2 || unambiguous || 76.6% Confident
Q9DCH5 - (Q9DCH5) 0610037L13Rik protein (RIKEN cDNA 0610037L13 gene) || Number of peptides = 1 || unambiguous || 76.5% Confident
COPB_MOUSE - (Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP) || Number of peptides = 3 || ambiguous || 76.5% Confident
DHA1_MOUSE - (P24549) Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Aldehyde dehydrogenase, cytosolic) (ALDH class 1) (ALHDII) (ALDH-E1) || Number of peptides = 7 || unambiguous || 76.4% Confident
Q9D1G1 - (Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) || Number of peptides = 2 || ambiguous || 76.4% Confident
Q9UNJ2 - (Q9UNJ2) Myosin-IXa || Number of peptides = 6 || ambiguous || 76.4% Confident
PSA7_MOUSE - (Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1) || Number of peptides = 3 || ambiguous || 75.9% Confident
UBCN_HUMAN - (Q16781) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19) (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (UBC13) || Number of peptides = 1 || unambiguous || 75.4% Confident
Q9D852 - (Q9D852) 2010300C02Rik protein || Number of peptides = 3 || unambiguous || 75.4% Confident
Q91W48 - (Q91W48) Archain 1 || Number of peptides = 3 || unambiguous || 75.3% Confident
FUS_MOUSE - (P56959) RNA-binding protein FUS (Pigpen protein) || Number of peptides = 2 || ambiguous || 75.3% Confident
TES_MOUSE - (P47226) Testin (TES1/TES2) || Number of peptides = 6 || unambiguous || 75.2% Confident
Q922F6 - (Q922F6) Unknown (Protein for IMAGE:3584589) (Fragment) || Number of peptides = 3 || unambiguous || 75.2% Confident
O95036 - (O95036) WUGSC:H_RG054D04.1 protein || Number of peptides = 1 || unambiguous || 75.1% Confident
DYLL_HUMAN - (Q9Y3P0) Putative dynein light chain protein DJ8B22.1 || Number of peptides = 2 || unambiguous || 75.0% Confident
Q14568 - (Q14568) Heat shock protein 86 (Fragment) || Number of peptides = 11 || unambiguous || 75.0% Confident
GELS_MOUSE - (P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) || Number of peptides = 4 || unambiguous || 75.0% Confident
Q9Y2S5 - (Q9Y2S5) HSPC015 || Number of peptides = 1 || ambiguous || 74.7% Confident
Q9CXI5 - (Q9CXI5) 3230402M22Rik protein || Number of peptides = 1 || ambiguous || 74.7% Confident
AP19_MOUSE - (P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) || Number of peptides = 4 || ambiguous || 74.6% Confident
Q9CUQ5 - (Q9CUQ5) C330027G06Rik protein (Fragment) || Number of peptides = 2 || unambiguous || 74.6% Confident
Q99N42 - (Q99N42) Thymidine phosphorylase || Number of peptides = 1 || unambiguous || 74.5% Confident
O14637 - (O14637) Laminin alpha 3b chain (Fragment) || Number of peptides = 8 || unambiguous || 74.3% Confident
ZN75_HUMAN - (P51815) Zinc finger protein 75 || Number of peptides = 1 || unambiguous || 74.3% Confident
Q9CR70 - (Q9CR70) 1110049G11Rik protein || Number of peptides = 1 || unambiguous || 74.0% Confident
Q9DC99 - (Q9DC99) 0710007A14Rik protein || Number of peptides = 1 || ambiguous || 74.0% Confident
Q9JHJ3 - (Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) || Number of peptides = 4 || unambiguous || 74.0% Confident
Q61627 - (Q61627) Glutamate receptor delta-1 subunit precursor || Number of peptides = 4 || unambiguous || 73.7% Confident
Q9D6U5 - (Q9D6U5) 2310057C03Rik protein || Number of peptides = 2 || ambiguous || 73.7% Confident
Q8WYI3 - (Q8WYI3) MSTP023 || Number of peptides = 3 || ambiguous || 73.7% Confident
K2C8_MOUSE - (P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A) || Number of peptides = 2 || ambiguous || 73.6% Confident
Q9CQC6 - (Q9CQC6) 1200015E15Rik protein (KIAA0005 gene product) || Number of peptides = 1 || ambiguous || 73.6% Confident
CBP_MOUSE - (P45481) CREB-binding protein || Number of peptides = 3 || unambiguous || 73.2% Confident
Q60603 - (Q60603) Potassium channel subunit || Number of peptides = 4 || unambiguous || 73.2% Confident
Q9D0V4 - (Q9D0V4) 2700047N05Rik protein || Number of peptides = 2 || ambiguous || 73.1% Confident
Q9CRS2 - (Q9CRS2) 4432404J10Rik protein (Fragment) || Number of peptides = 4 || unambiguous || 72.7% Confident
ELV1_MOUSE - (P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG) || Number of peptides = 3 || ambiguous || 72.6% Confident
GDIR_MOUSE - (Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) || Number of peptides = 3 || ambiguous || 72.5% Confident
Q8VEJ4 - (Q8VEJ4) Hypothetical 53.1 kDa protein || Number of peptides = 1 || ambiguous || 72.5% Confident
Q9Y632 - (Q9Y632) APC2 protein (Fragment) || Number of peptides = 1 || ambiguous || 72.5% Confident
CSN2_HUMAN - (Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15) (Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15) || Number of peptides = 4 || ambiguous || 72.5% Confident
Q9D819 - (Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene) || Number of peptides = 2 || unambiguous || 72.5% Confident
Q9BUR4 - (Q9BUR4) Hypothetical protein || Number of peptides = 2 || ambiguous || 72.5% Confident
TGR2_MOUSE - (Q62312) TGF-beta receptor type II precursor (EC 2.7.1.37) (TGFR-2) (TGF-beta type II receptor) || Number of peptides = 8 || unambiguous || 72.4% Confident
Q9Z1R1 - (Q9Z1R1) BAT2 || Number of peptides = 6 || unambiguous || 72.2% Confident
Q96L91 - (Q96L91) P400 SWI2/SNF2-related protein || Number of peptides = 3 || unambiguous || 72.2% Confident
P2CG_MOUSE - (Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13) || Number of peptides = 3 || unambiguous || 72.1% Confident
Q96L20 - (Q96L20) Hypothetical protein || Number of peptides = 2 || ambiguous || 72.1% Confident
BCAM_MOUSE - (O35855) Branched-chain amino acid aminotransferase, mitochondrial precursor (EC 2.6.1.42) (BCAT(m)) (Fragment) || Number of peptides = 1 || ambiguous || 72.1% Confident
KIP2_MOUSE - (Q9Z309) Kinase interacting protein 2 (KIP 2) || Number of peptides = 4 || ambiguous || 71.5% Confident
Q96L19 - (Q96L19) Similar to lactate dehydrogenase 1, A chain || Number of peptides = 2 || unambiguous || 70.9% Confident
Q96MZ8 - (Q96MZ8) Hypothetical protein FLJ31638 || Number of peptides = 4 || unambiguous || 70.9% Confident
RL35_HUMAN - (P42766) 60S ribosomal protein L35 || Number of peptides = 4 || unambiguous || 70.7% Confident
Q8VI37 - (Q8VI37) Paxillin alpha || Number of peptides = 1 || unambiguous || 70.7% Confident
TYB4_MOUSE - (P20065) Thymosin beta-4 (T beta 4) || Number of peptides = 4 || ambiguous || 70.5% Confident
HS9B_HUMAN - (P08238) Heat shock protein HSP 90-beta (HSP 84) (HSP 90) || Number of peptides = 10 || unambiguous || 70.5% Confident
STM2_MOUSE - (P83093) Stromal interaction molecule 2 (Fragment) || Number of peptides = 17 || ambiguous || 70.2% Confident
COA1_HUMAN - (Q13085) Acetyl-CoA carboxylase 1 (EC 6.4.1.2) (ACC-alpha) [Includes: Biotin carboxylase (EC 6.3.4.14)] || Number of peptides = 10 || unambiguous || 70.1% Confident
Q9BRU9 - (Q9BRU9) Hypothetical protein || Number of peptides = 2 || unambiguous || 70.1% Confident
K1CJ_MOUSE - (P02535) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (56 kDa cytokeratin) (Keratin, type I cytoskeletal 59 kDa) || Number of peptides = 2 || ambiguous || 70.1% Confident
Q9CUA4 - (Q9CUA4) 4933439C10Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 69.8% Confident
Q9JKT3 - (Q9JKT3) Candidate taste receptor T2R8 || Number of peptides = 4 || unambiguous || 69.8% Confident
N214_HUMAN - (P35658) Nuclear pore complex protein Nup214 (Nucleoporin Nup214) (214 kDa nucleoporin) (CAN protein) || Number of peptides = 4 || unambiguous || 69.8% Confident
FABE_MOUSE - (Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) || Number of peptides = 5 || unambiguous || 69.8% Confident
ITN2_HUMAN - (Q9NZM3) Intersectin 2 (SH3 domain-containing protein 1B) (SH3P18) (SH3P18-like WASP associated protein) || Number of peptides = 5 || unambiguous || 69.7% Confident
Q9DBF1 - (Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1) || Number of peptides = 3 || unambiguous || 69.5% Confident
VAA1_HUMAN - (P38606) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) (Isoform VA68) || Number of peptides = 1 || unambiguous || 69.2% Confident
HUNK_MOUSE - (O88866) Hormonally upregulated neu tumor-associated kinase (EC 2.7.1.-) (Serine/threonine protein kinase MAK-V) || Number of peptides = 3 || unambiguous || 69.2% Confident
Q9Y450 - (Q9Y450) ERFS (HBS1 (S. CEREVISIAE)-like) || Number of peptides = 3 || unambiguous || 68.6% Confident
Q91YT1 - (Q91YT1) Hypothetical 46.2 kDa protein || Number of peptides = 3 || unambiguous || 68.6% Confident
KAPA_MOUSE - (P05132) cAMP-dependent protein kinase, alpha-catalytic subunit (EC 2.7.1.37) (PKA C-alpha) || Number of peptides = 4 || ambiguous || 68.5% Confident
Q9D9H4 - (Q9D9H4) 1700069O15Rik protein || Number of peptides = 1 || ambiguous || 68.5% Confident
Q62141 - (Q62141) Paired amphipathic helix protein SIN3B || Number of peptides = 4 || unambiguous || 68.5% Confident
Q99J35 - (Q99J35) Hypothetical 41.0 kDa protein || Number of peptides = 3 || unambiguous || 68.4% Confident
Q16773 - (Q16773) Glutamine--phenylpyruvate aminotransferase (EC 2.6.1.64) (Glutamine transaminase K) || Number of peptides = 2 || unambiguous || 68.2% Confident
Q96M74 - (Q96M74) Hypothetical protein FLJ32778 || Number of peptides = 2 || unambiguous || 68.0% Confident
AGP2_MOUSE - (O35608) Angiopoietin-2 precursor (ANG-2) || Number of peptides = 1 || unambiguous || 68.0% Confident
PI52_MOUSE - (O70172) Phosphatidylinositol-4-phosphate 5-kinase type II alpha (EC 2.7.1.68) (PIP5KII-alpha) (1-phosphatidylinositol-4-phosphate kinase) (PtdIns(4)P-5-kinase B isoform) (Diphosphoinositide kinase) || Number of peptides = 1 || ambiguous || 67.7% Confident
PHS1_MOUSE - (Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) || Number of peptides = 5 || ambiguous || 67.6% Confident
Q9CXA2 - (Q9CXA2) 2810055F11Rik protein || Number of peptides = 1 || unambiguous || 67.4% Confident
R35A_MOUSE - (O55142) 60S ribosomal protein L35a || Number of peptides = 8 || ambiguous || 67.4% Confident
Q9CVI6 - (Q9CVI6) 1200015E15Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 67.4% Confident
Q8WUC7 - (Q8WUC7) Hypothetical protein (Fragment) || Number of peptides = 3 || unambiguous || 67.4% Confident
Q9H0G5 - (Q9H0G5) Hypothetical protein || Number of peptides = 1 || unambiguous || 67.4% Confident
Q9D0N4 - (Q9D0N4) 1110001I24Rik protein || Number of peptides = 4 || unambiguous || 67.2% Confident
Q9D0M1 - (Q9D0M1) 5730409F23Rik protein || Number of peptides = 1 || ambiguous || 67.1% Confident
GTM5_MOUSE - (P48774) Glutathione S-transferase Mu 5 (EC 2.5.1.18) (GST class-mu 5) (Fibrous sheath component 2) (Fsc2) || Number of peptides = 2 || unambiguous || 67.1% Confident
UBF1_MOUSE - (P25976) Nucleolar transcription factor 1 (Upstream binding factor 1) (UBF-1) || Number of peptides = 3 || ambiguous || 67.1% Confident
PDA4_MOUSE - (P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) || Number of peptides = 5 || unambiguous || 67.1% Confident
AKAC_HUMAN - (Q02952) A-kinase anchor protein 12 (A-kinase anchor protein 250 kDa) (AKAP 250) (Myasthenia gravis autoantigen gravin) || Number of peptides = 7 || unambiguous || 67.0% Confident
SIA9_MOUSE - (O88829) Lactosylceramide alpha-2,3-sialyltransferase (EC 2.4.99.9) (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase) (Ganglioside GM3 synthase) (ST3Gal V) (Sialyltransferase 9) || Number of peptides = 3 || ambiguous || 66.9% Confident
AC15_MOUSE - (P35601) Activator 1 140 kDa subunit (Replication factor C large subunit) (A1 140 kDa subunit) (RF-C 140 kDa subunit) (Activator 1 large subunit) (A1-P145) (Differentiation specific element binding protein) (ISRE-binding protein) || Number of peptides = 6 || unambiguous || 66.6% Confident
O14980 - (O14980) CRM1 protein || Number of peptides = 6 || unambiguous || 66.4% Confident
Q96H84 - (Q96H84) Hypothetical protein || Number of peptides = 4 || unambiguous || 66.3% Confident
G6PI_HUMAN - (P06744) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) (Sperm antigen-36) (SA-36) || Number of peptides = 2 || unambiguous || 66.1% Confident
PPI2_MOUSE - (P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) || Number of peptides = 2 || unambiguous || 66.0% Confident
O94986 - (O94986) Hypothetical protein KIAA0912 (Fragment) || Number of peptides = 10 || unambiguous || 65.9% Confident
Q9D0Q8 - (Q9D0Q8) 2600005K24Rik protein || Number of peptides = 1 || ambiguous || 65.8% Confident
Q9H5R9 - (Q9H5R9) Hypothetical protein FLJ23129 || Number of peptides = 1 || unambiguous || 65.8% Confident
NTC1_HUMAN - (P46531) Neurogenic locus notch homolog protein 1 precursor (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) || Number of peptides = 3 || unambiguous || 65.7% Confident
Q9JKB3 - (Q9JKB3) RNA binding protein MSY4 || Number of peptides = 3 || ambiguous || 65.7% Confident
FAF1_MOUSE - (P54731) FAS-associated factor 1 (FAF1 protein) || Number of peptides = 3 || unambiguous || 65.6% Confident
CLP1_MOUSE - (Q08091) Calponin H1, smooth muscle (Basic calponin) (Calponin 1) || Number of peptides = 3 || ambiguous || 65.5% Confident
Q8R0F2 - (Q8R0F2) Hypothetical 155.6 kDa protein || Number of peptides = 1 || unambiguous || 64.4% Confident
MYO6_HUMAN - (Q9UM54) Myosin VI || Number of peptides = 1 || ambiguous || 64.2% Confident
Q9BQQ4 - (Q9BQQ4) Hypothetical protein KIAA0298 || Number of peptides = 2 || unambiguous || 64.2% Confident
TBCA_MOUSE - (P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A) || Number of peptides = 2 || unambiguous || 64.2% Confident
Q9D7W8 - (Q9D7W8) 2210019E14Rik protein || Number of peptides = 1 || unambiguous || 64.0% Confident
Q8WVJ5 - (Q8WVJ5) Similar to RIKEN cDNA 2310035L15 gene || Number of peptides = 1 || unambiguous || 64.0% Confident
PRI2_MOUSE - (P33610) DNA primase large subunit (EC 2.7.7.-) (DNA primase 58 kDa subunit) (P58) || Number of peptides = 7 || unambiguous || 63.9% Confident
Q8WZ42 - (Q8WZ42) Titin || Number of peptides = 89 || ambiguous || 63.9% Confident
Q8R0H9 - (Q8R0H9) Similar to golgi associated, gamma adaptin ear containing, ARF binding protein 1 || Number of peptides = 1 || unambiguous || 63.9% Confident
Q9DCZ6 - (Q9DCZ6) 2410007D12Rik protein (RIKEN cDNA 2410007D12 gene) || Number of peptides = 1 || unambiguous || 63.8% Confident
HXK2_MOUSE - (O08528) Hexokinase type II (EC 2.7.1.1) (HK II) || Number of peptides = 2 || unambiguous || 63.7% Confident
Q9CT17 - (Q9CT17) 2610019N13Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 63.4% Confident
IPSP_HUMAN - (P05154) Plasma serine protease inhibitor precursor (PCI) (Protein C inhibitor) (Plasminogen activator inhibitor-3) (PAI3) (Acrosomal serine protease inhibitor) || Number of peptides = 3 || unambiguous || 63.4% Confident
NSDL_HUMAN - (Q15738) NAD(P)-dependent steroid dehydrogenase (EC 1.1.1.-) (H105e3 protein) || Number of peptides = 2 || unambiguous || 63.4% Confident
Q9NP81 - (Q9NP81) Seryl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.11) || Number of peptides = 2 || unambiguous || 63.4% Confident
Q9JHK4 - (Q9JHK4) RAB geranylgeranyl transferase alpha subunit (Rab geranylgeranyl transferase, a subunit) || Number of peptides = 4 || unambiguous || 63.2% Confident
CALX_MOUSE - (P35564) Calnexin precursor || Number of peptides = 5 || unambiguous || 63.1% Confident
NU50_MOUSE - (Q9JIH2) Nucleoporin 50 kDa (Nuclear pore-associated protein 60 kDa-like) || Number of peptides = 3 || unambiguous || 63.0% Confident
ABC1_HUMAN - (O95477) ATP-binding cassette, sub-family A, member 1 (ATP-binding cassette transporter 1) (ATP-binding cassette 1) (ABC-1) (Cholesterol efflux regulatory protein) || Number of peptides = 5 || unambiguous || 62.7% Confident
GRK4_HUMAN - (P32298) G protein-coupled receptor kinase GRK4 (EC 2.7.1.-) (ITI1) || Number of peptides = 4 || unambiguous || 62.7% Confident
Q9CSF2 - (Q9CSF2) 2810405K07Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 62.4% Confident
Q8R0K1 - (Q8R0K1) Hypothetical 87.3 kDa protein (Fragment) || Number of peptides = 12 || ambiguous || 62.4% Confident
TDT_MOUSE - (P09838) DNA nucleotidylexotransferase (EC 2.7.7.31) (Terminal addition enzyme) (Terminal deoxynucleotidyltransferase) (TDT) (Terminal transferase) || Number of peptides = 2 || unambiguous || 62.3% Confident
Q9BZB4 - (Q9BZB4) IL-5 promoter REII-region-binding protein || Number of peptides = 4 || ambiguous || 62.2% Confident
FLO1_HUMAN - (P41440) Folate transporter 1 (Placental folate transporter) (FOLT) (Reduced folate carrier protein) (RFC) (Intestinal folate carrier) (IFC-1) || Number of peptides = 3 || ambiguous || 62.2% Confident
LSM5_HUMAN - (Q9Y4Y9) U6 snRNA-associated Sm-like protein LSm5 || Number of peptides = 3 || unambiguous || 62.1% Confident
LKHA_HUMAN - (P09960) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) || Number of peptides = 2 || unambiguous || 62.1% Confident
Q9BYJ0 - (Q9BYJ0) Ksp37 (HBp17-related protein) (Ksp37 protein) || Number of peptides = 3 || unambiguous || 62.0% Confident
Q9CXW7 - (Q9CXW7) 3010033P07Rik protein || Number of peptides = 3 || ambiguous || 62.0% Confident
REQC_MOUSE - (P58269) Zinc-finger protein cer-d4 || Number of peptides = 3 || unambiguous || 61.9% Confident
Q9CQ79 - (Q9CQ79) Palate, lung, and nasal epithelium expressed transcript || Number of peptides = 2 || unambiguous || 61.9% Confident
UBP7_HUMAN - (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15) (Ubiquitin thiolesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus associated ubiquitin-specific protease) || Number of peptides = 7 || unambiguous || 61.8% Confident
Q924A2 - (Q924A2) Capicua protein || Number of peptides = 6 || unambiguous || 61.7% Confident
SNXD_HUMAN - (Q9Y5W8) Sorting nexin 13 (RGS domain- and PHOX domain-containing protein) (RGS-PX1) || Number of peptides = 4 || unambiguous || 61.7% Confident
Q8TE06 - (Q8TE06) SLTP004 || Number of peptides = 1 || unambiguous || 61.6% Confident
Q9HCH5 - (Q9HCH5) Hypothetical protein KIAA1597 (Fragment) || Number of peptides = 3 || unambiguous || 61.5% Confident
HPS4_HUMAN - (Q9NQG7) Hermansky-Pudlak syndrome 4 protein (Light-ear protein homolog) || Number of peptides = 2 || unambiguous || 61.1% Confident
CN2A_HUMAN - (O00408) cGMP-dependent 3',5'-cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP stimulated phosphodiesterase) (CGS-PDE) (cGSPDE) || Number of peptides = 3 || unambiguous || 61.0% Confident
Q9CSV9 - (Q9CSV9) 2610111M19Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 60.9% Confident
Q9ULM3 - (Q9ULM3) Hypothetical protein KIAA1197 (Fragment) || Number of peptides = 3 || unambiguous || 60.8% Confident
Q9NU61 - (Q9NU61) DJ93K22.1 (Novel protein (contains DKFZP564B116)) || Number of peptides = 7 || ambiguous || 60.7% Confident
ITB4_HUMAN - (P16144) Integrin beta-4 precursor (GP150) (CD104 antigen) || Number of peptides = 8 || unambiguous || 60.6% Confident
Q8VCA5 - (Q8VCA5) Similar to transmembrane protease, serine 4 || Number of peptides = 5 || unambiguous || 60.5% Confident
Q9NS81 - (Q9NS81) PEST-containing nuclear protein || Number of peptides = 2 || ambiguous || 60.4% Confident
Q9D0D6 - (Q9D0D6) 2610024N01Rik protein || Number of peptides = 3 || ambiguous || 60.2% Confident
GLGB_HUMAN - (Q04446) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen branching enzyme) (Brancher enzyme) || Number of peptides = 11 || unambiguous || 60.2% Confident
Q9D0U3 - (Q9D0U3) 1190001G19Rik protein || Number of peptides = 1 || ambiguous || 60.2% Confident
ILK1_HUMAN - (Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) || Number of peptides = 1 || ambiguous || 59.8% Confident
Q8R081 - (Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L || Number of peptides = 4 || unambiguous || 59.6% Confident
ARP2_HUMAN - (O15142) Actin-like protein 2 (Actin-related protein 2) || Number of peptides = 3 || unambiguous || 59.3% Confident
Q9EST5 - (Q9EST5) Proliferation related acidic leucine rich protein PAL31 (Similar to acidic protein rich in leucines) || Number of peptides = 6 || unambiguous || 59.2% Confident
MK14_MOUSE - (P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1) || Number of peptides = 3 || ambiguous || 58.9% Confident
Q96A49 - (Q96A49) SYAP1 || Number of peptides = 7 || unambiguous || 58.9% Confident
Q9H7U8 - (Q9H7U8) Hypothetical protein FLJ14235 || Number of peptides = 1 || unambiguous || 58.8% Confident
FSP1_HUMAN - (Q92674) Leucine-rich primary response protein 1 (Follicle-stimulating hormone primary response protein) || Number of peptides = 5 || unambiguous || 58.7% Confident
Q96NJ6 - (Q96NJ6) Hypothetical protein FLJ30726 || Number of peptides = 1 || unambiguous || 58.6% Confident
Q96QC2 - (Q96QC2) Hypothetical protein KIAA0170 || Number of peptides = 12 || unambiguous || 58.5% Confident
UCR1_MOUSE - (Q9CZ13) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor (EC 1.10.2.2) || Number of peptides = 3 || unambiguous || 58.5% Confident
Q8R0M3 - (Q8R0M3) Hypothetical 48.7 kDa protein (Fragment) || Number of peptides = 1 || unambiguous || 58.2% Confident
Q99NH2 - (Q99NH2) PAR-3 180 kDa isoform || Number of peptides = 4 || unambiguous || 58.2% Confident
KNG_MOUSE - (O08677) Kininogen precursor [Contains: Bradykinin] || Number of peptides = 4 || unambiguous || 58.1% Confident
Q96AV0 - (Q96AV0) Hypothetical protein || Number of peptides = 2 || unambiguous || 58.0% Confident
PCFB_HUMAN - (O94913) Pre-mRNA cleavage complex II protein Pcf11 (Fragment) || Number of peptides = 3 || unambiguous || 57.0% Confident
Q99JT4 - (Q99JT4) Hypothetical 4.7 kDa protein || Number of peptides = 1 || unambiguous || 57.0% Confident
Q9CQ21 - (Q9CQ21) 2400002F11Rik protein || Number of peptides = 1 || ambiguous || 56.9% Confident
Q9DBB4 - (Q9DBB4) 1300019C06Rik protein || Number of peptides = 3 || unambiguous || 56.8% Confident
Q9CS64 - (Q9CS64) 5730508B09Rik protein (Fragment) || Number of peptides = 1 || unambiguous || 56.7% Confident
Q9NXM6 - (Q9NXM6) Hypothetical protein FLJ20156 || Number of peptides = 3 || unambiguous || 56.7% Confident
BLM_MOUSE - (O88700) Bloom's syndrome protein homolog (EC 3.6.1.-) (mBLM) || Number of peptides = 4 || unambiguous || 56.7% Confident
PNPH_MOUSE - (P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) || Number of peptides = 1 || unambiguous || 56.4% Confident
Q922B8 - (Q922B8) Similar to DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1 || Number of peptides = 2 || ambiguous || 56.4% Confident
ART1_HUMAN - (Q9NZ08) Adipocyte-derived leucine aminopeptidase precursor (EC 3.4.11.-) (A-LAP) (ARTS-1) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator) || Number of peptides = 4 || ambiguous || 56.4% Confident
Q9Y5T4 - (Q9Y5T4) DNAJ domain-containing protein MCJ (Similar to DNAJ domain-containing) || Number of peptides = 1 || unambiguous || 56.4% Confident
UB5B_HUMAN - (P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) (P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) || Number of peptides = 1 || ambiguous || 56.2% Confident
Q9D303 - (Q9D303) 9130002C22Rik protein || Number of peptides = 2 || unambiguous || 56.2% Confident
MAT3_HUMAN - (P43243) Matrin 3 || Number of peptides = 3 || unambiguous || 56.1% Confident
O60377 - (O60377) P1.11659_5 (Fragment) || Number of peptides = 1 || ambiguous || 56.0% Confident
Q9C0C9 - (Q9C0C9) Hypothetical protein KIAA1734 (Fragment) || Number of peptides = 3 || unambiguous || 56.0% Confident
Q9CXF4 - (Q9CXF4) 4432405K22Rik protein || Number of peptides = 2 || unambiguous || 55.5% Confident
OXRP_HUMAN - (Q9Y4L1) 150 kDa oxygen-regulated protein precursor (Orp150) (Hypoxia up-regulated 1) || Number of peptides = 8 || unambiguous || 55.4% Confident
Q9D2R0 - (Q9D2R0) 2210408B16Rik protein (Acetoacetyl-coenzyme a synthetase) (RIKEN cDNA 2210408B16 gene) || Number of peptides = 1 || ambiguous || 55.1% Confident
SPA1_MOUSE - (P46062) Signal-induced proliferation associated protein 1 (Sipa-1) (GTPase-activating protein Spa-1) || Number of peptides = 4 || unambiguous || 55.0% Confident
BIN1_MOUSE - (O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) || Number of peptides = 3 || unambiguous || 55.0% Confident
Q99K41 - (Q99K41) Similar to elastin microfibril interface located protein || Number of peptides = 9 || unambiguous || 55.0% Confident
Q8R4H4 - (Q8R4H4) Metallocarboxypeptidase A5 || Number of peptides = 3 || unambiguous || 55.0% Confident
SMA4_MOUSE - (P97471) Mothers against decapentaplegic homolog 4 (SMAD 4) (Mothers against DPP homolog 4) (Deletion target in pancreatic carcinoma 4 homolog) (Smad4) || Number of peptides = 1 || ambiguous || 55.0% Confident
O54972 - (O54972) ETO/MTG8-related protein ETO-2 || Number of peptides = 2 || unambiguous || 54.9% Confident
TENX_HUMAN - (P22105) Tenascin-X precursor (TN-X) (Hexabrachion-like) || Number of peptides = 7 || unambiguous || 54.9% Confident
RS2_MOUSE - (P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein) || Number of peptides = 7 || ambiguous || 54.9% Confident
ORC2_MOUSE - (Q60862) Origin recognition complex subunit 2 || Number of peptides = 6 || unambiguous || 54.8% Confident
UBPQ_MOUSE - (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15) (Ubiquitin thiolesterase 26) (Ubiquitin-specific processing protease 26) (Deubiquitinating enzyme 26) || Number of peptides = 5 || unambiguous || 54.8% Confident
VINE_MOUSE - (Q9R1Z8) Vinexin (SH3-containing adapter molecule-1) (SCAM-1) (SH3 domain-containing protein SH3P3) || Number of peptides = 3 || unambiguous || 54.6% Confident
Q8VCE0 - (Q8VCE0) ATPase, Na+K+ transporting, alpha 3 subunit || Number of peptides = 3 || unambiguous || 54.5% Confident
Q9CWA7 - (Q9CWA7) 0610010F05Rik protein (Fragment) || Number of peptides = 3 || unambiguous || 54.4% Confident
MU18_HUMAN - (P43121) Cell surface glycoprotein MUC18 precursor (Melanoma-associated antigen MUC18) (Melanoma-associated antigen A32) (S-endo 1 endothelial-associated antigen) (CD146 antigen) (Melanoma adhesion molecule) || Number of peptides = 4 || unambiguous || 54.4% Confident
FRZB_MOUSE - (P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3) || Number of peptides = 2 || unambiguous || 54.4% Confident
Q9D2I8 - (Q9D2I8) 4930430J20Rik protein || Number of peptides = 2 || unambiguous || 54.4% Confident
Q96P55 - (Q96P55) Putative ion channel protein CATSPER2 variant 2 || Number of peptides = 2 || unambiguous || 54.2% Confident
Q9JHC9 - (Q9JHC9) Ets family transcription factor ELF2A2 || Number of peptides = 3 || unambiguous || 54.2% Confident
Q8VEZ6 - (Q8VEZ6) Olfactory receptor MOR135-28 || Number of peptides = 1 || unambiguous || 54.2% Confident
O15021 - (O15021) Hypothetical protein KIAA0303 (Fragment) || Number of peptides = 5 || unambiguous || 54.0% Confident
DPD2_MOUSE - (O35654) DNA polymerase delta subunit 2 (EC 2.7.7.7) || Number of peptides = 1 || unambiguous || 54.0% Confident
Q8VEY7 - (Q8VEY7) Olfactory receptor MOR276-2 || Number of peptides = 1 || unambiguous || 53.9% Confident
Q8R2Y6 - (Q8R2Y6) Hypothetical 35.4 kDa protein || Number of peptides = 8 || ambiguous || 53.7% Confident
Q9CZJ9 - (Q9CZJ9) 2700075B01Rik protein || Number of peptides = 1 || unambiguous || 53.7% Confident
Q15198 - (Q15198) PDGF receptor beta-like tumor suppressor (Similar to platelet-derived growth factor receptor-like) || Number of peptides = 9 || unambiguous || 53.7% Confident
RET_HUMAN - (P07949) Proto-oncogene tyrosine-protein kinase receptor ret precursor (EC 2.7.1.112) (C-ret) || Number of peptides = 2 || ambiguous || 53.7% Confident
TIE1_MOUSE - (Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112) || Number of peptides = 2 || ambiguous || 53.4% Confident
Q9NXE8 - (Q9NXE8) Hypothetical protein FLJ20291 || Number of peptides = 4 || unambiguous || 53.3% Confident
Q9UJR0 - (Q9UJR0) DJ1043E3.1 (Novel protein) (Fragment) || Number of peptides = 1 || unambiguous || 53.1% Confident
A2AA_HUMAN - (P08913) Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor) (Alpha-2AAR subtype C10) || Number of peptides = 1 || unambiguous || 53.0% Confident
Q9EQZ7 - (Q9EQZ7) Rim2 || Number of peptides = 7 || unambiguous || 53.0% Confident
RA18_MOUSE - (Q9QXK2) Postreplication repair protein RAD18 (mRAD18Sc) || Number of peptides = 7 || unambiguous || 52.9% Confident
CNE3_HUMAN - (O75131) Copine III || Number of peptides = 4 || unambiguous || 52.8% Confident
Q9NQ86 - (Q9NQ86) Zinc-binding protein || Number of peptides = 2 || unambiguous || 52.8% Confident
Q9H5K8 - (Q9H5K8) Hypothetical protein FLJ23342 || Number of peptides = 3 || unambiguous || 52.8% Confident
Q9DAS6 - (Q9DAS6) Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600029O15, full insert sequence || Number of peptides = 1 || unambiguous || 52.8% Confident
PGCV_HUMAN - (P13611) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP) || Number of peptides = 10 || unambiguous || 52.7% Confident
Q9P2L8 - (Q9P2L8) Hypothetical protein KIAA1328 (Fragment) || Number of peptides = 1 || unambiguous || 52.6% Confident
Q9BY44 - (Q9BY44) CDA02 || Number of peptides = 4 || unambiguous || 52.6% Confident
Q8QZX2 - (Q8QZX2) Similar to hypothetical protein MGC4701 (Hypothetical 66.3 kDa protein) || Number of peptides = 3 || unambiguous || 52.4% Confident
ABCR_HUMAN - (P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein) || Number of peptides = 7 || unambiguous || 52.4% Confident
Q99K43 - (Q99K43) Similar to protein regulator of cytokinesis 1 || Number of peptides = 7 || unambiguous || 52.3% Confident
Q9UPX4 - (Q9UPX4) Hypothetical protein KIAA1026 (Fragment) || Number of peptides = 2 || unambiguous || 52.1% Confident
TUL2_HUMAN - (O00295) Tubby related protein 2 (Tubby-like protein 2) || Number of peptides = 2 || unambiguous || 52.0% Confident
RS9_HUMAN - (P46781) 40S ribosomal protein S9 || Number of peptides = 3 || unambiguous || 52.0% Confident
ABE1_HUMAN - (Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68) (Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68) || Number of peptides = 2 || ambiguous || 51.9% Confident
CDNC_MOUSE - (P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2) || Number of peptides = 3 || ambiguous || 51.9% Confident
PA1G_MOUSE - (Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) || Number of peptides = 9 || unambiguous || 51.8% Confident
Q9H6H5 - (Q9H6H5) Hypothetical protein FLJ22276 || Number of peptides = 1 || ambiguous || 51.7% Confident
Q9CV19 - (Q9CV19) 2310057K23Rik protein (Fragment) || Number of peptides = 1 || ambiguous || 51.7% Confident
DLP2_HUMAN - (Q9P1A6) Disks large-associated protein 2 (DAP-2) (SAP90/PSD-95-associated protein 2) (SAPAP2) (PSD-95/SAP90 binding protein 2) (Fragment) || Number of peptides = 7 || unambiguous || 51.6% Confident
IN35_HUMAN - (P80217) Interferon-induced 35 kDa protein (IFP 35) || Number of peptides = 2 || unambiguous || 51.6% Confident
Q8VGZ1 - (Q8VGZ1) Olfactory receptor MOR14-4 || Number of peptides = 3 || unambiguous || 51.6% Confident
T2EA_MOUSE - (Q9D0D5) Transcription initiation factor IIE, alpha subunit (TFIIE-alpha) (General transcription factor IIE 56 kDa subunit) || Number of peptides = 7 || unambiguous || 51.6% Confident
Q99LU0 - (Q99LU0) Similar to CHMP1.5 protein || Number of peptides = 1 || ambiguous || 51.6% Confident
Q8VCN4 - (Q8VCN4) Hypothetical 83.4 kDa protein || Number of peptides = 4 || unambiguous || 51.4% Confident
Q9BQX0 - (Q9BQX0) DJ691N24.1.6 (KIAA0980 protein, isoform 6) (Fragment) || Number of peptides = 2 || ambiguous || 51.4% Confident
A1G1_MOUSE - (P22892) Adapter-related protein complex 1 gamma 1 subunit (Gamma-adaptin) (Adaptor protein complex AP-1 gamma-1 subunit) (Golgi adaptor HA1/AP1 adaptin gamma-1 subunit) (Clathrin assembly protein complex 1 gamma-1 large chain) || Number of peptides = 4 || ambiguous || 51.3% Confident
M10L_HUMAN - (Q9BXT6) Moloney leukemia virus 10-like protein 1 (MOV10-like 1) || Number of peptides = 2 || unambiguous || 51.2% Confident
ITAG_HUMAN - (O75578) Integrin alpha-10 precursor || Number of peptides = 3 || unambiguous || 51.0% Confident
SI8A_HUMAN - (Q92185) Alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase (EC 2.4.99.8) (Ganglioside GD3 synthase) (Ganglioside GT3 synthase) (Alpha-2,8-sialyltransferase 8A) (ST8Sia I) || Number of peptides = 1 || unambiguous || 51.0% Confident
MYBB_MOUSE - (P48972) Myb-related protein B (B-Myb) || Number of peptides = 4 || unambiguous || 50.9% Confident
Q9P0H7 - (Q9P0H7) TIP120 protein || Number of peptides = 3 || ambiguous || 50.9% Confident
Q91ZE5 - (Q91ZE5) EGF-like module-containing mucin-like receptor EMR4 || Number of peptides = 3 || ambiguous || 50.8% Confident
POL2_MOUSE - (P11369) Retrovirus-related POL polyprotein [Contains: Reverse transcriptase (EC 2.7.7.49); Endonuclease] || Number of peptides = 3 || ambiguous || 50.8% Confident
Q9CXY2 - (Q9CXY2) 1110049F12Rik protein || Number of peptides = 3 || unambiguous || 50.8% Confident
Q9D262 - (Q9D262) 9230110F15Rik protein || Number of peptides = 3 || unambiguous || 50.7% Confident
TRDN_HUMAN - (Q13061) Triadin || Number of peptides = 2 || unambiguous || 50.7% Confident
RP1_HUMAN - (P56715) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein) (Retinitis pigmentosa 1 protein) || Number of peptides = 5 || unambiguous || 50.7% Confident
H2AG_HUMAN - (P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) || Number of peptides = 5 || ambiguous || 50.6% Confident
P70392 - (P70392) Guanine nucleotide release/exchange factor Ras-GRF2 || Number of peptides = 1 || ambiguous || 50.3% Confident
Q9D1M8 - (Q9D1M8) Cysteine-rich protein 2 || Number of peptides = 4 || unambiguous || 50.1% Confident
Q9DBZ8 - (Q9DBZ8) 1200008O12Rik protein || Number of peptides = 1 || unambiguous || 50.1% Confident
Q9NPE9 - (Q9NPE9) Hypothetical protein FLJ11007 (HSPC055) (Hypothetical protein FLJ10027) (Similar to HSPC055 protein) || Number of peptides = 3 || unambiguous || 50.1% Confident
Q9JLJ2 - (Q9JLJ2) 4-trimethylaminobutyraldehyde dehydrogenase (EC 1.2.1.47) (Aldehyde dehydrogenase 9A) || Number of peptides = 2 || unambiguous || 50.1% Confident
Q9Y6L7 - (Q9Y6L7) Tolloid-like 2 protein || Number of peptides = 4 || unambiguous || 50.1% Confident
Q9Z1N9 - (Q9Z1N9) Renal munc13 || Number of peptides = 4 || unambiguous || 50.0% Confident
<font color="navy"><h1>RUN 12 </h1></font>D AE061201_sample18_28_11  
DTASelect v1.8
/data/search/2002-TK-LungDevo/lung_E14_cyto_1
/data/dbase/mousehumanEBI0802.fasta
-n

Locus Key:

Validation StatusLocusConfidence PercentageSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Spectrum Key:

UniqueFilenameXCorrDeltCNPrecursor M+H+ MassRank by SpIon ProportionCopiesSequence
 
URBB7_MOUSE99.6%61411.8%425477905.0(Q60973) Histone acetyltransferase type B subunit 2 (Retinoblastoma binding protein p46) (Retinoblastoma-binding protein 7) (RBBP-7) 
	TK270802_E14_cyto_2D_step11.3569.3569.2	1.648	0.3425	2775.96	1	2610.0%	2	K.DYALHWLVLGTHTSDEQNHLVVAR.V
	TK270802_E14_cyto_2D_step08.2155.2155.2	1.6095	0.336	1792.65	1	3670.0%	3	K.HPAKPDPSGECNPDLR.L
	TK270802_E14_cyto_2D_step15.2490.2490.1	0.6135	0.0991	1239.2	101	1670.0%	1	K.LKLHTFESHK.D
UPSD3_MOUSE99.6%798.1%530606998.2(P14685) 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (Proteasome subunit p58) (Transplantation antigen P91A) (Tum-P91A antigen) 
	TK270802_E14_cyto_2D_step07.2206.2206.1	1.5173	0.2292	1055.77	1	6110.0%	1	K.APQHTAVGFK.Q
	TK270802_E14_cyto_2D_step08.2439.2439.1	1.3998	0.1942	730.85	1	8000.0%	1	R.SFLHAR.L
*	TK270802_E14_cyto_2D_step07.2798.2798.1	2.3241	0.4318	1423.76	1	5000.0%	2	K.AVHGFFTSNNATR.D
	TK270802_E14_cyto_2D_step06.2702.2702.1	1.3646	0.2813	1049.94	1	6430.0%	1	R.LNHYVLYK.A
	TK270802_E14_cyto_2D_step13.1976.1976.2	1.388	0.3892	1184.57	1	7000.0%	1	R.KAPQHTAVGFK.Q
	TK270802_E14_cyto_2D_step06.1763.1763.1	0.8761	0.0238	610.89	11	6250.0%	1	R.HNVIK.T
UQ9QYF499.6%5519.1%561625447.6(Q9QYF4) SYNCRIP protein 
	TK270802_E14_cyto_2D_step13.3177.3177.3	1.5595	0.0242	2883.67	23	1600.0%	1	K.VKVWGNVGTVEWADPIEDPDPEVMAK.V
	TK270802_E14_cyto_2D_step01.1368.1368.1	1.4678	0.2064	1142.81	1	4440.0%	1	K.DSDLSHVQNK.S
	TK270802_E14_cyto_2D_step08.1844.1844.3	1.525	0.0906	1883.63	36	2000.0%	1	K.EAAQEAVKLYNNHEIR.S
	TK270802_E14_cyto_2D_step07.5098.5098.3	1.1179	0.1135	4511.3	2	910.0%	1	-.MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEK.L
	TK270802_E14_cyto_2D_step01.4290.4290.1	2.7252	0.4384	1596.35	1	6250.0%	1	R.DLFEDELVPLFEK.A
USERA_MOUSE99.6%466.6%485514496.9(Q61753) D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (3-PGDH) (A10) (Fragment) 
	TK270802_E14_cyto_2D_step02.2339.2339.1	1.1188	0.1346	472.56	10	8330.0%	1	K.LLVK.E
*	TK270802_E14_cyto_2D_step12.2693.2693.2	2.0298	0.3543	1087.63	1	5620.0%	1	R.RGQPLLVFR.A
	TK270802_E14_cyto_2D_step06.2822.2822.2	4.3766	0.5964	2049.42	1	5560.0%	2	R.ALVDHENVISCPHLGASTK.E
UO5520199.6%669.4%10821206645.0(O55201) Chromatin structural protein homolog Supt5hp (Similar to suppressor of Ty (S.cerevisiae) 5 homolog) 
	TK270802_E14_cyto_2D_step09.3532.3532.2	0.8628	0.061	1637.79	83	1430.0%	1	R.TPMYGSQTPLQDGSR.T
	TK270802_E14_cyto_2D_step13.1105.1105.3	1.1994	0.0835	2292.53	30	1390.0%	1	R.LGYWNQQMVPIKEMTDVLK.V
	TK270802_E14_cyto_2D_step13.2294.2294.1	1.7002	0.4223	1135.09	1	5500.0%	1	R.HLVLAGGSKPR.D
*	TK270802_E14_cyto_2D_step12.3051.3051.3	1.1298	0.0079	3580.69	1	1830.0%	1	-.MSDSEDSNFSEEEDSERSSEAEEAEVEEDQR.S
	TK270802_E14_cyto_2D_step06.2821.2821.1	1.1852	0.0101	1417.94	46	3500.0%	1	R.EEELGEYYMKK.Y
	TK270802_E14_cyto_2D_step08.2208.2208.2	0.9039	0.0915	1654.39	38	2500.0%	1	R.TPHYGSQTPLHDGSR.T
UAMPL_MOUSE99.6%7919.7%487526197.0(Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) 
	TK270802_E14_cyto_2D_step05.4031.4031.2	3.0754	0.5594	1848.99	1	5330.0%	1	R.LILADALCYAHTFNPK.V
*	TK270802_E14_cyto_2D_step07.3170.3170.1	0.9869	0.1849	1165.17	65	2500.0%	1	-.TKGLVLGIYAK.D
	TK270802_E14_cyto_2D_step01.1899.1899.1	1.9821	0.3763	1574.13	1	4230.0%	1	R.SAGVDDQENWHEGK.E
	TK270802_E14_cyto_2D_step03.5192.5192.3	1.1119	0.0465	3943.27	2	990.0%	1	R.ADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGK.A
	TK270802_E14_cyto_2D_step06.3098.3098.1	1.6604	0.2467	1195.8	1	4380.0%	2	R.MPLFEHYTR.Q
	TK270802_E14_cyto_2D_step03.2028.2028.1	1.362	0.201	861.97	2	5830.0%	1	R.EFVTHTK.W
UO7543399.6%4411.0%591682867.0(O75433) Cell division cycle protein 23 (CDC23) (Cell division cycle 23, yeast, homolog) 
	TK270802_E14_cyto_2D_step13.2125.2125.1	1.6943	0.451	1241.86	1	6000.0%	1	R.AAHFLHGCNSK.K
	TK270802_E14_cyto_2D_step04.0569.0569.2	0.9863	0.0782	2842.82	3	1150.0%	1	-.MVPVAVTAAVAPVLSINSDFSDLREIK.K
*	TK270802_E14_cyto_2D_step04.1910.1910.1	1.2597	0.0295	811.33	58	5000.0%	1	R.HAIEVNK.R
*	TK270802_E14_cyto_2D_step13.3388.3388.2	1.5182	0.2091	2363.4	8	2110.0%	1	K.LAKLHEQLTESEQAAQCYIK.Y
UCNBP_MOUSE99.6%71327.1%170187427.7(P53996) Cellular nucleic acid binding protein (CNBP) 
	TK270802_E14_cyto_2D_step03.1958.1958.1	2.5642	0.5133	1434.74	1	5830.0%	2	R.CGETGHVAINCSK.T
	TK270802_E14_cyto_2D_step07.1898.1898.1	0.9595	0.0698	715.67	31	5000.0%	2	R.SGHWAR.E
	TK270802_E14_cyto_2D_step08.2096.2096.2	1.9918	0.2411	1850.95	1	3930.0%	2	R.EQCCYNCGKPGHLAR.D
	TK270802_E14_cyto_2D_step04.2393.2393.1	1.6821	0.1602	1485.9	32	3180.0%	1	K.CYSCGEFGHIQK.D
UTCPQ_MOUSE99.6%152720.6%548595565.6(P42932) T-complex protein 1, theta subunit (TCP-1-theta) (CCT-theta) 
	TK270802_E14_cyto_2D_step04.2993.2993.1	2.3228	0.4447	1310.1	1	6000.0%	2	K.HFSGLEEAVYR.N
*	TK270802_E14_cyto_2D_step04.3238.3238.2	1.8998	0.2377	1628.58	1	4620.0%	1	K.AHEILPELVCCSAK.N
*	TK270802_E14_cyto_2D_step04.1990.1990.1	1.3522	0.1321	1174.77	9	4440.0%	1	K.LYSVHQEGNK.N
*	TK270802_E14_cyto_2D_step03.2650.2650.1	2.7988	0.3573	1216.83	1	6000.0%	2	K.VADIALHYANK.Y
*	TK270802_E14_cyto_2D_step12.4753.4753.2	0.9591	0.0328	2612.51	146	1300.0%	2	K.LYSVHQEGNKNVGLDIEAEVPAVK.D
*	TK270802_E14_cyto_2D_step10.3047.3047.2	1.6105	0.2654	1758.88	1	5710.0%	1	K.KAHEILPELVCCSAK.N
*	TK270802_E14_cyto_2D_step07.3765.3765.2	3.0298	0.4481	1897.32	1	4120.0%	3	K.ILGSGIYSSSVLHGMVFK.K
	TK270802_E14_cyto_2D_step03.3147.3147.1	2.0583	0.1551	962.96	1	6880.0%	1	K.APGFAQMLK.D
*	TK270802_E14_cyto_2D_step03.4932.4932.1	1.1524	0.0718	1570.19	4	3850.0%	1	K.DMLEASILDTYLGK.Y
	TK270802_E14_cyto_2D_step05.3174.3174.1	1.7073	0.3235	1279.11	1	6000.0%	1	K.KFAEAFEAIPR.A
UARF1_HUMAN99.6%156536.7%180205666.8(P32889) ADP-ribosylation factor 1 (P32889) ADP-ribosylation factor 1 
	TK270802_E14_cyto_2D_step10.3415.3415.2	3.1895	0.428	2155.87	1	4710.0%	6	R.HYFQNTQGLIFVVDSNDR.E
	TK270802_E14_cyto_2D_step01.2944.2944.1	1.3461	0.2239	1088.95	11	4500.0%	1	R.ILMVGLDAAGK.T
	TK270802_E14_cyto_2D_step12.2467.2467.2	1.4831	0.0742	843.02	14	7000.0%	1	K.IRPLWR.H
	TK270802_E14_cyto_2D_step02.3348.3348.1	2.1213	0.3661	1091.97	1	6110.0%	5	R.DAVLLVFANK.Q
	TK270802_E14_cyto_2D_step01.3391.3391.1	1.9098	0.2734	1567.86	1	4620.0%	1	K.NISFTVWDVGGQDK.I
	TK270802_E14_cyto_2D_step09.2556.2556.1	1.3818	0.0373	797.54	1	6670.0%	1	K.LGLHSLR.H
UKPY1_HUMAN99.6%6363.2%530578067.8(P14618) Pyruvate kinase, M1 isozyme (EC 2.7.1.40) (Pyruvate kinase muscle isozyme) (Cytosolic thyroid hormone-binding protein) (CTHBP) (THBP1) 
	TK270802_E14_cyto_2D_step10.3847.3847.2	3.336	0.4711	1880.67	1	6880.0%	6	R.AGKPVICATQMLESMIK.K
UQ9CY8299.6%357.2%277321054.2(Q9CY82) 5730420M11Rik protein 
	TK270802_E14_cyto_2D_step05.2066.2066.1	1.6152	0.0811	817.03	34	7500.0%	1	K.RSELIAK.I
	TK270802_E14_cyto_2D_step01.2174.2174.1	2.079	0.4479	1448.85	1	5830.0%	2	K.EFHLNESGDPSSK.S
UDYL1_HUMAN99.6%72120.2%89103667.4(Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (Q15701) Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) 
	TK270802_E14_cyto_2D_step03.2199.2199.1	1.5953	0.1902	769.7	3	7500.0%	2	K.DIAAHIK.K
	TK270802_E14_cyto_2D_step03.2538.2538.1	2.4016	0.4506	1284.92	1	5500.0%	4	R.NFGSYVTHETK.H
UTALI_MOUSE99.6%24588.6%25412698316.1(P26039) Talin 
	TK270802_E14_cyto_2D_step01.4128.4128.1	0.7336	0.0407	1456.3	73	1670.0%	1	K.GTRALEATTEHIR.Q
	TK270802_E14_cyto_2D_step04.2726.2726.2	0.8516	0.1133	2928.86	3	1670.0%	1	R.SGASGPENFQVGSMPPAQQQITSGQMHR.G
	TK270802_E14_cyto_2D_step01.2514.2514.1	2.0643	0.499	1546.9	1	5380.0%	1	R.DDILNGSHPVSFDK.A
	TK270802_E14_cyto_2D_step03.2279.2279.1	1.5484	0.1607	1140.99	20	3330.0%	1	R.ALEATTEHIR.Q
*	TK270802_E14_cyto_2D_step01.4130.4130.3	0.8033	0.1431	3914.38	211	340.0%	1	K.AHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVR.Q
*	TK270802_E14_cyto_2D_step04.4438.4438.2	1.7027	0.0028	2967.22	1	1920.0%	5	R.YDQATDTILTVTENIFSSMGDAGEMVR.Q
	TK270802_E14_cyto_2D_step01.2595.2595.1	0.9639	0.0057	740.96	22	4170.0%	1	R.ALAVNPR.D
*	TK270802_E14_cyto_2D_step05.2182.2182.1	1.0644	0.0445	860.02	9	4290.0%	1	R.TANPTAKR.Q
*	TK270802_E14_cyto_2D_step03.2463.2463.1	2.4553	0.3538	1500.74	1	5770.0%	3	R.VQELGHGCSALVTK.A
	TK270802_E14_cyto_2D_step07.2874.2874.1	1.8499	0.3488	1337.91	1	4580.0%	3	K.VSHVLAALQAGNR.G
	TK270802_E14_cyto_2D_step05.2822.2822.2	3.6672	0.4348	1714.17	1	6790.0%	1	K.TLSHPQQMALLDQTK.T
	TK270802_E14_cyto_2D_step09.4199.4199.2	1.3394	0.3168	2093.97	1	2250.0%	2	R.GVGAAATAVTQALNELLQHVK.A
	TK270802_E14_cyto_2D_step05.3195.3195.1	1.714	0.3989	1380.22	1	5000.0%	1	K.VEHGSVALPAIMR.S
	TK270802_E14_cyto_2D_step02.2078.2078.1	1.0639	0.0107	484.81	6	8330.0%	1	K.LVPR.L
	TK270802_E14_cyto_2D_step07.3700.3700.2	0.8496	0.112	3155.11	2	1500.0%	1	R.MVAAATNNLCEAANAAVQGHASQEKLISSAK.Q
UG3P_MOUSE99.6%104177856.0%332356798.2(P16858) Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) 
*	TK270802_E14_cyto_2D_step01.2122.2122.1	2.4613	0.3737	1371.9	2	4290.0%	3	R.GAAQNIIPASTGAAK.A
*	TK270802_E14_cyto_2D_step03.3802.3802.2	4.5194	0.6573	2295.51	1	5500.0%	35	K.WGEAGAEYVVESTGVFTTMEK.A
	TK270802_E14_cyto_2D_step01.2823.2823.2	2.4651	0.2211	1558.66	1	5380.0%	1	R.VPTPNVSVVDLTCR.L
	TK270802_E14_cyto_2D_step12.2987.2987.2	1.8626	0.2517	2373.43	1	3100.0%	12	K.RVIISAPSADAPMFVMGVNHEK.Y
*	TK270802_E14_cyto_2D_step01.0430.0430.1	1.5919	0.188	708.97	1	7500.0%	2	R.AAICSGK.V
	TK270802_E14_cyto_2D_step01.0464.0464.1	1.9943	0.0438	783.68	2	8000.0%	1	K.YDDIKK.V
*	TK270802_E14_cyto_2D_step04.3645.3645.2	1.3734	0.256	1631.26	2	3460.0%	5	K.LVINGKPITIFQER.D
	TK270802_E14_cyto_2D_step01.2823.2823.3	2.3596	0.2339	2337.49	1	2620.0%	1	K.LTGMAFRVPTPNVSVVDLTCR.L
	TK270802_E14_cyto_2D_step06.1707.1707.1	1.1484	0.0824	598.45	3	6000.0%	5	K.AGAHLK.G
	TK270802_E14_cyto_2D_step04.3814.3814.2	2.1749	0.4333	2216.47	1	4500.0%	3	R.VIISAPSADAPMFVMGVNHEK.Y
	TK270802_E14_cyto_2D_step12.4464.4464.2	2.6248	0.5785	2599.75	1	3040.0%	13	K.VIHDNFGIVEGLMTTVHAITATQK.T
	TK270802_E14_cyto_2D_step01.2422.2422.1	0.895	0.0763	797.12	10	5830.0%	1	K.LTGMAFR.V
*	TK270802_E14_cyto_2D_step12.3496.3496.3	1.5268	0.155	4054.76	7	1220.0%	11	K.GILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVK.L
*	TK270802_E14_cyto_2D_step05.3697.3697.2	1.194	0.0701	2298.81	28	2110.0%	2	K.LVINGKPITIFQERDPTNIK.W
	TK270802_E14_cyto_2D_step01.0517.0517.1	1.1987	0.1052	740.64	1	6000.0%	1	K.YDNSLK.I
UUBA1_MOUSE99.6%223819.8%10581178095.7(Q02053) Ubiquitin-activating enzyme E1 1 
	TK270802_E14_cyto_2D_step07.2301.2301.1	1.5057	0.0486	622.91	2	7500.0%	1	K.KISFK.S
	TK270802_E14_cyto_2D_step01.4430.4430.2	1.7305	0.1337	2732.71	4	1920.0%	1	R.KLAYVAAGDLAPINAFIGGLAAQEVMK.A
	TK270802_E14_cyto_2D_step01.1754.1754.1	1.1232	0.0613	828.97	46	4290.0%	1	K.ATLPSPDK.L
	TK270802_E14_cyto_2D_step07.3756.3756.2	1.8909	0.2866	2528.12	1	3180.0%	1	R.QLLHNFPPDQLTSSGAPFWSGPK.R
	TK270802_E14_cyto_2D_step05.2663.2663.2	2.5087	0.3683	1246.17	1	7730.0%	1	R.KPLLESGTLGTK.G
	TK270802_E14_cyto_2D_step15.2118.2118.3	1.4176	0.0528	2468.61	22	1430.0%	1	K.LEITMLSQGVSMLYSFFMPAAK.L
*	TK270802_E14_cyto_2D_step04.2000.2000.1	1.5821	0.1611	994.06	4	5000.0%	1	R.VGEFCHSR.G
*	TK270802_E14_cyto_2D_step11.4102.4102.3	1.2868	0.036	4384.38	12	1090.0%	2	R.LAELNSYVPVTAYTGPLVEDFLSSFQVVVLTNSPLEAQLR.V
	TK270802_E14_cyto_2D_step05.3776.3776.2	2.8289	0.4146	1437.97	1	7500.0%	1	R.QFLFRPWDVTK.L
	TK270802_E14_cyto_2D_step06.3707.3707.2	2.2924	0.4975	1699.88	1	5380.0%	2	K.NFPNAIEHTLQWAR.D
*	TK270802_E14_cyto_2D_step05.2557.2557.2	3.1148	0.4537	1717.99	1	5770.0%	1	R.QMNPYIQVTSHQNR.V
	TK270802_E14_cyto_2D_step04.2053.2053.2	2.6896	0.5893	1403.84	1	7730.0%	1	K.VVQGHQQLDSYK.N
	TK270802_E14_cyto_2D_step03.2472.2472.1	1.2302	0.3458	561.89	1	7500.0%	1	K.LPGFK.M
	TK270802_E14_cyto_2D_step01.2883.2883.1	1.3055	0.234	985.87	2	5710.0%	1	R.DEFEGLFK.Q
UDEST_MOUSE99.6%82619.4%165185228.0(Q9R0P5) Destrin (Actin-depolymerizing factor) (ADF) 
*	TK270802_E14_cyto_2D_step10.4101.4101.2	1.6259	0.3079	2079.86	3	2810.0%	3	R.KEELMFFLWAPEQAPLK.S
	TK270802_E14_cyto_2D_step06.2890.2890.1	1.8854	0.1049	1059.86	9	5620.0%	4	K.HFVGMLPEK.D
*	TK270802_E14_cyto_2D_step08.2478.2478.1	1.0324	0.0242	689.88	9	5000.0%	1	K.KFPGIK.H
UPUR9_MOUSE99.6%132124.5%592641576.8(Q9CWJ9) Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] 
	TK270802_E14_cyto_2D_step03.3508.3508.2	1.3702	0.2614	2036.22	1	4380.0%	1	K.AFTHTAQYDEAISDYFR.K
*	TK270802_E14_cyto_2D_step04.2694.2694.2	4.6494	0.6501	1864.57	1	6670.0%	1	K.HVSPAGAAVGVPLSEDEAR.V
*	TK270802_E14_cyto_2D_step07.2233.2233.1	1.0292	0.021	581.85	5	6250.0%	1	R.HLALK.A
	TK270802_E14_cyto_2D_step07.2000.2000.1	0.8255	0.1205	553.88	9	6670.0%	1	R.LFHH.-
	TK270802_E14_cyto_2D_step13.2700.2700.1	1.899	0.2694	1357.94	1	4580.0%	3	K.TLHPAVHAGILAR.N
*	TK270802_E14_cyto_2D_step03.3868.3868.1	1.1691	0.2263	1531.58	1	3750.0%	1	R.SLASLGLSLVASGGTAK.A
*	TK270802_E14_cyto_2D_step04.3768.3768.2	1.3655	0.0089	2273.71	15	2370.0%	1	K.EWVDKLSGVSVSSDAFFPFR.D
*	TK270802_E14_cyto_2D_step12.2647.2647.3	1.3812	0.1456	2554.51	12	1980.0%	1	K.TVASPDVTVEAAVEQIDIGGVTLLR.A
*	TK270802_E14_cyto_2D_step11.4191.4191.2	0.7577	0.0056	2688.99	130	1670.0%	1	K.YTQSNSVCYAKDGQVIGIGAGQQSR.I
UDHCA_MOUSE99.6%91722.1%276305977.8(P48758) Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase 1) 
*	TK270802_E14_cyto_2D_step06.2205.2205.1	1.1295	0.1643	972.58	13	5000.0%	1	K.LQAEGLSPR.F
*	TK270802_E14_cyto_2D_step03.2763.2763.2	3.3626	0.5526	1804.31	1	5940.0%	1	K.GVHAEEGWPNSAYGVTK.I
*	TK270802_E14_cyto_2D_step04.2874.2874.1	1.9799	0.2987	1584.94	1	5830.0%	2	R.FHQLDIDNPQSIR.A
	TK270802_E14_cyto_2D_step06.3025.3025.2	0.8734	0.0053	2414.76	33	1250.0%	1	R.SETITEEELVGLMNKFVEDTK.K
*	TK270802_E14_cyto_2D_step14.2414.2414.2	0.8038	0.0743	1933.27	83	1760.0%	3	K.KGVHAEEGWPNSAYGVTK.I
UFBL1_MOUSE99.6%112.4%705780575.2(Q08879) Fibulin-1 precursor (Basement-membrane protein 90) (BM-90) 
*	TK270802_E14_cyto_2D_step12.3044.3044.2	2.9213	0.5845	1907.41	1	5310.0%	1	R.DPVHTVSHTVISLPTFR.E
UQ8R57499.6%226.0%369408817.2(Q8R574) Phosphoribosyl pyrophosphate synthetase-associated protein 2 
	TK270802_E14_cyto_2D_step06.4013.4013.2	2.5541	0.551	1817.55	1	5000.0%	1	R.SVAAIHPSLEIPMLIPK.E
	TK270802_E14_cyto_2D_step05.1571.1571.1	0.8655	3.0E-4	616.67	17	5000.0%	1	K.KIAER.L
UUBP5_MOUSE99.6%8109.2%858958335.0(P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) (Ubiquitin thiolesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) 
*	TK270802_E14_cyto_2D_step07.2412.2412.1	1.6305	0.0179	729.95	2	8000.0%	1	K.HAFNLK.Q
	TK270802_E14_cyto_2D_step03.2539.2539.2	3.8159	0.4666	1447.05	1	7270.0%	1	R.KQEVQAWDGEVR.Q
	TK270802_E14_cyto_2D_step05.2002.2002.1	1.2795	0.2136	1044.9	13	4380.0%	1	K.GHPEFSTNR.Q
	TK270802_E14_cyto_2D_step01.3870.3870.1	1.1518	0.0726	1417.61	21	3640.0%	2	K.IVILPDYLEIAR.D
	TK270802_E14_cyto_2D_step06.2993.2993.1	0.6702	0.0145	1543.81	29	1670.0%	1	R.FASFPDYLVIQIK.K
*	TK270802_E14_cyto_2D_step06.3033.3033.2	3.5439	0.5345	2828.15	1	4040.0%	1	K.LGHGLLSGEYSKPALESGDGEQVPEQK.E
UK22E_HUMAN99.6%112121.1%645658658.0(P35908) Keratin, type II cytoskeletal 2 epidermal (Cytokeratin 2e) (K2e) (CK 2e) 
*	TK270802_E14_cyto_2D_step04.2165.2165.1	1.5161	0.2595	996.57	24	4380.0%	2	R.LQGEIAHVK.K
*	TK270802_E14_cyto_2D_step11.4341.4341.3	1.2525	0.1394	4495.83	6	1180.0%	1	K.VDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSR.N
*	TK270802_E14_cyto_2D_step05.2227.2227.1	1.7635	0.131	1390.91	6	5000.0%	1	R.SKEEAEALYHSK.Y
*	TK270802_E14_cyto_2D_step13.4000.4000.3	4.7692	0.6391	4096.75	1	2210.0%	1	R.FGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVK.V
*	TK270802_E14_cyto_2D_step08.2368.2368.1	1.9693	0.4098	1322.82	1	5000.0%	3	R.HGGGGGGFGGGGFGSR.S
*	TK270802_E14_cyto_2D_step12.1847.1847.2	0.6515	0.1022	1832.87	22	1000.0%	1	K.YEELQVTVGRHGDSLK.E
U6PGD_MOUSE99.6%71113.3%482531167.2(Q9DCD0) 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 
	TK270802_E14_cyto_2D_step13.3549.3549.3	1.1827	0.182	2837.98	26	1730.0%	1	K.GTGKWTAISALEYGMPVTLIGEAVFAR.C
	TK270802_E14_cyto_2D_step14.3480.3480.2	1.0123	0.0228	1860.48	8	2810.0%	1	R.VILLVKAGQAVDDFIEK.L
	TK270802_E14_cyto_2D_step05.3058.3058.1	2.2993	0.4701	1523.9	1	4580.0%	2	R.HEMLPANLIQAQR.D
	TK270802_E14_cyto_2D_step04.2654.2654.1	1.8151	0.1566	883.09	13	5830.0%	2	K.EAWPHIK.A
UMCM3_MOUSE99.6%162614.2%812915465.6(P25206) DNA replication licensing factor MCM3 (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) 
	TK270802_E14_cyto_2D_step06.2143.2143.1	1.4218	0.1028	730.83	5	7000.0%	1	K.YIHVAK.I
*	TK270802_E14_cyto_2D_step05.3411.3411.2	4.1952	0.6447	2285.9	1	6580.0%	2	K.IIKPTLTQESAAYIAEEYSR.L
	TK270802_E14_cyto_2D_step15.1770.1770.1	0.2957	0.1408	807.19	17	1430.0%	1	K.APAGQLPR.S
	TK270802_E14_cyto_2D_step08.2520.2520.1	2.84	0.473	1425.7	1	5420.0%	2	R.SLAPSIHGHDYVK.K
*	TK270802_E14_cyto_2D_step08.5196.5196.2	0.6553	0.0154	1939.29	66	940.0%	1	R.MQDDNQVMVSEGIVFLI.-
	TK270802_E14_cyto_2D_step01.3548.3548.1	1.524	0.1152	1526.65	4	3210.0%	2	R.GDINILLIGDPSVAK.S
	TK270802_E14_cyto_2D_step04.2362.2362.1	2.2911	0.344	1273.04	2	5500.0%	2	R.TAIHEVMEQGR.V
	TK270802_E14_cyto_2D_step05.1578.1578.1	0.9573	0.0619	711.77	7	5000.0%	1	R.LATAHAK.A
*	TK270802_E14_cyto_2D_step07.2329.2329.1	1.5497	0.3279	1008.19	1	6250.0%	1	K.HDSLLHGTK.K
	TK270802_E14_cyto_2D_step04.1929.1929.1	1.836	0.2108	1063.83	1	5620.0%	2	R.SVHYCPATK.K
UQ924M499.6%8287.4%10411160374.8(Q924M4) RANBP9 isoform 1 
	TK270802_E14_cyto_2D_step05.3143.3143.1	1.6154	0.2024	1431.69	1	4170.0%	1	K.IHEACMLALGSVK.S
	TK270802_E14_cyto_2D_step04.2745.2745.1	1.3001	0.1215	1102.33	2	4380.0%	1	K.ASGTEHWWK.I
	TK270802_E14_cyto_2D_step05.4423.4423.2	3.4709	0.4383	1886.78	1	5290.0%	5	K.IPAGLCATAIDILTTVVR.N
	TK270802_E14_cyto_2D_step14.3110.3110.3	0.9474	0.0372	3913.52	24	970.0%	1	R.IAAQDLLLAVATDFQNESAVALATAATRHLQEAEQTK.A
UIMD2_MOUSE99.6%174327.0%514557857.3(P24547) Inosine-5'-monophosphate dehydrogenase 2 (EC 1.1.1.205) (IMP dehydrogenase 2) (IMPDH-II) (IMPD 2) 
	TK270802_E14_cyto_2D_step06.3458.3458.2	1.5635	0.2279	2855.34	1	3080.0%	1	R.VGMGSGSICITQEVLACGRPQATAVYK.V
	TK270802_E14_cyto_2D_step03.3180.3180.2	2.3996	0.4366	1471.17	1	6150.0%	1	K.REDLVVAPAGVTLK.E
	TK270802_E14_cyto_2D_step06.3881.3881.2	2.9795	0.1356	1966.64	1	5000.0%	1	K.GKLPIVNENDELVAIIAR.T
	TK270802_E14_cyto_2D_step01.1627.1627.1	2.0504	0.4087	1159.99	1	6820.0%	1	K.VAQGVSGAVQDK.G
	TK270802_E14_cyto_2D_step04.3360.3360.2	4.0669	0.5511	1823.21	1	7000.0%	1	K.KYEQGFITDPVVLSPK.D
	TK270802_E14_cyto_2D_step05.2894.2894.2	3.1111	0.5291	1432.09	1	7080.0%	1	R.HGFCGIPITDTGR.M
	TK270802_E14_cyto_2D_step11.0288.0288.2	2.8527	0.4389	2074.63	1	4440.0%	3	K.RTSSAQVEGGVHSLHSYEK.R
	TK270802_E14_cyto_2D_step13.3286.3286.2	2.422	0.2584	2050.87	1	4210.0%	1	R.RFGVPVIADGGIQNVGHIAK.A
	TK270802_E14_cyto_2D_step05.3594.3594.2	1.4072	0.1066	1896.09	36	2500.0%	5	R.FGVPVIADGGIQNVGHIAK.A
	TK270802_E14_cyto_2D_step05.2405.2405.2	3.5262	0.6234	1917.97	1	5290.0%	1	R.TSSAQVEGGVHSLHSYEK.R
UNDKA_MOUSE99.6%183277.6%152172087.4(P15532) Nucleoside diphosphate kinase A (EC 2.7.4.6) (NDK A) (NDP kinase A) (Tumor metastatic process-associated protein) (Metastasis inhibition factor NM23) (NDPK-A) (nm23-M1) 
	TK270802_E14_cyto_2D_step12.3827.3827.2	4.4704	0.5753	2120.02	1	6390.0%	3	K.YMHSGPVVAMVWEGLNVVK.T
	TK270802_E14_cyto_2D_step04.2824.2824.2	2.6385	0.469	1347.25	1	5450.0%	2	R.TFIAIKPDGVQR.G
	TK270802_E14_cyto_2D_step01.2144.2144.1	1.28	0.1653	529.92	1	7500.0%	1	R.LVGLK.F
	TK270802_E14_cyto_2D_step03.2646.2646.2	2.2684	0.3699	1788.3	1	4380.0%	1	R.VMLGETNPADSKPGTIR.G
*	TK270802_E14_cyto_2D_step06.4459.4459.2	0.7493	0.1546	3064.14	1	1740.0%	1	K.EISLWFQPEELVEYKSCAQNWIYE.-
	TK270802_E14_cyto_2D_step09.3160.3160.2	0.7167	0.0604	2105.3	86	1390.0%	2	R.GDFCIQVGRNIIHGSDSVK.S
	TK270802_E14_cyto_2D_step03.2251.2251.2	3.443	0.0033	1487.43	1	8850.0%	1	R.NIIHGSDSVKSAEK.E
	TK270802_E14_cyto_2D_step03.2220.2220.1	2.0197	0.1325	1072.22	1	6670.0%	2	R.NIIHGSDSVK.S
*	TK270802_E14_cyto_2D_step05.3334.3334.2	1.0484	0.0897	1182.92	1	4440.0%	2	K.DRPFFTGLVK.Y
	TK270802_E14_cyto_2D_step01.0164.0164.1	1.3196	0.0196	828.88	119	5000.0%	1	R.GLVGEIIK.R
URS3A_MOUSE99.6%184634.2%263297549.7(P97351) 40S ribosomal protein S3a 
	TK270802_E14_cyto_2D_step02.3702.3702.2	2.3348	0.5111	1956.11	1	4690.0%	1	R.VFEVSLADLQNDEVAFR.K
	TK270802_E14_cyto_2D_step04.3129.3129.2	4.1416	0.5398	1582.14	1	8330.0%	1	K.NCLTNFHGMDLTR.D
	TK270802_E14_cyto_2D_step01.2219.2219.1	0.8175	0.1569	843.16	20	3570.0%	1	K.LIPDSIGK.D
	TK270802_E14_cyto_2D_step01.1562.1562.1	0.8349	0.0866	704.27	15	5000.0%	1	K.IASDGLK.G
	TK270802_E14_cyto_2D_step04.1737.1737.2	1.8942	0.4768	1221.29	1	6670.0%	4	K.TSYAQHQQVR.Q
	TK270802_E14_cyto_2D_step03.2354.2354.1	2.7165	0.4431	1301.85	1	6670.0%	1	K.LMELHGEGGSSGK.A
	TK270802_E14_cyto_2D_step01.2950.2950.1	1.1994	0.0126	972.48	89	5000.0%	1	R.LFCVGFTK.K
	TK270802_E14_cyto_2D_step05.3483.3483.2	2.6319	0.4924	1708.1	1	6150.0%	2	K.ACQSIYPLHDVFVR.K
UO8830699.6%72917.9%173183526.3(O88306) DJ-1 
	TK270802_E14_cyto_2D_step05.1961.1961.1	1.9273	0.2238	869.13	1	6430.0%	5	K.VTTHPLAK.D
	TK270802_E14_cyto_2D_step10.4007.4007.2	0.742	0.0088	2330.04	15	1140.0%	2	K.GLIAAICAGPTALLAHEVGFGCK.V
URL2A_MOUSE99.6%82222.4%1471645811.1(P14115) 60S ribosomal protein L27a (L29) 
	TK270802_E14_cyto_2D_step01.3051.3051.1	1.6968	0.4263	1140.79	1	5000.0%	1	K.TGVAPIIDVVR.S
	TK270802_E14_cyto_2D_step13.0510.0510.2	1.632	0.3599	945.58	1	5000.0%	1	R.GHVSHGHGR.I
	TK270802_E14_cyto_2D_step13.1705.1705.1	1.197	0.0424	698.09	2	6250.0%	4	R.HYHLK.R
	TK270802_E14_cyto_2D_step06.2457.2457.1	1.3478	0.1232	970.3	3	6430.0%	2	K.YHPGYFGK.V
UQ9CR8699.6%73718.2%148160628.2(Q9CR86) 1200011K09Rik protein (Calcineurin substrate CRHSP-24) (RIKEN cDNA 1200011K09 gene) 
	TK270802_E14_cyto_2D_step10.3472.3472.2	4.1943	0.657	1678.81	1	6670.0%	6	K.LQAVEVVITHLAPGTK.H
*	TK270802_E14_cyto_2D_step04.2406.2406.1	1.1465	0.1955	1267.05	1	5000.0%	1	K.HETWSGHVISN.-
UITH2_MOUSE99.6%687.3%9461059287.3(Q61703) Inter-alpha-trypsin inhibitor heavy chain H2 precursor (ITI heavy chain H2) 
*	TK270802_E14_cyto_2D_step08.4823.4823.3	0.8009	0.0302	4059.71	8	1180.0%	1	K.HLEVNVWIIEPQGMRFLHVPDTFEGHFQGVPVISK.G
	TK270802_E14_cyto_2D_step13.2270.2270.2	2.9839	0.5566	1470.08	1	7080.0%	2	K.AHVSFKPTVAQQR.K
	TK270802_E14_cyto_2D_step03.3608.3608.2	1.0444	0.1119	1632.05	33	2690.0%	1	K.QTVEAMKTILDDLR.T
*	TK270802_E14_cyto_2D_step07.2124.2124.1	1.5852	0.3871	792.69	1	7500.0%	1	K.IHLQPGK.L
UP2AA_MOUSE99.6%5719.4%309356085.5(P13353) Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform (EC 3.1.3.16) (PP2A-alpha) 
	TK270802_E14_cyto_2D_step09.2982.2982.2	2.3576	0.197	1918.71	1	5000.0%	2	R.AHQLVMEGYNWCHDR.N
	TK270802_E14_cyto_2D_step10.1912.1912.2	1.6581	0.2755	953.34	1	7140.0%	1	R.RGEPHVTR.R
	TK270802_E14_cyto_2D_step02.4512.4512.3	1.1692	0.1019	4228.62	9	1110.0%	1	K.YFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIR.A
UQ6318299.6%51317.0%112124734.8(Q63182) Transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C) (Elongation factor SIII P15 subunit) (2610301I15RIK protein) (2610043E24RIK protein) 
	TK270802_E14_cyto_2D_step03.2396.2396.1	1.4119	0.1122	1010.22	1	6250.0%	2	R.EIPSHVLSK.V
	TK270802_E14_cyto_2D_step03.2208.2208.1	2.0328	0.4734	1058.94	1	6670.0%	3	R.EHALTSGTIK.A
UVINC_MOUSE99.6%101212.6%10651166745.9(Q64727) Vinculin (Metavinculin) 
	TK270802_E14_cyto_2D_step03.2308.2308.1	1.4316	0.1592	1190.34	1	5560.0%	1	R.KIAELCDDPK.E
*	TK270802_E14_cyto_2D_step01.1690.1690.1	0.8852	0.0057	1497.84	61	1430.0%	1	R.DPNASPGDAGEQAIR.Q
	TK270802_E14_cyto_2D_step10.2583.2583.1	1.0338	0.129	1079.73	4	4380.0%	1	K.EVAKQCTDK.R
	TK270802_E14_cyto_2D_step10.2013.2013.3	0.8901	0.0391	1971.53	208	1760.0%	1	R.GLVAEGHRLANVMMGPYR.Q
	TK270802_E14_cyto_2D_step01.2471.2471.1	1.4452	0.0692	1001.64	3	5620.0%	1	R.IPTISTQLK.I
*	TK270802_E14_cyto_2D_step15.2429.2429.2	0.568	0.0189	2403.09	59	1140.0%	1	K.TISPMVMDAKAVAGNISDPDLQK.S
	TK270802_E14_cyto_2D_step13.2721.2721.3	3.4911	0.4405	4027.86	1	2000.0%	1	R.LTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQK.A
	TK270802_E14_cyto_2D_step14.2617.2617.3	2.4091	0.3373	3028.29	1	2500.0%	2	R.LTDELAPPKPPLPEGEVPPPRPPPPEEK.D
	TK270802_E14_cyto_2D_step01.0167.0167.1	0.7359	0.0104	1482.92	271	1920.0%	1	R.VDQLTAQLADLAAR.G
UO3594599.6%2210.2%501545887.7(O35945) Aldehyde dehydrogenase Ahd-2-like 
*	TK270802_E14_cyto_2D_step13.3845.3845.3	1.8347	0.2369	3220.06	1	2080.0%	1	K.LGPALSCGNTVVVKPAEQTPLTALHMASLIK.E
*	TK270802_E14_cyto_2D_step06.3194.3194.2	3.6038	0.4753	2172.57	1	6050.0%	1	K.KYILGNPLNSGINQGPQIDK.E
UHDGF_MOUSE99.6%61413.1%237262694.8(P51859) Hepatoma-derived growth factor (HDGF) 
	TK270802_E14_cyto_2D_step07.2600.2600.1	1.5266	0.1267	985.81	27	4290.0%	1	K.GYPHWPAR.I
	TK270802_E14_cyto_2D_step12.3487.3487.2	2.0754	0.4857	1991.35	1	4060.0%	3	K.YQVFFFGTHETAFLGPK.D
	TK270802_E14_cyto_2D_step07.1701.1701.1	0.9653	0.0027	690.86	22	6000.0%	2	K.FGKPNK.R
UHBB1_MOUSE99.6%4117381.5%146157097.6(P02088) Hemoglobin beta-1 chain (B1) (Major) 
	TK270802_E14_cyto_2D_step04.2585.2585.1	1.6627	0.1426	1138.96	6	4550.0%	4	K.VVAGVATALAHK.Y
	TK270802_E14_cyto_2D_step01.5563.5563.1	2.1416	0.5132	1468.47	1	4170.0%	8	K.GTFASLSELHCDK.L
*	TK270802_E14_cyto_2D_step01.2580.2580.1	1.9899	0.2456	993.53	1	6880.0%	3	K.AAVSCLWGK.V
	TK270802_E14_cyto_2D_step02.0710.0710.2	0.7821	0.0236	2990.15	120	930.0%	1	R.LLGNMIVIVLGHHLGKDFTPAAQAAFQK.V
	TK270802_E14_cyto_2D_step04.2638.2638.2	2.0779	0.3024	1128.81	2	6880.0%	1	K.LHVDPENFR.L
	TK270802_E14_cyto_2D_step01.2332.2332.1	2.7162	0.4957	1297.94	1	5910.0%	3	K.DFTPAAQAAFQK.V
	TK270802_E14_cyto_2D_step08.3390.3390.2	1.567	0.2525	2575.28	1	3330.0%	1	K.GTFASLSELHCDKLHVDPENFR.L
	TK270802_E14_cyto_2D_step03.2023.2023.1	2.097	0.3433	914.6	1	7140.0%	4	-.VHLTDAEK.A
	TK270802_E14_cyto_2D_step06.3507.3507.2	3.9463	0.5816	1887.24	1	5620.0%	5	K.KVITAFNDGLNHLDSLK.G
	TK270802_E14_cyto_2D_step02.3424.3424.2	2.5651	0.423	1278.04	2	5560.0%	4	R.LLVVYPWTQR.Y
	TK270802_E14_cyto_2D_step01.1950.1950.1	1.4585	0.2574	1302.98	1	5420.0%	1	K.VNSDEVGGEALGR.L
UPRO1_MOUSE99.6%3976551.1%139148268.3(P10924) Profilin I 
*	TK270802_E14_cyto_2D_step02.3096.3096.2	1.1807	0.0353	1686.46	67	2500.0%	1	K.STGGAPTFNVTVTMTAK.T
	TK270802_E14_cyto_2D_step01.2506.2506.1	1.2779	0.1001	1216.14	1	5450.0%	2	K.DSPSVWAAVPGK.T
	TK270802_E14_cyto_2D_step08.2255.2255.1	1.8076	0.0703	1153.82	14	4500.0%	2	K.EGVHGGLINKK.C
*	TK270802_E14_cyto_2D_step01.3316.3316.1	1.9159	0.432	1458.26	1	4230.0%	5	R.SSFFVNGLTLGGQK.C
	TK270802_E14_cyto_2D_step03.3422.3422.1	1.8489	0.1679	877.07	1	6430.0%	27	K.TLVLLMGK.E
	TK270802_E14_cyto_2D_step04.2376.2376.1	1.2987	0.0899	1167.87	27	3750.0%	1	K.CYEMASHLR.R
UQ9DCG999.6%4620.8%125141415.3(Q9DCG9) 0610038D11Rik protein 
	TK270802_E14_cyto_2D_step13.2901.2901.2	2.9588	0.5509	1392.31	1	8180.0%	1	K.LLTHNLLSSHVR.G
*	TK270802_E14_cyto_2D_step05.4855.4855.1	0.7721	0.1797	1575.84	3	1920.0%	1	R.GIPNMLLNDEETET.-
UQ9DAB499.6%3314.1%391428906.7(Q9DAB4) 1700015E05Rik protein 
	TK270802_E14_cyto_2D_step07.3064.3064.2	4.2533	0.6223	1818.18	1	5940.0%	1	K.HQSLGGQYGVQGFPTIK.I
	TK270802_E14_cyto_2D_step02.3847.3847.2	1.002	0.1298	2775.13	2	2290.0%	1	K.KTCEEHQLCVVAVLPHILDTGAAGR.N
	TK270802_E14_cyto_2D_step03.3504.3504.1	0.9055	0.0191	1411.7	66	2920.0%	1	K.GESPVDYDGGRTR.S
UMCM4_MOUSE99.6%686.5%862967367.2(P49717) DNA replication licensing factor MCM4 (CDC21 homolog) (P1-CDC21) 
	TK270802_E14_cyto_2D_step06.1869.1869.1	1.2797	2.0E-4	928.86	59	5000.0%	1	R.SGVRGTPVR.Q
	TK270802_E14_cyto_2D_step04.3412.3412.2	2.5472	0.3221	1816.3	1	4670.0%	2	R.SVLHEVMEQQTLSIAK.A
	TK270802_E14_cyto_2D_step04.3561.3561.2	3.0296	0.5341	1738.2	1	5710.0%	1	K.TTIENIQLPHTLLSR.F
	TK270802_E14_cyto_2D_step09.2626.2626.1	0.8435	0.0324	1154.0	2	4380.0%	1	K.THIDVIHYR.K
	TK270802_E14_cyto_2D_step04.2014.2014.1	1.4192	0.1722	921.07	5	5830.0%	1	R.KPDIYER.L
UGBLP_HUMAN99.6%2731327.1%317350777.7(P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (P25388) Guanine nucleotide-binding protein beta subunit-like protein 12.3 (P205) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) 
	TK270802_E14_cyto_2D_step09.2844.2844.3	3.0241	0.479	2747.52	1	2690.0%	4	K.TNHIGHTGYLNTVTVSPDGSLCASGGK.D
	TK270802_E14_cyto_2D_step15.3807.3807.2	0.9392	0.2292	2248.2	15	1580.0%	1	R.FSPNSSNPIIVSCGWDKLVK.V
	TK270802_E14_cyto_2D_step13.1561.1561.1	0.8945	0.0318	844.87	9	5830.0%	1	R.RFVGHTK.D
	TK270802_E14_cyto_2D_step12.1564.1564.3	1.175	0.0165	2986.88	26	1610.0%	1	K.LKTNHIGHTGYLNTVTVSPDGSLCASGGK.D
	TK270802_E14_cyto_2D_step03.3186.3186.1	1.2464	0.1883	791.86	5	6000.0%	1	K.TIIMWK.L
	TK270802_E14_cyto_2D_step09.3763.3763.2	1.4976	0.0713	2628.61	1	3040.0%	2	K.GHNGWVTQIATTPQFPDMILSASR.D
UG3B2_MOUSE99.6%3312.0%482540885.6(P97379) Ras-GTPase-activating protein binding protein 2 (GAP SH3-domain binding protein 2) (G3BP-2) 
	TK270802_E14_cyto_2D_step09.2417.2417.3	3.2907	0.4983	2996.53	1	2960.0%	1	R.NSSYVHGGVDASGKPQEAVYGQNDIHHK.V
	TK270802_E14_cyto_2D_step04.5216.5216.2	1.3002	0.1813	3189.66	1	1550.0%	1	K.IRHVDAHATLSDGVVVQVMGLLSNSGQPER.K
UHMG2_MOUSE99.6%216923.4%209240317.3(P30681) High mobility group protein 2 (HMG-2) 
	TK270802_E14_cyto_2D_step03.2902.2902.1	2.376	0.091	1467.81	2	5000.0%	6	K.HPDSSVNFAEFSK.K
*	TK270802_E14_cyto_2D_step03.2411.2411.1	2.1209	0.162	940.02	2	5710.0%	3	K.SKFEDLAK.S
*	TK270802_E14_cyto_2D_step03.2630.2630.1	3.0751	0.4544	1340.04	1	5830.0%	3	K.IEHPGLSIGDTAK.K
*	TK270802_E14_cyto_2D_step08.2854.2854.2	3.5266	0.5514	1582.23	1	7500.0%	2	K.IKIEHPGLSIGDTAK.K
	TK270802_E14_cyto_2D_step04.2736.2736.1	3.0238	0.479	1396.0	1	5000.0%	2	K.KLGEMWSEQSAK.D
	TK270802_E14_cyto_2D_step07.2894.2894.2	1.117	0.1589	1593.86	6	3460.0%	1	K.KHPDSSVNFAEFSK.K
UQ9D6F999.6%393.8%444495284.9(Q9D6F9) Tubulin, beta 4 
	TK270802_E14_cyto_2D_step03.2515.2515.2	3.1067	0.5597	1825.9	1	5310.0%	3	R.EIVHLQAGQCGNQIGAK.F
UQ9QZM099.6%3314.3%638673795.3(Q9QZM0) PLIC-2 
	TK270802_E14_cyto_2D_step04.3426.3426.2	4.4488	0.4458	1765.38	1	6790.0%	1	R.NPEISHLLNNPDIMR.Q
*	TK270802_E14_cyto_2D_step14.3672.3672.3	1.1362	0.1049	3561.77	2	1180.0%	1	R.SSSTPTTTNSSSFGLGSLSSLSNLGLNSPNFTELR.N
*	TK270802_E14_cyto_2D_step13.3720.3720.3	0.9626	0.1953	3980.55	8	750.0%	1	K.SQNRPQGQATTQPSTTAGTSTTTTTTTTAAAPAATTSSAPR.S
UAOP2_MOUSE99.6%2213.9%223247396.0(O08709) Antioxidant protein 2 (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) 
	TK270802_E14_cyto_2D_step03.3150.3150.2	2.1167	0.295	1835.11	1	5620.0%	1	K.KGESVMVVPTLSEEEAK.Q
	TK270802_E14_cyto_2D_step01.4626.4626.1	2.5562	0.4458	1527.1	1	6920.0%	1	R.DLAILLGMLDPVEK.D
UGFA1_MOUSE99.6%132713.2%680765926.8(P47856) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 (EC 2.6.1.16) (Hexosephosphate aminotransferase 1) (D-fructose-6-phosphate amidotransferase 1) (GFAT 1) (GFAT1) 
	TK270802_E14_cyto_2D_step14.2361.2361.2	0.7396	0.0856	2246.51	2	1940.0%	1	K.NNEFIVIHNGIITNYKDLK.K
	TK270802_E14_cyto_2D_step06.2742.2742.1	1.541	0.0581	950.21	4	5620.0%	1	K.HGPLALVDK.L
	TK270802_E14_cyto_2D_step04.3012.3012.1	2.1818	0.3619	1484.03	1	5420.0%	1	R.GYHYATCLEGALK.I
*	TK270802_E14_cyto_2D_step10.2405.2405.2	3.1269	0.4905	1829.01	1	5670.0%	4	R.WATHGEPNPVNSHPQR.S
	TK270802_E14_cyto_2D_step07.2513.2513.1	1.1785	0.1541	1256.04	1	5000.0%	2	K.SVHFPGQAVGTR.R
	TK270802_E14_cyto_2D_step04.3298.3298.1	1.7587	0.2702	1329.84	2	5000.0%	1	K.LSTDHIPILYR.T
	TK270802_E14_cyto_2D_step05.3395.3395.2	1.3855	0.091	1891.61	5	3330.0%	1	K.NNEFIVIHNGIITNYK.D
	TK270802_E14_cyto_2D_step11.2905.2905.2	2.6623	0.4498	1070.22	1	8890.0%	1	R.RGSPLLIGVR.S
UTRFE_MOUSE99.6%6018630.4%697767247.2(Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin) (Beta-1-metal binding globulin) 
*	TK270802_E14_cyto_2D_step03.2176.2176.1	1.8114	0.3224	1111.82	1	5000.0%	1	K.KTSYPDCIK.A
*	TK270802_E14_cyto_2D_step04.2790.2790.1	2.2894	0.1024	1479.95	1	5420.0%	5	K.KGTDFQLNQLEGK.K
*	TK270802_E14_cyto_2D_step01.1968.1968.1	1.1677	0.0316	815.59	10	5830.0%	1	K.NPAEWAK.N
*	TK270802_E14_cyto_2D_step06.4119.4119.2	1.1533	0.0731	2034.65	21	2500.0%	1	K.QEDFELLCPDGTRKPVK.D
*	TK270802_E14_cyto_2D_step06.2925.2925.1	1.8732	0.2229	1174.23	1	5620.0%	4	K.WCALSHLER.T
	TK270802_E14_cyto_2D_step06.1733.1733.1	1.7826	0.1189	889.83	6	5000.0%	5	K.SCHTGLGR.S
*	TK270802_E14_cyto_2D_step01.3448.3448.1	2.1854	0.4142	1241.25	1	6000.0%	2	K.DFQLFSSPLGK.D
*	TK270802_E14_cyto_2D_step07.2645.2645.2	4.7964	0.6268	2011.45	1	6180.0%	4	K.DFASCHLAQAPNHVVVSR.K
	TK270802_E14_cyto_2D_step01.2691.2691.1	0.9718	0.116	1539.9	4	3180.0%	1	R.DQYELLCLDNTR.K
*	TK270802_E14_cyto_2D_step02.4252.4252.1	2.7595	0.4678	1562.03	1	5380.0%	1	R.SAGWVIPIGLLFCK.L
*	TK270802_E14_cyto_2D_step04.2496.2496.1	1.6368	0.2286	1119.68	3	6250.0%	1	R.LLEACTFHK.H
*	TK270802_E14_cyto_2D_step07.3078.3078.1	0.8507	0.1967	1422.78	9	3180.0%	5	R.LYLGHNYVTAIR.N
*	TK270802_E14_cyto_2D_step03.2583.2583.2	3.0539	0.5061	1659.06	1	6670.0%	2	R.KPVDQYEDCYLAR.I
	TK270802_E14_cyto_2D_step04.1884.1884.1	1.2087	0.0863	916.98	5	5000.0%	2	K.VAQEHFGK.G
*	TK270802_E14_cyto_2D_step07.2050.2050.1	1.4692	0.2463	951.78	1	5620.0%	4	R.IPSHAVVAR.K
*	TK270802_E14_cyto_2D_step05.3323.3323.1	1.9554	0.171	1316.22	3	6000.0%	4	K.HTTIFEVLPEK.A
*	TK270802_E14_cyto_2D_step01.1606.1606.1	1.6508	0.3158	973.39	1	6880.0%	2	K.LPEGTTPEK.Y
*	TK270802_E14_cyto_2D_step09.2498.2498.1	1.3115	0.166	1257.69	1	4440.0%	2	R.LLEACTFHKH.-
*	TK270802_E14_cyto_2D_step03.2034.2034.1	2.8375	0.3817	1243.97	1	7000.0%	2	K.HQTVLDNTEGK.N
*	TK270802_E14_cyto_2D_step03.2202.2202.1	2.5884	0.2621	1362.83	1	5500.0%	2	K.WCAVSEHENTK.C
UANX6_MOUSE99.6%172721.1%672757555.5(P14824) Annexin VI (Lipocortin VI) (P68) (P70) (Protein III) (Chromobindin 20) (67 kDa calelectrin) (Calphobindin-II) (CPB-II) 
	TK270802_E14_cyto_2D_step02.2284.2284.1	0.824	0.0109	791.24	112	3330.0%	1	R.EEGGENR.D
	TK270802_E14_cyto_2D_step05.3921.3921.2	2.6916	0.5615	1672.81	1	6070.0%	1	R.LILGLMMPPAHYDAK.Q
	TK270802_E14_cyto_2D_step04.2106.2106.1	2.2345	0.4156	1482.7	1	5000.0%	2	R.AINEAYKEDYHK.S
	TK270802_E14_cyto_2D_step03.3576.3576.1	0.9425	0.1148	1075.0	4	4380.0%	1	K.CLIEILASR.T
	TK270802_E14_cyto_2D_step01.3898.3898.2	2.1087	0.4435	2854.43	1	2920.0%	1	R.ENDDVVSEDLVQQDVQDLYEAGELK.W
	TK270802_E14_cyto_2D_step06.1509.1509.1	0.6003	0.013	664.79	1	5000.0%	1	R.EFIEK.Y
	TK270802_E14_cyto_2D_step06.2267.2267.1	1.424	0.1133	773.13	15	6000.0%	1	R.SYPHLR.R
	TK270802_E14_cyto_2D_step06.3110.3110.1	1.3436	0.0458	1067.16	53	5000.0%	1	R.RVFQEFIK.K
	TK270802_E14_cyto_2D_step04.2208.2208.1	2.026	0.4314	1173.1	1	5500.0%	1	K.TTGKPIEASIR.G
*	TK270802_E14_cyto_2D_step06.2774.2774.1	2.1164	0.1681	1360.83	1	6000.0%	2	K.KTNYDIEHVIK.K
	TK270802_E14_cyto_2D_step05.2951.2951.1	1.27	0.1667	1081.89	1	5000.0%	1	K.NKPLFFADK.L
	TK270802_E14_cyto_2D_step03.2719.2719.1	2.3568	0.5492	1534.71	1	4580.0%	3	R.TNEQMHQLVAAYK.D
	TK270802_E14_cyto_2D_step03.3426.3426.1	1.4955	0.0775	1176.9	1	6500.0%	1	K.DAFVAIVQSVK.N
UADHA_MOUSE99.6%196143.9%374396408.1(P00329) Alcohol dehydrogenase A chain (EC 1.1.1.1) (ADH-A2) 
*	TK270802_E14_cyto_2D_step09.4903.4903.3	1.0049	0.1377	4726.27	1	990.0%	1	R.LDTMTSALLSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWK.G
*	TK270802_E14_cyto_2D_step05.1930.1930.2	1.2563	0.2191	1136.43	5	4380.0%	1	K.HPESNFCSR.S
	TK270802_E14_cyto_2D_step01.2348.2348.1	1.6373	0.2229	886.08	1	7140.0%	1	R.IIAVDINK.D
*	TK270802_E14_cyto_2D_step08.3895.3895.2	2.6524	0.3709	2507.84	1	3100.0%	3	K.AAVLWELHKPFTIEDIEVAPPK.A
*	TK270802_E14_cyto_2D_step12.4379.4379.2	2.0476	0.3123	1897.18	1	5000.0%	5	K.KFPLDPLITHVLPFEK.I
*	TK270802_E14_cyto_2D_step05.5106.5106.3	1.7998	0.1623	4086.54	1	1500.0%	2	R.SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK.V
*	TK270802_E14_cyto_2D_step10.3525.3525.2	1.7731	0.3635	2688.18	1	3040.0%	2	K.QIHNFISTSTFSQYTVVDDIAVAK.I
UZYX_MOUSE99.6%558.5%564607906.9(Q62523) Zyxin 
	TK270802_E14_cyto_2D_step13.2316.2316.2	3.1333	0.4806	1183.78	1	7500.0%	1	K.KFAPVVAPKPK.V
*	TK270802_E14_cyto_2D_step03.2591.2591.1	1.082	0.325	1023.76	1	4500.0%	1	R.SPGGPGPLTLK.E
*	TK270802_E14_cyto_2D_step01.1402.1402.1	0.9491	0.0271	729.03	2	5830.0%	1	K.FAPVAPK.F
*	TK270802_E14_cyto_2D_step05.2611.2611.2	3.0018	0.4344	1968.46	1	5000.0%	1	K.VNPFRPGDSEPPVAAGAQR.A
URL6_MOUSE99.6%184421.3%2873261210.8(P47911) 60S ribosomal protein L6 (TAX-responsive enhancer element binding protein 107) (TAXREB107) 
*	TK270802_E14_cyto_2D_step05.4347.4347.2	3.1933	0.3925	1530.28	1	6790.0%	4	R.SSITPGTVLIILTGR.H
	TK270802_E14_cyto_2D_step01.2208.2208.1	0.9833	0.1167	866.89	1	5000.0%	1	K.FVIATSTK.V
*	TK270802_E14_cyto_2D_step01.0179.0179.1	1.8955	0.0886	998.03	5	5620.0%	1	K.AVDLQILPK.I
	TK270802_E14_cyto_2D_step04.2696.2696.1	1.8651	0.418	996.99	1	6430.0%	2	K.HLTDAYFK.K
	TK270802_E14_cyto_2D_step13.1832.1832.1	1.3198	0.074	1000.93	2	5000.0%	2	K.KPFSQHVR.R
	TK270802_E14_cyto_2D_step01.2022.2022.1	1.4431	0.2543	698.33	1	8000.0%	2	R.NPVLVR.G
	TK270802_E14_cyto_2D_step13.1768.1768.1	1.6359	0.2227	783.71	2	5830.0%	2	R.KLLSHGK.K
UQ9CRY599.6%247.2%251294695.2(Q9CRY5) 3010001M15Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step06.3777.3777.2	4.6334	0.63	2004.06	1	5880.0%	2	K.SPVASIVYELNPNFKPPK.R
UR10A_MOUSE99.6%199134.6%2172491610.0(P53026) 60S ribosomal protein L10a (CSA-19) (NEDD-6) 
	TK270802_E14_cyto_2D_step06.4383.4383.1	1.4293	0.0749	1487.96	5	3750.0%	8	K.KYDAFLASESLIK.Q
	TK270802_E14_cyto_2D_step11.3027.3027.2	3.1072	0.5333	1267.12	1	8180.0%	1	K.VLCLAVAVGHVK.M
	TK270802_E14_cyto_2D_step06.3247.3247.2	3.027	0.4645	1603.86	1	6540.0%	2	K.FPSLLTHNENMVAK.V
	TK270802_E14_cyto_2D_step04.1686.1686.1	1.593	0.2093	954.01	6	5000.0%	4	R.EVLHGNQR.K
	TK270802_E14_cyto_2D_step04.2994.2994.1	1.0084	0.0628	1548.76	27	2500.0%	1	R.KFLETVELQISLK.N
	TK270802_E14_cyto_2D_step03.2351.2351.1	1.8296	0.2462	812.06	1	6430.0%	1	R.ILGPGLNK.A
	TK270802_E14_cyto_2D_step08.2095.2095.1	1.0681	0.0553	822.98	1	5000.0%	2	K.RFSGTVR.L
UMCM6_MOUSE99.6%123411.4%821928675.5(P97311) DNA replication licensing factor MCM6 (Mis5 homolog) 
*	TK270802_E14_cyto_2D_step03.3126.3126.2	2.3365	0.4414	1673.52	1	5670.0%	2	R.TSILAAANPVSGHYDR.S
*	TK270802_E14_cyto_2D_step10.3061.3061.2	3.4898	0.5149	1596.83	1	5770.0%	5	R.LVFLACHVAPTNPR.F
*	TK270802_E14_cyto_2D_step03.2260.2260.1	1.2463	0.1111	987.66	1	5710.0%	1	K.HVDEFSPR.A
	TK270802_E14_cyto_2D_step08.3657.3657.2	1.9282	0.456	2474.46	1	3500.0%	1	K.NLYHNLCTSLFPTIHGNDEVK.R
	TK270802_E14_cyto_2D_step10.3564.3564.2	1.2433	0.1397	1953.46	1	3440.0%	1	R.LTHYDHVLIELTQAGLK.G
	TK270802_E14_cyto_2D_step05.2857.2857.1	1.2488	0.0598	1008.0	30	5000.0%	1	K.RFLLDTNK.S
	TK270802_E14_cyto_2D_step03.1911.1911.1	1.674	0.2397	1303.65	1	6110.0%	1	R.MHCCDEVQPK.H
UTCPE_MOUSE99.6%228827.4%541596246.0(P80316) T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) 
	TK270802_E14_cyto_2D_step07.1586.1586.1	0.7457	0.0449	776.68	5	5000.0%	1	R.KPGESEE.-
	TK270802_E14_cyto_2D_step03.2363.2363.1	1.7177	0.1534	1086.81	5	6250.0%	1	K.DFSHPQMPK.K
	TK270802_E14_cyto_2D_step03.4472.4472.2	3.8185	0.6002	3117.86	1	3790.0%	7	K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G
	TK270802_E14_cyto_2D_step13.3494.3494.2	0.9805	0.0623	2195.75	5	2380.0%	1	R.VVYGGGAAEISCALAVSQEADK.C
	TK270802_E14_cyto_2D_step04.3117.3117.1	2.0265	0.4029	1186.03	1	5000.0%	5	R.SLHDALCVIR.N
*	TK270802_E14_cyto_2D_step04.2336.2336.1	1.3894	0.1058	939.19	5	5710.0%	1	R.IAIQHLDK.I
*	TK270802_E14_cyto_2D_step04.3996.3996.2	2.6931	0.4912	1656.11	1	5000.0%	2	K.LGFAGVVQEISFGTTK.D
	TK270802_E14_cyto_2D_step06.1909.1909.1	1.6305	0.3522	757.92	1	6670.0%	1	K.SHIMAAK.A
	TK270802_E14_cyto_2D_step08.3274.3274.2	1.3782	0.2202	1613.21	6	3080.0%	2	K.IAILTCPFEPPKPK.T
*	TK270802_E14_cyto_2D_step02.2964.2964.3	1.4829	0.1305	2662.01	8	1980.0%	1	K.DGDVTITNDGATILSMMDVDHQIAK.L
UQ8VCQ899.6%7217.2%530604537.4(Q8VCQ8) Similar to caldesmon 1 
*	TK270802_E14_cyto_2D_step10.2699.2699.2	3.8282	0.5947	2025.25	1	5260.0%	2	K.ASKPMKPAASDLPVPAEGVR.N
*	TK270802_E14_cyto_2D_step04.1558.1558.1	1.2295	0.2528	1029.33	1	3890.0%	4	R.STHQAAVVSK.I
	TK270802_E14_cyto_2D_step05.2277.2277.1	1.4932	0.1244	1015.12	2	5710.0%	1	K.RLQEALER.Q
UQ6081799.6%8346.0%215233844.6(Q60817) NASCENT polypeptide-associated complex alpha polypeptide (Alpha NAC/1.9.2. protein) 
	TK270802_E14_cyto_2D_step06.3739.3739.2	3.3522	0.5312	1552.98	1	7080.0%	5	K.NILFVITKPDVYK.S
UQ91W8399.6%81223.0%309334295.2(Q91W83) Putative TAT protein (Transactivating regulatory protein) 
	TK270802_E14_cyto_2D_step13.3218.3218.2	2.4251	0.211	1275.49	1	6500.0%	1	R.ILRPGGCLFLK.E
	TK270802_E14_cyto_2D_step03.2236.2236.1	2.1989	0.2978	1355.88	1	5770.0%	1	K.SSSVKPVVDPAAAK.L
	TK270802_E14_cyto_2D_step05.2469.2469.1	3.6899	0.5445	1422.95	1	6250.0%	2	K.KPNFEVGSSSQLK.L
	TK270802_E14_cyto_2D_step08.4143.4143.3	1.8773	0.1493	2807.63	2	2080.0%	1	R.LQELTGSEGQVFMENVTQLLQSSHK.E
	TK270802_E14_cyto_2D_step06.1943.1943.1	1.7266	0.3736	883.99	3	5710.0%	1	K.RPDPASLK.A
UPSE2_MOUSE99.6%116.7%239270575.7(P97372) Proteasome activator complex subunit 2 (Proteasome activator 28-beta subunit) (PA28beta) (PA28b) (Activator of multicatalytic protease subunit 2) (11S regulator complex beta subunit) (REG-beta) 
	TK270802_E14_cyto_2D_step06.4366.4366.2	3.3644	0.5593	1899.34	1	5670.0%	1	R.AFYAELYHIISSNLEK.I
URL5_MOUSE99.6%163227.7%296342699.8(P47962) 60S ribosomal protein L5 
*	TK270802_E14_cyto_2D_step07.3406.3406.1	0.7417	0.0438	868.67	13	5000.0%	1	R.YQVRFR.R
	TK270802_E14_cyto_2D_step04.2230.2230.1	1.2362	0.2502	1188.04	1	5000.0%	2	K.RFPGYDSESK.E
	TK270802_E14_cyto_2D_step07.1337.1337.1	1.0158	0.24	639.31	16	4000.0%	2	K.AHAAIR.E
	TK270802_E14_cyto_2D_step05.2874.2874.1	2.6261	0.4645	1437.0	1	6360.0%	3	K.HIMGQNVADYMR.Y
	TK270802_E14_cyto_2D_step09.2774.2774.1	1.1851	0.1055	1130.75	20	5000.0%	1	K.EFNAEVHRK.H
	TK270802_E14_cyto_2D_step04.2437.2437.1	0.5117	0.1409	1342.0	23	1540.0%	3	K.GAVDGGLSIPHSTK.R
	TK270802_E14_cyto_2D_step01.1292.1292.1	0.6121	0.0113	788.19	8	4000.0%	1	K.TDYYAR.K
	TK270802_E14_cyto_2D_step01.2307.2307.1	2.9157	0.2975	1535.82	1	6820.0%	1	R.YLMEEDEDAYKK.Q
	TK270802_E14_cyto_2D_step05.2307.2307.1	1.3717	0.1835	872.95	103	5000.0%	1	K.RLVIQDK.N
UVAA1_MOUSE99.6%7910.9%617682685.9(P50516) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) 
	TK270802_E14_cyto_2D_step04.3162.3162.1	2.6328	0.4659	1310.42	1	5450.0%	1	R.VGHSELVGEIIR.L
*	TK270802_E14_cyto_2D_step07.2058.2058.3	1.4486	0.0893	1783.39	3	2860.0%	1	K.ADYAQLLEDMQNAFR.S
	TK270802_E14_cyto_2D_step01.1346.1346.1	0.5443	0.1701	461.31	4	6670.0%	1	K.DPVK.D
	TK270802_E14_cyto_2D_step04.0623.0623.3	0.873	0.0329	3735.53	50	500.0%	1	K.LPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGK.T
	TK270802_E14_cyto_2D_step10.2471.2471.2	2.3446	0.4664	1319.97	1	5910.0%	2	K.LPANHPLLTGQR.V
UQ91VI899.6%113.4%435467604.7(Q91VI8) Similar to ubiquilin 2 (Fragment) 
	TK270802_E14_cyto_2D_step04.3236.3236.2	3.7129	0.6494	1782.53	1	7500.0%	1	R.NPEISHMLNNPDIMR.Q
UFETA_MOUSE99.6%174207449.4%605673375.9(P02772) Alpha-fetoprotein precursor (Alpha-fetoglobulin) (Alpha-1-fetoprotein) 
*	TK270802_E14_cyto_2D_step06.3287.3287.2	2.0069	0.4402	1686.85	1	5000.0%	4	R.KAPQLTSAELIDLTGK.M
*	TK270802_E14_cyto_2D_step01.1975.1975.1	1.2801	0.0884	1561.74	8	3850.0%	1	K.YGLSGCCSQSGVER.H
*	TK270802_E14_cyto_2D_step12.3980.3980.2	2.6329	0.4829	3086.21	1	2310.0%	17	K.NSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK270802_E14_cyto_2D_step08.3308.3308.2	2.1012	0.4732	1348.08	2	4550.0%	13	R.THPNLPVSVILR.I
*	TK270802_E14_cyto_2D_step02.2092.2092.1	0.9439	0.0863	691.7	6	6000.0%	1	K.ALQTMK.Q
*	TK270802_E14_cyto_2D_step10.3851.3851.2	3.8281	0.5765	1633.49	1	7500.0%	4	K.IMFMASFLHEYSR.T
*	TK270802_E14_cyto_2D_step01.2300.2300.1	1.8065	0.4335	1497.8	1	4580.0%	2	R.DETYAPPPFSEDK.F
*	TK270802_E14_cyto_2D_step01.0238.0238.1	1.9222	0.2416	920.39	1	7140.0%	1	K.DLCQAQGK.A
*	TK270802_E14_cyto_2D_step13.4266.4266.3	5.8354	0.6349	3213.18	1	3430.0%	10	K.KNSGDGCLESQLSVFLDEICHETELSNK.Y
*	TK270802_E14_cyto_2D_step01.1640.1640.2	1.6827	0.1928	1372.51	1	6000.0%	1	K.ADNKEECFQTK.R
*	TK270802_E14_cyto_2D_step03.2075.2075.2	3.7582	0.6881	2342.5	1	4750.0%	1	R.NEASPVNSGISHCCNSSYSNR.R
*	TK270802_E14_cyto_2D_step03.3051.3051.2	2.2897	0.4799	1634.76	1	5000.0%	3	R.EGSMLNEHVCSVIR.K
*	TK270802_E14_cyto_2D_step01.2383.2383.1	2.0103	0.2598	916.09	1	8330.0%	1	R.FIYEVSR.R
*	TK270802_E14_cyto_2D_step01.2648.2648.1	1.6125	0.2633	1069.11	3	6110.0%	4	K.MTSDVLAAMK.K
*	TK270802_E14_cyto_2D_step07.2345.2345.1	1.8412	0.1575	900.05	4	5830.0%	5	R.HQCLLAR.K
*	TK270802_E14_cyto_2D_step06.3223.3223.2	1.6818	0.2491	2192.16	1	3160.0%	1	K.KTAPASVPPFQFPEPAESCK.A
*	TK270802_E14_cyto_2D_step01.3224.3224.1	2.3945	0.5318	1560.1	1	5000.0%	7	K.APQLTSAELIDLTGK.M
*	TK270802_E14_cyto_2D_step05.2957.2957.1	1.8138	0.1018	1591.51	1	5420.0%	1	K.FIFHKDLCQAQGK.A
*	TK270802_E14_cyto_2D_step01.2274.2274.1	2.071	0.0731	1188.94	1	6110.0%	2	R.NFAQFSSEEK.I
*	TK270802_E14_cyto_2D_step10.4127.4127.3	4.6714	0.5463	2684.89	1	3700.0%	10	K.NVLSIATITFTQFVPEATEEEVNK.M
*	TK270802_E14_cyto_2D_step11.3805.3805.2	4.2811	0.5944	2183.36	1	5280.0%	6	K.WSGCGEGMADIFIGHLCIR.N
*	TK270802_E14_cyto_2D_step11.3885.3885.3	2.577	0.2669	2521.82	1	2950.0%	3	K.QKPELTEEQLAAVTADFSGLLEK.C
*	TK270802_E14_cyto_2D_step03.2002.2002.1	2.5091	0.3227	1144.16	1	5560.0%	7	K.HIEESQALSK.Q
	TK270802_E14_cyto_2D_step01.0488.0488.1	1.0381	0.0694	460.8	2	8330.0%	1	K.LISK.T
	TK270802_E14_cyto_2D_step01.0441.0441.1	0.8619	0.061	466.93	2	8330.0%	1	K.FGSR.N
UPPCE_MOUSE99.6%172921.5%710807525.7(Q9QUR6) Prolyl endopeptidase (EC 3.4.21.26) (Post-proline cleaving enzyme) (PE) 
	TK270802_E14_cyto_2D_step08.3102.3102.1	1.8549	0.1014	987.66	2	5710.0%	3	K.IPMFIVHK.K
	TK270802_E14_cyto_2D_step04.3866.3866.2	1.8301	0.1331	1651.76	1	3930.0%	1	K.NILQLHDLTTGALLK.T
	TK270802_E14_cyto_2D_step05.3953.3953.2	2.6975	0.4128	1609.33	1	5830.0%	1	R.SNFLVLCYLHDVK.N
*	TK270802_E14_cyto_2D_step08.3100.3100.1	1.1722	0.1915	1237.81	8	2730.0%	1	R.HMGGVLAVANIR.G
	TK270802_E14_cyto_2D_step06.2071.2071.1	1.1114	0.1461	841.97	1	6000.0%	2	K.YSCHFK.K
*	TK270802_E14_cyto_2D_step12.4656.4656.2	0.9547	0.0504	2998.97	4	1880.0%	1	K.KDSEIFYQFTSFLSPGVIYHCDLTK.E
	TK270802_E14_cyto_2D_step06.2293.2293.1	1.5892	0.225	958.56	1	6430.0%	2	K.YSPLHNVK.L
	TK270802_E14_cyto_2D_step01.0508.0508.1	2.3382	0.4622	1419.75	1	4170.0%	2	K.SDGTETSTNLHQK.L
*	TK270802_E14_cyto_2D_step03.3907.3907.2	1.4969	0.1022	1822.43	1	4290.0%	1	R.YVLLSIWEGCDPVNR.L
*	TK270802_E14_cyto_2D_step04.3185.3185.2	1.6328	0.1444	1823.45	21	3210.0%	1	R.LINIDFTDPDESKWK.V
*	TK270802_E14_cyto_2D_step06.3793.3793.3	1.4422	0.1843	3099.0	20	1060.0%	1	K.WMGGAELSDDGRYVLLSIWEGCDPVNR.L
*	TK270802_E14_cyto_2D_step04.2753.2753.1	1.0564	0.2683	1353.81	1	5500.0%	1	K.FTCMAWTHDGK.G
URS16_MOUSE99.6%4816.0%1441622510.2(P14131) 40S ribosomal protein S16 
	TK270802_E14_cyto_2D_step03.3163.3163.1	3.084	0.5308	1189.87	1	6000.0%	2	K.GPLQSVQVFGR.K
	TK270802_E14_cyto_2D_step06.2717.2717.1	1.7043	0.3225	1242.02	1	5450.0%	2	K.GGGHVAQIYAIR.Q
URL4_MOUSE99.6%163430.5%4194715411.0(Q9D8E6) 60S ribosomal protein L4 (L1) 
	TK270802_E14_cyto_2D_step06.2981.2981.2	3.2852	0.393	1763.71	1	6070.0%	1	R.RGPCIIYNEDNGIIK.A
	TK270802_E14_cyto_2D_step04.2264.2264.1	1.9303	0.216	1104.13	2	6250.0%	1	K.SNYNLPMHK.M
	TK270802_E14_cyto_2D_step06.1507.1507.1	0.8834	0.1585	600.21	2	5000.0%	1	K.KPAVGK.K
	TK270802_E14_cyto_2D_step04.3156.3156.1	1.8478	0.1275	1282.3	1	5560.0%	1	R.KLDELYGTWR.K
	TK270802_E14_cyto_2D_step04.2461.2461.1	2.0519	0.2577	1189.72	1	5450.0%	3	K.KLEAAATALATK.S
	TK270802_E14_cyto_2D_step03.3052.3052.2	1.3346	0.2859	2334.01	1	3100.0%	1	R.QPYAVSELAGHQTSAESWGTGR.A
	TK270802_E14_cyto_2D_step01.3179.3179.1	2.3331	0.3553	1270.82	1	5910.0%	3	R.NIPGITLLNVSK.L
	TK270802_E14_cyto_2D_step01.0192.0192.1	1.0574	0.1563	989.04	2	4380.0%	1	K.NVTLPAVFK.A
	TK270802_E14_cyto_2D_step13.3417.3417.2	2.3652	0.4246	1865.64	1	5670.0%	3	K.APIRPDIVNFVHTNLR.K
	TK270802_E14_cyto_2D_step02.3587.3587.2	0.9221	0.1501	1749.22	23	2190.0%	1	R.GGGTHRSGQGAFGNMCR.G
UDPY3_MOUSE99.6%224.2%570619366.5(Q62188) Dihydropyrimidinase related protein-3 (DRP-3) (Unc-33-like phosphoprotein) (ULIP protein) 
	TK270802_E14_cyto_2D_step07.1317.1317.1	0.8574	0.0228	628.86	3	5000.0%	1	K.KNIPR.I
	TK270802_E14_cyto_2D_step04.2917.2917.2	3.2572	0.5922	2032.83	1	5560.0%	1	R.NLHQSGFSLSGTQVDEGVR.S
UHS47_MOUSE99.6%468.9%417465908.8(P19324) 47 kDa heat shock protein precursor (Collagen-binding protein 1) (Serine protease inhibitor J6) 
*	TK270802_E14_cyto_2D_step01.2508.2508.1	0.7775	0.0198	1280.94	9	2500.0%	1	K.KPLEAAAPGTAEK.L
	TK270802_E14_cyto_2D_step04.3286.3286.1	2.6965	0.4989	1339.96	1	5830.0%	2	K.HLAGLGLTEAIDK.N
*	TK270802_E14_cyto_2D_step04.3154.3154.1	1.8745	0.231	1298.07	5	5000.0%	1	K.LQMVEMPLAHK.L
UROK_MOUSE99.6%207018.1%464509935.4(Q60577) Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (65 kDa phosphoprotein) 
	TK270802_E14_cyto_2D_step14.1627.1627.1	0.7028	0.079	873.18	2	3120.0%	1	R.GPPPPPPGR.G
	TK270802_E14_cyto_2D_step01.3832.3832.1	2.0038	0.3373	1343.75	1	5450.0%	1	K.IILDLISESPIK.G
	TK270802_E14_cyto_2D_step04.2449.2449.1	1.9452	0.25	1054.48	10	5560.0%	2	R.VVLIGGKPDR.V
	TK270802_E14_cyto_2D_step12.2125.2125.2	0.968	0.1168	1196.59	3	4000.0%	7	R.NLPLPPPPPPR.G
	TK270802_E14_cyto_2D_step03.2442.2442.1	2.421	0.4695	1581.72	2	4580.0%	2	K.RPAEDMEEEQAFK.R
	TK270802_E14_cyto_2D_step01.1635.1635.1	1.4529	0.3077	730.17	1	7140.0%	1	K.NAGAVIGK.G
	TK270802_E14_cyto_2D_step03.2319.2319.1	2.226	0.4275	1551.78	1	4550.0%	2	K.LFQECCPHSTDR.V
	TK270802_E14_cyto_2D_step01.0163.0163.1	1.1359	0.2274	874.05	3	5620.0%	1	K.DLAGSIIGK.G
UQ8R1K599.6%4810.4%222216349.4(Q8R1K5) Similar to heterogeneous nuclear ribonucleoprotein A3 (H. sapiens) 
	TK270802_E14_cyto_2D_step01.5574.5574.1	1.0999	0.0295	881.85	6	4500.0%	2	R.GGYGGGGGGSR.G
	TK270802_E14_cyto_2D_step05.2107.2107.1	2.0355	0.5301	1474.52	1	5000.0%	2	K.YHTINGHNCEVK.K
UQ99LJ399.6%5175.8%400459185.0(Q99LJ3) Hypothetical 45.9 kDa protein (Fragment) 
	TK270802_E14_cyto_2D_step05.1601.1601.2	1.2516	0.0991	1326.42	9	4500.0%	1	R.RDQALTEEHAR.Q
	TK270802_E14_cyto_2D_step04.3201.3201.1	3.096	0.4493	1296.11	1	6820.0%	4	R.LAILGIHNEVSK.I
ULDHL_HUMAN99.6%4427.6%381419438.6(Q9BYZ2) L-lactate dehydrogenase A-like (EC 1.1.1.27) 
*	TK270802_E14_cyto_2D_step07.3984.3984.3	0.9894	0.1367	3603.76	51	960.0%	1	K.VSIIGTGSVGMACAISILLKGLSDELALVDLDEDK.L
*	TK270802_E14_cyto_2D_step09.4792.4792.3	1.2549	0.0981	4386.65	97	810.0%	1	R.FLIGQKLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLK.D
*	TK270802_E14_cyto_2D_step02.4268.4268.2	3.6675	0.5237	1946.22	1	5620.0%	1	K.LIIVSNPVDILTYVAWK.L
*	TK270802_E14_cyto_2D_step01.3540.3540.1	0.9601	0.0108	1410.26	23	3640.0%	1	K.IKLTPEEEAHLK.K
UCLI1_MOUSE99.6%51120.7%241270135.2(Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride ion channel 27) (NCC27) (p64 CLCP) 
	TK270802_E14_cyto_2D_step11.2666.2666.3	1.1907	0.1443	1490.27	15	2290.0%	1	R.GFTIPEAFRGVHR.Y
	TK270802_E14_cyto_2D_step07.2760.2760.1	2.6945	0.275	1097.86	1	6880.0%	3	K.LHIVQVVCK.K
*	TK270802_E14_cyto_2D_step08.3754.3754.2	1.2542	0.0391	3139.28	27	1480.0%	1	K.VLDNYLTSPLPEEVDETSAEDEGISQRK.F
UO8911299.6%3318.5%399453417.8(O89112) P40 seven-transmembrane-domain protein (LANC-like protein 1) 
*	TK270802_E14_cyto_2D_step02.4647.4647.2	0.9663	0.0646	2803.08	19	1600.0%	1	K.GYGLCHGAAGNAYAFLALYNLTQDLK.Y
*	TK270802_E14_cyto_2D_step06.3649.3649.2	2.5961	0.5468	2538.83	1	5480.0%	1	K.IPQSHIQQICENILTSGENLSR.K
*	TK270802_E14_cyto_2D_step06.3637.3637.2	1.2816	0.052	2796.51	9	2000.0%	1	R.SITFLCGDAGPLAVAAVLYHKMNSEK.Q
U143G_HUMAN99.6%156522.4%246281714.9(P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) (P35214) 14-3-3 protein gamma (Protein kinase C inhibitor protein-1) (KCIP-1) 
	TK270802_E14_cyto_2D_step05.2309.2309.1	1.3139	0.194	775.92	2	7000.0%	1	K.KIEMVR.A
	TK270802_E14_cyto_2D_step10.2262.2262.1	0.9391	0.1738	1247.76	6	2780.0%	3	K.EHMQPTHPIR.L
	TK270802_E14_cyto_2D_step06.4265.4265.1	1.0982	0.0449	1082.1	3	3890.0%	2	R.YLAEVATGEK.R
	TK270802_E14_cyto_2D_step01.4658.4658.2	3.9383	0.5334	2237.87	1	5280.0%	1	K.ELEAVCQDVLSLLDNYLIK.N
	TK270802_E14_cyto_2D_step04.1637.1637.1	0.9704	0.0021	1106.66	222	2780.0%	1	K.RATVVESSEK.A
UG3P1_HUMAN99.6%91726.3%334358767.1(P00354) Glyceraldehyde 3-phosphate dehydrogenase, muscle (EC 1.2.1.12) 
*	TK270802_E14_cyto_2D_step01.2122.2122.1	2.4613	0.3737	1371.9	2	4290.0%	3	R.GAAQNLIPASTGAAK.A
*	TK270802_E14_cyto_2D_step01.2159.2159.1	1.6406	0.1255	872.62	1	6430.0%	2	K.VIPELDGK.L
*	TK270802_E14_cyto_2D_step01.1590.1590.1	1.0284	0.0405	833.65	38	4290.0%	1	K.EASEGPLK.G
*	TK270802_E14_cyto_2D_step15.3828.3828.2	0.8613	0.0476	2946.31	16	1540.0%	1	R.DPENIKWGDAGTAYVVESTGVFTTMEK.A
*	TK270802_E14_cyto_2D_step01.2187.2187.1	1.3352	0.4005	808.5	21	3570.0%	1	K.VGVDGFGR.I
*	TK270802_E14_cyto_2D_step13.3108.3108.2	1.2308	0.1428	2389.12	1	2140.0%	1	K.RIVISAPSADAPMFVMGVNHFK.Y
UMK_MOUSE99.6%3325.7%140154349.7(P12025) Midkine precursor (Retinoic acid-induced differentiation factor) 
*	TK270802_E14_cyto_2D_step04.2912.2912.2	3.9754	0.5564	2086.79	1	5000.0%	1	K.KGSECSEWTWGPCTPSSK.D
	TK270802_E14_cyto_2D_step04.2016.2016.1	1.3144	0.0339	1108.79	3	5000.0%	1	R.EGTCGAQTQR.V
*	TK270802_E14_cyto_2D_step04.1448.1448.1	0.7399	0.0060	920.48	56	2860.0%	1	R.VTKPCTSK.T
UQ99K5199.6%7138.4%630707425.6(Q99K51) Hypothetical 70.7 kDa protein 
	TK270802_E14_cyto_2D_step07.3485.3485.2	3.3991	0.5083	1417.81	1	7730.0%	1	K.AYFHLLNQIAPK.G
	TK270802_E14_cyto_2D_step04.2577.2577.1	1.7845	0.3444	1537.96	1	4580.0%	1	K.KLENCNYAVELGK.N
	TK270802_E14_cyto_2D_step14.1893.1893.2	0.7076	0.0134	1584.3	349	1430.0%	1	R.TLSEAGKSTSIQSFK.D
	TK270802_E14_cyto_2D_step05.3291.3291.2	1.6245	0.3211	1618.28	1	5420.0%	1	R.WANFHLENSGWQK.I
UHBE_MOUSE99.6%279554.8%146160058.2(P02104) Hemoglobin epsilon-Y2 chain 
	TK270802_E14_cyto_2D_step05.2943.2943.1	1.9562	0.1515	1195.45	1	6000.0%	6	K.KVLTAFGESIK.N
*	TK270802_E14_cyto_2D_step01.1943.1943.1	1.6779	0.2459	937.83	1	7860.0%	1	-.VNFTAEEK.T
	TK270802_E14_cyto_2D_step03.1931.1931.1	1.6805	0.2332	1002.81	3	5000.0%	1	K.LSELHCDK.L
	TK270802_E14_cyto_2D_step04.2776.2776.1	1.9464	0.2916	1169.16	1	5910.0%	4	K.LVAGVATALSHK.Y
	TK270802_E14_cyto_2D_step01.2450.2450.1	2.3837	0.3608	1330.94	1	5420.0%	2	K.VNVEEVGGEALGR.L
	TK270802_E14_cyto_2D_step01.3070.3070.1	1.3411	0.3049	1034.07	2	5000.0%	3	K.TLINGLWSK.V
	TK270802_E14_cyto_2D_step01.3670.3670.2	3.5922	0.5079	2020.49	1	5560.0%	3	R.FFDSFGNLSSASAIMGNPR.V
	TK270802_E14_cyto_2D_step01.2790.2790.1	1.4246	0.2061	1067.08	1	6110.0%	3	K.VLTAFGESIK.N
USTN1_MOUSE99.6%142841.2%148171436.0(P54227) Stathmin (Phosphoprotein p19) (pp19) (Oncoprotein 18) (Op18) (Leukemia-associated phosphoprotein p18) (pp17) (Prosolin) (Metablastin) (Pr22 protein) (Leukemia-associated gene protein) 
	TK270802_E14_cyto_2D_step01.1776.1776.1	1.9765	0.3558	1167.46	1	5560.0%	2	K.AIEENNNFSK.M
	TK270802_E14_cyto_2D_step03.2102.2102.1	1.5621	0.3037	914.49	9	5000.0%	2	K.SHEAEVLK.Q
*	TK270802_E14_cyto_2D_step01.2838.2838.1	1.6785	0.4688	1315.05	1	5450.0%	2	K.ESVPDFPLSPPK.K
	TK270802_E14_cyto_2D_step02.3355.3355.2	1.7777	0.0299	1391.93	8	4580.0%	2	R.ASGQAFELILSPR.S
	TK270802_E14_cyto_2D_step03.1935.1935.1	1.6959	0.1774	946.15	1	6430.0%	1	K.KLEAAEER.R
	TK270802_E14_cyto_2D_step11.3251.3251.2	1.4627	0.134	1546.02	2	4620.0%	1	K.RASGQAFELILSPR.S
	TK270802_E14_cyto_2D_step01.0143.0143.1	1.9693	0.2291	1075.77	1	7500.0%	1	K.DLSLEEIQK.K
UUBC7_HUMAN99.6%134941.6%154178628.5(P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) (P51966) Ubiquitin-conjugating enzyme E2-18 kDa UbcH7 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UbcM4) (E2-F1) (L-UBC) 
	TK270802_E14_cyto_2D_step05.4335.4335.2	3.6257	0.5307	2486.16	1	4520.0%	5	K.TDQVIQSLIALVNDPQPEHPLR.A
	TK270802_E14_cyto_2D_step04.2248.2248.1	1.9669	0.175	1131.01	1	6250.0%	2	K.IYHPNIDEK.G
	TK270802_E14_cyto_2D_step04.3446.3446.2	2.1819	0.3874	2000.29	1	4710.0%	2	K.GQVCLPVISAENWKPATK.T
	TK270802_E14_cyto_2D_step04.3838.3838.2	1.7675	0.2009	1792.51	1	5360.0%	4	R.IEINFPAEYPFKPPK.I
UMYHB_MOUSE99.6%193510.1%19722270265.5(O08638) Myosin heavy chain, smooth muscle isoform (SMMHC) 
	TK270802_E14_cyto_2D_step09.3727.3727.2	3.2591	0.5929	2470.32	1	4720.0%	2	K.LQQLFNHTMFILEQEEYQR.E
	TK270802_E14_cyto_2D_step08.2678.2678.1	1.5983	0.274	1053.99	8	5620.0%	2	K.VKPLLQVTR.Q
	TK270802_E14_cyto_2D_step03.1555.1555.3	1.3592	0.1459	1626.56	7	2140.0%	1	K.AEMEDLVSSKDDVGK.N
	TK270802_E14_cyto_2D_step04.2756.2756.1	1.9253	0.3121	1442.05	1	6250.0%	1	R.HVSTLNIQLSDSK.K
	TK270802_E14_cyto_2D_step04.2040.2040.3	1.4693	0.0804	1947.67	8	2500.0%	1	K.LQRELDEATESNEAMGR.E
	TK270802_E14_cyto_2D_step01.5403.5403.2	1.1626	0.0961	3049.89	2	1730.0%	1	R.DLGEELEALKTELEDTLDSTATQQELR.A
	TK270802_E14_cyto_2D_step03.2852.2852.1	2.0479	0.1109	1222.94	1	6670.0%	4	K.KFDQLLAEEK.N
	TK270802_E14_cyto_2D_step04.1974.1974.3	1.9246	0.1975	2618.5	3	2160.0%	1	K.DVASLGSQLQDTQELLQEETRQK.L
	TK270802_E14_cyto_2D_step07.1311.1311.1	0.6591	0.0391	648.95	59	5000.0%	1	K.EEKSR.Q
	TK270802_E14_cyto_2D_step06.3431.3431.2	2.2008	0.4838	1631.3	1	5770.0%	1	K.VCHLVGINVTDFTR.A
	TK270802_E14_cyto_2D_step03.2624.2624.1	1.9838	0.2261	1259.06	1	6000.0%	1	K.KEEELQAALAR.L
	TK270802_E14_cyto_2D_step06.2142.2142.1	1.2776	0.1266	1103.92	87	5000.0%	1	K.RQQQLTAMK.V
	TK270802_E14_cyto_2D_step13.4488.4488.2	0.8081	0.1228	2672.49	21	1090.0%	1	R.KLEGDASDFHEQIADLQAQIAELK.M
	TK270802_E14_cyto_2D_step01.1202.1202.1	0.2235	0.0	516.4	1	3330.0%	1	K.QKDK.K
UHBB0_MOUSE99.6%81626.0%146162818.6(P04443) Hemoglobin beta-H0 chain 
	TK270802_E14_cyto_2D_step04.2573.2573.1	2.0935	0.3651	1101.17	1	6250.0%	3	K.LHVDPENFK.L
	TK270802_E14_cyto_2D_step04.2798.2798.1	2.2317	0.5002	1588.72	1	5420.0%	2	K.ETFAHLSELHCDK.L
	TK270802_E14_cyto_2D_step01.1631.1631.1	1.166	0.2161	789.86	29	5000.0%	1	K.VGGETLGR.L
	TK270802_E14_cyto_2D_step04.2113.2113.1	1.8963	0.3479	960.74	1	6430.0%	1	-.VHFTAEEK.A
UQ8VDP499.6%687.2%9991124725.8(Q8VDP4) Hypothetical 112.5 kDa protein (Fragment) 
*	TK270802_E14_cyto_2D_step06.4823.4823.2	1.4713	0.0544	1959.0	23	2650.0%	1	K.EDGLLPKRPSSGGEEEEK.A
*	TK270802_E14_cyto_2D_step15.4116.4116.2	0.9088	0.0161	3178.47	8	1670.0%	1	R.VFTGIVTSLHDYFGVVDEEVFFQLSVVK.G
*	TK270802_E14_cyto_2D_step07.3930.3930.3	1.4465	0.0588	2720.41	64	1300.0%	1	K.VQTLSNQPLLKSPAPPLLHVAALGQK.Q
*	TK270802_E14_cyto_2D_step11.3053.3053.2	2.5674	0.5043	1500.55	1	6790.0%	2	K.SPAPPLLHVAALGQK.Q
UTCP1_MOUSE99.6%111912.1%556603416.1(P11984) T-complex protein 1, alpha subunit A (TCP-1-alpha) (CCT-alpha) (Tailless complex polypeptide 1A) (TCP-1-A) 
	TK270802_E14_cyto_2D_step08.2592.2592.1	2.1799	0.3953	1229.69	1	6000.0%	1	K.IHPTSVISGYR.L
	TK270802_E14_cyto_2D_step04.2816.2816.1	2.4494	0.205	1144.16	1	6110.0%	2	R.SLHDALCVVK.R
	TK270802_E14_cyto_2D_step03.2282.2282.1	1.9702	0.3127	1574.82	1	5000.0%	2	K.HGSYENAVHSGALDD.-
	TK270802_E14_cyto_2D_step03.2488.2488.1	1.9695	0.2531	1108.95	2	5560.0%	2	K.LLEVEHPAAK.V
	TK270802_E14_cyto_2D_step04.2034.2034.1	2.7767	0.3286	1413.66	1	5910.0%	2	R.AFHNEAQVNPER.K
*	TK270802_E14_cyto_2D_step04.1914.1914.1	0.8249	0.0558	1141.65	6	3750.0%	1	K.LHPECKDDK.H
UO0042999.6%91310.1%736818916.8(O00429) Dynamin-like protein 
	TK270802_E14_cyto_2D_step11.2662.2662.2	1.1606	0.114	1297.17	3	4000.0%	1	K.AVMHFLVNHVK.D
	TK270802_E14_cyto_2D_step09.2545.2545.2	1.3487	0.2426	1395.85	1	5000.0%	1	K.SKPIPIMPASPQK.G
	TK270802_E14_cyto_2D_step07.5049.5049.2	0.7329	0.0037	2880.89	62	960.0%	1	K.IFSPNVVNLTLVDLPGMTKVPVGDQPK.D
	TK270802_E14_cyto_2D_step08.2644.2644.1	1.3709	0.0165	948.23	16	5710.0%	2	K.KYPSLANR.N
	TK270802_E14_cyto_2D_step07.3445.3445.2	2.6702	0.5379	1559.16	1	6070.0%	1	K.GHAVNLLDVPVPVAR.K
UU5S1_MOUSE99.6%447.6%9711093615.0(O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) 
	TK270802_E14_cyto_2D_step06.2345.2345.1	1.52	0.4066	1306.91	12	3750.0%	1	R.VLSGTIHAGQPVK.V
	TK270802_E14_cyto_2D_step05.3121.3121.2	1.1719	0.0479	1895.99	34	3240.0%	1	R.GHVTQDAPIPGSPLYTIK.A
	TK270802_E14_cyto_2D_step13.2993.2993.2	3.0993	0.5835	1897.64	1	4380.0%	1	K.SIVIRPLEPQPAPHLAR.E
	TK270802_E14_cyto_2D_step11.4586.4586.2	0.9347	0.1259	2948.01	343	1000.0%	1	R.THTQGQAFSLSVFHHWQIVPGDPLDK.S
UQ922Y799.6%2116111.2%464510285.3(Q922Y7) Unknown (Protein for MGC:6388) 
	TK270802_E14_cyto_2D_step09.3366.3366.2	3.7698	0.5196	1522.63	1	7500.0%	8	R.LLIHQSLAGGIIGVK.G
	TK270802_E14_cyto_2D_step08.3898.3898.3	1.7051	0.2153	4188.6	1	1810.0%	4	K.KIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYK.G
UH33_HUMAN99.6%3526.7%1351519711.3(P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q) (P06351) Histone H3.3 (H3.A) (H3.B) (H3.3Q) 
	TK270802_E14_cyto_2D_step12.4047.4047.3	3.9701	0.5872	3441.19	1	2580.0%	2	R.FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK.R
	TK270802_E14_cyto_2D_step13.4741.4741.3	1.8315	0.0301	3926.01	115	1000.0%	1	K.TDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAK.R
UQ9QZF499.6%2214.0%349401804.9(Q9QZF4) Cytoplasmic linker protein 50 
	TK270802_E14_cyto_2D_step06.5215.5215.3	0.9841	0.0622	4318.01	14	1210.0%	1	R.LFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSR.S
	TK270802_E14_cyto_2D_step04.3312.3312.1	1.7106	0.439	1443.78	1	5420.0%	1	K.SLHSVVQTLESDK.V
URL7A_MOUSE99.6%173135.1%2652984510.6(P12970) 60S ribosomal protein L7a (Surfeit locus protein 3) 
	TK270802_E14_cyto_2D_step07.2110.2110.1	1.8321	0.3664	979.89	3	4440.0%	1	K.KVAPAPAVVK.K
	TK270802_E14_cyto_2D_step03.2502.2502.2	4.03	0.5641	1829.98	1	7670.0%	1	R.KTCTTVAFTQVNSEDK.G
	TK270802_E14_cyto_2D_step01.2498.2498.1	1.8867	0.0902	1218.2	3	6000.0%	1	K.NFGIGQDIQPK.R
	TK270802_E14_cyto_2D_step01.1854.1854.1	2.1105	0.4668	852.68	1	6880.0%	2	K.VAPAPAVVK.K
	TK270802_E14_cyto_2D_step12.1672.1672.1	1.0398	0.0898	738.56	5	4000.0%	3	K.RPPVLR.A
	TK270802_E14_cyto_2D_step12.4768.4768.2	1.1027	0.1466	2690.85	1	2170.0%	2	K.AQLVVIAHDVDPIELVVFLPALCR.K
	TK270802_E14_cyto_2D_step06.2938.2938.1	2.075	0.1929	1076.12	1	7500.0%	2	K.KVVNPLFEK.R
	TK270802_E14_cyto_2D_step13.2145.2145.2	1.5293	0.1737	833.31	2	7500.0%	1	R.LGHLVHR.K
	TK270802_E14_cyto_2D_step08.2643.2643.1	2.3748	0.0671	1066.9	1	6670.0%	2	R.HWGGNVLGPK.S
UHBA_MOUSE99.6%7181168.1%141149548.2(P01942) Hemoglobin alpha chain 
*	TK270802_E14_cyto_2D_step01.0428.0428.1	1.3351	0.0879	747.9	1	7500.0%	1	-.VLSGEDK.S
	TK270802_E14_cyto_2D_step02.3166.3166.2	2.3475	0.4021	1255.49	1	5910.0%	3	K.FLASVSTVLTSK.Y
	TK270802_E14_cyto_2D_step01.2642.2642.1	1.5502	0.2792	1031.34	1	5620.0%	4	R.MFASFPTTK.T
	TK270802_E14_cyto_2D_step05.2851.2851.2	2.2571	0.2601	1089.73	2	6250.0%	1	K.LRVDPVNFK.L
	TK270802_E14_cyto_2D_step04.5170.5170.1	0.6991	0.0018	1533.61	10	2140.0%	9	K.IGGHGAEYGAEALER.M
	TK270802_E14_cyto_2D_step08.3215.3215.2	1.7354	0.3438	1823.49	1	3670.0%	19	K.TYFPHFDVSHGSAQVK.G
	TK270802_E14_cyto_2D_step15.4555.4555.2	3.9586	0.68	3055.46	1	3700.0%	14	K.LLSHCLLVTLASHHPADFTPAVHASLDK.F
UQ921R299.6%123225.7%1401614210.7(Q921R2) Similar to ribosomal protein S13 
	TK270802_E14_cyto_2D_step11.3098.3098.2	2.1798	0.3599	1384.5	1	7080.0%	4	K.KGLTPSQIGVILR.D
	TK270802_E14_cyto_2D_step10.2623.2623.2	1.5137	0.1987	1013.14	1	7140.0%	1	K.RVLPPNWK.-
	TK270802_E14_cyto_2D_step07.1551.1551.1	0.8082	0.1814	638.84	1	6000.0%	1	R.MHAPGK.G
	TK270802_E14_cyto_2D_step03.1646.1646.1	1.1618	0.1002	970.72	77	3120.0%	2	R.DSHGVAQVR.F
UQ9D1P499.6%61216.6%331373517.9(Q9D1P4) 1110001O09Rik protein (RIKEN cDNA 1110001O09 gene) 
	TK270802_E14_cyto_2D_step09.2920.2920.2	2.6076	0.3844	1850.24	1	5000.0%	3	K.FQEHIIQAPKPVEAIK.R
*	TK270802_E14_cyto_2D_step09.2989.2989.3	1.3417	0.0191	2772.96	22	1630.0%	1	K.ELSELKPKFQEHIIQAPKPVEAIK.R
	TK270802_E14_cyto_2D_step11.2233.2233.2	0.9544	0.1037	1717.06	16	2500.0%	1	R.HNSEKPPEPVKPEVK.T
*	TK270802_E14_cyto_2D_step05.3477.3477.2	3.9226	0.5482	1830.53	1	7330.0%	1	R.KAEPMQWASLELPTTK.K
UCLP2_MOUSE99.6%51113.8%305331567.6(Q08093) Calponin H2, smooth muscle 
	TK270802_E14_cyto_2D_step04.1944.1944.1	1.7932	0.2644	776.86	1	8000.0%	1	R.HIYDTK.L
*	TK270802_E14_cyto_2D_step11.3054.3054.2	1.6708	0.3866	2310.15	1	3160.0%	1	K.NHILPPMDHCTISLQMGTNK.C
	TK270802_E14_cyto_2D_step07.3774.3774.2	3.0032	0.5743	1992.6	1	5000.0%	3	R.SMQNWHQLENLSNFIK.A
UQ8VDD599.6%24528.2%19602263555.7(Q8VDD5) Nonmuscle heavy chain myosin II-A 
	TK270802_E14_cyto_2D_step03.3170.3170.1	2.0418	0.3208	1295.7	1	5000.0%	1	K.ADFCIIHYAGK.V
	TK270802_E14_cyto_2D_step07.4214.4214.2	1.2846	0.0685	2804.98	3	2050.0%	1	K.ERYYSGLIYTYSGLFCVVINPYK.N
*	TK270802_E14_cyto_2D_step09.2746.2746.1	1.6025	0.1706	1041.11	12	5000.0%	2	K.VKPLLNSIR.H
	TK270802_E14_cyto_2D_step08.3220.3220.2	1.0937	0.2158	2414.26	13	1580.0%	1	K.EERTFHIFYYLLSGAGEHLK.T
	TK270802_E14_cyto_2D_step05.5183.5183.2	0.9013	0.0385	2615.4	52	1090.0%	1	R.KLEGDSTDLSDQIAELQAQIAELK.M
	TK270802_E14_cyto_2D_step04.2086.2086.1	2.4348	0.3777	1244.88	1	5560.0%	2	K.THEAQIQEMR.Q
	TK270802_E14_cyto_2D_step05.3664.3664.2	4.0623	0.4937	1575.42	1	7690.0%	3	K.VSHLLGINVTDFTR.G
*	TK270802_E14_cyto_2D_step01.2060.2060.1	2.5921	0.4241	1228.88	1	6000.0%	2	K.DLEAHIDTANK.N
	TK270802_E14_cyto_2D_step04.1858.1858.1	1.4525	0.0131	759.92	11	6000.0%	1	R.QNKELK.A
	TK270802_E14_cyto_2D_step04.2982.2982.1	1.6976	0.065	1226.16	16	4000.0%	2	R.AGVLAHLEEER.D
*	TK270802_E14_cyto_2D_step05.3117.3117.1	0.9692	0.0713	1159.95	2	3330.0%	1	R.RGDLPFVVTR.R
	TK270802_E14_cyto_2D_step04.2720.2720.1	2.533	0.1816	1415.08	1	5910.0%	2	K.KVEAQLQELQVK.F
UQ9JHU999.6%5716.3%557609326.4(Q9JHU9) Myo-inositol 1-phosphate synthase A1 (EC 5.5.1.4) (1300017C10Rik protein) (Similar to myo-inositol 1-phosphate synthase A1) 
*	TK270802_E14_cyto_2D_step13.2644.2644.2	3.5951	0.5486	2323.75	1	4760.0%	2	K.MERPGPGIKPGEVVATSPLPCK.K
*	TK270802_E14_cyto_2D_step04.5150.5150.2	0.8511	0.0669	2995.49	1	1350.0%	1	K.TMSIVSYNHLGNNDGQNLSAPLQFRSK.E
*	TK270802_E14_cyto_2D_step04.3564.3564.2	1.3234	0.0703	2777.84	61	1670.0%	1	K.TMSIVSYNHLGNNDGQNLSAPLQFR.S
*	TK270802_E14_cyto_2D_step12.2315.2315.3	1.0791	0.1917	4591.95	2	790.0%	1	R.VSFCTDSDPEPQGFHTVLSLLSFLFKAPLVPPGSPVVNALFR.Q
UGSHC_MOUSE99.6%3322.9%201222827.2(P11352) Glutathione peroxidase (EC 1.11.1.9) (GSHPx-1) (Cellular glutathione peroxidase) 
*	TK270802_E14_cyto_2D_step06.3761.3761.2	3.8125	0.5835	1959.75	1	5620.0%	1	K.YVRPGGGFEPNFTLFEK.C
*	TK270802_E14_cyto_2D_step05.2266.2266.1	1.2002	0.0039	1103.84	49	3750.0%	1	K.AHPLFTFLR.N
*	TK270802_E14_cyto_2D_step04.4173.4173.2	0.977	0.0407	2275.19	14	2110.0%	1	R.NDIAWNFEKFLVGPDGVPVR.R
UHS74_MOUSE99.6%463.2%841941335.2(Q61316) Heat shock 70-related protein APG-2 
	TK270802_E14_cyto_2D_step01.3647.3647.1	0.9309	0.0401	1585.93	2	3850.0%	1	R.NFTTEQVTAMLLSK.L
	TK270802_E14_cyto_2D_step06.2095.2095.1	1.9552	0.5022	872.44	1	6430.0%	2	K.NHAAPFSK.V
	TK270802_E14_cyto_2D_step13.1228.1228.1	0.9012	0.168	673.02	2	5000.0%	1	K.RFHGR.A
UACTB_HUMAN99.6%2601226833.6%375417375.5(P02570) Actin, cytoplasmic 1 (Beta-actin) (P02570) Actin, cytoplasmic 1 (Beta-actin) 
	TK270802_E14_cyto_2D_step01.2138.2138.1	1.1275	0.0725	1134.53	10	4440.0%	1	R.GYSFTTTAER.E
	TK270802_E14_cyto_2D_step03.4043.4043.3	1.9669	0.286	3235.93	1	2130.0%	6	R.CPEALFQPSFLGMESCGIHETTFNSIMK.C
	TK270802_E14_cyto_2D_step01.1686.1686.1	1.1446	0.0020	777.88	28	6000.0%	1	K.CDVDIR.K
	TK270802_E14_cyto_2D_step13.4438.4438.1	1.2543	0.178	1519.42	1	4500.0%	50	K.IWHHTFYNELR.V
	TK270802_E14_cyto_2D_step03.3882.3882.2	3.1483	0.5077	1958.06	1	4710.0%	33	R.VAPEEHPVLLTEAPLNPK.A
	TK270802_E14_cyto_2D_step03.4199.4199.2	3.2933	0.6409	2554.79	1	4550.0%	77	K.LCYVALDFEQEMATAASSSSLEK.S
	TK270802_E14_cyto_2D_step05.4075.4075.3	5.4708	0.6421	3188.56	1	2840.0%	14	R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L
U143E_HUMAN99.6%2413833.7%255291744.7(P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) (P42655) 14-3-3 protein epsilon (Mitochondrial import stimulation factor L subunit) (Protein kinase C inhibitor protein-1) (KCIP-1) (14-3-3E) 
	TK270802_E14_cyto_2D_step01.1980.1980.1	1.7966	0.0906	919.64	5	6430.0%	2	R.IISSIEQK.E
	TK270802_E14_cyto_2D_step01.1674.1674.1	1.1312	0.0709	630.01	6	8000.0%	1	K.NVIGAR.R
	TK270802_E14_cyto_2D_step03.2450.2450.1	1.1903	0.0862	1322.99	1	4550.0%	1	R.KEAAENSLVAYK.A
	TK270802_E14_cyto_2D_step01.3887.3887.1	3.4202	0.2294	1480.25	3	5450.0%	2	K.LICCDILDVLDK.H
	TK270802_E14_cyto_2D_step03.3539.3539.2	1.6415	0.1424	1823.21	2	3750.0%	10	K.AASDIAMTELPPTHPIR.L
	TK270802_E14_cyto_2D_step01.1756.1756.2	0.9194	0.0675	2698.69	5	1740.0%	1	K.LICCDILDVLDKHLIPAANTGESK.V
	TK270802_E14_cyto_2D_step01.4098.4098.2	4.1763	0.5347	2090.11	1	6670.0%	1	K.AAFDDAIAELDTLSEESYK.D
	TK270802_E14_cyto_2D_step05.2293.2293.1	3.1795	0.4884	1240.05	1	7270.0%	5	K.HLIPAANTGESK.V
UPTPA_MOUSE99.6%82218.0%323367106.4(P58389) Protein phosphatase 2A, regulatory subunit B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) 
	TK270802_E14_cyto_2D_step05.3792.3792.2	3.4853	0.4608	2458.77	1	4760.0%	2	K.TGPFAEHSNQLWNISAVPSWSK.V
*	TK270802_E14_cyto_2D_step15.4851.4851.2	0.9779	0.0539	3118.16	1	1480.0%	1	K.EAVGNSTRIDYGTGHEAAFAAFLCCLCK.I
	TK270802_E14_cyto_2D_step09.2897.2897.2	2.2187	0.4306	1018.7	1	7860.0%	1	K.FPVIQHFK.F
UST13_MOUSE99.6%71314.3%371416565.3(Q99L47) Hsc70-interacting protein (Hip) (Putative tumor suppressor ST13) 
	TK270802_E14_cyto_2D_step08.3479.3479.2	2.5318	0.4331	1936.58	1	4380.0%	1	R.LLGHWEEAAHDLALACK.L
*	TK270802_E14_cyto_2D_step06.1291.1291.1	0.7629	0.0215	749.89	8	4170.0%	1	K.VPPATHK.A
	TK270802_E14_cyto_2D_step10.2377.2377.2	1.1826	0.0956	1586.35	12	2310.0%	1	K.AIDLFTDAIKLNPR.L
*	TK270802_E14_cyto_2D_step03.2722.2722.1	3.1709	0.4411	1558.87	1	6070.0%	3	K.KGAAIEALNDGELQK.A
URL7_MOUSE99.6%225628.9%2703142010.9(P14148) 60S ribosomal protein L7 
	TK270802_E14_cyto_2D_step03.2072.2072.1	2.3969	0.2124	1362.81	1	6250.0%	2	K.TTHFVEGGDAGNR.E
	TK270802_E14_cyto_2D_step12.4039.4039.2	5.3329	0.5334	2140.6	1	6470.0%	1	K.FGIICMEDLIHEIYTVGK.R
	TK270802_E14_cyto_2D_step06.2529.2529.1	2.3036	0.1058	1083.87	1	5560.0%	4	K.KVPAVPETLK.K
	TK270802_E14_cyto_2D_step01.2235.2235.1	0.9491	0.0528	956.85	16	4380.0%	3	K.VPAVPETLK.K
	TK270802_E14_cyto_2D_step06.2306.2306.1	2.1987	0.3611	1014.04	2	5000.0%	1	K.KVATVPGTLK.K
	TK270802_E14_cyto_2D_step07.2137.2137.1	1.5495	0.0266	1488.8	8	3850.0%	1	K.KTTHFVEGGDAGNR.E
	TK270802_E14_cyto_2D_step11.0344.0344.1	0.5803	0.071	1013.85	3	2860.0%	1	K.VLQLLRLR.Q
	TK270802_E14_cyto_2D_step04.2260.2260.2	2.9968	0.5818	2119.52	1	4440.0%	1	K.TTHFVEGGDAGNREDQINR.L
	TK270802_E14_cyto_2D_step07.1518.1518.1	0.5686	0.0805	697.39	10	2500.0%	2	K.KVPAGPK.T
	TK270802_E14_cyto_2D_step03.1338.1338.1	1.0205	0.2852	570.36	1	5000.0%	4	K.VPAGPK.T
	TK270802_E14_cyto_2D_step07.2401.2401.1	1.5093	0.0124	607.01	5	7500.0%	1	K.KFALK.T
UQ99JW999.6%3312.7%300341319.0(Q99JW9) Similar to alpha-coatomer protein (Fragment) 
	TK270802_E14_cyto_2D_step15.2033.2033.1	0.4558	0.0239	896.04	35	2140.0%	1	K.TAATFARR.L
	TK270802_E14_cyto_2D_step05.3470.3470.2	3.2972	0.5052	1717.55	1	6430.0%	1	R.LLHDQVGVIQFGPYK.Q
	TK270802_E14_cyto_2D_step04.2902.2902.2	2.6936	0.5136	1680.53	1	6070.0%	1	R.LLELGPKPEVAQQTR.K
ULKHA_MOUSE99.6%101413.3%610688906.4(P24527) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) 
	TK270802_E14_cyto_2D_step09.2708.2708.1	1.3058	0.2087	946.88	1	5620.0%	2	K.APLPLGHIK.R
	TK270802_E14_cyto_2D_step08.2772.2772.1	1.1035	0.232	908.73	2	6670.0%	1	K.FTRPLFK.D
*	TK270802_E14_cyto_2D_step08.2170.2170.3	1.6698	0.0673	1287.97	50	2950.0%	1	R.DGEAPDPEDPSR.K
*	TK270802_E14_cyto_2D_step08.0294.0294.1	2.2132	0.3434	1581.54	1	5000.0%	1	K.SHDQAVHTYQEHK.A
*	TK270802_E14_cyto_2D_step01.2992.2992.1	0.6175	0.0487	1148.47	234	1670.0%	1	K.YTLGESQGYK.G
*	TK270802_E14_cyto_2D_step07.3100.3100.1	1.8801	0.4232	1370.05	1	5000.0%	1	K.ASMHPVTAMLVGR.D
	TK270802_E14_cyto_2D_step13.2098.2098.1	1.7524	0.1016	907.34	4	6670.0%	2	R.TQHLHLR.C
*	TK270802_E14_cyto_2D_step04.2457.2457.1	1.8813	0.328	1151.68	1	6110.0%	1	K.TFGESHPFTK.L
UQ8VHX899.6%1124.3%115126634.5(Q8VHX8) Filamin A (Fragment) 
*	TK270802_E14_cyto_2D_step05.3597.3597.2	3.9418	0.5629	2964.84	1	3890.0%	1	R.FGGEHVPNSPFQVTALAGDQPTVQTPLR.S
UENOA_MOUSE99.6%156283060.3%433470106.8(P17182) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) 
*	TK270802_E14_cyto_2D_step01.4226.4226.2	3.137	0.3907	2972.31	1	3960.0%	1	K.SFVQNYPVVSIEDPFDQDDWGAWQK.F
*	TK270802_E14_cyto_2D_step11.2594.2594.3	1.4608	0.0825	2062.72	10	2240.0%	1	K.GVSQAVEHINKTIAPALVSK.K
	TK270802_E14_cyto_2D_step01.2698.2698.1	1.5448	0.1132	817.14	13	6670.0%	1	K.EALELLK.T
	TK270802_E14_cyto_2D_step01.2248.2248.1	1.7709	0.1771	902.25	1	6250.0%	3	K.TIAPALVSK.K
*	TK270802_E14_cyto_2D_step01.5354.5354.2	2.2074	0.3365	2195.91	1	4210.0%	18	K.AGYTDQVVIGMDVAASEFYR.S
	TK270802_E14_cyto_2D_step01.2488.2488.1	2.2663	0.2141	1408.97	1	4170.0%	3	R.GNPTVEVDLYTAK.G
*	TK270802_E14_cyto_2D_step07.4842.4842.2	2.2078	0.3005	3026.36	1	2930.0%	22	R.HIADLAGNPEVILPVPAFNVINGGSHAGNK.L
	TK270802_E14_cyto_2D_step01.2059.2059.1	0.9541	0.031	767.21	84	5000.0%	1	R.EIFDSR.G
*	TK270802_E14_cyto_2D_step04.2154.2154.1	1.7086	0.0992	1184.18	9	4000.0%	2	K.GVSQAVEHINK.T
	TK270802_E14_cyto_2D_step02.3312.3312.2	1.865	0.4052	2037.08	1	4470.0%	3	K.FTASAGIQVVGDDLTVTNPK.R
	TK270802_E14_cyto_2D_step01.0560.0560.1	1.1664	0.2705	542.69	1	7500.0%	2	R.NPLAK.-
	TK270802_E14_cyto_2D_step05.2437.2437.1	2.1507	0.2512	1145.94	10	5560.0%	4	R.IGAEVYHNLK.N
	TK270802_E14_cyto_2D_step03.2707.2707.1	1.9472	0.3227	1074.38	1	5620.0%	2	R.SGKYDLDFK.S
	TK270802_E14_cyto_2D_step03.3724.3724.1	1.3244	0.2011	1522.16	3	3570.0%	15	K.FGANAILGVSLAVCK.A
	TK270802_E14_cyto_2D_step02.3374.3374.2	1.4047	0.37	1808.3	4	3820.0%	1	R.AAVPSGASTGIYEALELR.D
*	TK270802_E14_cyto_2D_step02.0670.0670.3	0.9339	0.0629	4393.67	4	620.0%	1	R.YITPDQLADLYKSFVQNYPVVSIEDPFDQDDWGAWQK.F
*	TK270802_E14_cyto_2D_step01.3155.3155.1	2.5578	0.3644	1443.1	1	5450.0%	5	R.YITPDQLADLYK.S
	TK270802_E14_cyto_2D_step05.1374.1374.1	0.56	0.0194	660.91	2	4000.0%	1	K.TGAPCR.S
	TK270802_E14_cyto_2D_step04.4732.4732.2	1.5704	0.3323	2357.44	1	2620.0%	37	R.SGETEDTFIADLVVGLCTGQIK.T
*	TK270802_E14_cyto_2D_step04.1865.1865.1	1.8955	0.1181	1074.94	1	6250.0%	4	K.KVNVVEQEK.I
	TK270802_E14_cyto_2D_step03.3020.3020.2	3.412	0.2534	1545.61	1	6920.0%	4	K.LAQSNGWGVMVSHR.S
UPUR2_MOUSE99.6%142013.7%10101073376.8(Q64737) Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (GART) (GAR transformylase) (5'-phosphoribosylglycinamide transformylase)] 
*	TK270802_E14_cyto_2D_step05.2541.2541.1	2.1358	0.4772	1137.93	1	6880.0%	1	R.HEIPTAQWR.A
*	TK270802_E14_cyto_2D_step01.2343.2343.1	1.5534	0.3234	1311.15	1	4500.0%	1	K.DQAEQVLHDVR.R
*	TK270802_E14_cyto_2D_step07.3545.3545.2	2.3702	0.4245	1314.66	1	7000.0%	2	R.IYSHSLLPIIR.S
*	TK270802_E14_cyto_2D_step08.2338.2338.1	1.3575	0.1221	654.78	1	6250.0%	1	K.IHWAK.E
*	TK270802_E14_cyto_2D_step14.4906.4906.2	0.9335	0.0038	3002.7	17	1610.0%	1	R.LLDGDEGPNTGGMGAYCPAPQVSKDLLVK.I
*	TK270802_E14_cyto_2D_step11.2626.2626.3	1.1249	0.0017	2181.73	43	1380.0%	1	K.IFPAALQLVASGAVQLREDGK.I
	TK270802_E14_cyto_2D_step06.3557.3557.2	4.1723	0.5229	1668.34	1	8000.0%	1	K.AFAHITGGGLLENIPR.V
	TK270802_E14_cyto_2D_step04.2512.2512.1	1.3739	0.186	886.37	1	6670.0%	2	R.EHTLAWK.L
	TK270802_E14_cyto_2D_step12.2804.2804.2	0.8413	0.0122	2243.9	57	1900.0%	1	K.ARVAVLISGTGSNLQALIDSTR.D
	TK270802_E14_cyto_2D_step07.2165.2165.1	1.5257	0.1347	798.82	6	5830.0%	2	K.KIQPLAK.A
UTBA1_HUMAN99.6%211735368.5%451501525.1(P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) (P05209) Tubulin alpha-1 chain (Alpha-tubulin 1) 
	TK270802_E14_cyto_2D_step06.3443.3443.2	5.327	0.6404	2754.99	1	5220.0%	16	K.AYHEQLSVAEITNACFEPANQMVK.C
	TK270802_E14_cyto_2D_step06.3373.3373.2	0.8383	0.0253	2416.08	3	2250.0%	1	R.QLFHPEQLITGKEDAANNYAR.G
	TK270802_E14_cyto_2D_step04.3377.3377.2	1.7915	0.4106	1413.89	1	6820.0%	3	R.QLFHPEQLITGK.E
	TK270802_E14_cyto_2D_step01.1928.1928.1	1.4617	0.0344	783.75	4	5830.0%	2	R.LSVDYGK.K
	TK270802_E14_cyto_2D_step10.3500.3500.2	3.6169	0.6341	1760.91	1	6330.0%	29	R.IHFPLATYAPVISAEK.A
	TK270802_E14_cyto_2D_step04.3802.3802.2	1.6817	0.3388	1867.33	1	3750.0%	2	R.AVCMLSNTTAIAEAWAR.L
	TK270802_E14_cyto_2D_step10.4124.4124.3	3.7835	0.5246	3395.12	1	2500.0%	2	K.LADQCTGLQGFLVFHSFGGGTGSGFTSLLMER.L
	TK270802_E14_cyto_2D_step04.2772.2772.1	1.3483	0.0015	906.12	76	5000.0%	1	R.EDMAALEK.D
	TK270802_E14_cyto_2D_step02.3559.3559.2	1.3145	0.0855	1704.56	1	3930.0%	1	R.AVFVDLEPTVIDEVR.T
	TK270802_E14_cyto_2D_step01.0104.0104.1	1.8278	0.3501	1018.35	3	5560.0%	3	K.DVNAAIATIK.T
	TK270802_E14_cyto_2D_step04.2762.2762.2	1.4174	0.1499	1721.68	9	4230.0%	6	R.NLDIERPTYTNLNR.L
	TK270802_E14_cyto_2D_step01.3566.3566.1	2.4263	0.4272	1587.18	1	5000.0%	2	R.SIQFVDWCPTGFK.V
	TK270802_E14_cyto_2D_step03.2150.2150.1	1.4987	0.1231	909.99	7	6430.0%	1	R.LSVDYGKK.S
	TK270802_E14_cyto_2D_step04.4388.4388.2	4.0257	0.5905	1490.1	1	8080.0%	4	R.LISQIVSSITASLR.F
	TK270802_E14_cyto_2D_step09.4499.4499.2	3.1606	0.4089	2413.56	1	3500.0%	18	R.FDGALNVDLTEFQTNLVPYPR.I
	TK270802_E14_cyto_2D_step05.1725.1725.1	0.9717	0.0499	1024.51	31	3120.0%	1	K.EDAANNYAR.G
	TK270802_E14_cyto_2D_step01.3510.3510.1	1.5854	0.1573	1086.43	3	5000.0%	1	K.EIIDLVLDR.I
	TK270802_E14_cyto_2D_step11.3778.3778.3	3.4014	0.5236	4302.4	1	1620.0%	36	R.ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDK.T
	TK270802_E14_cyto_2D_step15.3545.3545.2	1.7026	0.3938	2334.36	2	2630.0%	67	R.AFVHWYVGEGMEEGEFSEAR.E
	TK270802_E14_cyto_2D_step01.2810.2810.2	2.7486	0.3727	1827.88	1	5000.0%	1	K.VGINYQPPTVVPGGDLAK.V
	TK270802_E14_cyto_2D_step05.2021.2021.1	1.3212	0.2166	777.3	1	5830.0%	5	R.GHYTIGK.E
	TK270802_E14_cyto_2D_step08.1167.1167.1	0.4973	0.0026	509.11	1	3330.0%	4	K.HVPR.A
UIF36_HUMAN99.6%467.0%445522216.0(Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6) (Q64252) Eukaryotic translation initiation factor 3 subunit 6 (eIF-3 p48) (Mammary tumor-associated protein INT-6) (Viral integration site protein INT-6) 
	TK270802_E14_cyto_2D_step06.2739.2739.1	1.3914	0.157	872.34	10	5000.0%	1	R.IAHFLDR.H
	TK270802_E14_cyto_2D_step06.3010.3010.2	4.2345	0.6076	2187.37	1	5530.0%	2	K.LGHVVMGNNAVSPYQQVIEK.T
	TK270802_E14_cyto_2D_step09.1757.1757.1	0.3348	0.0071	516.63	2	5000.0%	1	K.HGFR.Q
UENPL_MOUSE99.6%91310.1%802924764.8(P08113) Endoplasmin precursor (Endoplasmic reticulum protein 99) (94 kDa glucose-regulated protein) (GRP94) (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96) 
	TK270802_E14_cyto_2D_step04.3041.3041.1	2.3337	0.424	1515.73	1	6540.0%	1	K.NLLHVTDTGVGMTR.E
*	TK270802_E14_cyto_2D_step11.1804.1804.1	0.7537	0.0366	948.54	15	2860.0%	1	K.ESREATEK.E
*	TK270802_E14_cyto_2D_step06.3185.3185.2	1.4412	0.3815	2253.92	1	3330.0%	2	R.FQSSHHSTDITSLDQYVER.M
	TK270802_E14_cyto_2D_step09.2178.2178.1	0.7944	0.0063	636.22	33	5000.0%	2	R.HPLIR.D
*	TK270802_E14_cyto_2D_step09.3096.3096.3	1.1673	0.0461	2273.71	61	1620.0%	1	R.LISLTDENALAGNEELTVKIK.C
	TK270802_E14_cyto_2D_step01.2706.2706.1	0.8104	0.0147	1486.68	151	2310.0%	1	K.GVVDSDDLPLNVSR.E
U143F_MOUSE99.6%2217.1%245280814.9(P11576) 14-3-3 protein eta (Protein kinase C inhibitor protein-1) (KCIP-1) 
	TK270802_E14_cyto_2D_step03.2307.2307.1	2.706	0.4303	1396.9	1	5830.0%	1	K.KNSVVEASEAAYK.E
	TK270802_E14_cyto_2D_step04.4001.4001.3	1.6532	0.0241	3292.18	23	1700.0%	1	K.DSTLIMQLLRDNLTLWTSDQQDEEAGEGN.-
UTEBP_MOUSE99.6%41016.9%160187214.5(Q9R0Q7) Telomerase-binding protein p23 (Hsp90 co-chaperone) (Progesterone receptor complex p23) 
	TK270802_E14_cyto_2D_step04.4890.4890.2	2.9986	0.6224	2069.05	1	5940.0%	1	K.HLNEIDLFHCIDPNDSK.H
	TK270802_E14_cyto_2D_step04.2132.2132.1	1.8484	0.2979	1133.22	1	6670.0%	3	R.KGESGQSWPR.L
UQ9WU7899.6%448.5%869961516.7(Q9WU78) ALG-2 interacting protein AIP1 
	TK270802_E14_cyto_2D_step03.2330.2330.3	1.1192	0.0191	1824.11	132	2670.0%	1	K.FGEEIARLQHAAELIK.N
	TK270802_E14_cyto_2D_step06.2573.2573.2	2.7196	0.5341	1680.81	1	5670.0%	1	K.ATLVKPTPVNVPVSQK.F
	TK270802_E14_cyto_2D_step13.2778.2778.3	1.1063	0.1048	3324.9	37	1080.0%	1	K.SCVLFNCAALASQIAAEQNLDNDEGLKTAAK.Q
	TK270802_E14_cyto_2D_step04.2221.2221.1	2.1216	0.4038	1317.92	1	5000.0%	1	K.NIQVSHQEFSK.M
UIF5A_HUMAN99.6%4570556.2%153167015.2(P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) (P10159) Initiation factor 5A (eIF-5A) (eIF-4D) (Rev-binding factor) 
	TK270802_E14_cyto_2D_step09.4444.4444.2	2.3485	0.4076	2630.71	1	2610.0%	3	K.YDCGEEILITVLSAMTEEAAVAIK.A
	TK270802_E14_cyto_2D_step06.5043.5043.1	2.0108	0.3185	1301.94	1	4090.0%	24	K.VHLVGIDIFTGK.K
	TK270802_E14_cyto_2D_step07.4134.4134.2	1.6806	0.1959	2740.4	1	3040.0%	10	K.RNDFQLIGIQDGYLSLLQDSGEVR.E
	TK270802_E14_cyto_2D_step04.2832.2832.2	2.5217	0.4262	2163.5	1	4410.0%	3	K.KYEDICPSTHNMDVPNIK.R
	TK270802_E14_cyto_2D_step01.1906.1906.1	1.6632	0.2371	828.68	1	6430.0%	1	R.LPEGDLGK.E
URL8_HUMAN99.6%4415.2%2572802511.0(P25120) 60S ribosomal protein L8 (P25120) 60S ribosomal protein L8 
	TK270802_E14_cyto_2D_step01.2039.2039.1	1.7285	0.3945	942.01	1	6000.0%	1	R.AVVGVVAGGGR.I
	TK270802_E14_cyto_2D_step04.2277.2277.1	1.4638	0.0502	826.97	2	6670.0%	1	R.IDKPILK.A
	TK270802_E14_cyto_2D_step06.1957.1957.1	1.3326	0.0719	617.87	4	7500.0%	1	R.HGYIK.G
	TK270802_E14_cyto_2D_step03.2387.2387.2	3.1716	0.5636	1690.45	1	5330.0%	1	R.ASGNYATVISHNPETK.K
UQ9QZE799.6%396.9%290329266.6(Q9QZE7) Translin associated protein X (Translin-associated factor X) 
*	TK270802_E14_cyto_2D_step12.3625.3625.2	1.95	0.4711	2270.45	1	3160.0%	3	R.AVTTGLQEYVEAVSFQHFIK.T
USPS1_HUMAN99.6%355.5%383422686.4(P49903) Selenide,water dikinase 1 (EC 2.7.9.3) (Selenophosphate synthetase 1) (Selenium donor protein 1) 
	TK270802_E14_cyto_2D_step02.4332.4332.2	0.8716	0.026	2266.29	51	1750.0%	1	R.NEVSFVIHNLPVLAKMAAVSK.A
	TK270802_E14_cyto_2D_step04.4073.4073.2	1.5129	0.2771	1680.99	2	3570.0%	2	R.NEVSFVIHNLPVLAK.M
UQ9QZE599.6%339.6%874975135.3(Q9QZE5) Coat protein gamma-cop (Coatomer protein complex, subunit gamma 1) 
*	TK270802_E14_cyto_2D_step11.4031.4031.3	1.1968	0.2254	3843.52	2	1410.0%	1	K.DCDPNTGEIDEEGYEDEYVLEDLEVTVADHIQK.V
	TK270802_E14_cyto_2D_step07.3068.3068.1	2.7268	0.502	1204.68	1	6500.0%	1	R.ILHLLGQEGPK.T
*	TK270802_E14_cyto_2D_step13.1680.1680.3	0.8762	0.0518	4345.79	26	640.0%	1	K.ALQQYTLEPSEKPFDLKSVPLATTPMAEQRPESTATAAVK.Q
UHS9A_MOUSE99.6%11094435.0%732846575.0(P07901) Heat shock protein HSP 90-alpha (HSP 86) (Tumor specific transplantation 86 kDa antigen) (TSTA) 
	TK270802_E14_cyto_2D_step01.1367.1367.1	1.5143	0.0041	865.67	5	6670.0%	1	R.EMLQQSK.I
	TK270802_E14_cyto_2D_step06.3439.3439.2	3.5213	0.6074	1790.28	1	6790.0%	10	K.HLEINPDHSIIETLR.Q
	TK270802_E14_cyto_2D_step05.2493.2493.1	1.8194	0.1736	1077.75	1	5710.0%	1	K.KFYEQFSK.N
	TK270802_E14_cyto_2D_step01.2231.2231.1	1.6703	0.2402	1541.83	1	4620.0%	2	R.YESLTDPSKLDSGK.E
	TK270802_E14_cyto_2D_step01.2902.2902.1	2.104	0.2762	1516.09	1	4620.0%	3	R.GVVDSEDLPLNISR.E
	TK270802_E14_cyto_2D_step01.1835.1835.1	1.3042	0.2047	1039.96	1	6880.0%	1	R.YESLTDPSK.L
*	TK270802_E14_cyto_2D_step06.2979.2979.1	1.9635	0.457	1211.39	2	5000.0%	6	K.HIYFITGETK.D
	TK270802_E14_cyto_2D_step07.4913.4913.2	2.5699	0.5157	1782.11	1	5360.0%	9	K.HSQFIGYPITLFVEK.E
	TK270802_E14_cyto_2D_step01.1890.1890.1	1.1018	0.0626	551.07	5	8330.0%	1	K.LYVR.R
	TK270802_E14_cyto_2D_step04.1985.1985.1	1.2595	0.1393	1170.81	3	5560.0%	2	K.LGIHEDSQNR.K
	TK270802_E14_cyto_2D_step01.2951.2951.1	1.2224	0.0648	1245.24	7	4090.0%	2	K.ADLINNLGTIAK.S
	TK270802_E14_cyto_2D_step05.3497.3497.1	1.7495	0.1585	1266.78	1	3890.0%	2	R.RAPFDLFENR.K
	TK270802_E14_cyto_2D_step04.5122.5122.1	1.2313	0.1388	1352.22	3	3500.0%	21	K.HFSVEGQLEFR.A
	TK270802_E14_cyto_2D_step03.2487.2487.2	2.3927	0.1398	1310.69	2	6500.0%	1	K.IRYESLTDPSK.L
	TK270802_E14_cyto_2D_step08.2674.2674.1	1.2259	0.2409	724.93	67	4000.0%	6	K.VILHLK.E
	TK270802_E14_cyto_2D_step06.5041.5041.2	2.0053	0.5123	2580.05	1	3250.0%	3	K.HGLEVIYMIEPIDEYCVQQLK.E
	TK270802_E14_cyto_2D_step07.2521.2521.1	0.9864	0.0176	903.89	35	5000.0%	1	K.TKPIWTR.N
	TK270802_E14_cyto_2D_step01.1939.1939.1	2.2576	0.2625	1154.13	1	6250.0%	2	K.YIDQEELNK.T
*	TK270802_E14_cyto_2D_step03.5178.5178.1	1.3684	0.3083	1166.06	1	4440.0%	3	K.ELHINLIPSK.Q
	TK270802_E14_cyto_2D_step01.1898.1898.1	1.5795	0.2357	810.97	2	8000.0%	1	K.FENLCK.I
	TK270802_E14_cyto_2D_step04.2217.2217.1	1.031	0.034	1040.03	23	4290.0%	1	K.TKFENLCK.I
	TK270802_E14_cyto_2D_step06.2854.2854.1	1.2288	0.0623	860.24	5	5830.0%	2	K.KLSELLR.Y
	TK270802_E14_cyto_2D_step01.2315.2315.1	1.2802	0.1564	1353.12	7	3750.0%	10	R.TLTIVDTGIGMTK.A
*	TK270802_E14_cyto_2D_step01.5498.5498.1	1.0068	0.0446	1544.58	13	3330.0%	1	K.SLTNDWEEHLAVK.H
	TK270802_E14_cyto_2D_step06.2195.2195.1	1.2181	0.0114	1297.53	103	3500.0%	1	K.LGIHEDSQNRK.K
	TK270802_E14_cyto_2D_step01.2394.2394.1	1.1449	0.03	730.98	25	6000.0%	1	K.LSELLR.Y
	TK270802_E14_cyto_2D_step02.3292.3292.1	1.5897	0.1017	816.2	30	6670.0%	1	R.ALLFVPR.R
	TK270802_E14_cyto_2D_step10.3022.3022.2	1.1192	0.0782	2018.94	119	2670.0%	9	K.VILHLKEDQTEYLEER.R
	TK270802_E14_cyto_2D_step01.0445.0445.1	0.9039	0.047	558.8	4	6250.0%	1	K.AQALR.D
	TK270802_E14_cyto_2D_step01.2023.2023.1	1.2015	0.1396	747.92	5	5830.0%	1	K.TLVSVTK.E
UTF1B_MOUSE99.6%204233.3%834888475.8(Q62318) Transcription intermediary factor 1-beta (TIF1-beta) (Tripartite motif protein 28) (KRAB-A interacting protein) (KRIP-1) 
	TK270802_E14_cyto_2D_step07.3026.3026.1	1.2366	0.1239	872.65	5	5000.0%	1	R.KLLASLVK.R
	TK270802_E14_cyto_2D_step03.2726.2726.1	1.0466	0.0499	746.9	2	6670.0%	1	K.LLASLVK.R
	TK270802_E14_cyto_2D_step03.3538.3538.1	1.8863	0.1907	948.12	1	7140.0%	1	K.MAILQIMK.E
	TK270802_E14_cyto_2D_step06.0575.0575.1	0.9548	0.1423	698.24	27	4000.0%	1	K.HATLQK.N
*	TK270802_E14_cyto_2D_step03.5107.5107.3	1.1023	0.016	4192.22	6	1040.0%	1	R.LLPCLHSACSACLGPATPAAANNSGDGGSAGDGAMVDCPVCK.Q
*	TK270802_E14_cyto_2D_step10.2329.2329.2	3.5787	0.6409	2009.03	1	5790.0%	5	K.IVAERPGTNSTGPGPMAPPR.A
	TK270802_E14_cyto_2D_step10.2371.2371.1	1.0234	0.0939	932.97	12	4170.0%	1	K.HQEHILR.F
	TK270802_E14_cyto_2D_step06.2318.2318.1	0.9612	0.2308	932.42	3	5000.0%	1	R.QHWTMTK.I
	TK270802_E14_cyto_2D_step14.3628.3628.2	1.2026	0.0741	2771.28	2	2050.0%	1	K.MIVDPVEPHGEMKFQWDLNAWTK.S
	TK270802_E14_cyto_2D_step03.1847.1847.1	1.0444	0.0565	669.99	5	5000.0%	1	R.APGPLSK.Q
*	TK270802_E14_cyto_2D_step06.3210.3210.3	1.5266	0.1251	2932.86	1	1900.0%	1	K.FSAVLVEPPPLNLPSAGLSSQELSGPGDGP.-
*	TK270802_E14_cyto_2D_step08.2863.2863.3	4.6929	0.6868	3327.12	1	2720.0%	2	K.RPAASSAAAASAAASSPAGGGGEAQELLEHCGVCR.E
*	TK270802_E14_cyto_2D_step14.5059.5059.3	1.702	0.2275	4338.92	1	1350.0%	1	R.VLLALFCHEPCRPLHQLATDSTFSMEQPGGTLDLTLIR.A
*	TK270802_E14_cyto_2D_step11.4238.4238.3	1.4379	0.0021	4501.53	40	870.0%	1	K.VFPGSTTEDYNLIVIERGAAAAAAGQAGTVPPGAPGAPPLPGMAIVK.E
URSP4_MOUSE99.6%61810.5%295327194.8(P14206) 40S ribosomal protein SA (P40) (34/67 kDa laminin receptor) 
	TK270802_E14_cyto_2D_step05.3286.3286.1	2.7023	0.3343	1265.97	1	6500.0%	4	R.KSDGIYIINLK.R
	TK270802_E14_cyto_2D_step13.2245.2245.3	1.837	0.2603	1880.87	9	3080.0%	1	R.EHPWEVMPDLYFYR.D
	TK270802_E14_cyto_2D_step02.2775.2775.1	1.3509	0.0758	656.82	2	7000.0%	1	K.LLLAAR.A
UUBCI_HUMAN99.6%71115.2%158180078.7(P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) (P50550) Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO-1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) (P18) 
	TK270802_E14_cyto_2D_step10.3055.3055.2	2.3449	0.4264	1444.9	1	6250.0%	1	R.KDHPFGFVAVPTK.N
	TK270802_E14_cyto_2D_step03.3240.3240.2	2.1463	0.3561	1317.34	1	6820.0%	1	K.DHPFGFVAVPTK.N
	TK270802_E14_cyto_2D_step06.3323.3323.1	2.5123	0.2955	1222.63	1	5500.0%	2	K.KGTPWEGGLFK.L
UFLNA_HUMAN99.6%5610620.4%26472807596.1(P21333) Filamin A (Alpha-filamin) (Filamin 1) (Endothelial actin-binding protein) (ABP-280) (Nonmuscle filamin) 
*	TK270802_E14_cyto_2D_step13.1645.1645.2	1.3005	0.1075	1293.92	7	4090.0%	1	K.YGGQPVPNFPSK.L
*	TK270802_E14_cyto_2D_step05.1530.1530.2	1.5656	0.3178	1082.12	1	6500.0%	3	R.VNVGAGSHPNK.V
*	TK270802_E14_cyto_2D_step12.4915.4915.2	1.2252	0.0417	1782.81	5	3000.0%	1	K.GTVEPQLEARGDSTYR.C
*	TK270802_E14_cyto_2D_step11.2885.2885.2	1.9267	0.3083	1425.08	1	5000.0%	1	R.LRNGHVGISFVPK.E
*	TK270802_E14_cyto_2D_step03.1939.1939.1	1.4808	0.0102	1170.8	3	4500.0%	2	K.VPVHDVTDASK.V
	TK270802_E14_cyto_2D_step04.2177.2177.1	1.1654	0.0428	988.82	31	5830.0%	2	R.WCNEHLK.C
	TK270802_E14_cyto_2D_step01.2044.2044.1	1.0643	0.0733	830.09	75	3570.0%	1	K.AIVDGNLK.L
*	TK270802_E14_cyto_2D_step10.3484.3484.2	2.9066	0.4741	1945.85	1	4710.0%	3	K.HTAMVSWGGVSIPNSPFR.V
*	TK270802_E14_cyto_2D_step01.1764.1764.1	1.026	0.1675	791.32	3	5710.0%	1	K.VYGPGVAK.T
*	TK270802_E14_cyto_2D_step01.2184.2184.1	1.1744	0.0951	883.33	8	5000.0%	1	K.AGVAPLQVK.V
*	TK270802_E14_cyto_2D_step03.2063.2063.1	1.2184	0.239	989.1	1	5620.0%	1	K.KGEITGEVR.M
*	TK270802_E14_cyto_2D_step07.3016.3016.2	3.3526	0.5265	1285.91	1	7730.0%	1	K.VTVLFAGQHIAK.S
*	TK270802_E14_cyto_2D_step05.2015.2015.1	1.3183	0.1331	1110.9	16	4000.0%	4	R.ALTQTGGPHVK.A
*	TK270802_E14_cyto_2D_step13.1570.1570.2	3.0246	0.5371	1636.45	1	5670.0%	3	R.VHGPGIQSGTTNKPNK.F
*	TK270802_E14_cyto_2D_step14.4636.4636.2	1.1201	0.0421	2239.87	21	2220.0%	1	R.LLGWIQNKLPQLPITNFSR.D
*	TK270802_E14_cyto_2D_step03.3486.3486.2	1.7683	0.1532	1287.1	1	5500.0%	1	K.LPQLPITNFSR.D
*	TK270802_E14_cyto_2D_step06.2907.2907.1	0.9112	0.0438	1155.94	4	4500.0%	1	R.NGHVGISFVPK.E
*	TK270802_E14_cyto_2D_step03.2678.2678.2	2.9215	0.5074	1648.6	1	5330.0%	1	K.TGVAVNKPAEFTVDAK.H
*	TK270802_E14_cyto_2D_step01.3148.3148.2	1.1127	0.3173	2766.61	1	2400.0%	1	K.LQVEPAVDTSGVQCYGPGIEGQGVFR.E
*	TK270802_E14_cyto_2D_step01.2435.2435.1	1.5855	0.3033	1570.96	1	3240.0%	1	R.GAGTGGLGLAVEGPSEAK.M
*	TK270802_E14_cyto_2D_step01.5403.5403.3	1.8274	0.2789	4574.33	1	1600.0%	1	R.EAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPK.A
*	TK270802_E14_cyto_2D_step05.1798.1798.1	1.6695	0.3474	1199.05	1	5000.0%	2	R.VKVEPSHDASK.V
	TK270802_E14_cyto_2D_step04.4245.4245.2	1.8027	0.1015	1894.31	2	4000.0%	1	R.QMQLENVSVALEFLDR.E
*	TK270802_E14_cyto_2D_step04.3676.3676.2	2.0423	0.4774	1754.56	1	3570.0%	2	R.TFSVWYVPEVTGTHK.V
*	TK270802_E14_cyto_2D_step11.4739.4739.3	1.1425	0.0241	4532.15	8	1120.0%	1	R.CSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACR.A
*	TK270802_E14_cyto_2D_step09.2706.2706.2	2.3561	0.4442	1702.77	1	5330.0%	2	R.TGVELGKPTHFTVNAK.A
*	TK270802_E14_cyto_2D_step07.4346.4346.3	1.2415	7.0E-4	4052.17	88	830.0%	1	R.DVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPK.S
*	TK270802_E14_cyto_2D_step06.2309.2309.1	1.2791	0.2328	1148.93	1	5560.0%	1	K.ETGEHLVHVK.K
	TK270802_E14_cyto_2D_step01.1543.1543.1	0.7661	0.0528	1045.78	2	5620.0%	1	K.DLAEDAPWK.K
*	TK270802_E14_cyto_2D_step07.5269.5269.2	0.6911	0.0904	2449.44	34	830.0%	1	K.IVGPSGAAVPCKVEPGLGADNSVVR.F
*	TK270802_E14_cyto_2D_step03.4320.4320.2	0.9618	0.13	2895.57	1	1960.0%	1	K.VGSAADIPINISETDLSLLTATVVPPSGR.E
*	TK270802_E14_cyto_2D_step15.4803.4803.3	1.4523	0.1631	4450.78	2	1150.0%	1	K.MSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFK.V
	TK270802_E14_cyto_2D_step05.4312.4312.2	3.5241	0.3589	1229.2	1	8500.0%	3	R.LIALLEVLSQK.K
UQ922D899.6%163015.4%9351012567.1(Q922D8) Similar to C1-tetrahydrofolate synthase 
	TK270802_E14_cyto_2D_step07.1909.1909.1	0.9273	0.1714	738.12	14	4170.0%	2	R.HAVVVGR.S
	TK270802_E14_cyto_2D_step12.2476.2476.2	2.3094	0.4666	1534.75	1	5330.0%	3	K.MHGGGPTVTAGLPLPK.A
*	TK270802_E14_cyto_2D_step06.3905.3905.2	2.8789	0.6053	1639.68	1	5670.0%	2	K.STTTIGLVQALGAHLR.Q
*	TK270802_E14_cyto_2D_step09.3596.3596.3	1.0861	0.0398	3249.31	43	1170.0%	1	K.ERASFITPVPGGVGPMTVAMLMQSTVESAQR.F
*	TK270802_E14_cyto_2D_step05.2251.2251.1	2.5481	0.4137	1203.79	1	6500.0%	2	R.KITIGQSPTEK.G
	TK270802_E14_cyto_2D_step09.2337.2337.1	2.9534	0.1494	1392.71	1	6820.0%	2	K.THLSLSHNPEQK.G
	TK270802_E14_cyto_2D_step15.3905.3905.3	1.0382	0.0346	4332.49	33	940.0%	1	K.DAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADRIALK.L
	TK270802_E14_cyto_2D_step03.2571.2571.1	2.0974	0.3403	1232.0	1	6670.0%	1	R.IFHELTQTDK.A
UIF3A_MOUSE99.6%17219.6%13441619506.8(P23116) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162 protein) (Centrosomin) 
	TK270802_E14_cyto_2D_step09.2958.2958.1	1.3146	0.2533	1005.87	4	4380.0%	2	R.ANEFLEVGK.K
	TK270802_E14_cyto_2D_step13.1121.1121.1	0.6664	0.0323	688.21	13	3000.0%	1	R.GLDDDR.G
	TK270802_E14_cyto_2D_step11.2625.2625.2	2.7879	0.4106	1411.57	1	6670.0%	1	K.SGNALFHASTLHR.L
	TK270802_E14_cyto_2D_step05.2161.2161.1	2.0771	0.4814	1261.93	1	5500.0%	1	R.RGPAEESSSWR.D
	TK270802_E14_cyto_2D_step05.0665.0665.1	1.1155	0.0807	708.31	17	6250.0%	1	K.QFEER.L
	TK270802_E14_cyto_2D_step08.2331.2331.1	1.6275	0.0469	1012.77	1	7140.0%	1	R.MHLSQIQR.H
	TK270802_E14_cyto_2D_step06.2842.2842.1	1.5456	0.2888	980.7	2	5710.0%	1	K.IHEPIMLK.Y
	TK270802_E14_cyto_2D_step04.2786.2786.1	3.0808	0.3935	1336.06	1	7000.0%	2	R.LYHDIAQQAFK.F
*	TK270802_E14_cyto_2D_step04.4120.4120.2	3.1497	0.5075	1926.81	1	5000.0%	1	R.LLQQVAQIYQSIEFSR.L
	TK270802_E14_cyto_2D_step04.3273.3273.1	1.1652	0.057	1112.09	124	4380.0%	1	K.RLEEIPLIK.S
*	TK270802_E14_cyto_2D_step01.3872.3872.1	1.0564	0.0792	1409.9	2	4090.0%	1	R.FSVLQYVVPEVK.D
	TK270802_E14_cyto_2D_step12.1692.1692.2	1.7901	0.0791	993.85	3	6250.0%	1	R.RVPPPALSR.D
	TK270802_E14_cyto_2D_step04.2045.2045.1	1.434	0.1529	928.0	1	6670.0%	1	R.HCDLQVR.I
	TK270802_E14_cyto_2D_step09.2196.2196.1	1.1353	0.0492	538.92	4	7500.0%	1	R.GPPLR.S
UCYTB_MOUSE99.6%96521.4%98110467.4(Q62426) Cystatin B (Stefin B) 
*	TK270802_E14_cyto_2D_step12.2696.2696.2	1.2666	0.1343	2445.7	7	2500.0%	8	R.VFQPLPHENKPLTLSSYQTNK.E
UIMB1_MOUSE99.6%7913.5%876971524.8(P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit) (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG) 
	TK270802_E14_cyto_2D_step06.3430.3430.2	3.8875	0.6744	2093.45	1	6560.0%	1	R.HFIMQVVCEATQCPDTR.V
	TK270802_E14_cyto_2D_step04.5034.5034.2	0.756	0.015	3080.87	16	1600.0%	1	K.IMSLYYQYMETYMGPALFAITIEAMK.S
	TK270802_E14_cyto_2D_step03.3624.3624.2	1.3678	0.0828	2502.5	1	2730.0%	1	K.EEPSNNVKLAATNALLNSLEFTK.A
	TK270802_E14_cyto_2D_step05.2386.2386.2	1.1158	0.0919	1880.37	1	4000.0%	1	K.LLETTDRPDGHQNNLR.S
	TK270802_E14_cyto_2D_step03.2855.2855.1	1.0415	0.1004	964.68	75	5000.0%	2	K.TTLVIMER.L
*	TK270802_E14_cyto_2D_step04.4421.4421.3	1.5126	0.2791	3270.98	6	1390.0%	1	R.ALQSNILPFCDEVMQLLLENLGNENVHR.S
UEF11_MOUSE99.6%216643448.3%462501649.0(P10126) Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor 1 A-1) (eEF1A-1) (Elongation factor Tu) (EF-Tu) 
	TK270802_E14_cyto_2D_step03.1858.1858.1	2.008	0.4018	787.12	1	8330.0%	5	K.KLEDGPK.F
	TK270802_E14_cyto_2D_step01.2014.2014.1	1.7572	0.2571	841.59	9	6670.0%	2	K.EVSTYIK.K
	TK270802_E14_cyto_2D_step08.4567.4567.2	3.4147	0.4907	2914.06	1	3390.0%	50	K.NMITGTSQADCAVLIVAAGVGEFEAGISK.N
	TK270802_E14_cyto_2D_step01.1670.1670.1	1.5746	0.1071	1284.9	2	4500.0%	1	K.MDSTEPPYSQK.R
	TK270802_E14_cyto_2D_step06.1958.1958.1	1.2378	0.07	1153.95	23	3000.0%	1	K.EAAEMGKGSFK.Y
	TK270802_E14_cyto_2D_step11.4073.4073.3	1.9237	0.2968	3468.6	1	1520.0%	1	K.NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTR.E
	TK270802_E14_cyto_2D_step01.2355.2355.1	1.1002	0.0423	1028.05	1	5000.0%	4	K.IGGIGTVPVGR.V
	TK270802_E14_cyto_2D_step04.2172.2172.1	1.1808	0.0104	939.57	26	5000.0%	2	K.RYEEIVK.E
	TK270802_E14_cyto_2D_step04.3586.3586.2	1.0007	0.0518	2519.82	4	1740.0%	41	R.VETGVLKPGMVVTFAPVNVTTEVK.S
	TK270802_E14_cyto_2D_step02.2602.2602.1	1.1078	0.1167	916.5	9	5000.0%	1	R.QTVAVGVIK.A
	TK270802_E14_cyto_2D_step04.2312.2312.1	1.6109	0.0816	1123.22	15	3330.0%	3	K.STTTGHLIYK.C
	TK270802_E14_cyto_2D_step07.2948.2948.2	2.983	0.5359	1407.73	1	6820.0%	7	K.YYVTIIDAPGHR.D
	TK270802_E14_cyto_2D_step04.3457.3457.1	2.4723	0.35	1317.91	1	6360.0%	24	R.EHALLAYTLGVK.Q
	TK270802_E14_cyto_2D_step01.1874.1874.1	1.0777	0.022	492.86	5	8330.0%	1	R.FAVR.D
	TK270802_E14_cyto_2D_step14.4378.4378.3	3.4777	0.5181	4390.68	1	2000.0%	33	K.NDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK.F
	TK270802_E14_cyto_2D_step01.2539.2539.1	1.7209	0.1732	978.15	3	5710.0%	3	R.LPLQDVYK.I
	TK270802_E14_cyto_2D_step14.0040.0040.1	1.524	0.2894	1591.88	1	3930.0%	2	K.THINIVVIGHVDSGK.S
UMLEN_MOUSE99.6%4627.0%141157314.9(Q60605) Myosin light chain alkali, non-muscle isoform (MLC3nm) (Fragment) 
	TK270802_E14_cyto_2D_step02.4204.4204.2	0.948	0.0024	1890.07	1	3000.0%	1	K.VLDFEHFLPMLQTVAK.N
	TK270802_E14_cyto_2D_step01.2203.2203.1	1.7681	0.0244	1355.06	26	3750.0%	1	R.ALGQNPTNAEVLK.V
	TK270802_E14_cyto_2D_step05.2709.2709.1	2.6327	0.4134	997.96	1	6880.0%	2	R.HVLVTLGEK.M
UIF4G_HUMAN99.6%6104.6%13951533615.2(Q04637) Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma) (eIF-4G) (eIF4G) (P220) 
	TK270802_E14_cyto_2D_step04.1905.1905.2	3.4273	0.5156	1480.36	1	7080.0%	2	K.IHNAENIQPGEQK.Y
	TK270802_E14_cyto_2D_step06.2789.2789.2	3.2356	0.5985	1973.24	1	5000.0%	1	K.ITKPGSIDSNNQLFAPGGR.L
*	TK270802_E14_cyto_2D_step07.4769.4769.2	1.0606	0.1821	3073.1	1	1450.0%	1	R.LSWGKGSSGGSGAQPSDAASEAARPATSTLIR.F
UIF42_MOUSE99.6%113.7%407464025.5(P10630) Eukaryotic initiation factor 4A-II (eIF-4A-II) (eIF4A-II) 
	TK270802_E14_cyto_2D_step05.2661.2661.1	2.1187	0.463	1545.9	1	5000.0%	1	K.LQAEAPHIVVGTPGR.V
UQ9Z0P599.6%114.9%349394716.8(Q9Z0P5) A6 related PROTEIN (PROTEIN TYPROTEIN tyrosine kinase 9-like) (A6-related protein) 
	TK270802_E14_cyto_2D_step07.3357.3357.2	4.2228	0.5885	1935.14	1	5940.0%	1	K.HQTLQGLAFPLQPEAQR.A
UACLY_MOUSE99.6%122414.3%10911197287.4(Q91V92) ATP-citrate (pro-S-)-lyase (EC 4.1.3.8) (Citrate cleavage enzyme) 
	TK270802_E14_cyto_2D_step08.3266.3266.2	3.0714	0.5676	1874.07	1	4720.0%	3	K.GVTIIGPATVGGIKPGCFK.I
*	TK270802_E14_cyto_2D_step04.1834.1834.1	1.7927	0.2382	914.21	1	5620.0%	3	R.LGHEATVGK.A
	TK270802_E14_cyto_2D_step07.2138.2138.1	1.0204	0.2193	1246.84	9	4000.0%	1	R.RGGPNYQEGLR.V
	TK270802_E14_cyto_2D_step04.3452.3452.1	1.1243	0.0122	1394.36	1	4550.0%	1	R.SMGFIGHYLDQK.R
	TK270802_E14_cyto_2D_step14.4328.4328.2	1.3108	0.0713	2917.3	1	2310.0%	1	R.TTDGVYEGVAIGGDRYPGSTFMDHVLR.Y
	TK270802_E14_cyto_2D_step03.5064.5064.3	1.1451	0.1799	3851.89	2	1360.0%	1	R.LPKYSCQFIEMCLMVTADHGPAVSGAHNTIICAR.A
	TK270802_E14_cyto_2D_step05.4121.4121.2	1.1931	0.0766	1973.32	6	2500.0%	1	K.QHFPATPLLDYALEVEK.I
	TK270802_E14_cyto_2D_step12.4717.4717.2	1.2641	0.0928	3006.62	3	2120.0%	1	R.NCGSFTREEADEYVDIGALNGIFVLGR.S
UPSD1_HUMAN99.6%556.9%9531058665.4(Q99460) 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) 
*	TK270802_E14_cyto_2D_step08.3155.3155.1	2.9637	0.4763	1469.74	1	6000.0%	1	R.HGGSLGLGLAAMGTAR.Q
*	TK270802_E14_cyto_2D_step04.2781.2781.1	1.3004	0.0771	908.0	48	6670.0%	1	R.RLDVFEK.T
*	TK270802_E14_cyto_2D_step04.3750.3750.2	2.1207	0.3442	2401.01	1	4250.0%	1	R.TPEQCPSVVSLLSESYNPHVR.Y
*	TK270802_E14_cyto_2D_step10.2491.2491.3	1.3276	0.052	1874.35	10	2670.0%	1	R.VMPAQLKVLTMPETCR.Y
*	TK270802_E14_cyto_2D_step03.2379.2379.1	1.0991	0.0776	745.14	5	6000.0%	1	K.EFALHK.L
USYS_MOUSE99.6%71113.9%511582586.3(P26638) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS) 
*	TK270802_E14_cyto_2D_step07.3222.3222.2	0.8314	0.0293	2276.93	8	1500.0%	1	R.EIGNLLHPSVPISNDEDADNK.V
	TK270802_E14_cyto_2D_step05.1937.1937.1	1.7483	0.268	789.23	2	8000.0%	2	R.VHQFEK.I
*	TK270802_E14_cyto_2D_step01.4614.4614.2	3.0751	0.4985	2932.99	1	2780.0%	1	K.EAVGDDESVPENVLNFDDLTADALAALK.V
	TK270802_E14_cyto_2D_step04.3205.3205.2	3.8529	0.5521	1685.16	1	6790.0%	1	K.YLIATSEQPIAALHR.D
*	TK270802_E14_cyto_2D_step10.4207.4207.2	1.1632	0.0659	3063.78	10	1250.0%	2	K.KEAVGDDESVPENVLNFDDLTADALAALK.V
UMDHC_MOUSE99.6%4108.7%333363466.6(P14152) Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) 
	TK270802_E14_cyto_2D_step06.3041.3041.2	4.3498	0.6583	2283.28	1	6050.0%	3	K.NVIIWGNHSSTQYPDVNHAK.V
	TK270802_E14_cyto_2D_step06.2247.2247.1	0.7762	0.0432	1007.62	92	2500.0%	1	K.EVGVYEALK.D
UPPP4_HUMAN99.6%229.4%307350805.1(P33172) Serine/threonine protein phosphatase 4 (EC 3.1.3.16) (Pp4) (Protein phosphatase X) (PP-X) (P33172) Serine/threonine protein phosphatase 4 (EC 3.1.3.16) (Pp4) (Protein phosphatase X) (PP-X) 
	TK270802_E14_cyto_2D_step09.4520.4520.3	1.1007	0.0175	3603.52	45	890.0%	1	R.AHQLVMEGYKWHFNETVLTVWSAPNYCYR.C
	TK270802_E14_cyto_2D_step05.2521.2521.1	2.2605	0.4435	1177.03	1	6110.0%	1	R.AHQLVMEGYK.W
UH2AZ_HUMAN99.6%2211.0%1271342210.6(P17317) Histone H2A.z (H2A/z) (P17317) Histone H2A.z (H2A/z) 
	TK270802_E14_cyto_2D_step13.2688.2688.2	3.261	0.4865	1372.58	1	6920.0%	1	K.ATIAGGGVIPHIHK.S
UQ9Z1N599.6%112.8%428490355.7(Q9Z1N5) Nuclear RNA helicase BAT1 (Similar to DNA segment, CHR 17, human D6S81E 1) 
	TK270802_E14_cyto_2D_step07.2297.2297.1	2.099	0.4487	1306.94	1	6360.0%	1	K.NCPHIVVGTPGR.I
UTCPH_MOUSE99.6%81613.1%544596527.8(P80313) T-complex protein 1, eta subunit (TCP-1-eta) (CCT-eta) 
	TK270802_E14_cyto_2D_step05.3169.3169.1	1.796	0.3301	1155.47	1	5560.0%	1	R.SLHDAIMIVR.R
	TK270802_E14_cyto_2D_step10.4100.4100.2	3.3924	0.5421	2895.7	1	3480.0%	3	R.VHTVEDYQAIVDAEWNILYDKLEK.I
	TK270802_E14_cyto_2D_step04.2685.2685.1	1.8487	0.3816	1065.06	1	6110.0%	2	K.LLDVVHPAAK.T
	TK270802_E14_cyto_2D_step02.3210.3210.1	0.903	0.2186	1105.8	7	3890.0%	1	K.QQLLIGAYAK.A
	TK270802_E14_cyto_2D_step09.3169.3169.2	1.478	0.3423	2020.47	1	3440.0%	1	K.QVKPYVEEGLHPQIIIR.A
UQ921M799.6%227.7%324367766.1(Q921M7) Similar to hypothetical protein DKFZp566A1524 
	TK270802_E14_cyto_2D_step07.4736.4736.2	0.8668	0.0407	2684.54	49	1250.0%	1	R.GLLGALTSTPYSPTQHLEREQALAK.Q
	TK270802_E14_cyto_2D_step05.3646.3646.2	2.7928	0.6287	2044.4	1	4440.0%	1	R.GLLGALTSTPYSPTQHLER.E
UNTF2_HUMAN99.6%102455.9%127144785.4(P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) (P13662) Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) 
	TK270802_E14_cyto_2D_step13.2933.2933.2	0.8447	0.0145	1529.07	157	1920.0%	1	K.AAIVEKLSSLPFQK.I
	TK270802_E14_cyto_2D_step12.3444.3444.3	4.0192	0.6355	3007.17	1	2880.0%	3	K.IQHSITAQDHQPTPDSCIISMVVGQLK.A
	TK270802_E14_cyto_2D_step07.3726.3726.2	1.3946	0.2517	2618.19	1	2500.0%	3	R.TQLGAIYIDASCLTWEGQQFQGK.A
	TK270802_E14_cyto_2D_step14.1613.1613.1	0.4576	0.0854	772.45	6	2500.0%	1	R.LALHNFG.-
UAPA1_MOUSE99.6%153135.6%264305875.9(Q00623) Apolipoprotein A-I precursor (Apo-AI) 
*	TK270802_E14_cyto_2D_step03.2127.2127.1	1.624	0.2144	1333.85	2	4000.0%	3	K.SNPTLNEYHTR.A
*	TK270802_E14_cyto_2D_step04.2029.2029.1	1.7093	0.3478	1299.67	1	5500.0%	3	R.TQLAPHSEQMR.E
*	TK270802_E14_cyto_2D_step04.1924.1924.1	1.5614	0.3302	828.22	1	6670.0%	1	R.THVDSLR.T
*	TK270802_E14_cyto_2D_step01.1759.1759.1	1.6373	0.1584	844.23	1	7500.0%	1	K.LQELQGR.L
*	TK270802_E14_cyto_2D_step05.3631.3631.1	1.4832	0.2116	1300.85	1	5500.0%	1	R.HSLMPMLETLK.T
*	TK270802_E14_cyto_2D_step03.4354.4354.3	2.6166	0.5332	4101.68	1	1860.0%	2	R.DYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQER.L
*	TK270802_E14_cyto_2D_step01.2803.2803.1	1.3501	0.2437	1242.34	1	5500.0%	1	K.DFANVYVDAVK.D
UQ922K299.6%687.8%641749236.8(Q922K2) Unknown (Protein for IMAGE:3493441) (Fragment) 
	TK270802_E14_cyto_2D_step05.2650.2650.1	1.4536	0.0827	1195.06	3	4440.0%	1	K.GTYLATFHQR.G
	TK270802_E14_cyto_2D_step08.2292.2292.1	1.2538	0.0226	714.03	2	7500.0%	2	K.LHWQK.N
	TK270802_E14_cyto_2D_step05.2610.2610.1	1.702	0.2881	1097.83	2	5560.0%	1	K.FAVLHGEAPR.I
	TK270802_E14_cyto_2D_step05.3390.3390.2	4.4976	0.5971	1922.54	1	6330.0%	1	R.FSHQGVQLIDFSPCER.Y
*	TK270802_E14_cyto_2D_step14.2337.2337.1	0.7313	0.014	919.2	2	2500.0%	1	R.GIALWGGDK.F
UTBA1_MOUSE99.6%6146.0%451501365.1(P02551) Tubulin alpha-1 chain 
	TK270802_E14_cyto_2D_step04.4370.4370.2	3.7437	0.5354	1460.57	1	7310.0%	3	R.LIGQIVSSITASLR.F
	TK270802_E14_cyto_2D_step01.3574.3574.1	1.1026	0.0025	1597.08	1	3750.0%	1	R.TIQFVDWCPTGFK.V
UQ99K8899.6%132924.7%365381477.7(Q99K88) Hypothetical 38.1 kDa protein 
	TK270802_E14_cyto_2D_step07.3844.3844.2	2.4218	0.0556	1310.27	1	7000.0%	2	R.ILVTLLHTLER.V
	TK270802_E14_cyto_2D_step04.2078.2078.1	1.805	0.4373	1044.26	1	5560.0%	1	R.HGSNLEAMGK.L
	TK270802_E14_cyto_2D_step02.5003.5003.1	0.8905	0.1399	1099.77	1	4440.0%	1	K.EIVPVLVSSR.K
	TK270802_E14_cyto_2D_step05.4048.4048.2	2.1438	0.469	2669.51	1	3120.0%	3	K.VAPEEVSEVIFGHVLTAGCGQNPTR.Q
	TK270802_E14_cyto_2D_step04.3140.3140.2	3.6435	0.5447	1937.08	1	4740.0%	2	K.VNIDGGAIALGHPLGASGCR.I
	TK270802_E14_cyto_2D_step07.2174.2174.1	1.4729	0.1354	803.87	3	7000.0%	1	K.KWQVSR.E
	TK270802_E14_cyto_2D_step13.2282.2282.1	1.2835	0.1862	946.56	4	4290.0%	3	K.APHLTHLR.T
UPDX2_MOUSE99.6%4270638.9%198217795.4(Q61171) Peroxiredoxin 2 (EC 1.11.1.-) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) 
*	TK270802_E14_cyto_2D_step01.4302.4302.2	3.1198	0.5242	1708.5	1	5310.0%	1	K.EGGLGPLNIPLLADVTK.S
	TK270802_E14_cyto_2D_step04.1614.1614.2	1.5593	0.123	1214.13	7	4500.0%	1	R.QITVNDLPVGR.S
	TK270802_E14_cyto_2D_step12.3573.3573.2	3.4749	0.6123	2703.48	1	4130.0%	25	K.LGCEVLGVSVDSQFTHLAWINTPR.K
*	TK270802_E14_cyto_2D_step01.3415.3415.1	1.4217	0.0794	1599.11	4	3330.0%	5	K.SAPDFTATAVVDGAFK.E
*	TK270802_E14_cyto_2D_step05.4319.4319.2	3.7366	0.6407	1837.35	1	6180.0%	7	R.KEGGLGPLNIPLLADVTK.S
*	TK270802_E14_cyto_2D_step01.2799.2799.1	1.6573	0.059	877.44	6	6430.0%	1	R.GLFIIDAK.G
UQ8VCM799.6%5513.8%436493915.9(Q8VCM7) Similar to fibrinogen, gamma polypeptide 
	TK270802_E14_cyto_2D_step04.3262.3262.3	1.4637	0.0546	1746.6	93	2320.0%	1	K.IHLISMQSTIPYALR.I
	TK270802_E14_cyto_2D_step01.1578.1578.1	1.6524	0.2879	1200.77	1	5500.0%	1	K.DSVQIHDTTGK.D
	TK270802_E14_cyto_2D_step09.2333.2333.2	2.3355	0.3827	1567.82	1	4640.0%	1	R.LSIGEGQQHHMGGSK.Q
	TK270802_E14_cyto_2D_step12.3736.3736.2	0.9803	0.1203	2293.45	2	2500.0%	1	K.FFTSHNGMQFSTWDNDNDK.F
UPSDB_HUMAN99.6%153519.7%422474646.5(O00231) 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) 
*	TK270802_E14_cyto_2D_step04.3225.3225.1	2.0873	0.2845	1269.23	2	5000.0%	3	R.VQIEHISSLIK.L
*	TK270802_E14_cyto_2D_step01.2410.2410.1	1.3201	0.1636	1210.22	1	4500.0%	2	R.DDPIISTHLAK.L
*	TK270802_E14_cyto_2D_step04.3366.3366.1	2.706	0.4878	1529.92	1	5420.0%	3	R.YQEALHLGSQLLR.E
*	TK270802_E14_cyto_2D_step01.3894.3894.1	1.2597	0.0063	1402.76	3	4580.0%	1	K.EQSILELGSLLAK.T
*	TK270802_E14_cyto_2D_step01.2216.2216.1	1.5208	0.0252	1517.76	18	3750.0%	1	R.DIQENDEEAVQVK.E
*	TK270802_E14_cyto_2D_step01.3420.3420.1	0.9217	0.0138	1505.37	40	2730.0%	1	K.LYDNLLEQNLIR.V
*	TK270802_E14_cyto_2D_step05.2567.2567.1	2.1018	0.1402	1146.11	2	6670.0%	3	K.TYHALSNLPK.A
URL32_HUMAN99.6%91723.1%1341572911.3(P02433) 60S ribosomal protein L32 (P02433) 60S ribosomal protein L32 
	TK270802_E14_cyto_2D_step03.2364.2364.1	2.7963	0.4088	1467.69	1	5000.0%	2	K.SYCAEIAHNVSSK.N
	TK270802_E14_cyto_2D_step13.2346.2346.2	1.6935	0.2291	1093.75	47	3890.0%	1	-.AALRPLVKPK.I
	TK270802_E14_cyto_2D_step13.2340.2340.1	1.0349	0.1151	984.52	1	5710.0%	1	R.KFLVHNVK.E
	TK270802_E14_cyto_2D_step08.2470.2470.1	1.4543	0.0052	858.86	1	6670.0%	3	K.FLVHNVK.E
UIRE1_MOUSE99.6%81018.1%889981407.5(P28271) Iron-responsive element binding protein 1 (IRE-BP 1) (Iron regulatory protein 1) (IRP1) (Ferritin repressor protein) (Aconitate hydratase) (EC 4.2.1.3) (Citrate hydro-lyase) (Aconitase) 
	TK270802_E14_cyto_2D_step12.3179.3179.2	1.7664	0.4317	2091.59	3	4170.0%	1	R.IIPPGSGIIHQVNLEYLAR.V
	TK270802_E14_cyto_2D_step09.4118.4118.2	0.82	0.1524	2959.08	55	1300.0%	1	K.AVEAGLSVKPYIKTSLSPGSGVVTYYLR.E
	TK270802_E14_cyto_2D_step13.1694.1694.2	0.9814	0.0042	3169.39	3	1720.0%	1	R.IHRSNLVGMGVIPLEYLPGETADSLGLTGR.E
*	TK270802_E14_cyto_2D_step10.4157.4157.3	1.5932	0.1268	4387.51	4	1340.0%	2	R.KTFLYSNSEFTLAHGSVVIAAITTCTNTSNPSVMLGAGLLAK.K
	TK270802_E14_cyto_2D_step05.3279.3279.2	4.189	0.6329	1778.62	1	5940.0%	1	K.NPFAHLAEPLDAAQPGK.R
	TK270802_E14_cyto_2D_step04.3957.3957.2	1.184	0.025	1659.12	1	3930.0%	1	K.EPLGVNAQGRQVFLK.D
	TK270802_E14_cyto_2D_step05.2826.2826.1	1.2979	0.0208	1171.59	1	6670.0%	1	K.NIEVPFKPAR.V
UQ9Z1R299.6%9237.9%11541210375.7(Q9Z1R2) Large proline-rich protein BAT3 (HLA-B-associated transcript 3) 
*	TK270802_E14_cyto_2D_step09.2264.2264.2	3.9956	0.7396	2820.56	1	4330.0%	4	R.APPQTQLPSGASSGTGSASATHGGAPLPGTR.G
	TK270802_E14_cyto_2D_step13.2930.2930.2	1.949	0.428	2216.64	1	3890.0%	1	R.SFFHQHYLGGQEPTPSNIR.M
	TK270802_E14_cyto_2D_step15.2650.2650.3	1.038	6.0E-4	2514.91	470	910.0%	1	R.LINLVGESLRLLGNTFVALSDLR.C
	TK270802_E14_cyto_2D_step07.2977.2977.2	1.4795	0.1607	1900.64	9	2940.0%	1	K.VKPQPPLSDAYLSGMPAK.R
UK6PL_MOUSE99.6%122818.8%780853017.1(P12382) 6-phosphofructokinase, liver type (EC 2.7.1.11) (Phosphofructokinase 1) (Phosphohexokinase) (Phosphofructo-1-kinase isozyme B) (PFK-B) 
*	TK270802_E14_cyto_2D_step11.4937.4937.3	0.993	0.0423	4569.27	16	950.0%	1	K.EGKISESTAQNYAHLTIAGLVGSIDNDFCGTDMTIGTDSALHR.I
	TK270802_E14_cyto_2D_step06.0326.0326.3	0.9582	0.0941	4721.43	6	1010.0%	1	R.GRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDR.I
	TK270802_E14_cyto_2D_step05.3125.3125.2	1.7366	0.3226	1910.65	1	3820.0%	2	R.TNVLGHLQQGGAPTPFDR.N
*	TK270802_E14_cyto_2D_step04.2184.2184.1	1.2769	0.2142	1062.84	3	6430.0%	1	K.KETDFEHR.M
	TK270802_E14_cyto_2D_step06.1935.1935.1	1.2835	0.1213	709.98	8	7000.0%	2	K.LLAHQK.V
*	TK270802_E14_cyto_2D_step01.4455.4455.1	2.1709	0.1481	1419.44	1	5910.0%	1	R.NEWGSLLEELVK.E
	TK270802_E14_cyto_2D_step11.3247.3247.2	1.9407	0.0502	1916.85	3	3750.0%	4	R.IMEVIDAITTTAQSHQR.T
URS23_HUMAN99.6%112330.1%1431580810.5(P39028) 40S ribosomal protein S23 (P39028) 40S ribosomal protein S23 
	TK270802_E14_cyto_2D_step12.1858.1858.2	1.5543	0.2593	1207.19	1	4550.0%	2	R.KGHAVGDIPGVR.F
	TK270802_E14_cyto_2D_step06.2265.2265.1	2.0619	0.2164	812.44	4	5710.0%	2	K.AHLGTALK.A
	TK270802_E14_cyto_2D_step05.2195.2195.1	1.6829	0.0866	1059.03	2	4500.0%	3	K.ANPFGGASHAK.G
	TK270802_E14_cyto_2D_step03.3534.3534.1	1.491	0.1265	1192.79	39	4000.0%	2	K.VANVSLLALYK.G
	TK270802_E14_cyto_2D_step13.2048.2048.1	2.2645	0.4242	940.59	1	5620.0%	1	K.KAHLGTALK.A
	TK270802_E14_cyto_2D_step05.2421.2421.1	1.6023	0.3013	1077.9	1	5500.0%	1	K.GHAVGDIPGVR.F
UQ91V8699.6%488.2%147157487.7(Q91V86) 11 days embryo cDNA, RIKEN full-length enriched library, clone:2700082N11, full insert sequence (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610006O05, full insert sequence) (Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610009G19, full insert sequence) (Adult male spleen cDNA, RIKEN full-length enriched library, clone:0910001P14, full insert sequence) (18 days embryo cDNA, RIKEN full-length enriched library, clone:1110005K11, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600013K09, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019A13, full insert sequence) (Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600019I13, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510004F04, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019E11, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019H05, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510022J06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510023M22, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510027H07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028E09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510028J08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510029L07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510031C09, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039C10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039D08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510039M06, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040I07, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040K10, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510040P08, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510041H16, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510044F14, full insert sequence) 
*	TK270802_E14_cyto_2D_step06.2767.2767.2	3.0704	0.6459	1109.99	1	8640.0%	2	K.VVAGVAAALAHK.Y
UQ9NWP199.6%112.2%540620204.8(Q9NWP1) Hypothetical protein FLJ20707 
*	TK270802_E14_cyto_2D_step04.1941.1941.1	1.8608	0.4635	1248.25	2	4550.0%	1	R.GTGHVSSGYVER.L
URS1A_HUMAN99.6%4640.3%1291470810.1(P39027) 40S ribosomal protein S15a 
*	TK270802_E14_cyto_2D_step05.1376.1376.2	0.7519	0.1038	1227.34	177	2000.0%	1	K.IVVNLTGRLNK.C
*	TK270802_E14_cyto_2D_step12.2576.2576.3	1.3061	0.0103	2554.68	204	1620.0%	1	R.FLTVMMKHGYIGEFEIIDDHR.A
*	TK270802_E14_cyto_2D_step10.3855.3855.2	3.1023	0.5548	2225.22	1	3950.0%	2	R.QFGFIVLTTSAGIMDHEEAR.R
UQ9EPL899.6%464.5%10391195864.8(Q9EPL8) RanBP7/importin 7 
	TK270802_E14_cyto_2D_step12.3956.3956.2	4.2706	0.5536	1652.84	1	7500.0%	1	R.SPLVAAMQHFLPVLK.D
	TK270802_E14_cyto_2D_step03.3108.3108.2	0.7912	0.0269	1683.18	398	2000.0%	1	K.DGALHMIGSLAEILLK.K
	TK270802_E14_cyto_2D_step09.3129.3129.2	1.0504	0.0873	1831.82	2	3000.0%	2	R.GIDQCIPLFVEAALER.L
UPAB1_MOUSE99.6%163819.0%636706439.5(P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein 1) (PABP 1) (PABP1) 
	TK270802_E14_cyto_2D_step06.2257.2257.1	1.2718	0.0049	1389.75	1	5000.0%	1	R.QAHLTNQYMQR.M
*	TK270802_E14_cyto_2D_step11.3622.3622.2	2.8427	0.4735	1626.48	1	6070.0%	3	R.LFPLIQAMHPSLAGK.I
	TK270802_E14_cyto_2D_step01.2460.2460.1	1.2568	0.0804	820.09	4	5710.0%	1	K.FGPALSVK.V
	TK270802_E14_cyto_2D_step06.2947.2947.2	3.9048	0.5637	1696.1	1	7000.0%	2	R.SKVDEAVAVLQAHQAK.E
	TK270802_E14_cyto_2D_step09.3052.3052.3	2.7557	0.3699	4461.56	1	1880.0%	3	R.NPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQK.Q
	TK270802_E14_cyto_2D_step08.3182.3182.2	2.5684	0.5218	1546.76	1	6540.0%	3	R.IVATKPLYVALAQR.K
	TK270802_E14_cyto_2D_step06.2382.2382.1	0.9396	0.0042	1545.8	126	2000.0%	1	K.EAAQKAVNSATGVPTV.-
UQ8VCI599.6%247.0%299327334.3(Q8VCI5) Peroxisomal farnesylated protein 
*	TK270802_E14_cyto_2D_step10.2249.2249.2	2.0879	0.3078	2086.88	2	3750.0%	2	K.AKPSPEHAPTISAPDASGPQK.R
UO3573799.6%5716.0%449491996.3(O35737) Heterogeneous nuclear ribonucleoprotein H 
	TK270802_E14_cyto_2D_step07.2441.2441.2	2.9173	0.6244	2099.01	1	4720.0%	1	R.YGDGGSTFQSTTGHCVHMR.G
	TK270802_E14_cyto_2D_step08.5189.5189.2	0.7988	0.0367	2908.9	1	1400.0%	1	K.EEIVQFFSGLEIVPNGITLPVDFQGR.S
	TK270802_E14_cyto_2D_step04.2529.2529.1	1.5959	0.2418	1095.43	1	5560.0%	2	R.VHIEIGPDGR.V
	TK270802_E14_cyto_2D_step07.3156.3156.2	1.2976	0.065	1843.55	43	2810.0%	1	R.STGEAFVQFASQEIAEK.A
UQ9D1L099.6%1115.7%153156619.6(Q9D1L0) Ethanol induced 6 
*	TK270802_E14_cyto_2D_step13.1981.1981.2	2.572	0.5702	2154.66	1	3700.0%	1	R.RAPAAQPPAAAAPSAVGSPAAAPR.Q
ULA_MOUSE99.6%101618.1%415477569.8(P32067) Lupus La protein homolog (La ribonucleoprotein) (La autoantigen homolog) 
	TK270802_E14_cyto_2D_step03.1696.1696.1	1.4178	0.1009	882.92	4	5710.0%	1	K.VLEGHAEK.E
	TK270802_E14_cyto_2D_step06.2217.2217.1	1.3151	0.1139	948.24	1	5000.0%	3	K.GSHVFTAAR.R
	TK270802_E14_cyto_2D_step01.3836.3836.1	1.5856	0.0616	1532.98	4	4170.0%	1	K.LDEGWVPLETMIK.F
	TK270802_E14_cyto_2D_step07.3766.3766.2	3.3704	0.6448	2075.64	1	6000.0%	1	K.ICHQIEYYFGDFNLPR.D
*	TK270802_E14_cyto_2D_step05.2578.2578.1	1.6733	0.068	1046.03	2	5000.0%	1	K.KFVEIPGQK.Y
	TK270802_E14_cyto_2D_step06.1821.1821.1	1.0091	0.0549	1087.68	149	4000.0%	1	K.GNRPGYAGAPK.G
	TK270802_E14_cyto_2D_step03.1504.1504.1	0.2879	0.0021	493.54	9	3330.0%	1	R.KQSK.V
	TK270802_E14_cyto_2D_step08.1771.1771.1	0.6922	0.0782	591.74	4	3750.0%	1	R.GPMKR.G
UQ9CY4099.6%1611824.6%122131848.8(Q9CY40) Hemoglobin, beta adult major chain 
	TK270802_E14_cyto_2D_step12.3775.3775.2	2.1428	0.3273	2995.38	1	2590.0%	1	K.KVADALANAAGHLDDLPGALSALSDLHAHK.L
	TK270802_E14_cyto_2D_step06.4275.4275.3	3.107	0.5543	2867.24	1	2410.0%	4	K.VADALANAAGHLDDLPGALSALSDLHAHK.L
UK1CI_HUMAN99.6%11359.5%622619875.2(P35527) Keratin, type I cytoskeletal 9 (Cytokeratin 9) (K9) (CK 9) 
*	TK270802_E14_cyto_2D_step08.3483.3483.2	3.2892	0.4606	1840.1	1	6670.0%	4	R.HGVQELEIELQSQLSK.K
*	TK270802_E14_cyto_2D_step05.2089.2089.1	1.0818	0.0183	1308.89	21	4440.0%	1	R.IKFEMEQNLR.Q
*	TK270802_E14_cyto_2D_step01.2196.2196.1	1.3671	0.2567	1586.9	1	4230.0%	1	K.VQALEEANNDLENK.I
*	TK270802_E14_cyto_2D_step07.1624.1624.1	1.4095	0.2709	812.79	1	5710.0%	4	K.KGPAAIQK.N
*	TK270802_E14_cyto_2D_step07.2649.2649.2	0.6548	0.066	1394.95	42	1500.0%	1	R.QEYEQLIAKNR.K
UAAC4_MOUSE99.6%9118.7%9121049775.4(P57780) Alpha-actinin 4 (Non-muscle alpha-actinin 4) (F-actin cross linking protein) 
	TK270802_E14_cyto_2D_step06.3359.3359.2	3.3217	0.4985	1487.01	1	8180.0%	1	K.NVNVQNFHISWK.D
	TK270802_E14_cyto_2D_step04.1619.1619.1	1.0489	0.1233	912.68	43	3570.0%	1	R.IAESNHIK.L
	TK270802_E14_cyto_2D_step08.0509.0509.2	0.6545	0.0077	1187.47	215	2220.0%	1	R.VHKPPKVQEK.C
	TK270802_E14_cyto_2D_step09.2817.2817.3	1.6534	0.1779	1802.42	4	2650.0%	1	K.GVKLVSIGAEEIVDGNAK.M
	TK270802_E14_cyto_2D_step04.2262.2262.1	1.577	0.2308	967.46	1	5000.0%	2	R.ASFNHFDK.D
	TK270802_E14_cyto_2D_step06.2671.2671.2	2.1761	0.3586	1463.83	3	4580.0%	1	R.LSNRPAFMPSEGR.M
	TK270802_E14_cyto_2D_step01.4023.4023.1	1.6977	0.2604	1217.27	2	5560.0%	1	R.LASDLLEWIR.R
UTAG2_MOUSE99.6%81628.3%212235977.1(Q9WVA4) Transgelin 2 
	TK270802_E14_cyto_2D_step01.3594.3594.1	1.0636	0.0982	1595.17	1	3460.0%	1	R.DDGLFSGDPNWFPK.K
	TK270802_E14_cyto_2D_step12.0365.0365.3	1.1416	0.1068	2766.23	2	1670.0%	1	K.IEKQYDADLEQILIQWITTQCR.E
*	TK270802_E14_cyto_2D_step01.2618.2618.1	1.2136	0.1523	1529.93	1	4230.0%	1	K.LINSLYPEGQAPVK.K
	TK270802_E14_cyto_2D_step12.4019.4019.2	5.2533	0.6154	2397.62	1	6110.0%	3	K.QYDADLEQILIQWITTQCR.E
*	TK270802_E14_cyto_2D_step06.2578.2578.1	2.5691	0.3605	1112.74	1	6110.0%	2	K.KIQASSMAFK.Q
UHBBZ_MOUSE99.6%3319.9%146163638.7(P04444) Hemoglobin beta-H1 chain (Z protein) 
	TK270802_E14_cyto_2D_step14.1775.1775.2	0.8346	0.0289	1702.24	20	1670.0%	1	K.VLTSLGLGVKNMDNLK.E
	TK270802_E14_cyto_2D_step06.3058.3058.1	2.5517	0.4486	1116.05	1	6500.0%	1	K.KVLTSLGLGVK.N
*	TK270802_E14_cyto_2D_step05.3134.3134.1	1.2241	0.0315	1222.84	11	4550.0%	1	K.LVIGVANALSHK.Y
UPE15_MOUSE99.6%98114.6%130150545.0(Q62048) Astrocytic phosphoprotein PEA-15 
	TK270802_E14_cyto_2D_step08.3790.3790.2	1.5124	0.3291	2174.05	1	2780.0%	9	K.SEEITTGSAWFSFLESHNK.L
UPRSX_HUMAN99.6%779.3%389441737.5(Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) (Q92524) 26S protease regulatory subunit S10B (Proteasome subunit p42) (p44) (Conserved ATPase domain protein 44) (CADp44) 
	TK270802_E14_cyto_2D_step01.5516.5516.1	0.7759	0.0173	550.08	1	6670.0%	1	R.YLPR.E
	TK270802_E14_cyto_2D_step10.2787.2787.2	1.9695	0.3281	1434.98	1	5000.0%	1	R.KIHIDLPNEQAR.L
	TK270802_E14_cyto_2D_step08.2080.2080.2	1.7424	0.3901	838.31	1	7860.0%	1	K.IHAGPITK.H
	TK270802_E14_cyto_2D_step03.1347.1347.1	0.5739	0.0254	401.88	3	7500.0%	1	R.LIR.E
	TK270802_E14_cyto_2D_step01.2795.2795.1	0.7948	0.015	971.14	59	4380.0%	1	R.FSEGTSADR.E
UO7014099.6%1711330.0%247283187.8(O70140) Calcyclin binding protein (Fragment) 
*	TK270802_E14_cyto_2D_step06.3173.3173.2	4.5716	0.5782	2444.65	1	4550.0%	2	K.KPELDNEKPAAVVAPLTTGYTVK.I
	TK270802_E14_cyto_2D_step10.3405.3405.2	3.1874	0.4621	2685.98	1	4320.0%	10	K.IYITLTGVHQVPTENVQVHFTER.S
*	TK270802_E14_cyto_2D_step03.2271.2271.1	1.3876	0.0846	948.09	7	5710.0%	1	K.SKIETELK.N
*	TK270802_E14_cyto_2D_step04.4033.4033.2	2.1406	0.3629	2226.5	1	3680.0%	2	K.NYSMIVNNLLKPISVESSSK.K
UQ9CRK799.6%147647.5%118128626.8(Q9CRK7) 9430095H01Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step03.2311.2311.2	3.9634	0.5233	1455.01	1	7140.0%	1	R.VGQAVDVVGQAGKPK.T
	TK270802_E14_cyto_2D_step02.4300.4300.2	1.5545	0.2282	2461.35	1	3100.0%	1	R.AELATEEFLPVTPILEGFVILR.K
	TK270802_E14_cyto_2D_step11.2986.2986.2	3.8796	0.6196	2083.13	1	5280.0%	8	K.TITGFQTHTTPVLLAHGER.A
UPRS8_HUMAN99.6%6816.7%406456267.5(P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) (P47210) 26S protease regulatory subunit 8 (Proteasome subunit p45) (Thyroid hormone receptor interacting protein 1) (TRIP1) (MSUG1 protein) (TAT-binding protein homolog 10) (TBP10) (P45/SUG) 
	TK270802_E14_cyto_2D_step08.2518.2518.1	1.4039	0.1624	1427.65	1	5000.0%	1	R.AVAHHTDCTFIR.V
	TK270802_E14_cyto_2D_step10.2866.2866.2	2.436	0.4965	1762.86	1	4640.0%	2	R.RVHVTQEDFEMAVAK.V
	TK270802_E14_cyto_2D_step10.0288.0288.3	2.2697	0.0869	2236.03	34	2360.0%	1	K.FVVDVDKNIDINDVTPNCR.V
	TK270802_E14_cyto_2D_step05.3688.3688.1	2.9737	0.0507	1551.97	1	5380.0%	1	K.HPELFEALGIAQPK.G
	TK270802_E14_cyto_2D_step08.3076.3076.2	1.0895	0.0049	2460.9	7	2380.0%	1	K.EVIELPVKHPELFEALGIAQPK.G
UQ9CSH099.6%91520.7%588633916.9(Q9CSH0) 2810036L13Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step03.1697.1697.2	1.4424	0.3087	1532.58	14	2860.0%	1	R.ITRPGNTDDPSGGNK.V
	TK270802_E14_cyto_2D_step13.2950.2950.2	1.5187	0.4252	1705.63	1	5000.0%	3	R.HDGYGSHGPLLPLPSR.Y
	TK270802_E14_cyto_2D_step15.3963.3963.2	1.0951	0.1485	2934.59	3	2000.0%	1	K.QHSVVPSQIFELEDGTSSYKDFAMSK.N
	TK270802_E14_cyto_2D_step14.2297.2297.2	0.7504	0.1694	1813.69	63	1670.0%	1	K.TDAVEALTALNHYQIR.V
	TK270802_E14_cyto_2D_step07.2208.2208.1	1.5287	0.2038	1424.7	1	4230.0%	1	R.SMPLSTEGGGSHHK.V
	TK270802_E14_cyto_2D_step05.2039.2039.1	1.6735	0.2351	995.94	3	5620.0%	1	R.AVTHLNNVK.L
	TK270802_E14_cyto_2D_step05.4067.4067.2	1.8947	0.217	3124.79	1	2600.0%	1	K.NIIQPPSCVLHYYNVPLCVTEETFTK.L
UTBB3_MOUSE99.6%61811.6%450504194.9(Q9ERD7) Tubulin beta-3 
	TK270802_E14_cyto_2D_step01.1948.1948.1	0.7642	0.0014	1028.85	33	3120.0%	1	K.VAVCDIPPR.G
	TK270802_E14_cyto_2D_step07.3986.3986.3	2.5582	0.0408	2796.47	1	2600.0%	1	R.SGAFGHLFRPDNFIFGQSGAGNNWAK.G
	TK270802_E14_cyto_2D_step04.4262.4262.2	2.6369	0.3784	1876.09	1	4380.0%	4	K.MSSTFIGNSTAIQELFK.R
USYD_MOUSE99.6%122811.0%501571176.5(Q922B2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS) 
*	TK270802_E14_cyto_2D_step07.1319.1319.2	0.7037	0.0202	960.96	63	2860.0%	1	K.ADDVVWVR.A
	TK270802_E14_cyto_2D_step07.3096.3096.1	1.0553	0.0763	1231.08	49	3330.0%	1	R.LQSGICHLFR.E
	TK270802_E14_cyto_2D_step12.3295.3295.2	2.1564	0.442	1402.95	1	5910.0%	3	R.VTMLFLGLHNVR.Q
	TK270802_E14_cyto_2D_step08.2664.2664.2	2.3356	0.3665	1438.57	1	6070.0%	2	R.FGAPPHAGGGIGLER.V
	TK270802_E14_cyto_2D_step09.2593.2593.1	0.9694	0.0106	1132.8	20	3890.0%	2	R.ALHHGIDLEK.I
UFKB1_MOUSE99.6%137553.3%107117918.2(P26883) FK506-binding protein (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) (Immunophilin FKBP12) 
*	TK270802_E14_cyto_2D_step11.3745.3745.3	1.821	0.0067	3610.6	8	1670.0%	1	R.AKLIISSDYAYGATGHPGIIPPHATLVFDVELLK.L
	TK270802_E14_cyto_2D_step09.2737.2737.2	2.6158	0.6197	1953.24	1	5000.0%	8	K.RGQTCVVHYTGMLEDGK.K
*	TK270802_E14_cyto_2D_step14.4771.4771.3	2.6297	0.3327	3412.72	1	2180.0%	3	K.LIISSDYAYGATGHPGIIPPHATLVFDVELLK.L
	TK270802_E14_cyto_2D_step04.1669.1669.1	1.0413	0.0205	740.67	28	5000.0%	1	K.KFDSSR.D
UG6PI_MOUSE99.6%101813.5%557626377.9(P06745) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) 
	TK270802_E14_cyto_2D_step06.1620.1620.1	1.1599	0.3616	721.17	1	6000.0%	1	R.KGLHHK.I
	TK270802_E14_cyto_2D_step08.2744.2744.1	1.2064	0.0362	880.7	2	5000.0%	3	R.AVLHVALR.N
	TK270802_E14_cyto_2D_step04.2878.2878.2	2.6903	0.3911	1711.76	1	4640.0%	1	K.VFEGNRPTNSIVFTK.L
*	TK270802_E14_cyto_2D_step02.4263.4263.2	1.8365	0.3372	1677.43	1	4290.0%	1	K.ILLANFLAQTEALMK.G
	TK270802_E14_cyto_2D_step05.2546.2546.1	2.5833	0.4315	1190.62	1	6500.0%	2	K.HFVALSTNTAK.V
*	TK270802_E14_cyto_2D_step04.3549.3549.2	2.3026	0.5733	1589.94	1	5770.0%	1	R.VWFVSNIDGTHIAK.T
*	TK270802_E14_cyto_2D_step05.2773.2773.1	1.172	0.031	855.99	5	6000.0%	1	K.LLEWHR.A
UTCPG_MOUSE99.6%101427.7%545606306.7(P80318) T-complex protein 1, gamma subunit (TCP-1-gamma) (CCT-gamma) (Matricin) 
	TK270802_E14_cyto_2D_step06.4558.4558.3	1.1878	0.035	4603.11	1	1340.0%	1	R.TQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYR.M
	TK270802_E14_cyto_2D_step03.3695.3695.1	1.448	0.0943	1187.9	5	4500.0%	1	K.TAVETAVLLLR.I
*	TK270802_E14_cyto_2D_step11.4078.4078.3	2.407	0.4389	3430.47	4	1850.0%	2	R.ILQMEEEYIHQLCEDIIQLKPDVVITEK.G
*	TK270802_E14_cyto_2D_step05.2210.2210.1	1.0887	0.0301	1243.96	16	4500.0%	1	K.KISTPVDVNNR.E
	TK270802_E14_cyto_2D_step03.2248.2248.1	1.6025	0.2645	1376.88	1	5450.0%	1	K.KGESQTDIEITR.E
	TK270802_E14_cyto_2D_step04.2242.2242.1	1.1495	0.0736	1099.34	136	3120.0%	1	R.IVSRPEELR.E
	TK270802_E14_cyto_2D_step03.1994.1994.1	1.8154	0.0284	1123.04	1	5560.0%	2	R.EIQVQHPAAK.S
	TK270802_E14_cyto_2D_step15.3253.3253.3	1.2754	0.0852	2834.03	2	2040.0%	1	R.NVLLDPQLVPGGGASEMAVAHALTEKSK.A
UQ9CZD299.6%8647.3%260296233.9(Q9CZD2) 2810018A15Rik protein 
	TK270802_E14_cyto_2D_step09.3912.3912.2	4.4336	0.517	2032.31	1	6390.0%	8	R.KLELSDNIISGGLEVLAEK.C
UQ99KQ299.6%308240.6%512540077.0(Q99KQ2) Hypothetical 54.0 kDa protein (Fragment) 
	TK270802_E14_cyto_2D_step10.3199.3199.2	1.835	0.4456	2203.7	1	3680.0%	6	R.LVSNHSLHETSSVFVDSLTK.V
*	TK270802_E14_cyto_2D_step14.3322.3322.2	1.0138	0.16	1857.88	30	1670.0%	1	K.WGDEHIPGSPYRIMVP.-
	TK270802_E14_cyto_2D_step08.1767.1767.3	1.0969	0.0576	1573.01	4	2310.0%	1	K.FNGTHIPGSPFKIR.V
	TK270802_E14_cyto_2D_step11.2665.2665.2	2.2401	0.4387	1826.14	1	4690.0%	1	R.RAPSVANIGSHCDLSLK.I
	TK270802_E14_cyto_2D_step07.2937.2937.1	2.3874	0.4132	1382.92	1	5830.0%	2	K.YGGPYHIGGSPFK.A
	TK270802_E14_cyto_2D_step08.2852.2852.1	2.0739	0.2497	1303.79	1	5910.0%	3	K.FNGTHIPGSPFK.I
	TK270802_E14_cyto_2D_step08.3685.3685.3	1.4513	0.132	4711.31	7	1050.0%	1	K.DGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDAR.R
	TK270802_E14_cyto_2D_step04.3044.3044.2	2.7092	0.543	1536.24	1	6540.0%	1	R.FVPAEMGMHTVSVK.Y
*	TK270802_E14_cyto_2D_step05.2014.2014.2	1.2788	0.2136	1821.33	2	3610.0%	1	K.VATVPQHATSGPGPADVSK.V
	TK270802_E14_cyto_2D_step13.3386.3386.2	3.783	0.5744	2306.42	1	5230.0%	1	K.GQHVPGSPFQFTVGPLGEGGAHK.V
	TK270802_E14_cyto_2D_step10.2909.2909.2	2.0608	0.3287	1436.92	1	4620.0%	3	K.AGNNMLLVGVHGPR.T
*	TK270802_E14_cyto_2D_step03.2800.2800.1	1.6877	0.2654	1414.13	6	3640.0%	1	K.WGDEHIPGSPYR.I
*	TK270802_E14_cyto_2D_step01.3211.3211.1	1.2099	0.151	1505.95	2	3460.0%	2	R.AEAGVPAEFGIWTR.E
UQ9CQ1699.6%248.8%1481660511.1(Q9CQ16) Ribosomal protein L27a (Ribosmal protein L27a) 
	TK270802_E14_cyto_2D_step05.2606.2606.2	3.4419	0.3663	1582.32	1	7080.0%	2	K.RNQSFCPTVNLDK.L
UALFA_MOUSE99.6%91727.8%363392258.1(P05064) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) 
	TK270802_E14_cyto_2D_step05.3888.3888.2	1.3504	0.2508	2110.21	1	3420.0%	2	K.IGEHTPSALAIMENANVLAR.Y
	TK270802_E14_cyto_2D_step14.2155.2155.3	1.5325	0.1675	2924.64	9	1390.0%	1	K.GVVPLAGTNGETTTQGLDGLSERCAQYK.K
*	TK270802_E14_cyto_2D_step08.2403.2403.1	2.3074	0.3937	1379.66	1	5910.0%	3	-.PHPYPALTPEQK.K
*	TK270802_E14_cyto_2D_step05.2919.2919.3	1.227	0.1671	3866.37	19	880.0%	1	K.VLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQK.F
	TK270802_E14_cyto_2D_step01.0584.0584.1	0.7608	0.0356	584.84	5	5000.0%	1	R.IVAPGK.G
U143Z_MOUSE99.6%133335.5%245277714.8(P35215) 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein-1) (KCIP-1) (Mitochondrial import stimulation factor S1 subunit) 
	TK270802_E14_cyto_2D_step01.2111.2111.1	2.5129	0.3444	1281.09	1	6820.0%	1	R.YLAEVAAGDDKK.G
	TK270802_E14_cyto_2D_step01.1331.1331.1	0.9729	0.0713	729.9	20	6000.0%	1	K.NELVQK.A
	TK270802_E14_cyto_2D_step01.4190.4190.1	2.6868	0.3044	1422.45	1	6820.0%	3	R.DICNDVLSLLEK.F
*	TK270802_E14_cyto_2D_step01.2547.2547.1	1.7429	0.0673	1333.04	2	5000.0%	1	K.FLIPNASQPESK.V
	TK270802_E14_cyto_2D_step01.1594.1594.1	2.0418	0.1065	892.02	4	6430.0%	2	R.VVSSIEQK.T
	TK270802_E14_cyto_2D_step11.2917.2917.2	3.1694	0.5388	2172.63	1	5830.0%	4	K.KGIVDQSQQAYQEAFEISK.K
	TK270802_E14_cyto_2D_step01.4355.4355.2	3.2737	0.5716	2133.66	1	4720.0%	1	K.TAFDEAIAELDTLSEESYK.D
UQ9D66399.6%4631.8%173193069.0(Q9D663) 0 day neonate skin cDNA, RIKEN full-length enriched library, clone:4632427M03, full insert sequence 
	TK270802_E14_cyto_2D_step06.3805.3805.2	3.837	0.5093	1726.65	1	6250.0%	2	K.VPSVSSSALVSSLHLLK.C
*	TK270802_E14_cyto_2D_step01.2316.2316.1	0.8287	0.0174	1552.85	38	2920.0%	1	-.MTKLFQSNDPTLR.R
	TK270802_E14_cyto_2D_step13.4001.4001.2	0.8166	0.0424	2905.06	4	1880.0%	1	R.MCYLTIKEMSCIAEDVIIVTSSLTK.D
ULGUL_MOUSE99.6%4813.7%183206785.5(Q9CPU0) Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D-lactoylglutathione methylglyoxal lyase) 
	TK270802_E14_cyto_2D_step04.2566.2566.1	1.7421	0.0985	979.84	4	7860.0%	2	K.RFEELGVK.F
	TK270802_E14_cyto_2D_step06.3447.3447.2	2.7692	0.4455	1793.37	1	5000.0%	2	R.GFGHIGIAVPDVYSACK.R
UACTA_HUMAN99.6%6456047.7%377420095.4(P03996) Actin, aortic smooth muscle (Alpha-actin 2) (P03996) Actin, aortic smooth muscle (Alpha-actin 2) 
	TK270802_E14_cyto_2D_step01.2923.2923.2	1.2205	0.0533	1793.31	9	3330.0%	2	K.SYELPDGQVITIGNER.F
	TK270802_E14_cyto_2D_step04.4074.4074.3	1.1469	0.1749	3191.5	3	1570.0%	1	R.CPETLFQPSFIGMESAGIHETTYNSIMK.C
	TK270802_E14_cyto_2D_step02.3112.3112.2	1.8735	0.4741	1963.39	1	4330.0%	2	K.YPIEHGIITNWDDMEK.I
	TK270802_E14_cyto_2D_step01.3008.3008.1	2.0794	0.2482	1001.78	2	5710.0%	7	R.DLTDYLMK.I
	TK270802_E14_cyto_2D_step13.2916.2916.1	2.4797	0.3881	1503.9	1	6000.0%	2	K.IWHHSFYNELR.V
	TK270802_E14_cyto_2D_step01.1786.1786.1	1.8243	0.2983	978.91	1	5560.0%	2	K.AGFAGDDAPR.A
	TK270802_E14_cyto_2D_step01.2390.2390.1	2.2963	0.276	1164.01	1	7000.0%	4	K.EITALAPSTMK.I
	TK270802_E14_cyto_2D_step02.2898.2898.1	1.0735	0.0086	645.55	3	6000.0%	6	R.GILTLK.Y
	TK270802_E14_cyto_2D_step10.2970.2970.2	1.6471	0.3493	1200.02	5	5500.0%	2	R.AVFPSIVGRPR.H
	TK270802_E14_cyto_2D_step05.3791.3791.2	2.5848	0.5296	3197.35	1	2590.0%	1	R.TTGIVLDSGDGVTHNVPIYEGYALPHAIMR.L
	TK270802_E14_cyto_2D_step01.0500.0500.1	0.8041	0.1271	517.03	2	6670.0%	1	R.EIVR.D
	TK270802_E14_cyto_2D_step05.2393.2393.1	2.802	0.323	1174.83	1	7000.0%	13	R.HQGVMVGMGQK.D
	TK270802_E14_cyto_2D_step03.3266.3266.2	3.1481	0.4048	1960.1	1	6180.0%	16	R.VAPEEHPTLLTEAPLNPK.A
UQ9D0E199.6%225.2%729776498.6(Q9D0E1) 2610023M21Rik protein 
*	TK270802_E14_cyto_2D_step02.5067.5067.1	0.6419	0.0257	1548.88	46	2140.0%	1	R.MGPGIDRISGAGMER.M
	TK270802_E14_cyto_2D_step07.3009.3009.2	2.4375	0.5475	2037.77	1	3180.0%	1	R.GNFGGSFAGSFGGAGGHAPGVAR.K
ULDHA_MOUSE99.6%3717153.8%331363677.7(P06151) L-lactate dehydrogenase A chain (EC 1.1.1.27) (LDH-A) (LDH muscle subunit) (LDH-M) 
	TK270802_E14_cyto_2D_step01.2120.2120.1	1.4303	0.2361	649.44	5	7000.0%	1	K.ISGFPK.N
	TK270802_E14_cyto_2D_step01.3580.3580.1	1.0256	0.0010	1248.24	34	3500.0%	1	K.KSADTLWGIQK.E
*	TK270802_E14_cyto_2D_step01.2491.2491.2	2.4408	0.3091	1832.47	1	5330.0%	1	K.SLNPELGTDADKEQWK.E
*	TK270802_E14_cyto_2D_step02.4223.4223.2	1.0152	0.0592	2908.38	70	1150.0%	1	K.GLYGINEDVFLSVPCILGQNGISDVVK.V
	TK270802_E14_cyto_2D_step03.2758.2758.1	1.3559	0.144	914.08	1	7500.0%	1	K.LVIITAGAR.Q
	TK270802_E14_cyto_2D_step02.4268.4268.2	3.6675	0.5237	1946.22	1	5620.0%	1	K.LLIVSNPVDILTYVAWK.I
*	TK270802_E14_cyto_2D_step13.2529.2529.1	1.0376	0.1061	1183.95	4	5560.0%	2	R.RVHPISTMIK.G
*	TK270802_E14_cyto_2D_step05.1488.1488.1	0.892	0.0546	793.78	1	5000.0%	5	K.YSPHCK.L
*	TK270802_E14_cyto_2D_step07.2665.2665.1	1.5291	0.3422	1028.05	1	5620.0%	4	R.VHPISTMIK.G
	TK270802_E14_cyto_2D_step11.4133.4133.2	3.4737	0.6318	2115.38	1	5000.0%	3	K.GYTSWAIGLSVADLAESIMK.N
	TK270802_E14_cyto_2D_step01.0159.0159.1	1.933	0.3455	1119.04	1	6670.0%	1	K.SADTLWGIQK.E
*	TK270802_E14_cyto_2D_step01.3426.3426.1	2.6667	0.2658	1058.05	2	6880.0%	2	K.DQLIVNLLK.E
*	TK270802_E14_cyto_2D_step01.3850.3850.1	0.9963	0.023	1389.07	14	3180.0%	1	K.VTLTPEEEARLK.K
*	TK270802_E14_cyto_2D_step01.1991.1991.1	0.9394	0.0322	1145.09	92	3330.0%	1	K.VTLTPEEEAR.L
*	TK270802_E14_cyto_2D_step14.4823.4823.3	2.5293	0.5063	3615.64	1	2210.0%	10	R.LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK.S
UDCUP_MOUSE99.6%116.0%367405986.7(P70697) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD) 
*	TK270802_E14_cyto_2D_step12.3945.3945.2	2.3652	0.5654	2365.67	1	3330.0%	1	R.LRDPAAAASELGYVFQAITLTR.Q
UFSC1_HUMAN99.6%154512.4%492543997.2(Q16658) Fascin (Singed-like protein) (55 kDa actin bundling protein) (p55) 
	TK270802_E14_cyto_2D_step11.3191.3191.2	1.6964	0.1059	1243.37	26	4440.0%	3	K.LINRPIIVFR.G
	TK270802_E14_cyto_2D_step06.2553.2553.3	1.4381	0.1752	2053.25	6	2350.0%	1	R.EVPGPDCRFLIVAHDDGR.W
	TK270802_E14_cyto_2D_step02.2584.2584.1	0.7604	0.0261	930.38	17	3570.0%	1	R.EVPGPDCR.F
	TK270802_E14_cyto_2D_step12.3301.3301.3	1.3422	0.0168	2678.73	32	1740.0%	1	K.VGKDELFALEQSCAQVVLQAANER.N
	TK270802_E14_cyto_2D_step05.2341.2341.1	1.6064	0.4117	1034.34	1	6880.0%	2	R.GEHGFIGCR.K
UALBU_MOUSE99.6%8654037.5%608686936.1(P07724) Serum albumin precursor 
*	TK270802_E14_cyto_2D_step10.1928.1928.1	0.6322	0.1262	710.57	22	4000.0%	1	K.SEIAHR.Y
	TK270802_E14_cyto_2D_step03.2318.2318.1	1.7774	0.1085	1078.04	1	7140.0%	4	R.NECFLQHK.D
*	TK270802_E14_cyto_2D_step01.2291.2291.2	1.7059	0.3177	1751.96	1	5770.0%	1	K.ECCHGDLLECADDR.A
*	TK270802_E14_cyto_2D_step03.2496.2496.2	2.8772	0.3146	1377.94	1	7000.0%	2	K.LQTCCDKPLLK.K
*	TK270802_E14_cyto_2D_step14.4060.4060.2	3.8443	0.4793	1483.55	1	7080.0%	11	K.GLVLIAFSQYLQK.C
*	TK270802_E14_cyto_2D_step01.1963.1963.1	0.8441	0.1361	1459.79	5	2270.0%	1	R.ENYGELADCCTK.Q
*	TK270802_E14_cyto_2D_step05.4025.4025.2	0.9974	4.0E-4	1881.52	17	2350.0%	1	K.APQVSTPTLVEAARNLGR.V
*	TK270802_E14_cyto_2D_step01.2536.2536.1	1.6016	0.2852	1150.59	2	5560.0%	2	K.LVQEVTDFAK.T
*	TK270802_E14_cyto_2D_step01.0128.0128.1	1.3896	0.0695	1596.69	1	3850.0%	1	K.DTCFSTEGPNLVTR.C
*	TK270802_E14_cyto_2D_step01.2131.2131.1	0.9687	0.0484	1252.08	6	3890.0%	2	R.YNDLGEQHFK.G
*	TK270802_E14_cyto_2D_step05.2425.2425.1	1.7558	0.0545	899.08	5	6670.0%	3	R.VCLLHEK.T
*	TK270802_E14_cyto_2D_step14.3182.3182.2	1.4592	0.29	1456.93	1	4090.0%	3	R.RHPDYSVSLLLR.L
*	TK270802_E14_cyto_2D_step07.4752.4752.2	1.5605	0.2261	1904.52	1	4000.0%	10	K.ENPTTFMGHYLHEVAR.R
*	TK270802_E14_cyto_2D_step01.1868.1868.1	1.5861	0.2504	762.36	1	7500.0%	1	K.LATDLTK.V
*	TK270802_E14_cyto_2D_step10.3186.3186.2	0.9396	0.026	1895.57	137	2330.0%	1	K.AETFTFHSDICTLPEK.E
*	TK270802_E14_cyto_2D_step05.3473.3473.1	1.1779	0.1106	1299.99	1	5500.0%	1	R.HPDYSVSLLLR.L
*	TK270802_E14_cyto_2D_step04.3178.3178.2	1.9932	0.4776	2155.21	1	3240.0%	1	K.AETFTFHSDICTLPEKEK.Q
	TK270802_E14_cyto_2D_step04.3072.3072.1	2.4931	0.2207	1020.04	1	6250.0%	6	K.SLHTLFGDK.L
*	TK270802_E14_cyto_2D_step14.2862.2862.2	2.3482	0.5193	1886.22	1	4330.0%	9	R.RPCFSALTVDETYVPK.E
*	TK270802_E14_cyto_2D_step05.2885.2885.1	2.0906	0.0867	1103.24	1	6670.0%	4	K.KQTALAELVK.H
*	TK270802_E14_cyto_2D_step01.2414.2414.2	1.9599	0.1654	1441.82	7	4620.0%	1	K.APQVSTPTLVEAAR.N
*	TK270802_E14_cyto_2D_step04.2021.2021.1	1.9663	0.1196	984.09	1	6430.0%	4	K.KYEATLEK.C
*	TK270802_E14_cyto_2D_step04.1701.1701.2	2.2346	0.454	1000.24	1	8750.0%	2	K.TPVSEHVTK.C
UTKT_MOUSE99.6%285241.3%623676317.5(P40142) Transketolase (EC 2.2.1.1) (TK) (P68) 
	TK270802_E14_cyto_2D_step04.2337.2337.1	1.4097	0.152	944.79	1	6250.0%	3	R.SGKPAELLK.M
*	TK270802_E14_cyto_2D_step13.3300.3300.2	2.0295	0.2574	2645.83	1	2860.0%	2	K.RCEAFGWHTIIVDGHSVEELCK.A
	TK270802_E14_cyto_2D_step07.2190.2190.1	1.4475	0.0101	981.09	10	3750.0%	3	K.HQPTAIIAK.T
*	TK270802_E14_cyto_2D_step03.2126.2126.1	1.3403	0.1077	920.79	2	6430.0%	1	R.MPTPPSYK.V
	TK270802_E14_cyto_2D_step15.3524.3524.3	1.2144	0.1733	3880.68	11	1070.0%	1	R.LRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMR.Y
	TK270802_E14_cyto_2D_step06.2399.2399.1	2.4824	0.5167	1395.88	1	4580.0%	2	R.KISSDLDGHPVPK.Q
*	TK270802_E14_cyto_2D_step03.5226.5226.2	0.7926	0.0063	3188.91	19	1330.0%	1	R.ILTVEDHYYEGGIGEAVSAAVVGEPGVTVTR.L
	TK270802_E14_cyto_2D_step01.1812.1812.1	1.7854	0.2535	915.92	1	6250.0%	1	K.AVELAANTK.G
*	TK270802_E14_cyto_2D_step07.4142.4142.2	2.2759	0.4429	2626.02	1	3800.0%	1	K.SKDDQVTVIGAGVTLHEALAAAESLK.K
	TK270802_E14_cyto_2D_step05.2574.2574.1	1.7747	0.0764	916.03	2	7140.0%	1	R.KLILDSAR.A
*	TK270802_E14_cyto_2D_step09.2346.2346.1	2.3541	0.3801	1164.71	1	6670.0%	3	K.EAWHGKPLPK.N
*	TK270802_E14_cyto_2D_step01.1964.1964.1	1.6777	0.033	843.94	8	5710.0%	1	K.DAIVQAVK.G
	TK270802_E14_cyto_2D_step05.4381.4381.2	0.8672	0.0408	3070.28	27	1200.0%	1	K.EHPDRFIECYIAEQNMVSIAVGCATR.D
	TK270802_E14_cyto_2D_step07.3036.3036.3	1.2246	0.0229	3090.0	8	1720.0%	1	K.QAFTDVATGSLGQGLGAACGMAYTGKYFDK.A
*	TK270802_E14_cyto_2D_step03.4916.4916.1	0.9902	0.0537	1403.94	28	3180.0%	1	K.LDNLVAIFDINR.L
URL30_HUMAN99.6%95327.2%114126539.6(P04645) 60S ribosomal protein L30 (P04645) 60S ribosomal protein L30 
	TK270802_E14_cyto_2D_step04.3290.3290.1	1.8386	0.2997	1447.88	1	5000.0%	2	R.KSEIEYYAMLAK.T
	TK270802_E14_cyto_2D_step10.2359.2359.2	4.4669	0.6124	2017.79	1	5280.0%	7	K.TGVHHYSGNNIELGTACGK.Y
UQ91YZ899.6%448.8%615678539.5(Q91YZ8) Hypothetical 67.9 kDa protein 
	TK270802_E14_cyto_2D_step06.5160.5160.2	0.8318	0.0378	2967.22	103	1350.0%	1	R.WQQGGRPQGFQGMPSALRQSGPRPALR.H
	TK270802_E14_cyto_2D_step06.2243.2243.1	1.4847	0.1004	1262.84	7	5000.0%	1	K.AHLTNQYMQR.V
	TK270802_E14_cyto_2D_step10.2901.2901.2	2.3013	0.5598	1704.95	1	5000.0%	1	R.SKVDEAVAVLQAHHAK.K
	TK270802_E14_cyto_2D_step06.2257.2257.1	1.2718	0.0049	1389.75	1	5000.0%	1	R.KAHLTNQYMQR.V
UPCB1_HUMAN99.6%92524.4%356375267.1(Q15365) Poly(rC)-binding protein 1 (Alpha-CP1) (hnRNP-E1) (Nucleic acid binding protein SUB2.3) 
*	TK270802_E14_cyto_2D_step05.3812.3812.2	2.1705	0.187	1963.01	1	5000.0%	4	K.QICLVMLETLSQSPQGR.V
*	TK270802_E14_cyto_2D_step01.2655.2655.1	2.0355	0.2482	1444.99	1	4620.0%	2	R.LVVPATQCGSLIGK.G
*	TK270802_E14_cyto_2D_step12.3983.3983.3	2.4885	0.4586	3383.18	1	2080.0%	2	K.AFAMIIDKLEEDINSSMTNSTAASRPPVTLR.L
*	TK270802_E14_cyto_2D_step09.3048.3048.2	1.7981	0.3611	2608.75	1	4170.0%	1	R.QQSHFAMMHGGTGFAGIDSSSPEVK.G
URL15_MOUSE99.6%133334.1%2142466811.1(Q9CZM2) 60S ribosomal protein L15 
	TK270802_E14_cyto_2D_step08.2612.2612.1	2.5395	0.4123	1565.83	1	5000.0%	2	R.NPDTQWITKPVHK.H
	TK270802_E14_cyto_2D_step13.2084.2084.2	2.5863	0.4133	1708.43	1	5000.0%	4	K.GATYGKPVHHGVNQLK.F
	TK270802_E14_cyto_2D_step07.1620.1620.1	1.2979	0.0518	714.05	8	7000.0%	3	R.HCGALR.V
	TK270802_E14_cyto_2D_step13.2448.2448.2	2.4505	0.3932	1721.37	1	5380.0%	1	R.RNPDTQWITKPVHK.H
*	TK270802_E14_cyto_2D_step02.4430.4430.2	1.0007	0.1579	3169.86	2	1330.0%	1	K.GHKFHHTIGVPAVQPGEGAILSSSTVTANTR.D
	TK270802_E14_cyto_2D_step13.0464.0464.1	0.9662	0.21	725.17	2	4000.0%	1	R.KRPVPK.G
UQ921J099.6%101616.3%564643865.9(Q921J0) Similar to exportin 1 (CRM1, yeast, homolog) (Expressed sequence AA420417) 
	TK270802_E14_cyto_2D_step03.3750.3750.1	1.402	0.1086	1544.96	14	3080.0%	1	R.EPEVLSTMAIIVNK.L
	TK270802_E14_cyto_2D_step01.3551.3551.1	1.3444	0.0452	1273.08	2	5560.0%	1	R.IYLDMLNVYK.C
	TK270802_E14_cyto_2D_step04.2742.2742.1	2.7156	0.3255	1343.2	1	6360.0%	2	K.SAFPHLQDAQVK.L
	TK270802_E14_cyto_2D_step02.3439.3439.2	1.1774	0.0025	2034.63	26	2500.0%	1	K.CLSENISAAIQANGEMVTK.Q
	TK270802_E14_cyto_2D_step10.3146.3146.2	2.233	0.4511	1296.15	2	5450.0%	2	K.AVGHPFVIQLGR.I
	TK270802_E14_cyto_2D_step15.4960.4960.2	0.9391	0.0155	2846.68	8	1670.0%	1	R.SNDPQMVAENFVPPLLDAVLIDYQR.N
UCOF1_MOUSE99.6%103571566.9%166185608.1(P18760) Cofilin, non-muscle isoform 
	TK270802_E14_cyto_2D_step03.2280.2280.2	4.113	0.5482	1523.32	1	9090.0%	1	K.HELQANCYEEVK.D
	TK270802_E14_cyto_2D_step01.2308.2308.1	2.6129	0.2601	918.11	1	7140.0%	3	K.NIILEEGK.E
	TK270802_E14_cyto_2D_step03.3275.3275.2	0.9503	0.2658	1310.49	4	3500.0%	1	K.AVLFCLSEDKK.N
	TK270802_E14_cyto_2D_step01.0202.0202.1	1.343	0.2311	1182.2	1	5560.0%	1	K.AVLFCLSEDK.K
	TK270802_E14_cyto_2D_step01.1544.1544.1	1.4625	0.0421	604.82	6	7500.0%	1	K.MLPDK.D
*	TK270802_E14_cyto_2D_step10.4056.4056.2	5.1347	0.5893	2021.25	1	6250.0%	75	K.KEDLVFIFWAPENAPLK.S
	TK270802_E14_cyto_2D_step01.3292.3292.1	1.1372	0.1591	1344.14	1	3080.0%	7	K.LGGSAVISLEGKPL.-
	TK270802_E14_cyto_2D_step07.2102.2102.1	1.6147	0.2046	661.7	4	7000.0%	3	K.KLTGIK.H
*	TK270802_E14_cyto_2D_step01.3462.3462.2	4.1265	0.4155	2199.43	1	5530.0%	2	K.EILVGDVGQTVDDPYTTFVK.M
	TK270802_E14_cyto_2D_step04.2434.2434.1	2.66	0.385	1045.93	1	6880.0%	2	K.KNIILEEGK.E
	TK270802_E14_cyto_2D_step01.1778.1778.1	1.1908	0.1117	800.98	2	6670.0%	1	K.MIYASSK.D
	TK270802_E14_cyto_2D_step01.2408.2408.1	1.6111	0.2804	1339.01	1	6000.0%	2	R.YALYDATYETK.E
UPSE1_MOUSE99.6%2212.4%249286736.0(P97371) Proteasome activator complex subunit 1 (Proteasome activator 28-alpha subunit) (PA28alpha) (PA28a) (Activator of multicatalytic protease subunit 1) (11S regulator complex alpha subunit) (REG-alpha) 
*	TK270802_E14_cyto_2D_step08.3513.3513.2	0.8072	0.0095	2267.76	63	1110.0%	1	K.DVTEQLNLVTTWLQLQIPR.I
	TK270802_E14_cyto_2D_step01.3080.3080.1	1.8622	0.4495	1261.96	1	5000.0%	1	K.APLDIPVPDPVK.E
UO0897299.6%113.3%244253686.1(O08972) Hypothetical 25.4 kDa protein 
	TK270802_E14_cyto_2D_step04.2025.2025.1	1.6907	0.4835	796.92	1	6430.0%	1	R.EHGVLGGK.L
UQ9CVB699.6%82612.4%170199138.4(Q9CVB6) 2210023N03Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step12.2357.2357.2	1.2385	0.1766	1453.57	1	4580.0%	3	R.ASHTAPQVLFSHR.E
	TK270802_E14_cyto_2D_step07.2650.2650.1	1.9411	0.296	1089.0	1	6430.0%	1	R.DYLHYHIK.C
UQ923D299.6%118.3%206221977.0(Q923D2) Similar to biliverdin reductase B (Flavin reductase (NADPH)) (Hypothetical 22.2 kDa protein) 
*	TK270802_E14_cyto_2D_step05.2629.2629.2	3.183	0.5889	1758.86	1	5620.0%	1	R.LPSEGPQPAHVVVGDVR.Q
UQ9DCC499.6%246.9%274286947.3(Q9DCC4) 1110058B13Rik protein 
	TK270802_E14_cyto_2D_step07.3269.3269.2	2.9497	0.5927	2004.56	1	5000.0%	2	R.TDVLTPAGTTIHGLHALER.G
UIF41_HUMAN99.6%235137.9%406461545.5(P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (P04765) Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) 
	TK270802_E14_cyto_2D_step06.2566.2566.1	1.0139	0.0551	935.0	7	6670.0%	2	K.FMRDPIR.I
	TK270802_E14_cyto_2D_step03.2988.2988.1	1.6222	0.2332	1187.93	1	5560.0%	1	K.KEELTLEGIR.Q
	TK270802_E14_cyto_2D_step10.4163.4163.3	5.564	0.5854	4172.36	1	2570.0%	2	R.SRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLR.G
	TK270802_E14_cyto_2D_step05.2982.2982.2	3.3472	0.6488	1829.91	1	6670.0%	2	R.GIYAYGFEKPSAIQQR.A
	TK270802_E14_cyto_2D_step04.2826.2826.1	1.5241	0.0331	1021.04	5	5000.0%	2	R.KVDWLTEK.M
	TK270802_E14_cyto_2D_step03.1960.1960.1	1.7018	0.0815	833.72	2	7000.0%	1	R.ENYIHR.I
	TK270802_E14_cyto_2D_step01.1790.1790.1	1.4441	0.0611	958.31	2	6430.0%	1	R.ELAQQIQK.V
	TK270802_E14_cyto_2D_step01.2363.2363.1	1.5493	0.0799	1143.21	2	6000.0%	4	K.ATQALVLAPTR.E
	TK270802_E14_cyto_2D_step05.3119.3119.2	4.1519	0.5363	1622.67	1	7500.0%	2	K.LQMEAPHIIVGTPGR.V
	TK270802_E14_cyto_2D_step01.3854.3854.1	2.0813	0.3885	1558.9	1	5830.0%	2	K.MFVLDEADEMLSR.G
	TK270802_E14_cyto_2D_step01.2864.2864.1	2.8019	0.3925	1171.94	1	7500.0%	2	K.DQIYDIFQK.L
	TK270802_E14_cyto_2D_step01.2440.2440.1	2.7183	0.4247	1583.62	1	5380.0%	2	R.DFTVSAMHGDMDQK.E
UTERA_MOUSE99.6%266417.4%806893085.3(Q01853) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)-ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin] 
	TK270802_E14_cyto_2D_step01.2735.2735.1	1.5874	0.2766	1541.97	1	4620.0%	1	R.LGDVISIQPCPDVK.Y
	TK270802_E14_cyto_2D_step05.1747.1747.3	1.9788	0.1657	1803.51	1	3210.0%	2	R.LDQLIYIPLPDEKSR.V
	TK270802_E14_cyto_2D_step04.3134.3134.1	1.2861	0.0295	1097.63	1	5620.0%	4	R.LEILQIHTK.N
	TK270802_E14_cyto_2D_step01.2768.2768.1	1.6333	0.3092	1253.46	1	4090.0%	1	K.GVLFYGPPGCGK.T
	TK270802_E14_cyto_2D_step06.3073.3073.1	1.6143	0.0959	948.66	4	6430.0%	2	R.KGDIFLVR.G
	TK270802_E14_cyto_2D_step01.3638.3638.1	2.0528	0.2872	1557.14	1	6250.0%	1	R.LDQLIYIPLPDEK.S
	TK270802_E14_cyto_2D_step09.2513.2513.1	1.474	0.2202	714.65	3	7000.0%	4	R.HPALFK.A
	TK270802_E14_cyto_2D_step01.3120.3120.1	1.9317	0.1945	1052.18	1	6250.0%	2	K.DVDLEFLAK.M
	TK270802_E14_cyto_2D_step08.2118.2118.1	1.7517	0.1136	839.16	3	5710.0%	3	K.AIGVKPPR.G
	TK270802_E14_cyto_2D_step04.2985.2985.2	3.6985	0.5617	1632.52	1	8330.0%	2	R.KYEMFAQTLQQSR.G
	TK270802_E14_cyto_2D_step13.3756.3756.3	1.8468	0.086	2520.9	17	2160.0%	1	K.NVFIIGATNRPDIIDPAILRPGR.L
	TK270802_E14_cyto_2D_step01.4456.4456.1	2.1158	0.1722	1434.05	1	5000.0%	1	R.IVSQLLTLMDGLK.Q
	TK270802_E14_cyto_2D_step01.1758.1758.1	1.3751	0.2476	1076.13	4	5000.0%	1	K.LAGESESNLR.K
URL21_MOUSE99.6%104621.4%1591843110.5(O09167) 60S ribosomal protein L21 
*	TK270802_E14_cyto_2D_step06.3051.3051.2	4.9179	0.5951	1657.97	1	8210.0%	6	R.VYNVTQHAVGIIVNK.Q
	TK270802_E14_cyto_2D_step03.2470.2470.1	2.1242	0.1156	889.56	2	5710.0%	3	K.KGDIVDIK.G
	TK270802_E14_cyto_2D_step07.3112.3112.1	1.4939	0.2961	1243.99	1	5000.0%	1	K.HGVVPLATYMR.I
UPIMT_MOUSE99.6%226.2%226245037.6(P23506) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) 
	TK270802_E14_cyto_2D_step08.2602.2602.2	3.6917	0.5669	1480.74	1	6540.0%	1	K.SGGASHSELIHNLR.K
UA2HS_MOUSE99.6%104229.9%345373266.5(P29699) Alpha-2-HS-glycoprotein precursor (Fetuin-A) (Countertrypin) 
*	TK270802_E14_cyto_2D_step06.2131.2131.2	1.9598	0.4639	1973.9	1	4060.0%	1	R.VMHTQCHSTPDSAEDVR.K
*	TK270802_E14_cyto_2D_step09.3639.3639.3	1.3216	0.1292	4026.64	2	1120.0%	1	K.LFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPR.G
*	TK270802_E14_cyto_2D_step04.4464.4464.2	4.3578	0.7095	2548.83	1	4780.0%	6	R.AQNVPLPVSTLVEFVIAATDCTAK.E
*	TK270802_E14_cyto_2D_step07.3149.3149.2	2.9535	0.4814	2140.84	1	4750.0%	2	R.HAFSPVASVESASGETLHSPK.V
UPRSA_MOUSE99.6%61010.0%442494935.2(O88685) 26S protease regulatory subunit 6A (TAT-binding protein 1) (TBP-1) 
	TK270802_E14_cyto_2D_step04.3058.3058.1	1.2411	0.1113	1462.16	1	4550.0%	1	R.KIEFPMPNEEAR.A
	TK270802_E14_cyto_2D_step05.4123.4123.2	3.6925	0.5667	1864.55	1	6330.0%	2	K.QIQELVEAIVLPMNHK.E
	TK270802_E14_cyto_2D_step04.2192.2192.1	2.5194	0.4225	1058.51	1	6880.0%	2	R.VTHELQAMK.D
	TK270802_E14_cyto_2D_step13.1252.1252.1	0.8722	0.0192	748.73	35	5000.0%	1	R.ACAAQTK.A
UPDX5_MOUSE99.6%2214.3%210218978.9(P99029) Peroxiredoxin 5, mitochondrial precursor (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) 
*	TK270802_E14_cyto_2D_step12.2087.2087.3	0.8128	0.1062	3044.53	1	690.0%	1	K.GVLFGVPGAFTPGCSKTHLPGFVEQAGALK.A
	TK270802_E14_cyto_2D_step06.3145.3145.1	1.8919	0.4291	1468.9	1	4620.0%	1	K.THLPGFVEQAGALK.A
URB5B_HUMAN99.6%244.7%215237078.1(P35239) Ras-related protein Rab-5B (P35239) Ras-related protein Rab-5B 
	TK270802_E14_cyto_2D_step07.2908.2908.1	2.3802	0.4228	1302.92	1	6670.0%	2	R.YHSLAPMYYR.G
UQ922P199.6%3923.3%116129094.1(Q922P1) RIKEN cDNA 2010012F05 gene 
	TK270802_E14_cyto_2D_step08.3665.3665.2	2.4064	0.6063	2772.08	1	2690.0%	3	K.NLLEISGPETVPLPNVPSVALPSKPAK.K
UCOPP_MOUSE99.6%579.0%9051024495.3(O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) 
	TK270802_E14_cyto_2D_step11.4125.4125.3	1.4591	0.3117	3373.11	1	1330.0%	1	K.VLAAQETHEGVTEDGIEDAFEVLGEIQEIVK.T
	TK270802_E14_cyto_2D_step05.3809.3809.3	3.3692	0.5856	3827.24	1	2210.0%	2	K.TCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVR.I
	TK270802_E14_cyto_2D_step07.2281.2281.1	1.3605	0.2033	1049.85	1	6430.0%	1	R.IWHSSTYR.L
	TK270802_E14_cyto_2D_step03.2146.2146.1	1.2178	0.0859	967.13	3	5830.0%	1	K.IWDYQNK.T
UHP28_HUMAN99.6%229.4%181206308.9(Q13442) 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) 
*	TK270802_E14_cyto_2D_step04.2484.2484.1	2.7023	0.3777	1214.8	1	6500.0%	1	K.KVTQLDLDGPK.E
*	TK270802_E14_cyto_2D_step07.1958.1958.1	1.3071	0.1823	657.38	1	7000.0%	1	K.MHLAGK.T
UQ91WK299.6%5711.4%352398326.7(Q91WK2) Similar to eukaryotic translation initiation factor 3, subunit 3 (Gamma, 40kD) 
	TK270802_E14_cyto_2D_step11.2925.2925.2	2.4717	0.5326	2079.75	1	4210.0%	2	K.SAVADKHELLSLASSNHLGK.S
	TK270802_E14_cyto_2D_step01.0180.0180.1	1.2625	0.0345	1163.98	53	3890.0%	1	K.EKDFSPEALK.K
*	TK270802_E14_cyto_2D_step13.2081.2081.2	2.0678	0.3963	1167.0	1	7220.0%	1	K.LFKPHQAPAR.M
	TK270802_E14_cyto_2D_step08.2975.2975.1	2.1877	0.44	1505.74	1	5000.0%	1	K.HELLSLASSNHLGK.S
UMPK2_MOUSE99.6%2211.0%401444367.0(Q63932) Dual specificity mitogen-activated protein kinase kinase 2 (EC 2.7.1.-) (MAP kinase kinase 2) (MAPKK 2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK2) 
*	TK270802_E14_cyto_2D_step02.3274.3274.1	0.8475	0.0131	1089.7	29	4380.0%	1	K.LLMNHAFIK.R
	TK270802_E14_cyto_2D_step13.3484.3484.3	4.2794	0.5564	3618.26	1	2720.0%	1	R.RKPVLPALTINPTIAEGPSPTSEGASEANLVDLQK.K
URL24_HUMAN99.6%61416.6%1571777911.3(P38663) 60S ribosomal protein L24 (L30) (P38663) 60S ribosomal protein L24 (L30) 
	TK270802_E14_cyto_2D_step07.1852.1852.1	1.473	0.0031	684.3	2	8000.0%	1	K.IVKPVK.V
	TK270802_E14_cyto_2D_step07.1781.1781.1	1.0654	0.0041	801.93	5	5830.0%	2	K.IYPGHGR.R
	TK270802_E14_cyto_2D_step01.2714.2714.1	1.19	0.1306	1264.16	16	2500.0%	3	R.AITGASLADIMAK.R
US24B_HUMAN99.6%111.2%12681377896.7(O95487) Protein transport protein Sec24B (SEC24-related protein B) 
*	TK270802_E14_cyto_2D_step04.3329.3329.1	2.1053	0.5853	1541.97	1	5360.0%	1	R.ETHSALGPALQAAFK.L
URFA2_MOUSE99.6%4612.6%270297186.1(Q62193) Replication protein A 32 kDa subunit (RP-A) (RF-A) (Replication factor-A protein 2) 
*	TK270802_E14_cyto_2D_step12.2841.2841.3	1.3696	0.2004	2610.0	16	1310.0%	1	K.QAVDFLCNEGHIYSTVDDDHFK.S
*	TK270802_E14_cyto_2D_step07.2818.2818.2	3.9505	0.5191	1366.93	1	7730.0%	1	R.SQLQHMPVPSIK.Q
UK2C1_HUMAN99.6%133713.7%643658868.1(P04264) Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protein) 
*	TK270802_E14_cyto_2D_step07.4258.4258.2	1.3477	0.1356	1997.5	2	3330.0%	5	R.THNLEPYFESFINNLR.R
*	TK270802_E14_cyto_2D_step02.3300.3300.1	0.8256	0.0352	1217.67	102	2500.0%	1	R.FVSTTYSGVTR.-
*	TK270802_E14_cyto_2D_step01.3192.3192.1	1.4323	0.0824	1386.17	12	4090.0%	2	K.SLNNQFASFIDK.V
*	TK270802_E14_cyto_2D_step03.2135.2135.1	2.9045	0.4589	1342.82	1	5910.0%	2	K.SKAEAESLYQSK.Y
*	TK270802_E14_cyto_2D_step01.1642.1642.2	2.9345	0.7003	2385.14	1	3330.0%	1	R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G
*	TK270802_E14_cyto_2D_step01.1506.1506.1	1.5958	0.0918	673.85	3	7000.0%	1	K.VDLQAK.L
UMIF_MOUSE99.6%61223.7%114123737.3(P34884) Macrophage migration inhibitory factor (MIF) (Phenylpyruvate tautomerase) (Delayed early response protein 6) (DER6) (Glycosylation-inhibiting factor) 
	TK270802_E14_cyto_2D_step03.3214.3214.2	3.3812	0.3462	1289.53	1	8000.0%	1	-.PMFIVNTNVPR.A
*	TK270802_E14_cyto_2D_step01.3114.3114.1	1.154	0.0481	1047.3	84	4380.0%	1	K.LLCGLLSDR.L
*	TK270802_E14_cyto_2D_step05.2193.2193.1	1.449	0.0669	840.46	2	6670.0%	3	R.LHISPDR.V
UEF2_MOUSE99.6%9749347.3%857951836.8(P58252) Elongation factor 2 (EF-2) 
	TK270802_E14_cyto_2D_step01.3216.3216.1	1.577	0.3294	1310.66	1	4550.0%	2	K.DSVVAGFQWATK.E
	TK270802_E14_cyto_2D_step01.0099.0099.1	1.0014	0.1644	1123.9	1	5560.0%	1	K.STLTDSLVCK.A
	TK270802_E14_cyto_2D_step07.2781.2781.2	2.4951	0.5888	1618.7	1	5380.0%	5	K.TGTITTFEHAHNMR.V
	TK270802_E14_cyto_2D_step07.2512.2512.2	2.6521	0.3873	1310.46	1	6820.0%	3	R.NMSVIAHVDHGK.S
	TK270802_E14_cyto_2D_step01.2079.2079.1	1.3513	0.14	971.4	2	5560.0%	1	R.GGGQIIPTAR.R
	TK270802_E14_cyto_2D_step08.2798.2798.1	1.5798	0.0561	1075.99	37	5000.0%	4	R.IKPVLMMNK.M
	TK270802_E14_cyto_2D_step03.2580.2580.1	2.5088	0.3431	1569.7	1	5000.0%	2	K.DLEEDHACIPIKK.S
	TK270802_E14_cyto_2D_step12.2843.2843.2	1.5029	0.1982	2119.33	16	2500.0%	1	K.RGHVFEESQVAGTPMFVVK.A
	TK270802_E14_cyto_2D_step03.2218.2218.1	2.2707	0.0937	883.15	1	6670.0%	2	K.KVEDMMK.K
	TK270802_E14_cyto_2D_step01.2008.2008.1	0.809	0.0281	1030.67	1	4380.0%	1	K.DKEGKPLLK.A
	TK270802_E14_cyto_2D_step13.0522.0522.1	0.2806	0.0015	445.54	4	1670.0%	2	K.SPNK.H
*	TK270802_E14_cyto_2D_step01.2575.2575.1	2.2231	0.1907	1095.45	1	5500.0%	2	R.VFSGVVSTGLK.V
	TK270802_E14_cyto_2D_step02.4966.4966.2	1.3927	0.1599	2992.32	1	2000.0%	1	R.LMEPIYLVEIQCPEQVVGGIYGVLNR.K
	TK270802_E14_cyto_2D_step04.3513.3513.2	3.7046	0.5959	1964.55	1	6180.0%	3	R.GHVFEESQVAGTPMFVVK.A
	TK270802_E14_cyto_2D_step09.1750.1750.1	0.8987	0.0146	514.16	2	6670.0%	2	K.KLPR.T
	TK270802_E14_cyto_2D_step06.4418.4418.2	3.2194	0.3825	2604.52	1	3480.0%	3	R.WLPAGDALLQMITIHLPSPVTAQK.Y
	TK270802_E14_cyto_2D_step05.5145.5145.3	1.2352	0.059	4248.91	3	1280.0%	10	R.SNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETR.K
	TK270802_E14_cyto_2D_step02.2972.2972.1	1.0721	0.0965	822.09	66	5000.0%	1	R.TILMMGR.Y
	TK270802_E14_cyto_2D_step06.2239.2239.1	2.0053	0.2392	1207.86	5	5000.0%	3	R.IMGPNYTPGKK.E
	TK270802_E14_cyto_2D_step06.2473.2473.1	1.2665	0.1134	775.85	9	7000.0%	1	K.KLWGDR.Y
	TK270802_E14_cyto_2D_step01.4548.4548.1	1.4549	0.2078	1447.41	1	5000.0%	2	K.EGIPALDNFLDKL.-
	TK270802_E14_cyto_2D_step04.2120.2120.1	1.2711	0.1224	785.49	1	6670.0%	1	K.EGKPLLK.A
	TK270802_E14_cyto_2D_step07.4506.4506.2	1.0239	0.2313	2579.52	2	2390.0%	2	R.VTDGALVVVDCVSGVCVQTETVLR.Q
	TK270802_E14_cyto_2D_step05.3369.3369.2	2.2197	0.4798	2147.12	1	3160.0%	6	K.ARPFPDGLAEDIDKGEVSAR.Q
	TK270802_E14_cyto_2D_step02.4136.4136.2	0.9561	0.0947	2763.1	12	1460.0%	3	R.YVEPIEDVPCGNIVGLVGVDQFLVK.T
*	TK270802_E14_cyto_2D_step10.4469.4469.2	1.5186	0.2606	2821.55	2	2310.0%	5	K.DGSGFLINLIDSPGHVDFSSEVTAALR.V
	TK270802_E14_cyto_2D_step04.4397.4397.2	3.4727	0.5273	2207.05	1	4720.0%	7	K.STAISLFYELSENDLNFIK.Q
	TK270802_E14_cyto_2D_step01.1750.1750.1	1.4903	0.2293	755.92	2	7500.0%	2	K.NPADLPK.L
	TK270802_E14_cyto_2D_step01.2492.2492.1	1.2956	0.2578	1594.86	1	3460.0%	1	R.ETVSEESNVLCLSK.S
	TK270802_E14_cyto_2D_step06.2793.2793.1	2.0088	0.2557	1405.0	1	5000.0%	2	K.KEDLYLKPIQR.T
URS7_HUMAN99.6%71519.1%1942212710.1(P23821) 40S ribosomal protein S7 (S8) (P23821) 40S ribosomal protein S7 (S8) 
	TK270802_E14_cyto_2D_step08.2606.2606.1	1.5217	0.0941	971.04	1	6430.0%	2	K.HVVFIAQR.R
	TK270802_E14_cyto_2D_step02.4190.4190.2	3.2129	0.5554	2370.5	1	4290.0%	3	R.TLTAVHDAILEDLVFPSEIVGK.R
	TK270802_E14_cyto_2D_step07.0369.0369.1	0.5242	0.0363	670.66	1	5000.0%	1	K.RPRSR.T
	TK270802_E14_cyto_2D_step15.1733.1733.1	0.5763	0.0288	684.68	1	3750.0%	1	K.QKRPR.S
UHS7C_MOUSE99.6%121241937.5%646708715.5(P08109) Heat shock cognate 71 kDa protein 
	TK270802_E14_cyto_2D_step05.2853.2853.2	4.315	0.5606	1485.2	1	7690.0%	3	K.SQIHDIVLVGGSTR.I
	TK270802_E14_cyto_2D_step06.3267.3267.1	1.9314	0.0467	1238.87	1	5560.0%	7	R.MVNHFIAEFK.R
	TK270802_E14_cyto_2D_step01.3062.3062.1	1.3349	0.2366	1256.86	1	5560.0%	2	R.FEELNADLFR.G
	TK270802_E14_cyto_2D_step12.3145.3145.2	1.3297	0.1934	1655.65	5	3460.0%	2	K.HWPFMVVNDAGRPK.V
	TK270802_E14_cyto_2D_step01.2083.2083.1	1.5782	0.285	946.4	1	7140.0%	2	K.VCNPIITK.L
	TK270802_E14_cyto_2D_step14.4284.4284.2	1.1223	0.055	3001.95	1	1920.0%	21	R.TLSSSTQASIEIDSLYEGIDFYTSITR.A
	TK270802_E14_cyto_2D_step01.2086.2086.2	2.0012	0.3778	1693.25	1	4670.0%	1	K.STAGDTHLGGEDFDNR.M
	TK270802_E14_cyto_2D_step01.1738.1738.1	1.9176	0.1354	765.96	2	8000.0%	1	K.VQVEYK.G
	TK270802_E14_cyto_2D_step03.4536.4536.2	3.3276	0.4394	2518.82	1	3910.0%	40	R.GVPQIEVTFDIDANGILNVSAVDK.S
	TK270802_E14_cyto_2D_step08.3291.3291.2	4.9182	0.1256	2266.81	1	5240.0%	6	K.GPAVGIDLGTTYSCVGVFQHGK.V
	TK270802_E14_cyto_2D_step01.0171.0171.1	1.6473	0.3385	1303.92	1	6000.0%	1	K.NSLESYAFNMK.A
	TK270802_E14_cyto_2D_step04.1964.1964.2	2.7387	0.3852	1749.09	1	6540.0%	2	K.NQTAEKEEFEHQQK.E
	TK270802_E14_cyto_2D_step01.1858.1858.1	1.8124	0.3035	774.19	2	7500.0%	1	K.DNNLLGK.F
	TK270802_E14_cyto_2D_step01.2507.2507.1	1.3524	0.1789	1201.14	8	3640.0%	2	K.DAGTIAGLNVLR.I
	TK270802_E14_cyto_2D_step14.3588.3588.2	0.8982	0.0319	1953.21	41	2060.0%	1	K.DNNLLGKFELTGIPPAPR.G
	TK270802_E14_cyto_2D_step01.3232.3232.1	0.9514	0.0767	1084.36	1	6250.0%	3	K.LLQDFFNGK.E
	TK270802_E14_cyto_2D_step06.1826.1826.2	1.9445	0.1834	931.66	2	8570.0%	2	K.RNTTIPTK.Q
	TK270802_E14_cyto_2D_step01.0079.0079.1	1.9825	0.1859	993.92	2	6250.0%	2	K.EIAEAYLGK.T
*	TK270802_E14_cyto_2D_step01.3399.3399.1	2.1208	0.2546	1279.96	2	6670.0%	2	K.CNEIISWLDK.N
UO3549999.6%267230.8%773839544.4(O35499) Nuclear autoantigenic sperm protein 
*	TK270802_E14_cyto_2D_step12.3381.3381.2	0.9655	0.0342	2126.56	1	2940.0%	1	R.DEQMKEGEETEGSEEEDR.E
	TK270802_E14_cyto_2D_step09.4146.4146.3	3.9962	0.6017	3989.15	1	2200.0%	6	K.LGEVSVESENYIQAVEEFQACLSLQEQYLEAHDR.L
	TK270802_E14_cyto_2D_step10.3493.3493.2	0.9771	0.0534	3150.44	1	2410.0%	1	R.LLAETHYQLGLAYGYNSQYDEAVAQFGK.S
	TK270802_E14_cyto_2D_step04.4412.4412.2	1.3978	0.1142	2791.84	1	3480.0%	2	K.SLQENEEEEIGNLELAWDMLDLAK.I
	TK270802_E14_cyto_2D_step04.2444.2444.1	1.3249	0.2676	1087.21	1	5620.0%	2	R.MAVLHEQMK.E
	TK270802_E14_cyto_2D_step03.1289.1289.2	0.5578	0.0087	970.99	14	2140.0%	1	R.KPEEESPR.K
	TK270802_E14_cyto_2D_step03.2562.2562.1	3.0801	0.284	1344.9	1	6360.0%	3	K.EAQLYAAQAHLK.L
*	TK270802_E14_cyto_2D_step03.2171.2171.2	1.3744	0.1955	1978.67	1	3750.0%	1	K.SLTKPETDKEQESEVEK.G
	TK270802_E14_cyto_2D_step05.3017.3017.2	4.2405	0.5909	2146.0	1	5790.0%	1	R.KPTDGASSSNCVTDISHLVR.K
*	TK270802_E14_cyto_2D_step03.3618.3618.3	2.912	0.4664	4431.22	1	1860.0%	2	R.MENGVLGNALEGVHVEEEEGEKTEDESLVENNDNVDEEAR.E
	TK270802_E14_cyto_2D_step08.2618.2618.1	2.4237	0.3015	857.29	1	7140.0%	2	K.KLLGLGQK.H
	TK270802_E14_cyto_2D_step01.1558.1558.2	2.6896	0.4768	1819.39	1	4170.0%	2	K.AKQEPEVNGGSGDAVSSGK.E
	TK270802_E14_cyto_2D_step05.1519.1519.2	0.8463	0.028	1127.25	9	2500.0%	1	K.RKPEEESPR.K
UO0913299.6%61210.6%350401656.8(O09132) A6 gene product 
	TK270802_E14_cyto_2D_step07.3052.3052.1	2.7605	0.2839	1455.82	1	5830.0%	3	K.HQTLQGVAFPISR.D
	TK270802_E14_cyto_2D_step10.2150.2150.2	0.7511	0.0438	1922.66	12	2190.0%	1	K.DEVFGTVKEDVSLHGYK.K
	TK270802_E14_cyto_2D_step08.3387.3387.1	1.7612	0.3743	1018.0	1	7500.0%	1	R.YHFFLYK.H
UTPIS_MOUSE99.6%186233.5%248265817.3(P17751) Triosephosphate isomerase (EC 5.3.1.1) (TIM) 
	TK270802_E14_cyto_2D_step03.1672.1672.2	1.2382	0.1727	1468.6	1	4580.0%	4	K.TATPQQAQEVHEK.L
	TK270802_E14_cyto_2D_step01.1875.1875.1	1.2407	0.1013	1138.04	1	5000.0%	1	K.IAVAAQNCYK.V
*	TK270802_E14_cyto_2D_step02.3287.3287.2	1.2074	0.2961	1540.94	1	3850.0%	1	K.DLGATWVVLGHSER.R
	TK270802_E14_cyto_2D_step01.1615.1615.1	1.3454	0.2877	758.83	4	5830.0%	1	K.VIADNVK.D
	TK270802_E14_cyto_2D_step03.2904.2904.1	0.7531	0.0596	1459.94	10	2920.0%	2	R.HVFGESDELIGQK.V
	TK270802_E14_cyto_2D_step08.2836.2836.2	2.7612	0.288	1616.9	4	5770.0%	1	R.RHVFGESDELIGQK.V
	TK270802_E14_cyto_2D_step01.1952.1952.1	1.3727	0.0198	850.0	1	6670.0%	1	K.VVFEQTK.V
*	TK270802_E14_cyto_2D_step10.3557.3557.2	3.7742	0.6145	1827.66	1	6470.0%	6	K.VSHALAEGLGVIACIGEK.L
UPL10_MOUSE99.6%122214.5%660731417.2(P16381) Putative ATP-dependent RNA helicase PL10 
*	TK270802_E14_cyto_2D_step01.3683.3683.1	0.931	0.0647	1392.96	19	3640.0%	1	K.DSLILVFVETKK.G
	TK270802_E14_cyto_2D_step04.3564.3564.3	1.6804	0.1395	4166.25	53	1110.0%	1	K.YDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTR.Y
	TK270802_E14_cyto_2D_step07.2564.2564.1	2.1122	0.4445	1182.87	1	4500.0%	3	R.GCHLLVATPGR.L
	TK270802_E14_cyto_2D_step06.1895.1895.1	0.9884	0.0464	1091.81	172	4380.0%	2	R.YTRPTPVQK.H
	TK270802_E14_cyto_2D_step07.1744.1744.1	0.9685	0.0516	799.86	99	4290.0%	1	R.FSGGFGAR.D
	TK270802_E14_cyto_2D_step07.2630.2630.1	1.8245	0.0379	793.82	3	5830.0%	2	K.HAIPIIK.E
	TK270802_E14_cyto_2D_step01.4432.4432.1	1.0339	0.0929	1293.77	1	5000.0%	1	R.SFLLDLLNATGK.D
UQ8VEE999.6%338.3%504559565.2(Q8VEE9) Similar to proteasome (Prosome, macropain) 26S subunit, non-ATPase, 5 
*	TK270802_E14_cyto_2D_step06.3218.3218.1	1.8574	0.3359	1360.1	1	5000.0%	1	R.LLQAVEPIHLAR.N
*	TK270802_E14_cyto_2D_step11.2813.2813.2	1.3568	0.0227	1791.79	23	2860.0%	1	R.LMFNSPGFVEFVMDR.S
*	TK270802_E14_cyto_2D_step05.3365.3365.2	3.7364	0.4312	1661.64	1	6430.0%	1	R.ALQSVVQAVPLHELR.E
UTBBX_HUMAN99.6%160427457.2%444496714.9(P05218) Class I beta tubulin. Tubulin beta-5 chain (P05218) Class I beta tubulin. Tubulin beta-5 chain 
	TK270802_E14_cyto_2D_step12.3499.3499.2	5.8918	0.6611	1963.08	1	8530.0%	28	K.GHYTEGAELVDSVLDVVR.K
	TK270802_E14_cyto_2D_step02.3483.3483.2	1.4931	0.1062	1699.1	35	3080.0%	2	K.NSSYFVEWIPNNVK.T
	TK270802_E14_cyto_2D_step05.3731.3731.3	2.9435	0.4613	3442.11	1	2190.0%	1	R.KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK.I
	TK270802_E14_cyto_2D_step01.2800.2800.1	1.7227	0.4063	1322.94	1	4090.0%	1	R.IMNTFSVVPSPK.V
	TK270802_E14_cyto_2D_step12.4384.4384.2	2.5901	0.3999	1622.36	1	5770.0%	1	R.LHFFMPGFAPLTSR.G
	TK270802_E14_cyto_2D_step03.3582.3582.2	2.017	0.3584	1041.87	1	6880.0%	1	R.YLTVAAVFR.G
	TK270802_E14_cyto_2D_step10.3941.3941.2	4.5108	0.3617	1873.74	1	6880.0%	16	K.MAVTFIGNSTAIQELFK.R
	TK270802_E14_cyto_2D_step03.2515.2515.2	3.1067	0.5597	1825.9	1	5310.0%	3	R.EIVHIQAGQCGNQIGAK.F
	TK270802_E14_cyto_2D_step06.4005.4005.2	3.4318	0.515	2802.95	1	4000.0%	35	R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G
	TK270802_E14_cyto_2D_step03.1983.1983.2	2.4658	0.2475	1080.44	1	7860.0%	6	K.IREEYPDR.I
	TK270802_E14_cyto_2D_step03.4315.4315.2	1.3606	0.3457	2712.65	1	2710.0%	16	K.LTTPTYGDLNHLVSATMSGVTTCLR.F
	TK270802_E14_cyto_2D_step01.3206.3206.1	1.5106	0.2205	1231.15	2	5000.0%	1	R.ISEQFTAMFR.R
	TK270802_E14_cyto_2D_step01.2182.2182.1	1.9885	0.2861	1304.95	1	4550.0%	2	R.ISVYYNEATGGK.Y
	TK270802_E14_cyto_2D_step08.4425.4425.3	4.6714	0.6549	4598.57	1	2370.0%	41	K.VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFR.T
UMCM7_MOUSE99.6%163417.5%719812116.4(Q61881) DNA replication licensing factor MCM7 (CDC47 homolog) 
*	TK270802_E14_cyto_2D_step04.2142.2142.1	1.8744	0.277	1192.01	1	5560.0%	2	R.SVHFSEAEQR.C
*	TK270802_E14_cyto_2D_step11.2593.2593.2	2.754	0.4243	1297.21	1	7000.0%	4	K.YGTQLVHLAHR.E
*	TK270802_E14_cyto_2D_step05.3127.3127.1	1.4842	0.358	1581.86	3	3570.0%	1	R.GNIHICLMGDPGVAK.S
*	TK270802_E14_cyto_2D_step05.3495.3495.2	2.8357	0.41	1489.89	1	7920.0%	1	R.TQRPADVIFATIR.E
*	TK270802_E14_cyto_2D_step09.2874.2874.1	0.9839	0.0333	1405.8	1	3640.0%	1	R.GRSVHFSEAEQR.C
*	TK270802_E14_cyto_2D_step03.2523.2523.2	3.1428	0.5669	1690.58	1	6430.0%	1	K.IQEHSDQVPVGNIPR.S
	TK270802_E14_cyto_2D_step03.3668.3668.1	1.0624	0.0562	801.66	1	7500.0%	2	R.TLLAILR.L
*	TK270802_E14_cyto_2D_step05.4120.4120.2	1.4087	0.3634	2022.94	1	3890.0%	2	R.IAQPGDHVSVTGIFLPVLR.T
	TK270802_E14_cyto_2D_step09.2804.2804.2	1.5827	0.2048	1798.93	4	3670.0%	1	R.TAIHEVMEQQTISIAK.A
*	TK270802_E14_cyto_2D_step04.4280.4280.2	2.5338	0.5627	1842.36	1	3820.0%	1	K.ALLLLLVGGVDQSPQGMK.I
UQ9DAR799.6%4612.7%338389886.5(Q9DAR7) 1700001E16Rik protein (RIKEN cDNA 1700001E16 gene) 
*	TK270802_E14_cyto_2D_step05.3941.3941.2	2.0728	0.4406	2097.35	1	4720.0%	1	K.TPFQVEHVAQLLTGSPELK.L
	TK270802_E14_cyto_2D_step08.2858.2858.1	1.6101	0.1637	829.05	3	6670.0%	2	K.IIFLHGK.V
	TK270802_E14_cyto_2D_step07.3890.3890.2	2.3864	0.5561	2188.99	1	4380.0%	1	K.WNQQQLDDLYLIAICHR.R
UO0030199.6%101417.7%711731617.3(O00301) KSRP 
*	TK270802_E14_cyto_2D_step01.1779.1779.2	2.5639	0.3872	1983.14	1	4710.0%	1	K.IGQQPQQPGAPPQQDYTK.A
*	TK270802_E14_cyto_2D_step07.1976.1976.2	2.8063	0.5602	2109.96	1	5000.0%	1	K.KIGQQPQQPGAPPQQDYTK.A
*	TK270802_E14_cyto_2D_step01.3187.3187.1	1.3441	0.1708	1535.34	94	3080.0%	1	K.AINQQTGAFVEISR.Q
*	TK270802_E14_cyto_2D_step06.2446.2446.1	2.0578	0.2915	923.95	1	6880.0%	2	R.HSVGVVIGR.S
*	TK270802_E14_cyto_2D_step06.5103.5103.1	0.9037	0.0917	1404.83	111	2270.0%	1	K.RQLEDGDQPESK.K
*	TK270802_E14_cyto_2D_step03.1337.1337.2	0.7849	4.0E-4	1136.32	30	2220.0%	1	R.ERDQGGFGDR.N
*	TK270802_E14_cyto_2D_step11.3458.3458.2	0.8297	0.0572	2636.5	4	1920.0%	1	R.IINDLLQSLRSGPPGPPGGPGMPPGGR.G
*	TK270802_E14_cyto_2D_step14.3738.3738.3	1.1137	0.0795	3431.2	2	1540.0%	2	R.GGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGK.G
UCSE1_MOUSE99.6%9135.4%9711104555.8(Q9ERK4) Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) 
	TK270802_E14_cyto_2D_step01.3236.3236.1	0.8662	0.0697	1468.52	14	2920.0%	1	K.EHDPVGQMVNNPK.I
	TK270802_E14_cyto_2D_step13.2329.2329.1	1.6834	0.2261	1048.81	1	6880.0%	2	K.IHLAQSLHK.L
	TK270802_E14_cyto_2D_step06.2582.2582.1	1.5521	0.0906	803.78	3	6670.0%	1	R.TAHSLFK.R
	TK270802_E14_cyto_2D_step06.2366.2366.1	1.6222	0.1298	989.92	1	6250.0%	1	K.KICAVGITK.L
	TK270802_E14_cyto_2D_step04.3402.3402.2	3.3371	0.4554	1591.23	1	6540.0%	1	R.FQSGDFHVINGVLR.T
ULAS1_MOUSE99.6%71331.9%263299947.0(Q61792) LIM and SH3 domain protein 1 (LASP-1) (MLN 50) 
	TK270802_E14_cyto_2D_step04.5260.5260.3	0.9951	0.0533	4623.13	27	900.0%	1	R.YRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVER.T
	TK270802_E14_cyto_2D_step01.1983.1983.1	1.6751	0.4008	1068.12	1	5560.0%	1	K.EPAAPVSIQR.S
	TK270802_E14_cyto_2D_step03.2067.2067.1	2.2144	0.1027	1176.93	5	6110.0%	1	K.KTQDQISNIK.Y
	TK270802_E14_cyto_2D_step01.3339.3339.1	1.5599	0.288	1552.71	1	3570.0%	1	R.TGDTGMLPANYVEAI.-
	TK270802_E14_cyto_2D_step04.1782.1782.1	1.8182	0.2617	1214.65	2	5000.0%	3	K.ACFHCETCK.M
UHBB2_MOUSE99.6%7945.9%146157478.1(P02089) Hemoglobin beta-2 chain (B2) (Minor) 
*	TK270802_E14_cyto_2D_step05.2837.2837.1	2.7916	0.2859	1222.11	1	6000.0%	1	K.KVITAFNEGLK.N
*	TK270802_E14_cyto_2D_step13.4929.4929.2	0.8294	0.0426	2930.73	131	1480.0%	1	R.LLGNAIVIVLGHHLGKDFTPAAQAAFQK.V
*	TK270802_E14_cyto_2D_step01.0131.0131.1	1.1896	0.2012	1021.96	2	5620.0%	1	K.SAVSCLWAK.V
*	TK270802_E14_cyto_2D_step01.2150.2150.1	1.4626	0.0612	1312.89	5	4170.0%	1	K.VNPDEVGGEALGR.L
	TK270802_E14_cyto_2D_step01.1918.1918.1	1.5583	0.0482	718.73	27	6000.0%	2	K.NLDNLK.G
*	TK270802_E14_cyto_2D_step01.0116.0116.1	1.4578	0.2728	1092.1	1	5000.0%	1	K.VITAFNEGLK.N
URIR1_MOUSE99.6%142019.9%792902196.9(P07742) Ribonucleoside-diphosphate reductase M1 chain (EC 1.17.4.1) (Ribonucleotide reductase large chain) 
	TK270802_E14_cyto_2D_step07.2168.2168.1	0.9128	0.0040	627.98	1	6250.0%	1	-.MHVIK.R
*	TK270802_E14_cyto_2D_step06.3361.3361.2	1.6461	0.1852	1802.76	3	4060.0%	1	R.HSPMVASSTLDIVMANK.D
	TK270802_E14_cyto_2D_step10.2958.2958.2	2.5183	0.3431	1572.98	1	4620.0%	3	R.TRPAANPIQFTLNK.E
*	TK270802_E14_cyto_2D_step12.3432.3432.3	1.381	0.0525	3132.52	37	1440.0%	1	K.DEVAVCNLASLALNMYVTPEHTYDFEK.L
	TK270802_E14_cyto_2D_step05.3605.3605.2	3.5711	0.5322	1696.77	1	6430.0%	1	R.VLSGEFQIVNPHLLK.D
	TK270802_E14_cyto_2D_step12.2981.2981.3	1.8161	0.3774	3322.46	2	1440.0%	1	K.SAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLR.V
	TK270802_E14_cyto_2D_step05.2785.2785.1	1.3005	0.2278	1126.88	1	6110.0%	1	K.HPDYAILAAR.I
	TK270802_E14_cyto_2D_step01.3106.3106.1	1.0035	0.2513	1369.84	7	2730.0%	1	K.DDSIEGIYDTLK.Q
	TK270802_E14_cyto_2D_step05.2041.2041.1	1.0147	0.112	739.81	1	7500.0%	1	R.VSVGIHK.E
	TK270802_E14_cyto_2D_step07.3305.3305.1	1.9137	0.4144	1270.62	1	5560.0%	1	K.LTSMHFYGWK.Q
	TK270802_E14_cyto_2D_step09.3074.3074.2	0.9153	0.0414	2167.87	10	2500.0%	1	K.DDSIEGIYDTLKQCALISK.S
UWDR1_HUMAN99.6%5910.7%606661946.7(O75083) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) (NORI-1) 
*	TK270802_E14_cyto_2D_step01.3240.3240.1	0.7686	0.0214	1110.98	12	3330.0%	2	R.LYSILGTTLK.D
*	TK270802_E14_cyto_2D_step04.3320.3320.2	3.3402	0.5041	2420.89	1	4050.0%	2	R.NIDNPALADIYTEHAHQVVVAK.Y
*	TK270802_E14_cyto_2D_step02.3151.3151.3	0.8775	0.1062	3357.98	2	780.0%	1	K.VCALGGSKAHDGGIYAISWSPDSTHLLSASGDK.T
UTCPB_MOUSE99.6%276929.3%535574476.4(P80314) T-complex protein 1, beta subunit (TCP-1-beta) (CCT-beta) 
	TK270802_E14_cyto_2D_step06.3899.3899.1	1.3813	0.1978	1557.06	1	3850.0%	6	R.SLHDALCVLAQTVK.D
	TK270802_E14_cyto_2D_step02.2992.2992.2	0.8586	0.0857	2286.84	8	2380.0%	1	R.VQDDEVGDGTTSVTVLAAELLR.E
	TK270802_E14_cyto_2D_step04.2785.2785.1	1.7455	0.3573	1238.65	2	4550.0%	1	K.GSGNLEAIHVIK.K
	TK270802_E14_cyto_2D_step07.1930.1930.1	1.1247	0.0774	883.84	6	5000.0%	1	K.KIGVNQPK.R
	TK270802_E14_cyto_2D_step01.2906.2906.1	1.1312	0.1858	1535.71	1	4640.0%	1	R.DAALMVTNDGATILK.N
	TK270802_E14_cyto_2D_step06.2681.2681.2	1.332	0.3387	1539.85	1	5000.0%	1	R.AAHSEGHITAGLDMK.E
	TK270802_E14_cyto_2D_step04.3701.3701.2	2.7069	0.5828	2370.21	1	4050.0%	1	R.TVYGGGCSEMLMAHAVTQLANR.T
	TK270802_E14_cyto_2D_step07.2658.2658.1	1.4116	0.3235	1132.03	3	5000.0%	2	K.HGINCFINR.Q
	TK270802_E14_cyto_2D_step03.4231.4231.2	2.4569	0.4238	1506.32	1	6070.0%	1	R.LSSFIGAIAIGDLVK.S
	TK270802_E14_cyto_2D_step13.1468.1468.1	1.0418	0.1144	748.81	57	5000.0%	2	K.LLTHHK.D
	TK270802_E14_cyto_2D_step10.1615.1615.2	1.6598	0.4738	1018.5	1	7140.0%	1	K.RVPDHHPC.-
	TK270802_E14_cyto_2D_step10.3103.3103.2	1.2406	0.1189	1309.61	9	3000.0%	2	K.IHPQTIISGWR.E
UHXB5_MOUSE99.6%115.9%269294659.1(P09079) Homeobox protein Hox-B5 (Hox-2.1) (MU-1) (H24.1) 
	TK270802_E14_cyto_2D_step03.2178.2178.1	1.8902	0.4222	1552.81	1	5000.0%	1	R.SSASSSHFGAVGESSR.A
UQ921L099.6%336.9%655709828.4(Q921L0) Similar to phosphatidylinositol binding clathrin assembly protein 
	TK270802_E14_cyto_2D_step04.1954.1954.1	1.636	0.4584	1457.81	1	4640.0%	1	R.ITAAQHSVTGSAVSK.T
	TK270802_E14_cyto_2D_step06.4519.4519.2	1.6736	0.065	1920.41	2	3160.0%	1	R.ATTLSNAVSSLASTGLSLTK.V
	TK270802_E14_cyto_2D_step07.1645.1645.2	1.1546	0.1832	1089.2	2	3330.0%	1	K.LTGGSNWQPK.V
UQ9CSP799.6%396.7%268287435.3(Q9CSP7) 2700017M01Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step13.2238.2238.2	1.5522	0.39	1695.15	5	3240.0%	3	R.LPSRPPLPGSGGSQSGAK.M
UR23B_MOUSE99.6%61418.5%416435174.8(P54728) UV excision repair protein RAD23 homolog B (MHR23B) (XP-C repair complementing complex 58 kDa protein) (P58) 
	TK270802_E14_cyto_2D_step03.4168.4168.2	0.7965	0.1662	2133.08	6	1940.0%	2	R.QIIQQNPSLLPALLQQIGR.E
	TK270802_E14_cyto_2D_step10.3046.3046.2	2.9884	0.3591	1263.73	1	7500.0%	3	K.NFVVVMVTKPK.A
*	TK270802_E14_cyto_2D_step14.0004.0004.3	1.1135	0.0943	4595.75	61	870.0%	1	R.ESQAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLR.N
UQ9D0K499.6%3512.0%241255707.8(Q9D0K4) 2610008L04Rik protein (Similar to quinoid dihydropteridine reductase) 
	TK270802_E14_cyto_2D_step05.2550.2550.1	2.0774	0.3274	1369.79	1	4580.0%	1	K.GAVHQLCQSLAGK.N
*	TK270802_E14_cyto_2D_step07.3001.3001.2	2.9195	0.5682	1672.94	1	6000.0%	2	K.RPNSGSLIQVVTTDGK.T
UCABA_MOUSE99.6%81410.9%285308317.9(Q99020) CARG-binding factor-A (CBF-A) 
	TK270802_E14_cyto_2D_step15.2025.2025.1	0.4609	0.0015	1031.63	65	1430.0%	1	K.DLKDYFTK.F
	TK270802_E14_cyto_2D_step13.1378.1378.1	1.5835	0.4112	991.42	1	5000.0%	2	K.KFHTVSGSK.C
	TK270802_E14_cyto_2D_step08.1544.1544.1	0.4317	0.0154	682.73	65	2000.0%	1	K.KAMAMK.K
	TK270802_E14_cyto_2D_step04.3894.3894.1	1.6566	0.0911	960.91	3	6430.0%	2	R.GFVFITFK.E
	TK270802_E14_cyto_2D_step06.1883.1883.1	1.2085	0.344	864.58	1	5710.0%	2	K.FHTVSGSK.C
UNPM_MOUSE99.6%598.6%292325604.8(Q61937) Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Numatrin) (Nucleolar protein NO38) 
	TK270802_E14_cyto_2D_step01.2112.2112.1	2.0482	0.5077	1570.84	1	4580.0%	2	K.VDNDENEHQLSLR.T
	TK270802_E14_cyto_2D_step03.1870.1870.1	1.3864	0.2477	915.94	7	4290.0%	2	K.DLKPSTPR.S
	TK270802_E14_cyto_2D_step13.1213.1213.1	0.4593	0.0389	445.48	4	5000.0%	1	K.VPVK.K
UCGC8_MOUSE99.6%1112.9%163176675.0(Q9D187) Hypothetical protein CGI-128 homolog 
	TK270802_E14_cyto_2D_step04.3926.3926.2	3.4902	0.5932	2310.28	1	4750.0%	1	R.VAAALENTHLLEVVNQCLSAR.S
UMAP4_MOUSE99.6%101213.7%11251176755.0(P27546) Microtubule-associated protein 4 (MAP 4) 
	TK270802_E14_cyto_2D_step10.1990.1990.2	1.3138	0.0014	873.25	55	4290.0%	1	K.TQPTSLPK.Q
*	TK270802_E14_cyto_2D_step15.3595.3595.2	1.1613	0.1146	2500.1	15	1590.0%	1	K.DMSPLPESEVTLGKDVVILPETK.V
*	TK270802_E14_cyto_2D_step10.2846.2846.3	1.3334	0.0746	2914.44	127	1480.0%	1	K.RPAAATATARPSTLPARDVKPKPITEAK.V
*	TK270802_E14_cyto_2D_step13.1829.1829.2	2.0392	0.4268	1652.23	2	3750.0%	1	R.TSPSKPSSAPALKPGPK.T
*	TK270802_E14_cyto_2D_step13.2289.2289.2	3.8027	0.6725	1579.41	1	7670.0%	1	K.KPMSLASGSVPAAPHK.R
*	TK270802_E14_cyto_2D_step12.2935.2935.3	1.4816	0.0103	2857.89	2	1880.0%	1	K.TEGGGSEALPCPGPPAGEEPVIPEAAPDR.G
*	TK270802_E14_cyto_2D_step03.4012.4012.2	1.121	0.0154	1818.26	73	2650.0%	1	R.VKPMSAPSRSSGALSVDK.K
*	TK270802_E14_cyto_2D_step05.1855.1855.1	1.6711	0.2519	1354.81	1	5000.0%	2	K.AAGSIASAQKPPAGK.V
UWDRC_MOUSE99.6%3310.2%423473475.6(Q9JJA4) WD-repeat protein 12 (YTM1 homolog) 
*	TK270802_E14_cyto_2D_step06.3686.3686.3	1.4853	0.1191	2343.2	4	2390.0%	1	K.ALHCCRGHAGSVDAIAVDSSGAK.F
*	TK270802_E14_cyto_2D_step13.2934.2934.2	1.2108	0.0688	2409.58	110	2110.0%	1	K.HMELENISSEEVVELEYVEK.Y
*	TK270802_E14_cyto_2D_step03.2346.2346.1	2.3168	0.5359	1541.77	1	4380.0%	1	R.GHAGSVDAIAVDSSGAK.F
UQ9CQM999.6%92718.7%337377785.6(Q9CQM9) Thioredoxin-like 2 
*	TK270802_E14_cyto_2D_step10.3937.3937.3	1.2242	0.0080	2828.07	28	1770.0%	1	K.TYSNWPTYPQLYVSGELIGGLDIIK.E
	TK270802_E14_cyto_2D_step01.4335.4335.1	1.6604	0.3989	1581.55	1	4170.0%	3	K.YEISSVPTFLFFK.N
*	TK270802_E14_cyto_2D_step09.2730.2730.1	1.1246	0.3319	1079.76	4	3750.0%	1	K.EHPHVSFVK.L
*	TK270802_E14_cyto_2D_step09.2544.2544.2	2.2382	0.3824	1709.88	1	5000.0%	4	R.HVSSGAFPPSTNEHLK.E
URS3_MOUSE99.6%259936.6%243266749.7(P17073) 40S ribosomal protein S3 
	TK270802_E14_cyto_2D_step03.2499.2499.1	2.1637	0.2347	1575.78	1	4330.0%	4	K.GGKPEPPAMPQPVPTA.-
	TK270802_E14_cyto_2D_step01.0151.0151.1	1.6233	0.1285	1471.81	1	5000.0%	1	K.DEILPTTPISEQK.G
*	TK270802_E14_cyto_2D_step01.3395.3395.1	1.2213	0.1589	1144.83	3	3890.0%	1	K.IMLPWDPSGK.I
	TK270802_E14_cyto_2D_step08.2376.2376.1	1.241	0.0662	638.03	1	7500.0%	2	R.HVLLR.Q
	TK270802_E14_cyto_2D_step01.3272.3272.1	0.9964	0.1936	1574.88	1	3460.0%	1	R.FGFPEGSVELYAEK.V
	TK270802_E14_cyto_2D_step05.3151.3151.1	1.4096	0.1248	1031.88	1	6880.0%	5	R.TEIIILATR.T
	TK270802_E14_cyto_2D_step05.3131.3131.1	1.2706	0.2139	1025.3	1	6250.0%	1	R.KFVADGIFK.A
	TK270802_E14_cyto_2D_step08.2667.2667.2	2.8918	0.5135	1461.64	1	6670.0%	5	K.KPLPDHVSIVEPK.D
UWDR1_MOUSE99.6%7157.6%606664076.6(O88342) WD-repeat protein 1 (Actin interacting protein 1) (AIP1) 
	TK270802_E14_cyto_2D_step12.1961.1961.1	0.4538	0.064	901.12	11	2140.0%	1	K.GHTNQVSR.M
	TK270802_E14_cyto_2D_step06.2909.2909.1	1.6862	0.127	1276.02	1	5500.0%	3	K.KVFASLPQVER.G
*	TK270802_E14_cyto_2D_step04.3320.3320.2	3.3402	0.5041	2420.89	1	4050.0%	2	R.NIDNPAIADIYTEHAHQVVVAK.Y
	TK270802_E14_cyto_2D_step05.1514.1514.1	0.9301	0.2064	639.69	28	5000.0%	1	K.EHLLK.Y
UQ9D7G099.6%72116.4%318348487.0(Q9D7G0) 2310010D17Rik protein 
	TK270802_E14_cyto_2D_step07.3689.3689.2	0.6188	0.0627	2524.95	50	950.0%	1	R.INNACFEAVVVTNTIPQEDKMK.H
	TK270802_E14_cyto_2D_step03.2203.2203.1	2.5314	0.2922	1435.76	1	5420.0%	2	K.IFSGSSHQDLSQK.I
	TK270802_E14_cyto_2D_step09.3578.3578.2	2.9607	0.5247	1805.9	1	5620.0%	4	R.VYAILTHGIFSGPAISR.I
UALDR_MOUSE99.6%132923.8%315356017.2(P45376) Aldose reductase (EC 1.1.1.21) (AR) (Aldehyde reductase) 
	TK270802_E14_cyto_2D_step05.1826.1826.2	1.203	0.0229	1309.42	269	3500.0%	1	K.YNKTTAQVLIR.F
	TK270802_E14_cyto_2D_step07.5310.5310.1	0.5966	0.0569	1109.01	7	2500.0%	2	K.RQDLFIVSK.L
	TK270802_E14_cyto_2D_step09.4899.4899.2	0.9292	0.2112	2462.34	4	1750.0%	1	R.HIDCAQVYQNEKEVGVALQEK.L
	TK270802_E14_cyto_2D_step03.2098.2098.2	3.1119	0.5249	1507.02	1	7270.0%	1	R.HIDCAQVYQNEK.E
	TK270802_E14_cyto_2D_step04.2797.2797.1	1.586	0.1249	1107.3	3	5710.0%	1	K.LWCTFHDK.S
	TK270802_E14_cyto_2D_step07.2772.2772.2	2.319	0.4521	2219.16	1	3820.0%	1	K.YKPAVNQIECHPYLTQEK.L
	TK270802_E14_cyto_2D_step08.2236.2236.1	2.172	0.0313	885.14	13	5710.0%	4	R.ILNKPGLK.Y
UQ8VBT999.6%243.6%550597967.0(Q8VBT9) RIKEN cDNA 1190006K01 gene (Similar to alveolar soft part sarcoma chromosome region, candidate 1) 
*	TK270802_E14_cyto_2D_step09.2580.2580.2	1.8493	0.3035	1929.26	1	2890.0%	2	R.LGGPSASLRPLTSPSANSSK.S
UQ9CWK199.6%116.9%259294445.7(Q9CWK1) 2410026J11Rik protein 
	TK270802_E14_cyto_2D_step05.3165.3165.2	3.9134	0.6292	2007.35	1	6180.0%	1	K.SNCKPSTFAYPAPLEVPK.E
UGIPC_MOUSE99.6%4419.2%333361295.9(Q9Z0G0) RGS19-interacting protein 1 (GAIP C-terminus interacting protein GIPC) (RGS-GAIP interacting protein) (Synectin) (SemaF cytoplasmic domain associated protein 1) (SEMCAP-1) 
*	TK270802_E14_cyto_2D_step13.3312.3312.2	0.9486	0.0878	3081.37	2	1410.0%	1	R.SGLGVGEPGPLGGSAAGESQMGLPPPPAALRPR.L
	TK270802_E14_cyto_2D_step13.2713.2713.2	3.0214	0.461	1622.03	1	6430.0%	1	R.LVFHTQLAHGSPTGR.I
*	TK270802_E14_cyto_2D_step07.1962.1962.2	1.3572	0.232	1436.59	9	3330.0%	1	R.SAGGHPGSGPQLGTGR.G
UHS9B_MOUSE99.6%9179327.9%723831945.0(P11499) Heat shock protein HSP 90-beta (HSP 84) (Tumor specific transplantation 84 kDa antigen) (TSTA) 
	TK270802_E14_cyto_2D_step05.2654.2654.1	1.6877	0.1883	1022.02	1	6430.0%	2	K.KFYEAFSK.N
	TK270802_E14_cyto_2D_step06.4058.4058.2	2.9758	0.287	1786.42	1	5710.0%	15	K.HLEINPDHPIVETLR.Q
	TK270802_E14_cyto_2D_step12.2524.2524.2	3.1439	0.4836	1914.51	2	4670.0%	4	K.KHLEINPDHPIVETLR.Q
	TK270802_E14_cyto_2D_step03.2138.2138.1	2.297	0.2551	1144.06	1	7220.0%	2	K.LGIHEDSTNR.R
	TK270802_E14_cyto_2D_step03.1381.1381.1	0.8677	0.0736	953.89	12	3750.0%	5	R.ADHGEPIGR.G
	TK270802_E14_cyto_2D_step12.4336.4336.2	1.004	0.0256	2992.97	5	1730.0%	2	K.DLVVLLFETALLSSGFSLEDPQTHSNR.I
	TK270802_E14_cyto_2D_step08.2922.2922.2	4.15	0.5968	2180.14	1	5830.0%	7	R.YHTSQSGDEMTSLSEYVSR.M
	TK270802_E14_cyto_2D_step07.2882.2882.1	1.408	0.1683	888.86	21	5000.0%	4	R.RLSELLR.Y
	TK270802_E14_cyto_2D_step07.2161.2161.2	1.3909	0.1266	1298.8	2	4500.0%	1	K.LGIHEDSTNRR.R
	TK270802_E14_cyto_2D_step06.4606.4606.2	1.0748	0.088	2608.76	1	3000.0%	2	K.RGFEVVYMTEPIDEYCVQQLK.E
	TK270802_E14_cyto_2D_step08.3813.3813.2	4.4069	0.6344	1813.08	1	7860.0%	17	K.HSQFIGYPITLYLEK.E
	TK270802_E14_cyto_2D_step01.1926.1926.1	1.6819	0.0641	659.25	1	7000.0%	1	K.VVVITK.H
	TK270802_E14_cyto_2D_step01.2372.2372.1	1.8594	0.3761	1276.9	1	6360.0%	2	R.ELISNASDALDK.I
	TK270802_E14_cyto_2D_step01.2055.2055.1	1.2519	0.035	734.63	5	6670.0%	2	K.SLVSVTK.E
	TK270802_E14_cyto_2D_step03.3599.3599.2	1.7799	0.3751	2434.52	1	3250.0%	1	R.LVSSPCCIVTSTYGWTANMER.I
	TK270802_E14_cyto_2D_step01.0080.0080.1	1.9318	0.2603	891.95	1	7500.0%	1	K.FYEAFSK.N
	TK270802_E14_cyto_2D_step02.3562.3562.2	1.1747	0.0331	2449.91	2	2630.0%	1	R.GFEVVYMTEPIDEYCVQQLK.E
	TK270802_E14_cyto_2D_step05.3459.3459.1	1.7166	0.1593	1239.14	9	4440.0%	5	R.RAPFDLFENK.K
	TK270802_E14_cyto_2D_step01.2315.2315.1	1.2802	0.1564	1353.12	7	3750.0%	10	R.TLTLVDTGIGMTK.A
UPDX1_MOUSE99.6%3427851.3%199221768.1(P35700) Peroxiredoxin 1 (EC 1.11.1.-) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Osteoblast specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) 
	TK270802_E14_cyto_2D_step01.0170.0170.1	2.1407	0.2693	1197.02	1	6110.0%	1	R.LVQAFQFTDK.H
	TK270802_E14_cyto_2D_step01.2856.2856.1	2.4988	0.2188	922.45	5	7140.0%	2	R.GLFIIDDK.G
*	TK270802_E14_cyto_2D_step10.3548.3548.3	2.1011	0.2283	2771.74	1	2390.0%	2	K.LNCQVIGASVDSHFCHLAWINTPK.K
*	TK270802_E14_cyto_2D_step08.3429.3429.2	2.7601	0.3125	1767.92	1	5000.0%	4	K.KQGGLGPMNIPLISDPK.R
	TK270802_E14_cyto_2D_step01.2220.2220.1	2.1056	0.3717	1167.0	1	4500.0%	2	K.ATAVMPDGQFK.D
*	TK270802_E14_cyto_2D_step08.2894.2894.2	4.2265	0.5885	2396.54	1	4760.0%	15	K.HGEVCPAGWKPGSDTIKPDVNK.S
	TK270802_E14_cyto_2D_step01.2527.2527.1	1.5093	0.2751	1109.99	2	5560.0%	2	R.TIAQDYGVLK.A
UCRKL_MOUSE99.6%3312.2%303338176.7(P47941) Crk-like protein 
	TK270802_E14_cyto_2D_step04.3281.3281.2	3.2278	0.5344	1741.85	1	6430.0%	1	K.IHYLDTTTLIEPAPR.Y
	TK270802_E14_cyto_2D_step07.2813.2813.1	2.1201	0.269	1413.87	2	5450.0%	1	R.VSHYIINSLPNR.R
	TK270802_E14_cyto_2D_step09.2805.2805.1	0.7897	0.0978	1079.54	6	4440.0%	1	R.SSPHGKHGNR.N
UHS71_HUMAN99.6%4163.4%641700525.6(P08107) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) 
*	TK270802_E14_cyto_2D_step05.3423.3423.2	3.5209	0.607	2267.97	1	3810.0%	4	K.AAAIGIDLGTTYSCVGVFQHGK.V
UVIME_MOUSE99.6%111924.1%465535575.1(P20152) Vimentin 
	TK270802_E14_cyto_2D_step01.3606.3606.1	1.2146	0.0095	1170.28	156	3330.0%	1	K.ILLAELEQLK.G
*	TK270802_E14_cyto_2D_step12.2895.2895.3	1.1153	0.0384	2923.88	12	1020.0%	1	R.TYSLGSALRPSTSRSLYSSSPGGAYVTR.S
*	TK270802_E14_cyto_2D_step13.3498.3498.3	2.3871	0.3986	4042.16	1	1990.0%	1	K.KLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALR.D
	TK270802_E14_cyto_2D_step01.3630.3630.1	0.689	0.1241	1396.3	24	2270.0%	1	R.DVRQQYESVAAK.N
*	TK270802_E14_cyto_2D_step02.3922.3922.2	1.6175	0.3522	1559.85	1	5000.0%	1	R.ISLPLPTFSSLNLR.E
	TK270802_E14_cyto_2D_step04.3685.3685.2	3.5394	0.5938	1535.68	1	7500.0%	2	R.KVESLQEEIAFLK.K
*	TK270802_E14_cyto_2D_step07.5102.5102.3	1.2362	0.1374	3913.64	20	830.0%	1	K.LHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALR.D
UQ8R01699.6%111722.0%455525116.5(Q8R016) Similar to bleomycin hydrolase 
	TK270802_E14_cyto_2D_step04.2069.2069.1	2.0644	0.1812	1396.5	1	5450.0%	2	R.VENSWGEDHGHK.G
	TK270802_E14_cyto_2D_step03.2440.2440.1	1.7733	0.0865	987.05	7	6430.0%	1	R.MNDILNHK.M
*	TK270802_E14_cyto_2D_step13.2672.2672.3	3.8073	0.5151	2731.9	1	3330.0%	1	R.ATVQGAQHVFQHVVPQEGKPVTNQK.S
*	TK270802_E14_cyto_2D_step05.5286.5286.2	0.7407	0.0383	2760.44	65	1250.0%	1	K.FNIEEFEFSQSYLFFWDKVER.C
	TK270802_E14_cyto_2D_step01.2676.2676.1	1.3647	0.2311	1440.92	1	4580.0%	1	K.DGEAVWFGCDVGK.H
	TK270802_E14_cyto_2D_step05.1919.1919.1	2.1938	0.3413	928.9	1	6250.0%	2	R.NLVHSGATK.G
*	TK270802_E14_cyto_2D_step09.2586.2586.2	1.2788	0.1223	1513.05	10	4090.0%	2	K.ICFVNDPRPQHK.Y
UQ9D1A299.6%4106.1%475527675.7(Q9D1A2) 0610010E05Rik protein (RIKEN cDNA 0610010E05 gene) 
	TK270802_E14_cyto_2D_step04.3720.3720.2	3.249	0.5891	1882.04	1	4440.0%	3	R.YPSLSLHGIEGAFSGSGAK.T
	TK270802_E14_cyto_2D_step05.2321.2321.1	1.4316	0.0608	1162.35	3	5560.0%	1	K.KFAELQSPNK.F
UQ9R0C499.6%10146.3%18212020094.3(Q9R0C4) Intermediate filament protein nestin 
*	TK270802_E14_cyto_2D_step01.2794.2794.1	1.2413	0.0519	870.36	8	6670.0%	1	K.ENLEPLR.F
*	TK270802_E14_cyto_2D_step06.2705.2705.1	1.2442	0.0956	1589.9	18	3080.0%	1	R.AVEDEQMTVNPPEK.V
*	TK270802_E14_cyto_2D_step04.1898.1898.3	1.4259	0.0082	1610.68	26	2140.0%	1	R.SLEGENHDPLSSVVK.E
*	TK270802_E14_cyto_2D_step03.3643.3643.2	0.8827	0.0628	1967.45	2	2350.0%	2	K.ENQESLVSLNEGGMETVK.S
*	TK270802_E14_cyto_2D_step07.3486.3486.2	1.3553	0.063	1789.2	29	2350.0%	1	R.LQTPGGSSQASLGFPDPK.L
*	TK270802_E14_cyto_2D_step13.1564.1564.3	0.8554	0.0199	1850.64	163	890.0%	1	R.FEEAEDQVLERLIEK.E
*	TK270802_E14_cyto_2D_step12.2564.2564.2	3.6234	0.5984	1699.89	1	5620.0%	2	K.APLVGSPVHLGPSQPLK.F
*	TK270802_E14_cyto_2D_step01.4264.4264.1	1.0702	0.0281	1304.26	8	3000.0%	1	R.NDQEVVRSLDK.E
UR37A_HUMAN99.6%124830.8%911014410.4(P12751) 60S ribosomal protein L37a (P12751) 60S ribosomal protein L37a 
	TK270802_E14_cyto_2D_step08.2174.2174.1	2.0488	0.2208	1055.64	1	5620.0%	4	K.KIEISQHAK.Y
	TK270802_E14_cyto_2D_step06.2811.2811.1	2.8137	0.4801	1408.8	1	5000.0%	4	R.AVGIWHCGSCMK.T
	TK270802_E14_cyto_2D_step06.2149.2149.1	1.3611	0.1291	702.68	1	5830.0%	4	K.KVGIVGK.Y
UDDB1_HUMAN99.6%223.3%11401269685.3(Q16531) DNA damage binding protein 1 (Damage-specific DNA binding protein 1) (DDB p127 subunit) (DDBa) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (Xeroderma pigmentosum group E complementing protein) (XPCe) (X-associated protein 1) (XAP-1) 
*	TK270802_E14_cyto_2D_step07.3569.3569.2	2.0462	0.0674	1689.83	1	3930.0%	1	R.LEIYVVTAEGLRPVK.E
*	TK270802_E14_cyto_2D_step06.3115.3115.2	3.0789	0.5542	2587.41	1	3640.0%	1	R.SLSTTNVFACSDRPTVIYSSNHK.L
UCYPH_MOUSE99.6%4652054.0%163178407.9(P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) 
	TK270802_E14_cyto_2D_step01.1916.1916.1	1.1929	0.1054	571.64	9	7500.0%	1	K.GFGYK.G
*	TK270802_E14_cyto_2D_step03.3944.3944.2	2.0706	0.453	2009.97	1	3530.0%	3	-.VNPTVFFDITADDEPLGR.V
	TK270802_E14_cyto_2D_step08.4993.4993.2	0.9173	0.1706	2795.96	20	1730.0%	20	K.HTGPGILSMANAGPNTNGSQFFICTAK.T
	TK270802_E14_cyto_2D_step05.1665.1665.1	0.7679	0.0157	692.64	30	4000.0%	3	K.GSSFHR.I
	TK270802_E14_cyto_2D_step07.2285.2285.1	1.586	0.2609	689.79	1	7000.0%	8	K.HVVFGK.V
	TK270802_E14_cyto_2D_step01.1647.1647.1	0.9496	0.0089	698.56	9	6000.0%	2	R.SIYGEK.F
	TK270802_E14_cyto_2D_step01.0218.0218.1	1.1749	0.0925	1280.65	1	5000.0%	2	K.EGMNIVEAMER.F
	TK270802_E14_cyto_2D_step01.3246.3246.1	1.4981	0.1791	1057.95	3	5620.0%	5	R.VSFELFADK.V
UQ9CYG699.6%51714.4%222249486.0(Q9CYG6) 5730478E03Rik protein 
	TK270802_E14_cyto_2D_step06.3659.3659.2	2.0863	0.3854	1833.2	1	3440.0%	4	R.ATAAFILANEHNVALFK.H
	TK270802_E14_cyto_2D_step03.2814.2814.2	2.0552	0.2508	1873.15	1	5000.0%	1	R.MLVQCMQDQEHPSIR.T
UQ9DAW999.6%102625.8%330364295.7(Q9DAW9) 1600014M03Rik protein 
	TK270802_E14_cyto_2D_step06.4438.4438.3	1.6717	0.167	4450.12	2	1250.0%	2	K.AIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTK.G
	TK270802_E14_cyto_2D_step05.4268.4268.2	2.7734	0.4634	2333.46	1	4210.0%	4	K.KVNESSLNWPQLENIGNFIK.A
	TK270802_E14_cyto_2D_step07.4853.4853.3	1.0451	0.1492	4221.55	21	790.0%	1	K.AIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAK.T
	TK270802_E14_cyto_2D_step01.3550.3550.1	1.3137	0.0591	1290.29	13	4000.0%	1	K.DGIILCELINK.L
	TK270802_E14_cyto_2D_step01.1996.1996.1	1.0677	0.1465	1217.25	14	3750.0%	2	K.GASQAGMLAPGTR.R
UNDKB_MOUSE99.6%134744.1%152173637.5(Q01768) Nucleoside diphosphate kinase B (EC 2.7.4.6) (NDK B) (NDP kinase B) (nm23-M2) (P18) 
	TK270802_E14_cyto_2D_step05.3322.3322.1	1.1	0.0636	1178.33	1	5000.0%	2	K.DRPFFPGLVK.Y
*	TK270802_E14_cyto_2D_step05.5042.5042.2	3.7895	0.6177	1963.65	1	5710.0%	6	K.EIHLWFKPEELIDYK.S
	TK270802_E14_cyto_2D_step04.4396.4396.2	1.5249	0.3827	2096.38	2	2780.0%	1	K.YMNSGPVVAMVWEGLNVVK.T
	TK270802_E14_cyto_2D_step01.2400.2400.1	1.2936	0.0871	1167.66	21	3120.0%	1	K.SCAHDWVYE.-
	TK270802_E14_cyto_2D_step03.2244.2244.1	2.9315	0.087	1487.84	1	6150.0%	2	R.NIIHGSDSVESAEK.E
UFKB4_MOUSE99.6%154122.8%457514415.7(P30416) FK506-binding protein 4 (Possible peptidyl-prolyl cis-trans isomerase FKBP4) (EC 5.2.1.8) (PPiase) (Rotamase) (p59 protein) (HSP binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59) 
	TK270802_E14_cyto_2D_step13.2918.2918.2	2.809	0.3326	1510.28	1	6250.0%	1	R.LASHLNLAMCHLK.L
*	TK270802_E14_cyto_2D_step08.1847.1847.1	1.1212	0.0547	595.89	4	7500.0%	2	K.VHALR.L
	TK270802_E14_cyto_2D_step09.3164.3164.2	3.767	0.5339	2042.8	1	5280.0%	5	K.GEHSIVYLKPSYAFGSVGK.E
*	TK270802_E14_cyto_2D_step07.3202.3202.2	2.3641	0.374	1686.7	1	6070.0%	1	R.RGEAHLAVNDFDLAR.A
*	TK270802_E14_cyto_2D_step01.1799.1799.1	2.7347	0.4739	1543.7	1	5360.0%	2	K.AEVAAGDHPTDAEMK.G
	TK270802_E14_cyto_2D_step06.3751.3751.2	1.834	0.2323	1638.98	1	5770.0%	1	R.VFVHYTGWLLDGTK.F
*	TK270802_E14_cyto_2D_step06.2593.2593.2	3.7785	0.4853	2494.48	1	4320.0%	2	K.VGEVCHITCKPEYAYGAAGSPPK.I
UHBAZ_MOUSE99.6%4852253.2%141161047.6(P06467) Hemoglobin zeta chain 
*	TK270802_E14_cyto_2D_step01.2204.2204.1	1.7715	0.2626	1005.84	1	6670.0%	2	K.IMTAVGDAVK.S
*	TK270802_E14_cyto_2D_step12.2977.2977.2	2.6202	0.5127	1487.44	1	7500.0%	5	K.LLSHCLLVTMAAR.F
	TK270802_E14_cyto_2D_step05.3230.3230.1	1.4436	0.277	1215.97	1	5000.0%	1	K.LSELHAYILR.V
*	TK270802_E14_cyto_2D_step02.3390.3390.1	1.4136	0.0202	1110.91	4	5000.0%	3	R.AIIMSMWEK.M
*	TK270802_E14_cyto_2D_step13.4678.4678.2	2.5419	0.4645	1987.12	1	4670.0%	19	K.TYFPHFDLHHGSQQLR.A
*	TK270802_E14_cyto_2D_step03.4295.4295.2	2.4542	0.5442	1371.61	1	8180.0%	1	K.FMSILSSILTEK.Y
*	TK270802_E14_cyto_2D_step07.1713.1713.1	1.1666	0.3798	561.64	3	5000.0%	9	R.AHGFK.I
UQ9D10799.6%3526.9%186209177.0(Q9D107) 2010015D08Rik protein 
	TK270802_E14_cyto_2D_step07.2706.2706.1	1.6626	0.3778	1558.15	1	4170.0%	2	K.IQHILCTGNLCTK.E
	TK270802_E14_cyto_2D_step10.3372.3372.3	1.2488	0.1134	4116.22	6	1180.0%	1	K.IGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHK.F
UPMG1_MOUSE99.6%173334.4%253287017.2(Q9DBJ1) Phosphoglycerate mutase 1 (EC 5.4.2.1) (EC 5.4.2.4) (EC 3.1.3.13) (Phosphoglycerate mutase isozyme B) (PGAM-B) (BPG-dependent PGAM 1) 
	TK270802_E14_cyto_2D_step06.2561.2561.1	1.5616	0.1666	1153.27	9	4000.0%	3	R.VLIAAHGNSLR.G
	TK270802_E14_cyto_2D_step01.1602.1602.1	1.6512	0.1572	975.96	1	7220.0%	1	K.AMEAVAAQGK.V
	TK270802_E14_cyto_2D_step02.3387.3387.2	1.0891	0.145	1783.35	2	3570.0%	1	R.DAGYEFDICFTSVQK.R
	TK270802_E14_cyto_2D_step06.2469.2469.1	2.4644	0.3852	1061.9	1	7220.0%	2	R.HYGGLTGLNK.A
	TK270802_E14_cyto_2D_step08.1868.1868.1	0.8707	0.0533	757.8	3	4170.0%	1	K.RGGQALR.D
	TK270802_E14_cyto_2D_step03.2884.2884.1	1.3335	0.0797	614.92	7	8750.0%	1	K.LVLIR.H
	TK270802_E14_cyto_2D_step04.2536.2536.1	2.6346	0.3324	1315.01	1	6000.0%	2	R.HGESAWNLENR.F
	TK270802_E14_cyto_2D_step12.2952.2952.2	1.2623	0.1473	2119.32	11	1760.0%	3	K.NLKPIKPMQFLGDEETVR.K
UP137_MOUSE99.6%225.0%656735485.4(Q60865) GPI-anchored protein p137 (p137GPI) 
*	TK270802_E14_cyto_2D_step01.4607.4607.2	2.817	0.5642	2469.65	1	3570.0%	1	K.QGLSGVPILSEEELSLLDEFYK.L
	TK270802_E14_cyto_2D_step03.4264.4264.1	0.7969	0.0306	1322.83	317	2500.0%	1	K.TVLELQYVLDK.L
UAPT_MOUSE99.6%4622.2%180197366.8(P08030) Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT) 
*	TK270802_E14_cyto_2D_step01.4664.4664.1	1.7682	0.2495	1511.4	1	3750.0%	1	R.LGPIPFFSLLQYD.-
*	TK270802_E14_cyto_2D_step07.2433.2433.1	1.12	0.0149	782.0	9	5830.0%	2	R.LLASHLK.S
*	TK270802_E14_cyto_2D_step02.4247.4247.2	4.1607	0.6052	2135.26	1	5790.0%	1	R.GFLFGPSLAQELGVGCVLIR.K
UQ9CQ6099.6%4423.3%257272545.8(Q9CQ60) 1110030K05Rik protein (RIKEN cDNA 1110030K05 gene) 
*	TK270802_E14_cyto_2D_step01.2490.2490.1	2.2761	0.3423	1484.82	1	4670.0%	1	R.DLPAAAAPAGPASFAR.W
*	TK270802_E14_cyto_2D_step03.4407.4407.2	1.5254	0.4045	2345.32	1	2270.0%	1	R.VTLTLPVLNAAQSIIFVATGEGK.A
	TK270802_E14_cyto_2D_step07.2325.2325.2	3.0526	0.5798	1603.5	1	6430.0%	1	K.IVAPISDSPKPPPQR.V
*	TK270802_E14_cyto_2D_step06.2181.2181.1	1.8304	0.2214	698.95	1	8000.0%	1	R.THLLSK.L
UAPA4_MOUSE99.6%113714.4%395450295.6(P06728) Apolipoprotein A-IV precursor (Apo-AIV) 
*	TK270802_E14_cyto_2D_step06.3146.3146.1	2.8136	0.4903	1548.88	1	6250.0%	3	K.LNHQMEGLAFQMK.K
*	TK270802_E14_cyto_2D_step01.1951.1951.1	0.9636	0.0328	1447.96	89	1920.0%	1	K.LGDASTYADGVHNK.L
*	TK270802_E14_cyto_2D_step07.4037.4037.2	2.8236	0.4606	2027.2	1	5290.0%	5	K.LVPFVVQLSGHLAKETER.V
*	TK270802_E14_cyto_2D_step01.2584.2584.1	1.6057	0.4329	1244.0	1	4550.0%	1	R.SLAPLTVGVQEK.L
UKPY2_MOUSE99.6%118245860.6%530577567.5(P52480) Pyruvate kinase, M2 isozyme (EC 2.7.1.40) 
	TK270802_E14_cyto_2D_step01.0488.0488.1	1.0381	0.0694	460.8	2	8330.0%	1	K.IISK.I
	TK270802_E14_cyto_2D_step11.2913.2913.2	3.4791	0.5702	1887.95	1	5670.0%	45	R.LNFSHGTHEYHAETIK.N
	TK270802_E14_cyto_2D_step01.3340.3340.1	1.9613	0.4002	1471.85	1	5500.0%	1	K.CDENILWLDYK.N
	TK270802_E14_cyto_2D_step03.1698.1698.2	1.5874	0.0958	954.6	2	7860.0%	1	K.IENHEGVR.R
	TK270802_E14_cyto_2D_step08.4914.4914.2	1.8702	0.21	1824.76	4	3670.0%	6	R.RFDEILEASDGIMVAR.G
	TK270802_E14_cyto_2D_step11.4109.4109.2	4.5915	0.6495	1862.95	1	7000.0%	9	K.FGVEQDVDMVFASFIR.K
	TK270802_E14_cyto_2D_step01.2632.2632.1	1.1614	0.0049	1143.98	12	3500.0%	2	R.GDLGIEIPAEK.V
*	TK270802_E14_cyto_2D_step01.2448.2448.1	1.947	0.272	1173.92	4	5000.0%	1	R.LDIDSAPITAR.N
	TK270802_E14_cyto_2D_step01.2474.2474.1	1.4239	0.2319	1362.05	5	3750.0%	1	R.NTGIICTIGPASR.S
	TK270802_E14_cyto_2D_step01.0568.0568.1	2.1259	0.3191	719.84	1	7500.0%	1	K.VVEVGSK.I
	TK270802_E14_cyto_2D_step08.2328.2328.2	1.9921	0.2923	871.16	2	9170.0%	1	R.MQHLIAR.E
	TK270802_E14_cyto_2D_step01.3186.3186.1	1.6153	0.3148	934.98	1	5710.0%	5	R.GIFPVLCK.D
	TK270802_E14_cyto_2D_step01.3862.3862.2	3.2646	0.4983	2494.71	1	3750.0%	1	R.AEGSDVANAVLDGADCIMLSGETAK.G
	TK270802_E14_cyto_2D_step02.2643.2643.1	1.6096	0.3547	842.89	3	4290.0%	5	R.APIIAVTR.N
*	TK270802_E14_cyto_2D_step01.3514.3514.1	1.758	0.2203	1590.1	1	4230.0%	1	K.DAVLNAWAEDVDLR.V
	TK270802_E14_cyto_2D_step05.3126.3126.2	4.1867	0.5497	1767.39	1	6760.0%	3	K.KGVNLPGAAVDLPAVSEK.D
	TK270802_E14_cyto_2D_step05.4016.4016.2	4.2767	0.6067	1935.53	1	7000.0%	14	R.EAEAAIYHLQLFEELR.R
	TK270802_E14_cyto_2D_step02.2538.2538.1	1.6439	0.0216	705.82	24	8000.0%	1	K.VFLAQK.M
	TK270802_E14_cyto_2D_step01.3490.3490.1	2.2654	0.3869	1464.98	1	5420.0%	3	K.IYVDDGLISLQVK.E
*	TK270802_E14_cyto_2D_step05.3696.3696.2	3.1279	0.5372	2305.08	1	3860.0%	4	R.RLAPITSDPTEAAAVGAVEASFK.C
*	TK270802_E14_cyto_2D_step01.2330.2330.1	1.8257	0.2302	947.3	2	6880.0%	1	R.VNLAMDVGK.A
	TK270802_E14_cyto_2D_step01.2603.2603.1	1.1927	0.1716	1222.48	6	4500.0%	1	K.CCSGAIIVLTK.S
	TK270802_E14_cyto_2D_step05.1681.1681.1	1.1683	0.0159	674.07	6	5000.0%	1	R.KVLGEK.G
	TK270802_E14_cyto_2D_step13.1114.1114.3	1.2	0.0158	1783.0	77	1470.0%	1	K.GADFLVTEVENGGSLGSK.K
	TK270802_E14_cyto_2D_step04.4304.4304.3	1.7512	0.1593	2755.49	1	2200.0%	1	K.GDVVIVLTGWRPGSGFTNTMRVVPVP.-
UQ9CWI599.6%7277.8%2042404711.6(Q9CWI5) Ribosomal protein L15 
	TK270802_E14_cyto_2D_step13.1996.1996.1	1.5797	0.2205	1013.88	2	5620.0%	5	K.FHHTIGGSR.R
	TK270802_E14_cyto_2D_step06.2157.2157.1	1.6402	0.1845	882.07	8	6670.0%	1	R.NTLQLHR.Y
USH3L_MOUSE99.6%41011.4%114128114.9(Q9JJU8) SH3 domain-binding glutamic acid-rich-like protein 
*	TK270802_E14_cyto_2D_step04.3501.3501.1	2.5414	0.3707	1594.72	1	4580.0%	3	K.KQQDVLCFLEANK.I
UVDP_MOUSE99.6%223.0%9411051534.9(Q9Z1Z0) General vesicular transport factor p115 (Transcytosis associated protein) (TAP) (Vesicle docking protein) (Fragment) 
	TK270802_E14_cyto_2D_step05.2491.2491.1	1.3348	0.1132	1597.93	1	4170.0%	1	K.TLEQHDNIVTHYK.N
	TK270802_E14_cyto_2D_step01.1900.1900.1	2.0764	0.5031	1525.92	1	3570.0%	1	K.SVPVEGESEHVSAAK.T
UQ9CR1699.6%112519.5%370407437.4(Q9CR16) 4930564J03Rik protein (RIKEN cDNA 4930564J03 gene) (Peptidylprolyl isomerase D) (Cyclophilin D) 
	TK270802_E14_cyto_2D_step03.3851.3851.2	1.0706	0.0098	1758.3	28	2670.0%	1	R.LQPIALSCVLNIGACK.L
	TK270802_E14_cyto_2D_step07.2942.2942.1	1.7215	0.2641	1029.08	1	5620.0%	4	K.HVVFGQVIK.G
*	TK270802_E14_cyto_2D_step07.2450.2450.2	0.6281	0.0111	2092.47	36	1050.0%	2	R.ALCTGEKGTGSTTGKPLHFK.G
*	TK270802_E14_cyto_2D_step03.1883.1883.1	1.0365	0.1253	1058.85	25	3330.0%	1	K.KAQEIAPGDK.A
*	TK270802_E14_cyto_2D_step10.2409.2409.2	1.7653	0.2744	1332.94	1	5830.0%	1	K.GTGSTTGKPLHFK.G
*	TK270802_E14_cyto_2D_step04.2708.2708.2	1.1429	0.0933	1781.19	5	3120.0%	1	-.MSHASPAAKPSNSKNPR.V
UQ9CWI499.6%3312.2%312349088.2(Q9CWI4) Esterase 10 
	TK270802_E14_cyto_2D_step10.2873.2873.1	0.9918	0.0577	859.07	9	5830.0%	1	K.KIPVVFR.L
*	TK270802_E14_cyto_2D_step15.4179.4179.2	3.6373	0.5884	2562.29	1	4750.0%	1	R.LQEGYDHSYYFIATFIADHIR.H
*	TK270802_E14_cyto_2D_step03.2574.2574.1	1.5176	0.0459	1175.1	7	5000.0%	1	K.VFEHSSVELK.C
UQ9EQR099.6%348414.0%25042724266.6(Q9EQR0) Fatty acid synthase 
*	TK270802_E14_cyto_2D_step15.4019.4019.2	1.2239	0.0477	2779.91	2	2170.0%	4	R.AIPQEKPIFLSVEDTSFQWVDSLK.S
	TK270802_E14_cyto_2D_step03.4947.4947.1	0.832	0.0738	1254.14	89	3000.0%	1	K.FDASFFGVHPK.Q
	TK270802_E14_cyto_2D_step12.2118.2118.1	0.4814	0.0755	897.63	36	1250.0%	1	K.LSPDAIPGK.W
*	TK270802_E14_cyto_2D_step03.2803.2803.2	1.9229	0.2939	1358.6	1	5000.0%	1	R.VTAIYIDPATHR.Q
*	TK270802_E14_cyto_2D_step03.5028.5028.3	1.138	0.1953	2851.93	22	1300.0%	1	K.EVRTGGLAFHSYFMEGIAPTLLQALK.K
*	TK270802_E14_cyto_2D_step08.4794.4794.3	0.8922	0.0525	4278.39	11	670.0%	1	R.LLLEVSYEAIVDGGINPASLRGTNTGVWVGVSGSEASEALSR.D
*	TK270802_E14_cyto_2D_step07.3054.3054.1	1.6312	0.1159	853.2	1	5710.0%	5	K.ALHLVGLK.R
*	TK270802_E14_cyto_2D_step08.4219.4219.3	1.5009	0.1441	4288.53	34	1030.0%	1	R.CPAGVVPACHNSEDTVTISGPQAAVNEFVEQLKQEGVFAK.E
*	TK270802_E14_cyto_2D_step05.2887.2887.2	2.6584	0.3999	1682.22	1	4380.0%	1	K.SNMGHPEPASGLAALTK.V
*	TK270802_E14_cyto_2D_step05.4245.4245.2	2.9697	0.3447	2746.69	1	3000.0%	1	R.SGECPAALVGGINLLLKPNTSVQFMK.L
*	TK270802_E14_cyto_2D_step03.3515.3515.1	1.8051	0.207	1131.76	5	5000.0%	2	R.SEAVVAVLLTK.K
*	TK270802_E14_cyto_2D_step01.4572.4572.2	1.4401	0.0767	1926.23	2	3440.0%	1	R.IRCILLSNLSNTSHAPK.L
*	TK270802_E14_cyto_2D_step04.2748.2748.1	1.811	0.3375	1471.11	9	4550.0%	1	R.RQQEQLVPTLEK.F
*	TK270802_E14_cyto_2D_step01.3991.3991.1	2.2995	0.5567	1412.8	1	5910.0%	1	K.DNLEFFLTNLGK.V
*	TK270802_E14_cyto_2D_step06.2791.2791.2	2.2282	0.2239	1294.66	1	6000.0%	2	R.LQVVDRPLPVR.G
*	TK270802_E14_cyto_2D_step07.2438.2438.1	1.5607	0.1662	1269.85	7	5000.0%	1	R.HFQLEQDKPK.E
*	TK270802_E14_cyto_2D_step12.3549.3549.2	3.0092	0.5232	2501.37	1	4320.0%	1	K.VHLTGINVNPNALFPPVEFPAPR.G
*	TK270802_E14_cyto_2D_step06.2718.2718.1	1.5688	0.351	1063.35	4	3890.0%	2	R.GTPLISPHIK.W
*	TK270802_E14_cyto_2D_step14.4636.4636.3	2.545	0.2449	3359.3	1	2070.0%	3	K.VLLSLEHGVWAPNLHFHNPNPEIPALLDGR.L
UTRXB_MOUSE99.6%101829.1%499544976.3(Q9JMH6) Thioredoxin reductase, cytoplasmic (EC 1.6.4.5) (TR) 
*	TK270802_E14_cyto_2D_step03.4227.4227.2	1.363	0.2032	2666.9	1	2290.0%	1	R.VTAQSTNSEETIEGEFNTVLLAVGR.D
*	TK270802_E14_cyto_2D_step10.2161.2161.1	0.9687	0.0246	726.75	4	7000.0%	1	R.FIGPHR.I
*	TK270802_E14_cyto_2D_step09.3092.3092.1	2.9796	0.4961	1395.85	1	6670.0%	3	K.LMHQAALLGQALK.D
	TK270802_E14_cyto_2D_step07.3828.3828.2	3.2328	0.5764	2284.54	1	4770.0%	2	R.VVGFHVLGPNAGEVTQGFAAALK.C
*	TK270802_E14_cyto_2D_step04.3306.3306.2	3.6898	0.6428	1968.23	1	5620.0%	1	K.MTESVQSHIGSLNWGYR.V
*	TK270802_E14_cyto_2D_step13.2501.2501.3	1.9189	0.0195	2692.44	10	1760.0%	1	K.DPPGSYDFDLIIIGGGSGGLAAAKEAAK.F
*	TK270802_E14_cyto_2D_step09.4396.4396.3	1.4371	0.1071	3777.32	12	1330.0%	1	R.LYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEK.A
UTCPD_MOUSE99.6%154523.4%539580668.0(P80315) T-complex protein 1, delta subunit (TCP-1-delta) (CCT-delta) (A45) 
	TK270802_E14_cyto_2D_step04.3117.3117.1	2.0265	0.4029	1186.03	1	5000.0%	5	R.SIHDALCVIR.C
	TK270802_E14_cyto_2D_step06.3063.3063.2	2.5602	0.4517	1458.83	1	5830.0%	1	K.GIHPTIISESFQK.A
	TK270802_E14_cyto_2D_step01.4574.4574.2	4.3603	0.6635	3035.14	1	3930.0%	1	R.AFADAMEVIPSTLAENAGLNPISTVTELR.N
	TK270802_E14_cyto_2D_step07.2358.2358.1	1.2129	0.0321	1152.89	27	4440.0%	2	K.QMQVLHPAAR.M
*	TK270802_E14_cyto_2D_step07.1838.1838.3	1.1824	0.0078	3491.09	27	1290.0%	1	K.TIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGK.L
	TK270802_E14_cyto_2D_step02.5107.5107.2	1.0888	0.1959	3107.29	8	1550.0%	2	K.AQDIEAGDGTTSVVIIAGSLLDSCTKLLQK.G
UGTP1_MOUSE99.6%71323.4%209234067.8(P46425) Glutathione S-transferase P 1 (EC 2.5.1.18) (GST YF-YF) (GST-piA) (GST class-pi) 
	TK270802_E14_cyto_2D_step04.2684.2684.2	2.3902	0.3754	2067.81	1	5560.0%	1	K.AFLSSPEHVNRPINGNGKQ.-
	TK270802_E14_cyto_2D_step15.2172.2172.2	0.6637	0.0572	1135.66	7	3330.0%	1	R.SLGLYGKNQR.E
	TK270802_E14_cyto_2D_step13.3509.3509.2	3.3227	0.2916	2137.08	1	5260.0%	3	K.ALPGHLKPFETLLSQNQGGK.A
	TK270802_E14_cyto_2D_step01.2240.2240.1	1.0157	0.1214	738.47	6	5000.0%	1	R.SLGLYGK.N
UPCB2_MOUSE99.6%5715.5%362382226.8(Q61990) Poly(rC)-binding protein 2 (Alpha-CP2) (Putative heterogeneous nuclear ribonucleoprotein X) (hnRNP X) (CTBP) (CBP) 
	TK270802_E14_cyto_2D_step15.4196.4196.3	4.2502	0.5899	3355.47	1	2750.0%	2	K.AFAMIIDKLEEDISSSMTNSTAASRPPVTLR.L
	TK270802_E14_cyto_2D_step01.1902.1902.1	1.6074	0.1573	1290.39	11	4500.0%	1	R.INISEGNCPER.I
	TK270802_E14_cyto_2D_step07.2210.2210.1	1.1321	0.0069	699.91	4	6000.0%	1	R.LLMHGK.E
	TK270802_E14_cyto_2D_step01.2140.2140.1	1.0336	0.0647	802.91	23	5000.0%	1	K.EVGSIIGK.K
UGAL1_MOUSE99.6%484.6%391421765.3(Q9R0N0) Galactokinase (EC 2.7.1.6) (Galactose kinase) 
*	TK270802_E14_cyto_2D_step05.2139.2139.1	1.6536	0.1162	842.04	25	5830.0%	2	R.HVVSEIR.R
*	TK270802_E14_cyto_2D_step04.2232.2232.1	2.192	0.4485	1231.96	1	5000.0%	2	R.HSLGSSEYPVR.R
UZIN_MOUSE99.6%228.9%760816015.4(P58404) Zinedin 
*	TK270802_E14_cyto_2D_step11.2337.2337.3	3.2875	0.5874	3599.52	1	2120.0%	1	R.AAAAVASAASSCRPLGSGTAPNPTAAAPASSPAPGPGPVGK.G
	TK270802_E14_cyto_2D_step09.4722.4722.2	0.69	0.0687	2742.61	29	960.0%	1	K.HEEAIHAVACHPSKALIASAGADALAK.V
UDYHC_MOUSE99.6%24346.6%46445320306.4(Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein heavy chain) 
*	TK270802_E14_cyto_2D_step05.1623.1623.3	1.1273	0.0788	2206.69	5	1620.0%	1	K.AEVDMDTDAPQVSHKPGGEPK.I
*	TK270802_E14_cyto_2D_step01.2819.2819.1	0.9873	0.1795	1485.23	2	3640.0%	1	K.FKVQYPQSQACK.M
	TK270802_E14_cyto_2D_step02.4536.4536.3	1.8777	0.2977	2788.39	1	2270.0%	1	K.VFYEEELDVPLVLFNEVLDHVLR.I
	TK270802_E14_cyto_2D_step06.2714.2714.1	1.4412	0.2657	1093.07	1	5620.0%	1	K.HLLPVETQR.F
*	TK270802_E14_cyto_2D_step05.2514.2514.2	3.6476	0.5044	2635.41	1	4570.0%	2	R.VLRPQVTAVAQQNQGEAPEPQDMK.V
*	TK270802_E14_cyto_2D_step08.2572.2572.2	1.432	0.1046	1752.98	3	3330.0%	1	K.RAPVIDADKPVSSQLR.V
*	TK270802_E14_cyto_2D_step05.1515.1515.3	1.0198	0.0119	2711.72	94	1140.0%	1	K.KVCQEMYLTYGDGEEVGGMWVEK.V
*	TK270802_E14_cyto_2D_step01.3996.3996.1	1.5373	0.201	1375.34	30	3640.0%	1	K.VNFLPEIITLSK.E
	TK270802_E14_cyto_2D_step08.3854.3854.2	0.8915	0.0429	2698.01	110	1090.0%	2	R.HVPVVYVDYPGPASLTQIYGTFNR.A
	TK270802_E14_cyto_2D_step08.2072.2072.1	1.1461	0.1898	853.63	9	4290.0%	3	K.ALGHQLGR.F
*	TK270802_E14_cyto_2D_step13.1809.1809.2	1.2109	0.1573	946.67	3	5710.0%	1	K.LPQPPTHR.E
*	TK270802_E14_cyto_2D_step13.4194.4194.2	1.274	0.293	2375.06	1	2250.0%	1	R.TLHTTASNWLHLIPQTLSPLK.R
*	TK270802_E14_cyto_2D_step03.2612.2612.1	1.2587	0.2888	1595.85	1	3210.0%	1	R.APVIDADKPVSSQLR.V
*	TK270802_E14_cyto_2D_step09.4576.4576.3	1.4534	0.2163	4572.82	2	940.0%	1	R.ITTVPLPTAPNVPIIDYEVSISGEWSPWQAKVPQIEVETHK.V
	TK270802_E14_cyto_2D_step03.2439.2439.3	1.5813	0.0258	2371.06	113	1750.0%	1	R.FYFVGDEDLLEIIGNSKNVAK.L
	TK270802_E14_cyto_2D_step14.2110.2110.2	0.8918	0.067	1461.54	100	2080.0%	1	R.QDLADVVQVCEGK.K
	TK270802_E14_cyto_2D_step04.2124.2124.1	1.2715	0.2062	1110.03	32	4440.0%	1	K.TPVSITEHPK.I
	TK270802_E14_cyto_2D_step01.0577.0577.1	1.1738	0.0844	546.94	3	7500.0%	1	K.VLGTR.K
*	TK270802_E14_cyto_2D_step03.2367.2367.1	1.5504	0.0652	1181.09	7	5560.0%	1	K.VPQIEVETHK.V
	TK270802_E14_cyto_2D_step10.3625.3625.2	2.5504	0.3101	1637.02	1	5380.0%	1	K.NVHLAPGWLMQLEK.K
URAN_HUMAN99.6%3526338.0%216244237.5(P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) (P17080) GTP-binding nuclear protein RAN (TC4) (Ran GTPase) (Androgen receptor-associated protein 24) 
	TK270802_E14_cyto_2D_step03.2238.2238.1	1.071	0.0441	550.06	1	8750.0%	2	K.FGGLR.D
	TK270802_E14_cyto_2D_step14.1605.1605.1	0.524	0.0024	753.2	20	2000.0%	1	K.TTFVKR.H
	TK270802_E14_cyto_2D_step01.2764.2764.1	2.6172	0.4877	1518.09	1	6670.0%	2	R.VCENIPIVLCGNK.V
	TK270802_E14_cyto_2D_step12.3236.3236.2	2.3475	0.5082	2056.37	1	3530.0%	14	K.YVATLGVEVHPLVFHTNR.G
	TK270802_E14_cyto_2D_step04.2273.2273.1	1.953	0.2972	962.93	1	6430.0%	2	R.HLTGEFEK.K
	TK270802_E14_cyto_2D_step01.2391.2391.1	1.471	0.261	1215.94	1	6110.0%	2	K.NLQYYDISAK.S
	TK270802_E14_cyto_2D_step01.2636.2636.1	0.8248	0.0032	1295.14	2	4000.0%	1	K.FNVWDTAGQEK.F
	TK270802_E14_cyto_2D_step01.2304.2304.1	2.0811	0.3208	1018.62	1	5500.0%	2	K.LVLVGDGGTGK.T
	TK270802_E14_cyto_2D_step10.2390.2390.2	1.3321	0.162	1119.15	1	7500.0%	3	K.RHLTGEFEK.K
UCAN2_MOUSE99.6%111325.0%700798725.0(O08529) Calpain 2, large [catalytic] subunit precursor (EC 3.4.22.17) (Calcium-activated neutral proteinase) (CANP) (M-type) (M-calpain) (Millimolar-calpain) (80 kDa M-calpain subunit) (CALP80) 
*	TK270802_E14_cyto_2D_step05.3478.3478.2	2.122	0.2959	1911.89	1	4060.0%	1	K.LPPGEYVLVPSTFEPHK.D
*	TK270802_E14_cyto_2D_step14.4280.4280.3	1.147	0.2029	4338.91	5	1050.0%	1	K.INGCYEALSGGATTEGFEDFTGGIAEWYELRKPPPNLFK.I
	TK270802_E14_cyto_2D_step05.3245.3245.2	2.0711	0.2724	2004.6	3	4410.0%	1	K.RPTEICADPQFIIGGATR.T
*	TK270802_E14_cyto_2D_step05.3302.3302.3	1.5851	0.1564	2712.77	42	1770.0%	1	R.NECLEAGALFQDPSFPALPSSLGYK.E
*	TK270802_E14_cyto_2D_step09.2445.2445.2	1.0255	0.0243	2038.73	12	2630.0%	1	K.GHAYSVTGAEEVESSGSLQK.L
	TK270802_E14_cyto_2D_step11.2511.2511.2	0.9005	0.0946	942.28	2	5000.0%	1	R.KPPPNLFK.I
*	TK270802_E14_cyto_2D_step03.3215.3215.2	1.0955	0.0328	1824.58	157	2500.0%	1	K.IMVDMLDEDGSGKLGLK.E
*	TK270802_E14_cyto_2D_step09.2402.2402.3	1.0563	0.0466	2831.13	105	960.0%	1	K.ALEKGSLLGCSIDITSAADSEAVTYQK.L
*	TK270802_E14_cyto_2D_step10.2714.2714.2	3.4175	0.5583	1436.3	1	8180.0%	2	K.LPCQLHQVIVAR.F
UQ9DCB799.6%4615.7%1591826210.1(Q9DCB7) 3100001N19Rik protein 
	TK270802_E14_cyto_2D_step03.3523.3523.2	3.3732	0.5007	1356.03	1	8640.0%	1	K.LVAIVDVIDQNR.A
	TK270802_E14_cyto_2D_step10.1858.1858.1	1.005	0.0761	716.31	1	6000.0%	2	K.FPHSAR.Q
	TK270802_E14_cyto_2D_step05.2073.2073.1	1.1068	0.0164	879.19	1	5000.0%	1	R.RYVEVGR.V
UQ9CXZ299.6%3513.5%163174037.1(Q9CXZ2) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510049H02, full insert sequence 
	TK270802_E14_cyto_2D_step01.2535.2535.1	1.8386	0.2358	889.27	1	5620.0%	1	K.AAVSGLWGK.V
	TK270802_E14_cyto_2D_step01.2100.2100.1	2.4097	0.458	1289.14	2	5420.0%	2	K.VNADEVGGEALGR.L
UNED4_MOUSE99.6%245022.6%9571099685.6(P46935) NEDD-4 protein (EC 6.3.2.-) (Fragment) 
	TK270802_E14_cyto_2D_step03.2690.2690.1	1.4162	0.3188	884.12	1	7500.0%	1	K.DFVLHPR.S
*	TK270802_E14_cyto_2D_step04.3440.3440.3	2.0157	0.4096	3121.16	10	1800.0%	1	R.TQWKRPSPDDDLTDEDNDDMQLQAQR.A
	TK270802_E14_cyto_2D_step05.2226.2226.1	1.5322	0.1791	1034.8	1	5000.0%	2	R.VAGMAVYHGK.L
	TK270802_E14_cyto_2D_step06.1955.1955.1	1.6821	0.2019	907.55	20	5830.0%	2	R.AHTCFNR.L
	TK270802_E14_cyto_2D_step05.2922.2922.1	1.6697	0.2012	890.07	1	8000.0%	1	R.KYEFFR.R
*	TK270802_E14_cyto_2D_step04.2112.2112.2	3.7126	0.6557	2173.2	1	4750.0%	2	R.LAVCGNPATSQPVTSSNHSSR.G
	TK270802_E14_cyto_2D_step02.4255.4255.2	1.4187	0.3644	2756.69	1	2500.0%	1	K.IFDENELELLMCGLGDVDVNDWR.E
	TK270802_E14_cyto_2D_step12.1861.1861.1	0.6264	0.0148	1071.97	32	2140.0%	1	R.MERPYTFK.D
	TK270802_E14_cyto_2D_step09.2088.2088.1	0.9969	0.171	707.85	18	4000.0%	4	K.IPAHLR.G
	TK270802_E14_cyto_2D_step01.2524.2524.1	1.3296	0.2953	842.65	1	5620.0%	2	K.VIAGIGLAK.K
	TK270802_E14_cyto_2D_step15.2312.2312.2	0.9603	0.0809	2028.28	2	2940.0%	1	R.LWIEFDGEKGLDYGGVAR.E
	TK270802_E14_cyto_2D_step01.4359.4359.1	1.5802	0.2	1551.28	2	4580.0%	1	K.EGFFELIPQDLIK.I
*	TK270802_E14_cyto_2D_step11.2146.2146.2	1.2139	0.3847	1866.55	1	3210.0%	1	R.LDLPPYESFDELWDK.L
*	TK270802_E14_cyto_2D_step02.4330.4330.3	1.1034	0.0107	4161.47	35	950.0%	1	R.LLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDK.L
*	TK270802_E14_cyto_2D_step07.3092.3092.1	1.7266	0.1194	1133.69	1	5000.0%	3	R.VFFINHNIK.K
UCLH1_HUMAN99.6%428825.4%16751916135.7(Q00610) Clathrin heavy chain 1 (CLH-17) 
*	TK270802_E14_cyto_2D_step14.2134.2134.3	1.3558	0.12	2004.44	1	3280.0%	1	R.KDPELWGSVLLESNPYR.R
*	TK270802_E14_cyto_2D_step03.3271.3271.1	1.2394	0.1081	828.51	9	5000.0%	2	K.NLILVVR.G
*	TK270802_E14_cyto_2D_step06.3074.3074.2	2.5053	0.4172	1760.06	1	5330.0%	1	R.KFNALFAQGNYSEAAK.V
	TK270802_E14_cyto_2D_step05.2215.2215.1	2.1659	0.2189	1072.01	2	6250.0%	2	R.AHIAQLCEK.A
*	TK270802_E14_cyto_2D_step10.3547.3547.2	1.3393	0.0063	2383.92	1	3330.0%	1	K.YGYIHLYDLETGTCIYMNR.I
*	TK270802_E14_cyto_2D_step05.2217.2217.2	3.6299	0.5984	1778.58	1	6330.0%	1	R.IHEGCEEPATHNALAK.I
*	TK270802_E14_cyto_2D_step12.4460.4460.2	0.7436	0.0714	2885.97	11	1000.0%	1	R.RPLIDQVVQTALSETQDPEEVSVTVK.A
*	TK270802_E14_cyto_2D_step06.2102.2102.1	1.3151	0.087	1370.66	5	4090.0%	2	K.NNRPSEGPLQTR.L
*	TK270802_E14_cyto_2D_step03.3543.3543.2	1.4845	0.2178	2354.22	1	3640.0%	2	R.ISGETIFVTAPHEATAGIIGVNR.K
*	TK270802_E14_cyto_2D_step04.2998.2998.1	2.0404	0.3795	944.8	1	6670.0%	1	K.HELIEFR.R
*	TK270802_E14_cyto_2D_step10.4095.4095.2	4.3645	0.577	2371.22	1	5500.0%	5	R.KFDVNTSAVQVLIEHIGNLDR.A
*	TK270802_E14_cyto_2D_step04.1395.1395.3	1.0664	0.0112	1433.11	385	1880.0%	1	K.SVDPTLALSVYLR.A
*	TK270802_E14_cyto_2D_step04.3353.3353.2	3.543	0.5353	1973.15	1	5280.0%	1	R.LASTLVHLGEYQAAVDGAR.K
*	TK270802_E14_cyto_2D_step04.3226.3226.3	1.5973	0.0789	2360.94	4	2140.0%	2	K.MEGNAEESTLFCFAVRGQAGGK.L
*	TK270802_E14_cyto_2D_step04.0665.0665.2	0.8756	0.0555	3150.0	74	1300.0%	2	R.FQEHLQLQNLGINPANIGFSTLTMESDK.F
*	TK270802_E14_cyto_2D_step02.4246.4246.2	2.2046	0.4849	3190.36	1	3390.0%	1	R.FQSVPAQPGQTSPLLQYFGILLDQGQLNK.Y
*	TK270802_E14_cyto_2D_step10.3067.3067.2	2.7571	0.4154	1947.64	1	4410.0%	3	K.LHIIEVGTPPTGNQPFPK.K
*	TK270802_E14_cyto_2D_step11.4353.4353.2	1.4419	0.1055	3073.75	1	2500.0%	1	R.LDNYDAPDIANIAISNELFEEAFAIFR.K
*	TK270802_E14_cyto_2D_step05.2269.2269.1	1.2166	0.1089	1460.77	14	4000.0%	1	R.FLRENPYYDSR.V
*	TK270802_E14_cyto_2D_step05.2518.2518.1	1.9019	0.3727	1559.83	1	3930.0%	3	R.RPISADSAIMNPASK.V
*	TK270802_E14_cyto_2D_step06.2762.2762.1	2.2708	0.3336	1520.9	1	5000.0%	2	R.HSSLAGCQIINYR.T
*	TK270802_E14_cyto_2D_step03.5238.5238.3	1.1258	0.0314	3728.73	51	970.0%	1	K.WISLNTVALVTDNAVYHWSMEGESQPVKMFDR.H
*	TK270802_E14_cyto_2D_step04.2925.2925.2	2.8034	0.5869	1718.75	1	5670.0%	1	K.VSQPIEGHAASFAQFK.M
	TK270802_E14_cyto_2D_step04.1817.1817.1	0.957	0.1365	1058.9	13	3120.0%	1	K.TGQIKEVER.I
ULEG1_MOUSE99.6%123845.5%134147355.5(P16045) Galectin-1 (Beta-galactoside-binding lectin L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin) (14 kDa lectin) 
	TK270802_E14_cyto_2D_step03.2826.2826.1	2.0539	0.3996	1488.92	1	5000.0%	4	K.DSNNLCLHFNPR.F
	TK270802_E14_cyto_2D_step04.2238.2238.2	2.265	0.3082	1663.14	1	5000.0%	2	R.FNAHGDANTIVCNTK.E
	TK270802_E14_cyto_2D_step10.4033.4033.2	2.6365	0.5406	2927.51	1	3200.0%	1	R.EPAFPFQPGSITEVCITFDQADLTIK.L
	TK270802_E14_cyto_2D_step03.2334.2334.1	1.7703	0.1928	944.55	5	5710.0%	4	K.LPDGHEFK.F
UQ91VW399.6%1135.5%93104775.1(Q91VW3) Similar to SH3 domain binding glutamic acid-rich protein like 3 
*	TK270802_E14_cyto_2D_step11.4093.4093.3	3.9753	0.5701	3828.37	1	2270.0%	1	K.ATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLK.L
UHMG1_MOUSE99.6%6960542.5%214247635.7(P07155) High mobility group protein 1 (HMG-1) (Amphoterin) (Heparin-binding protein p30) 
	TK270802_E14_cyto_2D_step13.2162.2162.1	0.4895	0.036	1496.08	30	1360.0%	1	K.MSSYAFFVQTCR.E
	TK270802_E14_cyto_2D_step01.1774.1774.1	1.4311	0.0447	711.28	1	8000.0%	2	K.DIAAYR.A
	TK270802_E14_cyto_2D_step03.1940.1940.2	1.9659	0.3344	1135.12	1	6110.0%	1	K.TYIPPKGETK.K
	TK270802_E14_cyto_2D_step03.2867.2867.2	2.8593	0.4933	1596.46	1	6920.0%	2	K.KLGEMWNNTAADDK.Q
	TK270802_E14_cyto_2D_step03.4924.4924.1	1.345	0.0795	1468.3	1	4170.0%	10	K.HPDASVNFSEFSK.K
	TK270802_E14_cyto_2D_step03.2226.2226.1	1.8473	0.0755	927.82	2	5710.0%	3	K.GKFEDMAK.A
	TK270802_E14_cyto_2D_step04.1672.1672.1	1.2784	0.0164	918.98	1	6430.0%	3	K.FKDPNAPK.R
	TK270802_E14_cyto_2D_step05.1195.1195.3	0.8772	0.017	2019.13	213	1170.0%	1	K.MSSYAFFVQTCREEHK.K
	TK270802_E14_cyto_2D_step09.2928.2928.2	3.4293	0.6359	1524.71	1	6790.0%	13	K.IKGEHPGLSIGDVAK.K
	TK270802_E14_cyto_2D_step03.2804.2804.1	2.5731	0.4673	1282.07	1	5420.0%	6	K.GEHPGLSIGDVAK.K
	TK270802_E14_cyto_2D_step08.2796.2796.1	2.9828	0.4876	1593.6	1	5380.0%	1	K.KHPDASVNFSEFSK.K
UQ9UEV999.6%12167.6%26022781905.7(Q9UEV9) Actin-binding protein homolog ABP-278 
	TK270802_E14_cyto_2D_step04.1513.1513.3	0.9361	0.0085	2136.16	101	1320.0%	1	K.SGCIVNNLAEFTVDPKDAGK.A
	TK270802_E14_cyto_2D_step03.1476.1476.3	1.2916	0.1265	1606.07	7	1330.0%	1	K.TGEEVGFVVDAKTAGK.G
	TK270802_E14_cyto_2D_step14.2633.2633.3	1.4699	0.1196	2947.06	8	1640.0%	2	R.GEAGVPAEFSIWTREAGAGGLSIAVEGPSK.A
	TK270802_E14_cyto_2D_step12.3016.3016.2	1.0767	0.0411	2312.47	45	2050.0%	2	R.GQHVTGSPFQFTVGPLGEGGAHK.V
	TK270802_E14_cyto_2D_step13.2406.2406.3	0.8901	0.011	3140.53	151	890.0%	1	K.VMYTPMAPGNYLISVKYGGPNHIVGSPFK.A
	TK270802_E14_cyto_2D_step07.2986.2986.2	1.3803	0.2277	1628.38	1	3850.0%	1	R.YAPTEVGLHEMHIK.Y
	TK270802_E14_cyto_2D_step12.3495.3495.2	1.0289	0.0356	2866.37	10	1600.0%	1	R.FIPHENGVHTIDVKFNGSHVVGSPFK.V
	TK270802_E14_cyto_2D_step13.3608.3608.3	1.3887	0.1155	3941.91	3	1410.0%	1	R.AWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAK.I
	TK270802_E14_cyto_2D_step10.2854.2854.1	1.263	0.228	1276.71	9	3750.0%	1	R.AWGPGLHGGIVGR.S
URLA0_MOUSE99.6%91729.3%317342166.2(P14869) 60S acidic ribosomal protein P0 (L10E) 
	TK270802_E14_cyto_2D_step03.3806.3806.1	1.4261	0.2974	1430.8	5	4170.0%	2	R.GTIEILSDVQLIK.T
	TK270802_E14_cyto_2D_step04.2104.2104.1	2.1606	0.203	1220.69	1	5000.0%	1	R.GHLENNPALEK.L
*	TK270802_E14_cyto_2D_step01.3267.3267.2	2.8264	0.4281	2699.6	1	4170.0%	2	K.AFLADPSAFAAAAPAAAATTAAPAAAAAPAK.A
	TK270802_E14_cyto_2D_step08.3586.3586.2	1.0628	0.0212	2790.24	4	1600.0%	2	R.NVASVCLQIGYPTVASVPHSIINGYK.R
	TK270802_E14_cyto_2D_step01.3774.3774.1	2.2799	0.4472	1316.54	1	5450.0%	2	K.TSFFQALGITTK.I
URHOA_MOUSE99.6%92339.4%193217826.1(Q9QUI0) Transforming protein RhoA 
	TK270802_E14_cyto_2D_step06.3651.3651.1	1.6859	0.1791	1082.29	1	6880.0%	1	K.TCLLIVFSK.D
	TK270802_E14_cyto_2D_step05.2519.2519.1	1.3574	0.3143	1216.9	1	5000.0%	1	K.KLVIVGDGACGK.T
	TK270802_E14_cyto_2D_step01.4591.4591.2	1.0002	0.085	2776.13	1	2610.0%	2	K.DQFPEVYVPTVFENYVADIEVDGK.Q
	TK270802_E14_cyto_2D_step07.4132.4132.2	0.9466	0.1164	2011.66	8	2500.0%	1	K.QVELALWDTAGQEDYDR.L
	TK270802_E14_cyto_2D_step10.3277.3277.2	3.6987	0.5378	1609.81	1	8460.0%	4	K.HFCPNVPIILVGNK.K
UPDI_MOUSE99.6%176118.7%509571444.9(P09103) Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (P55) (ERP59) 
	TK270802_E14_cyto_2D_step10.4144.4144.2	4.0828	0.64	2988.1	1	3790.0%	4	R.TGPAATTLSDTAAAESLVDSSEVTVIGFFK.D
	TK270802_E14_cyto_2D_step07.3792.3792.2	1.5293	0.0524	1968.24	3	3440.0%	3	K.HNQLPLVIEFTEQTAPK.I
	TK270802_E14_cyto_2D_step11.3462.3462.1	0.9087	0.0208	1083.45	1	4380.0%	1	K.THILLFLPK.S
	TK270802_E14_cyto_2D_step07.2666.2666.1	1.6756	0.2952	930.73	1	5710.0%	3	K.VHSFPTLK.F
	TK270802_E14_cyto_2D_step07.3838.3838.2	3.2908	0.4305	1836.32	1	6430.0%	5	K.ILFIFIDSDHTDNQR.I
	TK270802_E14_cyto_2D_step09.3018.3018.2	2.0598	0.0935	1955.86	1	4000.0%	1	K.IKPHLMSQEVPEDWDK.Q
USODC_MOUSE99.6%144230.1%153158116.5(P08228) Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) 
*	TK270802_E14_cyto_2D_step04.1909.1909.1	1.5822	0.2546	845.85	4	6670.0%	2	R.TMVVHEK.Q
*	TK270802_E14_cyto_2D_step04.3025.3025.1	1.9598	0.2683	1370.98	1	5000.0%	2	R.VISLSGEHSIIGR.T
*	TK270802_E14_cyto_2D_step03.2599.2599.2	3.0623	0.38	1515.61	1	6920.0%	1	K.GDGPVQGTIHFEQK.A
*	TK270802_E14_cyto_2D_step03.2306.2306.1	2.0161	0.4236	1170.1	1	5910.0%	5	R.HVGDLGNVTAGK.D
UQ9CQ9999.6%41039.1%115116514.5(Q9CQ99) 2700049I22Rik protein (RIKEN cDNA 2700049I22 gene) 
	TK270802_E14_cyto_2D_step01.2303.2303.2	3.4291	0.6044	2776.77	1	3280.0%	1	K.LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK.K
*	TK270802_E14_cyto_2D_step01.2503.2503.1	1.6975	0.2459	1245.54	1	5910.0%	3	K.NIEDVIAQGVGK.L
UQ99PC399.6%6187.9%3924659810.0(Q99PC3) CGI-74-like SR-rich protein 
	TK270802_E14_cyto_2D_step10.2783.2783.2	2.9843	0.4576	1868.86	1	5330.0%	4	K.SHLLNCCPHDVLSGTR.M
	TK270802_E14_cyto_2D_step05.2407.2407.1	1.5328	0.0608	824.98	1	6670.0%	1	K.VHDLALR.A
	TK270802_E14_cyto_2D_step04.2105.2105.1	1.8761	0.2469	845.64	3	6430.0%	1	R.LADHFGGK.L
UENOB_HUMAN99.6%181946.9%433468567.7(P13929) Beta enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle enolase) (MSE) (Enolase 3) 
*	TK270802_E14_cyto_2D_step07.4842.4842.2	2.2078	0.3005	3026.36	1	2930.0%	13	R.HIADLAGNPDLILPVPAFNVINGGSHAGNK.L
UQ9EPZ299.6%112.5%831926317.4(Q9EPZ2) ELAC2 
*	TK270802_E14_cyto_2D_step09.3061.3061.2	3.2375	0.519	2462.99	1	4750.0%	1	R.FGPDTQHLILNENCPSVHNLR.S
UPSB6_MOUSE99.6%104221.4%238254255.1(Q60692) Proteasome subunit beta type 6 precursor (EC 3.4.25.1) (Proteasome delta chain) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome subunit Y) 
*	TK270802_E14_cyto_2D_step12.2499.2499.2	1.7504	0.1801	1570.8	1	5000.0%	5	K.LTPIHDHIFCCR.S
	TK270802_E14_cyto_2D_step08.4226.4226.3	3.3588	0.4818	4059.65	1	2170.0%	4	R.SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK.E
UMY9B_HUMAN99.6%6122.0%21582435558.7(Q13459) Myosin IXb (Unconventional myosin-9b) 
*	TK270802_E14_cyto_2D_step06.3199.3199.1	1.2005	0.0563	1346.77	1	4090.0%	1	R.ELIGMDPVAVFR.W
*	TK270802_E14_cyto_2D_step01.0187.0187.1	2.6776	0.1321	1156.61	2	6880.0%	3	K.YLDEFLLNK.I
*	TK270802_E14_cyto_2D_step14.2274.2274.2	0.7052	0.0045	1747.58	63	2140.0%	1	K.YVHMQLVAQATATRR.L
*	TK270802_E14_cyto_2D_step08.1879.1879.1	0.5952	0.012	848.54	47	3330.0%	1	K.NDFEPVK.Q
UT172_HUMAN99.6%444.1%18492068866.5(O14981) TBP-associated factor 172 (TAF-172) (TAF(II)170) 
*	TK270802_E14_cyto_2D_step10.3537.3537.2	0.929	0.049	1914.28	2	3120.0%	1	R.QEPTSESSMEDSPTTER.L
*	TK270802_E14_cyto_2D_step05.3703.3703.3	1.0509	0.1373	3195.24	3	1110.0%	1	K.LHGILCDDMGLGKTLQSICILAGDHCHR.A
*	TK270802_E14_cyto_2D_step13.2241.2241.2	1.5988	0.0077	1608.94	1	5830.0%	1	K.FNYCILDEGHVIK.N
*	TK270802_E14_cyto_2D_step13.2965.2965.2	3.8844	0.5692	2003.48	1	5620.0%	1	K.LCNHPALVLTPQHPEFK.T
UCAP1_MOUSE99.6%143225.7%474515757.5(P40124) Adenylyl cyclase-associated protein 1 (CAP 1) 
*	TK270802_E14_cyto_2D_step04.3133.3133.1	2.5055	0.3382	1228.73	1	7000.0%	2	K.KEPALLELEGK.K
	TK270802_E14_cyto_2D_step06.3438.3438.2	2.3503	0.3521	1930.64	1	4120.0%	4	R.SALFAQINQGESITHALK.H
	TK270802_E14_cyto_2D_step03.3015.3015.1	1.144	0.1401	1277.86	1	5500.0%	2	K.EFHTTGLAWSK.T
	TK270802_E14_cyto_2D_step05.2537.2537.1	1.4463	0.1535	812.7	1	7000.0%	1	K.HVDWVR.A
	TK270802_E14_cyto_2D_step07.4561.4561.3	1.5741	0.0659	4028.7	37	1210.0%	1	K.NSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFK.T
*	TK270802_E14_cyto_2D_step03.2347.2347.2	2.6914	0.4995	2181.35	1	4740.0%	1	R.LEAVSHTSDMHCGYGDSPSK.G
	TK270802_E14_cyto_2D_step03.2004.2004.1	1.1361	0.1699	1151.8	1	4440.0%	1	K.TDGCHAYLSK.N
	TK270802_E14_cyto_2D_step08.2342.2342.1	1.9729	0.4756	1122.85	1	6670.0%	2	K.HAEMVHTGLK.L
UPGK1_MOUSE99.6%2410028.8%416444057.6(P09411) Phosphoglycerate kinase 1 (EC 2.7.2.3) 
	TK270802_E14_cyto_2D_step04.4218.4218.2	2.4421	0.4084	1773.08	1	5310.0%	7	K.ALESPERPFLAILGGAK.V
	TK270802_E14_cyto_2D_step02.2890.2890.1	1.0393	0.05	774.64	122	4290.0%	1	K.GKDASGNK.V
	TK270802_E14_cyto_2D_step06.2549.2549.1	2.4929	0.4161	1369.9	1	5420.0%	4	R.AHSSMVGVNLPQK.A
*	TK270802_E14_cyto_2D_step01.0166.0166.1	1.3016	0.1978	1220.0	1	6000.0%	1	K.YSLEPVAAELK.S
*	TK270802_E14_cyto_2D_step04.1878.1878.1	1.5728	0.3729	893.9	1	6430.0%	1	K.KYAEAVGR.A
	TK270802_E14_cyto_2D_step03.2095.2095.1	1.1431	0.1173	977.81	3	4290.0%	1	R.FHVEEEGK.G
*	TK270802_E14_cyto_2D_step02.0670.0670.2	0.7279	0.0887	2929.45	122	770.0%	1	K.FCLDNGANSVVLMSHLGRPDGVPMPDK.Y
	TK270802_E14_cyto_2D_step05.1464.1464.2	1.8464	0.1105	1204.07	29	6110.0%	5	K.IQLINNMLDK.V
	TK270802_E14_cyto_2D_step04.3097.3097.2	3.9736	0.6402	1743.47	1	6760.0%	1	K.VSHVSTGGGASLELLEGK.V
UYB1_MOUSE99.6%101822.0%322357309.9(P27817) Nuclease sensitive element binding protein 1 (Y box binding protein-1) (Y-box transcription factor) (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (Enhancer factor I subunit A) (EFI-A) (DNA-binding protein B) (DBPB) 
	TK270802_E14_cyto_2D_step08.2455.2455.3	3.5796	0.4388	3227.96	1	2160.0%	2	R.RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.Q
	TK270802_E14_cyto_2D_step05.1770.1770.1	0.9733	0.0042	748.72	13	6250.0%	2	R.RPYRR.R
	TK270802_E14_cyto_2D_step03.2360.2360.1	0.8823	0.0633	1316.8	7	3000.0%	1	R.QPREDGNEEDK.E
	TK270802_E14_cyto_2D_step08.1841.1841.1	0.8337	0.0030	593.4	18	5000.0%	2	R.RYPR.R
	TK270802_E14_cyto_2D_step05.1706.1706.1	1.8729	0.0902	660.59	1	8000.0%	2	K.KVIATK.V
	TK270802_E14_cyto_2D_step06.2491.2491.3	1.3745	0.0382	1591.14	6	2860.0%	1	K.NEGSESAPEGQAQQR.R
UQ8VDM499.6%152918.3%9081002035.2(Q8VDM4) Hypothetical 100.2 kDa protein (Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2) 
	TK270802_E14_cyto_2D_step04.5265.5265.3	1.3671	0.105	3416.25	103	1130.0%	1	R.WLPLGLGLNHLGKGEAIEAILAALEVVSEPFR.S
	TK270802_E14_cyto_2D_step09.2826.2826.1	1.3085	0.0234	843.88	4	7500.0%	2	R.TFGHLLR.Y
	TK270802_E14_cyto_2D_step06.2522.2522.1	1.1776	0.1371	1040.02	5	4440.0%	2	R.LAQGLTHLGK.G
	TK270802_E14_cyto_2D_step07.5206.5206.3	1.2796	0.1922	4188.86	9	1350.0%	1	K.DHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIK.S
*	TK270802_E14_cyto_2D_step01.1571.1571.2	2.3864	0.4349	1929.54	1	5000.0%	1	K.TPVQSQQPSATTPSGADEK.S
	TK270802_E14_cyto_2D_step04.1962.1962.1	1.4716	0.1256	826.57	1	5710.0%	2	R.HLAGEVAK.E
	TK270802_E14_cyto_2D_step06.3075.3075.2	2.7159	0.4054	1843.74	1	5360.0%	3	K.VQQLLHICSEHFDSK.E
*	TK270802_E14_cyto_2D_step04.3569.3569.2	1.33	0.054	2503.67	14	2140.0%	1	K.CFAADIISVLAMTMSGERECLK.Y
	TK270802_E14_cyto_2D_step03.4118.4118.2	2.1897	0.2666	1523.07	1	5360.0%	2	R.AVPLALALISVSNPR.L
UQ921Q599.6%338.8%558608155.6(Q921Q5) Similar to RAP1, GTP-GDP dissociation stimulator 1 
	TK270802_E14_cyto_2D_step06.2665.2665.1	0.8186	0.0707	1461.81	144	2920.0%	1	K.EVQDLAFLDVVSK.L
*	TK270802_E14_cyto_2D_step12.3536.3536.2	0.9875	0.1307	1903.47	191	2060.0%	1	R.MLIDAQAEAAEQLGKNAK.L
	TK270802_E14_cyto_2D_step06.2998.2998.2	3.8788	0.5678	1918.5	1	6180.0%	1	R.HVEDGNVTVQHAALSALR.N
UQ9WV3999.6%558.2%11401268815.3(Q9WV39) Damage-specific DNA binding protein 1 
	TK270802_E14_cyto_2D_step05.3474.3474.2	3.1721	0.515	1646.05	1	7080.0%	1	R.ALYYLQIHPQELR.Q
	TK270802_E14_cyto_2D_step02.3490.3490.2	1.1399	0.1281	2493.06	2	2050.0%	1	R.NGIGIHEHASIDLPGIKGLWPLR.S
	TK270802_E14_cyto_2D_step05.3681.3681.2	1.8673	0.3101	1984.58	2	4120.0%	1	R.IGRPSETGIIGIIDPECR.M
	TK270802_E14_cyto_2D_step13.3589.3589.3	1.1217	0.1264	3737.17	62	1130.0%	1	R.DFNPNWMSAVEILDDDNFLGAENAFNLFVCQK.D
	TK270802_E14_cyto_2D_step06.2919.2919.1	1.7043	0.2913	976.15	1	7500.0%	1	K.IEHSFWR.S
URL1X_MOUSE99.6%153737.5%1762073210.7(P11249) 60S ribosomal protein L18a 
	TK270802_E14_cyto_2D_step02.3335.3335.1	1.0305	0.0024	906.57	38	5830.0%	1	K.NFGIWLR.Y
	TK270802_E14_cyto_2D_step10.2498.2498.1	0.7356	0.0307	764.89	37	5000.0%	1	K.FPLPHR.V
	TK270802_E14_cyto_2D_step07.2457.2457.1	1.7463	0.1233	1097.91	1	5000.0%	4	R.IFAPNHVVAK.S
	TK270802_E14_cyto_2D_step03.3010.3010.1	1.3513	0.1157	782.16	1	6000.0%	2	K.RPNTFF.-
	TK270802_E14_cyto_2D_step08.2279.2279.2	1.7322	0.3375	1044.87	3	7140.0%	1	K.CHTPPLYR.M
	TK270802_E14_cyto_2D_step06.2490.2490.1	2.6538	0.3691	930.08	1	7860.0%	3	R.AHSIQIMK.V
	TK270802_E14_cyto_2D_step05.1895.1895.1	1.369	0.1994	967.8	5	5000.0%	2	R.SGTHNMYR.E
	TK270802_E14_cyto_2D_step01.2171.2171.1	1.1234	0.0525	1456.94	1	4170.0%	1	R.DLTTAGAVTQCYR.D
UPSA5_MOUSE99.6%4425.7%241264114.8(Q9Z2U1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome zeta chain) (EC 3.4.25.1) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) 
	TK270802_E14_cyto_2D_step05.2935.2935.1	1.802	0.178	1588.88	9	4230.0%	1	K.RITSPLMEPSSIEK.I
	TK270802_E14_cyto_2D_step06.3555.3555.2	1.2508	0.0148	2477.29	1	2620.0%	1	K.LNATNIELATVQPGQNFHMFTK.E
*	TK270802_E14_cyto_2D_step03.2594.2594.2	3.1993	0.4813	1963.95	1	4720.0%	1	R.AIGSASEGAQSSLQEVYHK.S
	TK270802_E14_cyto_2D_step02.3046.3046.1	1.5618	0.0635	773.95	5	6670.0%	1	K.SSLIILK.Q
UPSD4_MOUSE99.6%82016.2%376407044.8(O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain binding protein) 
	TK270802_E14_cyto_2D_step03.2642.2642.2	3.1511	0.5168	1711.97	1	6070.0%	1	R.LQAQQDAVNIVCHSK.T
*	TK270802_E14_cyto_2D_step06.5185.5185.3	0.8205	0.0040	3633.23	55	890.0%	1	K.EEDDYDVMQDPEFLQSVLENLPGVDPNNAAIR.S
	TK270802_E14_cyto_2D_step07.2432.2432.1	1.4943	0.0298	753.44	4	6670.0%	3	R.VAHLALK.H
	TK270802_E14_cyto_2D_step06.1937.1937.1	1.9761	0.061	823.11	1	8330.0%	3	K.LHTVQPK.G
UQ91VH999.6%339.6%437490625.7(Q91VH9) Eukaryotic translation termination factor 1 
	TK270802_E14_cyto_2D_step14.2186.2186.3	1.2042	9.0E-4	2184.99	68	1180.0%	1	K.FGATLEIVTDKSQEGSQFVK.G
	TK270802_E14_cyto_2D_step03.2172.2172.1	2.6046	0.3843	1493.61	1	5910.0%	1	R.YVLHCQGTEEEK.I
	TK270802_E14_cyto_2D_step13.1780.1780.1	1.1905	0.0304	946.21	53	3890.0%	1	K.GFGGIGGILR.Y
URS29_HUMAN99.6%2220.0%55654610.1(P30054) 40S ribosomal protein S29 (P30054) 40S ribosomal protein S29 
	TK270802_E14_cyto_2D_step13.2462.2462.2	3.1365	0.5185	1411.12	1	7500.0%	1	-.GHQQLYWSHPR.K
UQ9NXW199.6%3313.6%412468316.8(Q9NXW1) Hypothetical protein FLJ20030 
*	TK270802_E14_cyto_2D_step10.3680.3680.3	0.9242	0.0656	3860.57	28	830.0%	1	R.HLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKR.S
*	TK270802_E14_cyto_2D_step05.5041.5041.2	1.0102	0.0103	2521.14	25	2140.0%	1	R.LQHLAESWGGKENGFGLAECCR.D
*	TK270802_E14_cyto_2D_step05.2621.2621.1	2.592	0.4136	1227.03	1	6000.0%	1	R.LQHLAESWGGK.E
UQ9CSM499.6%41012.9%851021110.6(Q9CSM4) 60S ribosomal protein L27 (Fragment) 
	TK270802_E14_cyto_2D_step06.2751.2751.2	3.179	0.4649	1410.47	1	7000.0%	1	K.VYNYNHLMPTR.Y
UDJA1_MOUSE99.5%61416.4%397448687.1(P54102) DnaJ homolog subfamily A member 1 (Heat shock 40 kDa protein 4) (DnaJ protein homolog 2) (HSJ-2) 
	TK270802_E14_cyto_2D_step04.5152.5152.3	1.2557	0.1025	4779.46	1	1040.0%	1	R.GEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVK.H
	TK270802_E14_cyto_2D_step07.4700.4700.2	1.0304	0.1803	2687.94	1	2270.0%	2	R.HYNGEAYEDDEHHPRGGVQCQTS.-
	TK270802_E14_cyto_2D_step05.2705.2705.1	2.5796	0.3799	1395.92	1	4580.0%	3	R.TIVITSHPGQIVK.H
UANM1_MOUSE99.5%133320.5%371424365.4(Q9JIF0) Protein arginine N-methyltransferase 1 (EC 2.1.1.-) 
	TK270802_E14_cyto_2D_step02.3827.3827.1	1.1612	0.3024	1341.6	2	3000.0%	1	R.DLDFTIDLDFK.G
	TK270802_E14_cyto_2D_step03.3030.3030.2	2.4399	0.3814	1727.82	1	5000.0%	4	R.TGFSTSPESPYTHWK.Q
	TK270802_E14_cyto_2D_step06.2186.2186.1	1.3194	0.204	905.92	24	5830.0%	1	R.NSMFHNR.H
	TK270802_E14_cyto_2D_step08.2568.2568.1	0.6913	0.0096	1160.64	181	2220.0%	1	K.QLVTNACLIK.E
	TK270802_E14_cyto_2D_step01.3739.3739.1	1.4703	0.2722	1401.36	4	3640.0%	1	K.WLAPDGLIFPDR.A
	TK270802_E14_cyto_2D_step04.2856.2856.1	2.5587	0.3923	1039.65	2	6250.0%	3	K.LDHVVTIIK.G
	TK270802_E14_cyto_2D_step03.2755.2755.1	1.785	0.0497	1357.85	1	5910.0%	2	K.GKVEEVELPVEK.V
UP2G4_MOUSE99.5%91720.6%394436996.9(P50580) Proliferation-associated protein 2G4 (Proliferation-associated protein 1) (Protein p38-2G4) 
	TK270802_E14_cyto_2D_step04.3953.3953.2	1.0781	0.15	1631.37	11	3330.0%	1	K.HELLQPFNVLYEK.E
	TK270802_E14_cyto_2D_step07.3608.3608.2	2.3709	0.333	2350.92	1	4000.0%	2	K.GIAFPTSISVNNCVCHFSPLK.S
	TK270802_E14_cyto_2D_step05.2489.2489.1	2.3068	0.2664	1185.12	1	6000.0%	2	K.AAHLCAEAALR.L
	TK270802_E14_cyto_2D_step06.2513.2513.2	3.1491	0.4875	1928.53	1	5940.0%	2	R.LVKPGNQNTQVTEAWNK.V
	TK270802_E14_cyto_2D_step12.2971.2971.2	1.9494	0.48	2172.26	1	3610.0%	2	K.VAHSFNCTPIEGMLSHQLK.Q
UENOA_HUMAN99.5%352.5%433470387.4(P06733) Alpha enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase) 
*	TK270802_E14_cyto_2D_step04.2154.2154.1	1.7086	0.0992	1184.18	9	4000.0%	2	K.GVSKAVEHINK.T
UPHS2_MOUSE99.5%4410.3%842972867.1(Q9WUB3) Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) 
	TK270802_E14_cyto_2D_step03.3096.3096.2	3.1757	0.4498	1875.4	1	6000.0%	1	K.TCAYTNHTVLPEALER.W
	TK270802_E14_cyto_2D_step06.4358.4358.3	1.259	0.0751	3235.45	90	1020.0%	1	K.WVDTQVVLAMPYDTPVPGYRNNVVNTMR.L
	TK270802_E14_cyto_2D_step14.3102.3102.3	0.8056	0.0227	3463.06	76	750.0%	1	R.LAACFLDSMATLGLAAYGYGIRYEFGIFNQK.I
	TK270802_E14_cyto_2D_step01.4236.4236.1	0.6927	0.1999	1285.35	6	2270.0%	1	R.NIATSGKFSSDR.T
UFKB3_MOUSE99.5%116.2%224251489.3(Q62446) Rapamycin-selective 25 kDa immunophilin (FKBP25) (Peptidyl-prolyl cis-trans isomerase) (EC 5.2.1.8) (PPiase) (Rotamase) 
*	TK270802_E14_cyto_2D_step06.3213.3213.2	3.0601	0.5017	1689.09	1	6920.0%	1	K.DHLVNAYNHLFESK.R
UO1525099.5%112.4%623698595.6(O15250) Aminopeptidase P-like (EC 3.4.11.9) (XAA-PRO aminopeptidase) (X-PRO aminopeptidase) (Proline aminopeptidase) (Aminoacylproline aminopeptidase) (Soluble aminopeptidase P) 
*	TK270802_E14_cyto_2D_step06.2913.2913.1	2.5098	0.386	1456.86	1	5710.0%	1	K.GHIAVSAAVFPTGTK.G
UATOX_MOUSE99.5%1127.9%6873386.5(O08997) Copper transport protein ATOX1 (Metal transport protein ATX1) 
*	TK270802_E14_cyto_2D_step05.3227.3227.2	3.1255	0.4665	2133.17	1	5000.0%	1	K.KVCIDSEHSSDTLLATLNK.T
URADI_MOUSE99.5%353.8%583684526.1(P26043) Radixin 
	TK270802_E14_cyto_2D_step05.2295.2295.1	2.4911	0.4109	1497.79	1	5000.0%	2	K.KTQNDVLHAENVK.A
	TK270802_E14_cyto_2D_step07.2225.2225.1	1.3013	0.0848	1248.82	1	5620.0%	1	R.IQNWHEEHR.G
UQ8R3C099.5%9199.5%642728915.6(Q8R3C0) Similar to hypothetical protein FLJ13081 
	TK270802_E14_cyto_2D_step10.3013.3013.2	1.8457	0.255	1282.52	1	6500.0%	2	R.IIQHLVPASFR.L
*	TK270802_E14_cyto_2D_step11.4770.4770.2	1.0396	0.1397	3039.02	23	1460.0%	1	K.VDYDFSYHQMEFPCNINVLITSEGR.S
*	TK270802_E14_cyto_2D_step10.3113.3113.2	3.1948	0.3007	1663.69	1	5380.0%	3	K.LQHINPLLPTCLNK.E
	TK270802_E14_cyto_2D_step10.2495.2495.2	1.7348	0.4451	1160.77	1	5500.0%	1	R.VHSPPASLVPR.I
UQ8VDW099.4%61211.0%427490675.7(Q8VDW0) Nuclear RNA helicase, DECD variant of DEAD box family 
	TK270802_E14_cyto_2D_step01.2975.2975.1	0.5233	0.0251	1260.77	39	1250.0%	1	R.YQQFKDFQR.R
	TK270802_E14_cyto_2D_step07.3197.3197.1	2.0696	0.4135	1465.04	1	4550.0%	3	K.LTLHGLQQYYVK.L
	TK270802_E14_cyto_2D_step05.2589.2589.1	1.8925	0.3302	1296.72	1	5450.0%	1	K.GSYVSIHSSGFR.D
*	TK270802_E14_cyto_2D_step09.5156.5156.1	0.6046	0.067	1464.44	8	1920.0%	1	K.GLAVTFVSDENDAK.I
UH4_HUMAN99.4%5921.6%1021123611.4(P02304) Histone H4 (P02304) Histone H4 
	TK270802_E14_cyto_2D_step01.1732.1732.1	2.1802	0.4102	1136.87	2	4440.0%	2	R.DAVTYTEHAK.R
	TK270802_E14_cyto_2D_step03.2491.2491.1	1.725	0.3089	1327.97	1	5000.0%	2	R.DNIQGITKPAIR.R
URS4_HUMAN99.4%2710121.8%2622946710.2(P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) (P12750) 40S ribosomal protein S4, X isoform (Single copy abundant mRNA protein) (SCR10) 
	TK270802_E14_cyto_2D_step11.2481.2481.2	2.7442	0.3161	1219.25	1	6500.0%	7	K.GIPHLVTHDAR.T
	TK270802_E14_cyto_2D_step12.2348.2348.2	0.9333	0.0449	1508.73	163	2500.0%	1	R.ERHPGSFDVVHVK.D
	TK270802_E14_cyto_2D_step02.3278.3278.1	1.2941	0.0982	991.25	1	7500.0%	1	R.LSNIFVIGK.G
	TK270802_E14_cyto_2D_step01.2050.2050.1	1.1922	0.0227	774.02	1	7500.0%	1	R.IGVITNR.E
	TK270802_E14_cyto_2D_step09.3040.3040.1	1.7938	0.2491	1169.94	1	5000.0%	3	K.GNKPWISLPR.G
	TK270802_E14_cyto_2D_step07.2354.2354.1	1.0526	0.1303	792.81	2	5000.0%	1	R.KIFVGTK.G
	TK270802_E14_cyto_2D_step11.2603.2603.2	1.3655	0.2481	1224.54	2	5000.0%	3	R.HPGSFDVVHVK.D
UTHIO_MOUSE99.4%103047.1%104115444.9(P10639) Thioredoxin (ATL-derived factor) (ADF) 
*	TK270802_E14_cyto_2D_step01.2667.2667.1	2.2017	0.2908	1323.05	1	5830.0%	3	K.EAFQEALAAAGDK.L
*	TK270802_E14_cyto_2D_step13.3328.3328.1	2.5338	0.289	1525.02	1	5450.0%	2	K.MIKPFFHSLCDK.Y
*	TK270802_E14_cyto_2D_step05.4528.4528.2	1.9518	0.4053	2792.06	1	2830.0%	4	K.YSNVVFLEVDVDDCQDVAADCEVK.C
UIF37_MOUSE99.4%225.3%547635586.0(O70194) Eukaryotic translation initiation factor 3 subunit 7 (eIF-3 zeta) (eIF3 p66) 
	TK270802_E14_cyto_2D_step04.3424.3424.2	2.3615	0.5092	2311.21	1	5000.0%	1	R.NLAMEATYINHNFSQQCLR.M
	TK270802_E14_cyto_2D_step11.2470.2470.2	0.937	0.1013	1222.87	46	4440.0%	1	K.LGYVSRYHVK.D
UFSC1_MOUSE99.4%154116.7%492542746.7(Q61553) Fascin (Singed-like protein) 
	TK270802_E14_cyto_2D_step03.2519.2519.1	0.7671	0.0589	492.84	14	6670.0%	1	K.VAFR.D
	TK270802_E14_cyto_2D_step01.1603.1603.1	0.9773	0.1161	878.04	1	5620.0%	1	K.VNASASSLK.K
*	TK270802_E14_cyto_2D_step01.2255.2255.1	1.2388	0.1419	1424.87	4	3750.0%	1	R.LSCFAQSVSPAEK.W
	TK270802_E14_cyto_2D_step01.2172.2172.1	1.1729	0.1546	1191.96	1	4550.0%	1	R.YLAPSGPSGTLK.A
	TK270802_E14_cyto_2D_step09.2782.2782.1	0.9101	0.018	799.0	18	4290.0%	4	K.GDHAGVLK.A
	TK270802_E14_cyto_2D_step01.2882.2882.1	1.4701	0.1794	1147.9	1	6110.0%	1	K.YLTAEAFGFK.V
*	TK270802_E14_cyto_2D_step03.2680.2680.1	1.724	0.2772	1130.47	2	6110.0%	2	R.FLVVAHDDGR.W
*	TK270802_E14_cyto_2D_step07.3449.3449.2	2.5638	0.3871	1807.63	1	5330.0%	4	R.LVARPEPATGFTLEFR.S
UPIG1_HUMAN99.4%444.7%12901485326.0(P19174) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1 (EC 3.1.4.11) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) 
	TK270802_E14_cyto_2D_step05.2507.2507.1	1.9529	0.3974	1554.88	2	3750.0%	1	R.ISQEHLADHFDSR.E
*	TK270802_E14_cyto_2D_step11.3885.3885.2	1.1875	0.1444	1681.55	20	2860.0%	1	R.NEPNSYAISFRAEGK.I
*	TK270802_E14_cyto_2D_step03.2972.2972.1	1.3269	0.2335	1060.81	3	4380.0%	1	K.FSDVLHTIK.E
*	TK270802_E14_cyto_2D_step13.3445.3445.3	1.1748	0.0375	2882.12	136	1480.0%	1	R.DPLREIEEPYFFLDEFVTFLFSK.E
UQ9CQ9299.4%3519.1%152170098.5(Q9CQ92) 2010003O14Rik protein (RIKEN cDNA 2010003O14 gene) 
	TK270802_E14_cyto_2D_step06.5085.5085.2	1.6747	0.1009	2020.52	7	3000.0%	2	K.EEQRDYVFYLAVGNYR.L
*	TK270802_E14_cyto_2D_step04.1889.1889.1	2.0077	0.4045	1366.66	1	5830.0%	1	R.KFQSEQAAGSVSK.S
URO60_MOUSE99.4%3310.2%538601247.9(O08848) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP) 
*	TK270802_E14_cyto_2D_step02.1680.1680.1	0.3417	0.1847	797.09	8	1430.0%	1	R.AGHGLRGK.L
	TK270802_E14_cyto_2D_step11.2803.2803.2	2.7655	0.5232	1681.66	1	5330.0%	1	R.LSHLKPSSEGLAIVTK.Y
*	TK270802_E14_cyto_2D_step10.3093.3093.3	1.1036	0.1488	3440.8	20	1170.0%	1	K.TDTAADVFVVFTDNETFAGQVHPAVALREYR.K
UPRS6_MOUSE99.4%597.4%418472815.3(P54775) 26S protease regulatory subunit 6B (MIP224) (MB67 interacting protein) (TAT-binding protein-7) (TBP-7) (CIP21) 
	TK270802_E14_cyto_2D_step08.2646.2646.1	1.566	0.097	1421.91	4	3750.0%	2	R.ELLKPNASVALHK.H
	TK270802_E14_cyto_2D_step04.4422.4422.2	2.0929	0.3125	1946.41	1	3530.0%	2	K.ENAPAIIFIDEIDAIATK.R
UBTF3_MOUSE99.4%71331.4%204220119.4(Q64152) Transcription factor BTF3 (RNA polymerase B transcription factor 3) 
	TK270802_E14_cyto_2D_step01.3411.3411.2	1.1194	0.0327	2693.18	15	1670.0%	1	K.APLATGEDDDDEVPDLVENFDEASK.N
	TK270802_E14_cyto_2D_step01.3406.3406.2	1.6081	0.2321	3121.01	1	2500.0%	1	K.APLATGEDDDDEVPDLVENFDEASKNEAN.-
	TK270802_E14_cyto_2D_step01.2016.2016.1	1.8641	0.0749	742.62	16	6670.0%	1	R.LAEALPK.Q
	TK270802_E14_cyto_2D_step06.3878.3878.3	1.1415	0.0106	3089.96	3	1200.0%	1	K.LGVNNISGIEEVNMFTNQGTVIHFNNPK.V
URL17_MOUSE99.4%61816.8%1842142310.2(Q9CPR4) 60S ribosomal protein L17 (L23) 
	TK270802_E14_cyto_2D_step05.3853.3853.1	1.9384	0.3367	1189.86	5	4440.0%	1	K.SAEFLLHMLK.N
	TK270802_E14_cyto_2D_step10.3371.3371.2	2.5455	0.5087	1781.14	1	4670.0%	4	K.GLDVDSLVIEHIQVNK.A
	TK270802_E14_cyto_2D_step08.2094.2094.1	1.033	0.0265	613.74	32	5000.0%	1	K.GMHIR.K
UMCA1_MOUSE99.4%115.8%310339978.4(P31230) Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] 
	TK270802_E14_cyto_2D_step04.3376.3376.2	2.5867	0.5162	2022.77	1	4410.0%	1	R.TVVSGLVNHVPLEQMQNR.M
UPSA3_MOUSE99.4%6814.2%254282745.4(O70435) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome component C8) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome subunit K) 
	TK270802_E14_cyto_2D_step11.2254.2254.1	0.9444	0.0345	935.94	66	4290.0%	1	K.GRHEIVPK.D
	TK270802_E14_cyto_2D_step06.3513.3513.1	1.2393	0.2807	1381.09	3	3460.0%	1	R.HVGMAVAGLLADAR.S
	TK270802_E14_cyto_2D_step04.2004.2004.1	1.5217	0.2927	722.87	3	8000.0%	1	R.HEIVPK.D
	TK270802_E14_cyto_2D_step03.2995.2995.1	1.3138	0.0367	1230.06	4	5000.0%	2	K.IIYIVHDEVK.D
	TK270802_E14_cyto_2D_step02.3528.3528.2	0.7605	0.0725	1655.2	405	1540.0%	1	K.EVAKIIYIVHDEVK.D
UQ9D4W499.4%113.4%319351835.1(Q9D4W4) 6330577E15Rik protein 
*	TK270802_E14_cyto_2D_step04.2354.2354.1	1.8072	0.4159	1226.9	1	4500.0%	1	R.SSSHSFCSVVK.R
UICAL_MOUSE99.4%5713.8%788849225.5(P51125) Calpain inhibitor (Calpastatin) 
	TK270802_E14_cyto_2D_step11.4098.4098.3	0.9763	0.0516	4554.93	11	1010.0%	1	K.EQKPFTPASPVQSTPSKPSDKSGMDAALDDLIDTLGGHEDTNR.D
*	TK270802_E14_cyto_2D_step09.2201.2201.2	1.5535	0.2883	2126.73	7	2380.0%	2	K.AASLGSSQPSRPHVGEAATATK.V
*	TK270802_E14_cyto_2D_step07.5082.5082.3	1.4751	0.0147	3028.09	2	1850.0%	1	K.AASLGSSQPSRPHVGEAATATKVTASSAATSK.S
	TK270802_E14_cyto_2D_step04.5076.5076.3	0.9469	0.1074	3799.45	4	1060.0%	1	R.DDPPYTGPVVLDPMYSTYLEALGIKEGTIPPEYR.K
UPUR6_MOUSE99.4%81412.2%425470707.2(Q9DCL9) Multifunctional protein ADE2 [Includes: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)] 
	TK270802_E14_cyto_2D_step03.3679.3679.3	1.3903	0.0052	2724.25	6	1900.0%	1	K.CGETAFIAPQCEMIPIEWVCRR.I
	TK270802_E14_cyto_2D_step05.4041.4041.2	1.924	0.3788	2697.21	1	3810.0%	1	K.KCGETAFIAPQCEMIPIEWVCR.R
*	TK270802_E14_cyto_2D_step06.3271.3271.1	0.9388	0.0184	1291.84	11	3500.0%	1	K.EVYELLDTPGR.V
*	TK270802_E14_cyto_2D_step05.1806.1806.1	1.1481	0.0452	1149.71	1	4440.0%	3	K.RNPGVQEGYK.F
	TK270802_E14_cyto_2D_step02.2780.2780.1	0.7353	0.1016	837.47	10	5000.0%	1	R.IATGSFLK.R
UQ99J9999.4%4612.5%297330236.6(Q99J99) Similar to thiosulfate sulfurtransferase (Rhodanese) 
*	TK270802_E14_cyto_2D_step06.3029.3029.1	1.6544	0.416	1493.83	1	5000.0%	1	R.HWLNQNLPISSGK.S
*	TK270802_E14_cyto_2D_step06.5383.5383.1	0.8696	0.073	1582.07	6	2500.0%	1	K.THEDILENLDARR.F
*	TK270802_E14_cyto_2D_step03.2219.2219.1	1.3106	0.1719	1238.94	1	6000.0%	2	R.AQPEHIISEGR.G
UQ9Z1K199.4%3511.4%396437695.0(Q9Z1K1) HS1 binding protein 3 
*	TK270802_E14_cyto_2D_step10.2245.2245.2	1.6703	0.2487	1835.78	1	3610.0%	2	R.KPTLPASVGPSEPGSGPQK.Q
*	TK270802_E14_cyto_2D_step01.4208.4208.2	1.6983	0.3198	2629.24	1	2800.0%	1	K.LFDDPDLGGAVSLGDPLLLPAASESR.G
UQ99LE699.4%358.6%628717827.0(Q99LE6) Similar to ATP-binding cassette, sub-family F (GCN20), member 2 
	TK270802_E14_cyto_2D_step05.4397.4397.3	1.3096	0.053	4384.12	57	940.0%	1	R.AVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGR.R
	TK270802_E14_cyto_2D_step12.2776.2776.2	2.2172	0.464	1442.9	1	5000.0%	2	R.ILHGLGFTPAMQR.K
UPSD7_MOUSE99.4%123023.7%321365406.8(P26516) 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit S12) (Proteasome subunit p40) (Mov34 protein) 
	TK270802_E14_cyto_2D_step05.2101.2101.1	1.7923	0.2856	1009.69	1	5620.0%	1	R.ITNQVHGLK.G
	TK270802_E14_cyto_2D_step07.2792.2792.1	2.3571	0.1923	1159.89	1	5560.0%	3	R.IVGWYHTGPK.L
	TK270802_E14_cyto_2D_step01.2884.2884.1	0.8706	0.017	1164.17	127	2220.0%	1	K.NDIAINELMK.R
	TK270802_E14_cyto_2D_step05.3046.3046.1	2.4396	0.323	1323.02	3	5450.0%	3	R.SVVALHNLINNK.I
	TK270802_E14_cyto_2D_step03.3492.3492.1	1.3451	0.2165	1186.84	1	5000.0%	1	R.VVGVLLGSWQK.K
	TK270802_E14_cyto_2D_step06.3734.3734.2	2.8036	0.5229	2685.63	1	3480.0%	3	K.TFEHVTSEIGAEEAEEVGVEHLLR.D
U2A5E_MOUSE99.4%3510.1%387454985.5(Q61151) Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon isoform (PP2A, B subunit, B' epsilon isoform) (PP2A, B subunit, B56 epsilon isoform) (PP2A, B subunit, PR61 epsilon isoform) (PP2A, B subunit, R5 epsilon isoform) (Fragment) 
	TK270802_E14_cyto_2D_step05.2467.2467.1	1.9067	0.4115	1419.03	1	5000.0%	2	K.CVSSPHFQVAER.A
	TK270802_E14_cyto_2D_step12.4507.4507.2	0.9955	0.0475	3157.36	2	1730.0%	1	R.STLNELVDYITISRGCLTEQTYPEVVR.M
UPUR1_HUMAN99.4%226.8%517573996.8(Q06203) Amidophosphoribosyltransferase precursor (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (ATASE) (GPAT) 
*	TK270802_E14_cyto_2D_step08.2998.2998.3	1.6956	0.0411	2875.81	33	1670.0%	1	K.TSETEGWVVSSESCSFLSIGARYYR.E
*	TK270802_E14_cyto_2D_step05.3098.3098.1	2.1146	0.4067	1155.87	1	6670.0%	1	K.KFGVLSDNFK.G
UG25B_HUMAN99.4%6185.8%191213116.0(P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) (P21181) G25K GTP-binding protein, brain isoform (GP) (CDC42 homolog) 
	TK270802_E14_cyto_2D_step10.2717.2717.1	2.1268	0.3867	1405.8	1	4500.0%	3	K.WVPEITHHCPK.T
UIF32_MOUSE99.4%81226.8%325364615.6(Q9QZD9) Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1) 
	TK270802_E14_cyto_2D_step01.2091.2091.1	1.3704	0.1486	947.93	6	5000.0%	1	K.SGEVLVNVK.E
	TK270802_E14_cyto_2D_step09.3442.3442.3	1.1569	0.0657	3683.92	139	1020.0%	2	R.LGTYMGHTGAVWCVDADWDTKHVLTGSADNSCR.L
	TK270802_E14_cyto_2D_step06.3537.3537.1	0.7747	0.0324	1527.43	75	2270.0%	1	R.FFHLAFEEEFGR.V
	TK270802_E14_cyto_2D_step11.2505.2505.3	1.5987	0.0105	1994.48	1	2970.0%	1	-.MKPILLQGHERSITQIK.Y
	TK270802_E14_cyto_2D_step04.1890.1890.1	2.1698	0.4034	1317.73	1	5450.0%	1	K.HVLTGSADNSCR.L
	TK270802_E14_cyto_2D_step12.2660.2660.2	1.8193	0.2517	1681.54	7	3670.0%	2	K.GHFGPINSVAFHPDGK.S
UQ9D7G799.4%223.7%327352178.1(Q9D7G7) 0710008K08Rik protein 
	TK270802_E14_cyto_2D_step12.2575.2575.2	2.9171	0.5153	1190.24	1	5910.0%	1	R.LHALVVGPGLGR.D
USYW_MOUSE99.4%3310.0%481542836.7(P32921) Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tryptophan--tRNA ligase) (TrpRS) 
*	TK270802_E14_cyto_2D_step03.3380.3380.3	1.486	0.134	3774.88	1	1750.0%	1	R.DTVEEHRQFGGNCEVDVSFMYLTFFLEDDDR.L
	TK270802_E14_cyto_2D_step08.2900.2900.1	1.9031	0.4007	1145.92	1	6250.0%	1	K.KPFYLYTGR.G
	TK270802_E14_cyto_2D_step06.2310.2310.1	1.6333	0.2916	973.72	2	5710.0%	1	K.HVTFNQVK.G
UTCPY_MOUSE99.4%3312.2%531581847.7(Q61390) T-complex protein 1, zeta-2 subunit (TCP-1-zeta-2) (CCT-zeta-2) 
*	TK270802_E14_cyto_2D_step12.3648.3648.2	1.0368	0.1006	2730.54	6	1920.0%	1	K.NAIEDGCVVPGAGAVEVAIAEALVNYK.H
*	TK270802_E14_cyto_2D_step06.3498.3498.2	2.848	0.5109	2317.27	1	4250.0%	1	K.DGNVLLHEMQIQHPTASIIAK.V
*	TK270802_E14_cyto_2D_step05.3721.3721.2	1.5855	0.0274	1836.37	36	2190.0%	1	R.VRLGIQAFADALLIIPK.V
UQ9CQ1999.4%116.4%172198544.9(Q9CQ19) Transient receptor protein 2 
	TK270802_E14_cyto_2D_step06.2939.2939.1	2.2602	0.4178	1377.0	1	6000.0%	1	K.KGNFNYVEFTR.I
URAC1_HUMAN99.4%5915.1%192214508.5(P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) (P15154) Ras-related C3 botulinum toxin substrate 1 (p21-Rac1) (Ras-like protein TC25) 
	TK270802_E14_cyto_2D_step08.3107.3107.2	1.0846	0.0608	1633.33	14	3210.0%	1	K.KLTPITYPQGLAMAK.E
	TK270802_E14_cyto_2D_step13.2841.2841.1	2.3904	0.3916	1588.72	1	4620.0%	2	R.HHCPNTPIILVGTK.L
UQ9CS2599.4%446.5%816911826.6(Q9CS25) 2810406C15Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step01.3306.3306.1	0.9819	0.0060	1217.52	9	3640.0%	1	R.ALSAKKPSAVSR.L
	TK270802_E14_cyto_2D_step10.3246.3246.3	1.2479	0.0307	2900.75	65	1500.0%	1	K.AKVVFLSDESSEDELSAEMTEEETPK.R
	TK270802_E14_cyto_2D_step04.3300.3300.2	2.8966	0.5008	1569.45	1	6430.0%	1	R.GKPEIVGSNLDALVR.V
UTAL1_MOUSE99.4%5712.8%337373877.0(Q93092) Transaldolase (EC 2.2.1.2) 
	TK270802_E14_cyto_2D_step05.2926.2926.1	1.8958	0.398	1440.02	1	5000.0%	1	R.ILDWHVANTDKK.S
	TK270802_E14_cyto_2D_step03.2682.2682.1	2.104	0.2977	1500.8	1	5450.0%	1	R.WLHNEDQMAVEK.L
*	TK270802_E14_cyto_2D_step05.2103.2103.1	1.7517	0.1804	1226.97	2	5500.0%	1	K.KLGGPQEEQIK.N
*	TK270802_E14_cyto_2D_step01.2250.2250.1	1.554	0.3632	800.25	1	6430.0%	2	K.LAPALSVK.A
UEF1D_MOUSE99.4%5715.7%281312935.0(P57776) Elongation factor 1-delta (EF-1-delta) 
*	TK270802_E14_cyto_2D_step03.2750.2750.2	2.2921	0.5528	2197.7	1	4350.0%	1	K.SLAGSSGPGASSGPGGDHSELIVR.I
*	TK270802_E14_cyto_2D_step07.2004.2004.1	1.3893	0.1025	757.0	1	7500.0%	1	K.KPTLVAK.S
	TK270802_E14_cyto_2D_step05.2019.2019.2	2.4292	0.327	1426.32	1	6250.0%	1	R.ATAPQTQHVSPMR.Q
UQ9CR4999.4%486.8%147161468.2(Q9CR49) Hemoglobin Y, beta-like embryonic chain 
*	TK270802_E14_cyto_2D_step08.3457.3457.1	1.444	0.1512	1285.95	7	4440.0%	2	R.LLVVYPWTHR.F
UPYRG_MOUSE99.4%102015.2%591667116.6(P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase) 
	TK270802_E14_cyto_2D_step10.3114.3114.2	2.8286	0.5218	1628.43	1	5330.0%	3	K.LCSAHGVLVPGGFGVR.G
	TK270802_E14_cyto_2D_step04.2976.2976.1	1.3364	0.0195	1380.02	12	3460.0%	1	K.YILVTGGVISGIGK.G
*	TK270802_E14_cyto_2D_step08.2414.2414.1	1.3888	0.3183	898.84	1	6670.0%	2	R.LPHYLQK.G
*	TK270802_E14_cyto_2D_step08.2870.2870.2	2.7798	0.0164	2392.88	2	3810.0%	1	K.TSHPVVIDMPEHNPGQMGGTMR.L
	TK270802_E14_cyto_2D_step07.2449.2449.1	1.6456	0.2143	1303.85	1	5910.0%	2	K.ALEHSALAINHK.L
*	TK270802_E14_cyto_2D_step02.4260.4260.2	0.9063	0.0058	2131.61	21	1670.0%	1	K.KPFLGVCLGIQLAVVEFSR.N
URS11_HUMAN99.4%102228.5%1581843110.3(P04643) 40S ribosomal protein S11 (P04643) 40S ribosomal protein S11 
	TK270802_E14_cyto_2D_step01.2616.2616.1	1.9557	0.3514	750.02	1	8330.0%	1	K.NIGLGFK.T
	TK270802_E14_cyto_2D_step01.2098.2098.1	1.2529	0.2901	1267.04	6	4500.0%	1	K.EAIEGTYIDKK.C
	TK270802_E14_cyto_2D_step06.2429.2429.1	0.9578	0.0011	974.06	39	4380.0%	1	K.RVLLGETGK.E
	TK270802_E14_cyto_2D_step07.2961.2961.1	2.138	0.2313	1349.98	1	5500.0%	3	K.NMSVHLSPCFR.D
	TK270802_E14_cyto_2D_step03.2847.2847.1	1.4064	0.1156	981.88	2	5830.0%	3	R.DYLHYIR.K
UQ99KN999.4%3311.7%531567585.9(Q99KN9) Similar to KIAA0171 gene product (Fragment) 
	TK270802_E14_cyto_2D_step14.2746.2746.2	0.832	0.0606	1644.56	4	2500.0%	1	K.SAFPFSDKLGELSDK.I
*	TK270802_E14_cyto_2D_step06.1938.1938.2	2.3733	0.5313	2411.02	1	3480.0%	1	K.ASPDQNASTHTPQSSAKPSVPSSK.S
	TK270802_E14_cyto_2D_step08.4279.4279.3	1.4352	0.0542	2641.91	7	2160.0%	1	K.DEEETVTTKHIHITQATETTTTR.H
UTCPZ_MOUSE99.4%4411.1%531580047.1(P80317) T-complex protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) 
	TK270802_E14_cyto_2D_step04.2416.2416.1	1.1159	0.0448	938.27	29	3750.0%	1	R.GLVLDHGAR.H
*	TK270802_E14_cyto_2D_step13.3364.3364.2	0.8559	0.0684	2463.46	32	1590.0%	1	R.TKVHAELADVLTEAVVDSILAIR.K
	TK270802_E14_cyto_2D_step06.3498.3498.2	2.848	0.5109	2317.27	1	4250.0%	1	K.DGNVLLHEMQIQHPTASLIAK.V
	TK270802_E14_cyto_2D_step05.2561.2561.1	1.9608	0.0090	744.12	4	8000.0%	1	K.KIIELK.K
UTSN_MOUSE99.4%71711.0%228262016.4(Q62348) Translin 
*	TK270802_E14_cyto_2D_step04.1984.1984.1	1.4053	0.3515	849.17	1	7500.0%	2	R.EHFSTVK.T
	TK270802_E14_cyto_2D_step04.2237.2237.1	1.5167	0.1277	1259.21	1	6000.0%	2	R.KVVQSLEQTAR.E
	TK270802_E14_cyto_2D_step06.2238.2238.1	1.4269	0.1252	801.91	2	5830.0%	3	K.THLTSLK.T
URL26_HUMAN99.4%123222.1%1451725810.6(Q02877) 60S ribosomal protein L26 (Q02877) 60S ribosomal protein L26 
	TK270802_E14_cyto_2D_step06.2275.2275.1	2.0577	0.1726	1420.8	1	4620.0%	3	K.ANGTTVHVGIHPSK.V
	TK270802_E14_cyto_2D_step13.2093.2093.1	1.2803	0.1073	1080.98	2	5000.0%	3	R.HFNAPSHIR.R
	TK270802_E14_cyto_2D_step06.2461.2461.1	1.2187	0.0994	991.72	1	6880.0%	1	R.KIMSSPLSK.E
UQ99L5299.4%112.9%315343225.1(Q99L52) Hypothetical 34.3 kDa protein 
*	TK270802_E14_cyto_2D_step04.2144.2144.1	1.5927	0.4764	1052.19	1	5620.0%	1	K.HAEAVAYYK.K
UQ924D299.4%9295.9%15611699007.9(Q924D2) Myosin light chain kinase (Fragment) 
*	TK270802_E14_cyto_2D_step06.5061.5061.2	1.8898	0.2167	1922.59	11	2810.0%	5	R.FESQPQSQEVTEGQTVK.F
*	TK270802_E14_cyto_2D_step14.2206.2206.3	0.998	0.0112	2785.91	1	1560.0%	1	K.LLLQCQVISDPPATVTWSLNGKTLK.T
*	TK270802_E14_cyto_2D_step06.2298.2298.1	2.6326	0.3158	1303.96	1	5910.0%	1	K.RPESQGSAPVFK.E
*	TK270802_E14_cyto_2D_step02.3418.3418.2	0.8486	0.1629	1804.88	31	1790.0%	1	K.DIPAEQMDFRANLQR.Q
*	TK270802_E14_cyto_2D_step10.3364.3364.2	1.1154	0.0685	2615.48	17	1820.0%	1	K.FICEVSGIPKPDVGWFLEGIPVR.R
UO3586499.4%5526.9%334375496.5(O35864) 38 kDa MOV34 ISOLOGUE (Kip1 C-terminus interacting protein-2) (COP9 (Constitutive photomorphogenic), subunit 5) (Arabidopsis) 
	TK270802_E14_cyto_2D_step04.5200.5200.2	0.7627	0.0838	3139.17	6	1480.0%	1	K.YWVNTLSSSSLLTNADYTTGQVFDLSEK.L
	TK270802_E14_cyto_2D_step04.3968.3968.2	3.0992	0.4752	1643.47	1	5360.0%	1	K.TTIEAIHGLMSQVIK.D
	TK270802_E14_cyto_2D_step11.2642.2642.3	1.114	0.0139	2283.12	158	1670.0%	1	K.TWELANNMQEAQSIDEIYK.Y
	TK270802_E14_cyto_2D_step10.4424.4424.2	0.8586	0.1408	2132.13	8	1580.0%	1	K.MVMHARSGGNLEVMGLMLGK.V
	TK270802_E14_cyto_2D_step09.4592.4592.3	1.1821	7.0E-4	4150.89	102	790.0%	1	K.LLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEK.L
UAAC1_HUMAN99.4%577.4%8921029745.4(P12814) Alpha-actinin 1 (Alpha-actinin cytoskeletal isoform) (Non-muscle alpha-actinin 1) (F-actin cross linking protein) 
	TK270802_E14_cyto_2D_step05.2083.2083.1	1.6248	0.1878	1413.77	1	5450.0%	1	R.VPENTMHAMQQK.L
	TK270802_E14_cyto_2D_step07.3434.3434.2	3.0794	0.4827	1503.1	1	7730.0%	1	K.NVNIQNFHISWK.D
	TK270802_E14_cyto_2D_step13.4326.4326.3	1.6009	0.1352	4600.89	1	1280.0%	1	R.ELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL.-
UQ9P22999.4%4415.3%660737887.1(Q9P229) Hypothetical protein KIAA1499 (Fragment) 
	TK270802_E14_cyto_2D_step15.1744.1744.3	1.0475	0.1064	1977.45	20	1880.0%	1	R.DECLLPCKDAPELGYAK.E
	TK270802_E14_cyto_2D_step12.2732.2732.3	0.8463	0.0224	3950.95	40	730.0%	1	K.CVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIR.K
*	TK270802_E14_cyto_2D_step06.2803.2803.1	2.3478	0.3862	1413.76	1	5000.0%	1	K.TGNQHFGYLYGR.Y
	TK270802_E14_cyto_2D_step06.4951.4951.3	1.8168	0.2252	4323.18	3	1410.0%	1	R.LSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVR.D
UKPCI_MOUSE99.3%113.2%586671995.8(Q62074) Protein kinase C, iota type (EC 2.7.1.-) (nPKC-iota) (Protein kinase C lambda) 
	TK270802_E14_cyto_2D_step13.3318.3318.2	2.2914	0.5104	2188.21	1	5830.0%	1	R.LGCHPQTGFADIQGHPFFR.N
UHS71_MOUSE99.3%152329.3%641699945.6(P17879) Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) 
	TK270802_E14_cyto_2D_step03.4143.4143.3	2.063	0.0721	2844.35	8	1880.0%	1	K.FGDAVVQSDMKHWPFQVVNDGDKPK.V
	TK270802_E14_cyto_2D_step08.4217.4217.2	0.8117	0.0168	2778.54	60	960.0%	1	R.DLNKSINPDEAVAYGAAVQAAILMGDK.S
	TK270802_E14_cyto_2D_step05.4866.4866.1	1.1179	0.0727	1315.66	89	2780.0%	1	R.FEELCSDLFR.G
	TK270802_E14_cyto_2D_step03.3451.3451.2	2.261	0.4992	2776.4	1	3480.0%	2	K.QTQTFTTYSDNQPGVLIQVYEGER.A
	TK270802_E14_cyto_2D_step03.1746.1746.1	0.9372	0.1377	458.77	9	8330.0%	1	R.LIGR.K
	TK270802_E14_cyto_2D_step09.2136.2136.1	1.1206	0.0141	614.9	8	5000.0%	3	K.RLIGR.K
	TK270802_E14_cyto_2D_step01.0112.0112.1	1.0701	0.1307	1487.74	124	2500.0%	1	R.TTPSYVAFTDTER.L
	TK270802_E14_cyto_2D_step11.3571.3571.2	0.871	0.1507	2902.06	1	1920.0%	1	R.NVLIFDLGGGTFDVSILTIDDGIFEVK.A
	TK270802_E14_cyto_2D_step01.1722.1722.1	1.2284	0.1391	688.0	4	6670.0%	1	R.LIGDAAK.N
	TK270802_E14_cyto_2D_step04.4033.4033.3	1.5307	0.0823	3339.25	6	1530.0%	1	K.SENVQDLLLLDVAPLSLGLETAGGVMTALIKR.N
	TK270802_E14_cyto_2D_step01.1947.1947.1	1.1393	0.2373	1229.89	4	3500.0%	1	K.VEIIANDQGNR.T
	TK270802_E14_cyto_2D_step01.1734.1734.1	1.1178	0.0384	804.79	70	5000.0%	1	K.ITITNDK.G
UTCTP_MOUSE99.3%123620.9%172194624.9(P14701) Translationally controlled tumor protein (TCTP) (p23) (21 kDa polypeptide) (p21) (Lens epithelial protein) 
	TK270802_E14_cyto_2D_step01.3096.3096.1	0.872	0.2184	1432.97	1	3330.0%	1	R.EIADGLCLEVEGK.M
*	TK270802_E14_cyto_2D_step05.1910.1910.2	2.7032	0.22	1214.93	4	7220.0%	1	K.GKLEEQKPER.V
	TK270802_E14_cyto_2D_step05.2803.2803.2	1.9937	0.3179	1422.92	1	6670.0%	3	R.VKPFMTGAAEQIK.H
UPGK1_HUMAN99.3%5254.6%417445978.1(P00558) Phosphoglycerate kinase 1 (EC 2.7.2.3) (Primer recognition protein 2) (PRP 2) 
*	TK270802_E14_cyto_2D_step09.3101.3101.2	3.0272	0.4838	2038.98	1	5000.0%	5	K.SVVLMSHLGRPDGVPMPDK.Y
USYEP_HUMAN99.3%777.1%14401630267.7(P07814) Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)] 
*	TK270802_E14_cyto_2D_step04.4534.4534.2	1.1026	0.0102	1945.4	44	2500.0%	1	R.WFGFLEAQQAFQSVGTK.W
*	TK270802_E14_cyto_2D_step01.3122.3122.1	1.0287	0.0202	1254.15	9	3330.0%	1	K.MFEIVFEDPK.I
*	TK270802_E14_cyto_2D_step12.3700.3700.2	0.7059	0.0347	2351.06	67	1110.0%	1	R.RGFFICDQPYEPVSPYSCK.E
*	TK270802_E14_cyto_2D_step06.4811.4811.2	1.3148	0.0448	2017.59	6	2620.0%	1	K.DPSKNQGGGLSSSGAGEGQGPK.K
*	TK270802_E14_cyto_2D_step06.2879.2879.1	1.652	0.1544	973.8	1	6670.0%	1	K.FNHWELK.G
*	TK270802_E14_cyto_2D_step13.2798.2798.3	1.2793	0.0064	1865.28	70	2350.0%	1	K.SLIGVEYKPVSATGAEDK.D
*	TK270802_E14_cyto_2D_step07.2998.2998.1	2.1554	0.3826	1242.7	1	6250.0%	1	R.KPYIWEYSR.L
URS12_MOUSE99.3%3329.0%131143947.2(P09388) 40S ribosomal protein S12 
	TK270802_E14_cyto_2D_step04.2560.2560.1	1.9484	0.3919	1067.32	1	6110.0%	1	K.TALIHDGLAR.G
	TK270802_E14_cyto_2D_step06.3130.3130.1	2.255	0.3671	1191.65	1	5560.0%	1	K.KLGEWVGLCK.I
*	TK270802_E14_cyto_2D_step04.3068.3068.2	1.3162	0.1099	2137.94	34	1760.0%	1	R.QAHLCVLASNCDEPMYVK.L
UROA2_MOUSE99.3%8249.7%341359938.6(O88569) Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2 / hnRNP B1) 
	TK270802_E14_cyto_2D_step06.2154.2154.1	1.5381	0.18	1412.08	8	3180.0%	2	K.YHTINGHNAEVR.K
	TK270802_E14_cyto_2D_step08.2896.2896.1	1.8112	0.1539	863.39	7	5710.0%	4	K.KLFVGGIK.E
	TK270802_E14_cyto_2D_step05.1994.1994.1	1.6005	0.3146	1340.86	3	4170.0%	2	R.EESGKPGAHVTVK.K
UQ9CV3199.3%4611.3%284321105.0(Q9CV31) 2310014J01Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step05.2915.2915.1	1.902	0.3836	1566.94	1	4670.0%	2	K.HGGGGIVANLSEQSLK.D
	TK270802_E14_cyto_2D_step01.2207.2207.1	1.9176	0.3317	1335.32	1	5000.0%	1	R.DAEDVDLTHYR.I
	TK270802_E14_cyto_2D_step07.1661.1661.1	0.9714	0.0574	614.91	4	5000.0%	1	R.QNLIK.C
URL3_MOUSE99.3%173722.6%4024599310.2(P27659) 60S ribosomal protein L3 (J1 protein) 
	TK270802_E14_cyto_2D_step06.2266.2266.1	1.2217	0.0471	885.06	47	5000.0%	2	K.AGMTHIVR.E
	TK270802_E14_cyto_2D_step01.1716.1716.1	0.8685	0.0407	812.92	30	5000.0%	1	K.FIDTTSK.F
	TK270802_E14_cyto_2D_step01.2552.2552.1	1.5747	0.2653	764.35	4	6670.0%	1	K.AFMGPLK.K
	TK270802_E14_cyto_2D_step05.2579.2579.1	1.4116	0.1919	1591.82	9	3750.0%	1	K.TVFAEHISDECKR.R
*	TK270802_E14_cyto_2D_step07.4224.4224.2	2.5026	0.4958	2453.1	1	3570.0%	4	K.SINPLGGFVHYGEVTNDFIMLK.G
	TK270802_E14_cyto_2D_step09.2961.2961.2	2.4768	0.4929	985.39	1	8750.0%	1	R.HGSLGFLPR.K
	TK270802_E14_cyto_2D_step10.2749.2749.2	2.3282	0.2212	1827.64	1	4060.0%	2	K.KAHLMEIQVNGGTVAEK.L
*	TK270802_E14_cyto_2D_step06.2130.2130.1	1.2392	0.1629	971.84	2	5710.0%	2	R.IIAHTQMR.L
UROA1_MOUSE99.3%71916.3%319340659.2(P49312) Heterogeneous nuclear ribonucleoprotein A1 (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) (HDP-1) (Topoisomerase-inhibitor suppressed) 
	TK270802_E14_cyto_2D_step05.2229.2229.1	1.5839	0.218	1437.78	3	3750.0%	1	R.EDSQRPGAHLTVK.K
	TK270802_E14_cyto_2D_step08.2896.2896.1	1.8112	0.1539	863.39	7	5710.0%	4	K.KIFVGGIK.E
	TK270802_E14_cyto_2D_step09.1904.1904.3	1.0845	0.0028	1853.58	256	1110.0%	1	R.NQGGYGGSSSSSSYGSGRR.F
	TK270802_E14_cyto_2D_step05.2035.2035.1	1.2744	0.2053	1488.59	17	3180.0%	1	K.YHTVNGHNCEVR.K
UKINH_MOUSE99.3%445.1%9631095496.3(Q61768) Kinesin heavy chain (Ubiquitous kinesin heavy chain) (UKHC) 
	TK270802_E14_cyto_2D_step05.2441.2441.1	1.8932	0.3801	1360.97	5	5500.0%	1	R.FRPLNESEVNR.G
	TK270802_E14_cyto_2D_step08.2144.2144.1	1.3738	0.2668	1481.61	13	3330.0%	1	R.HVAVTNMNEHSSR.S
*	TK270802_E14_cyto_2D_step13.1120.1120.3	0.9951	0.0202	1709.07	101	1730.0%	1	K.IKSLTEYLQNDEQK.K
	TK270802_E14_cyto_2D_step03.2332.2332.1	0.7162	0.1174	1267.94	31	3000.0%	1	K.QLESTQTESNK.K
UQ9D0X899.3%2211.3%195211099.5(Q9D0X8) 1110055E19Rik protein 
	TK270802_E14_cyto_2D_step07.2809.2809.1	1.7482	0.3934	1386.9	1	5420.0%	1	K.YGGPQHIVGSPFK.A
	TK270802_E14_cyto_2D_step03.1948.1948.1	0.7205	0.0042	1056.65	127	2500.0%	1	K.NSFTVDCSK.A
UQ9DAJ699.3%5925.0%152171826.0(Q9DAJ6) 1500026J17Rik protein 
	TK270802_E14_cyto_2D_step04.3766.3766.2	1.8756	0.2479	2198.73	1	3680.0%	1	R.YFHVVIAGPQDSPFEGGTFK.L
	TK270802_E14_cyto_2D_step01.2668.2668.1	1.9505	0.3254	1038.96	1	5000.0%	2	R.LLAEPVPGIK.A
	TK270802_E14_cyto_2D_step05.2049.2049.1	1.8604	0.2971	987.83	1	6430.0%	2	K.IYHPNVDK.L
UDPY2_MOUSE99.3%142821.5%572621716.4(O08553) Dihydropyrimidinase related protein-2 (DRP-2) (ULIP 2 protein) 
	TK270802_E14_cyto_2D_step01.5516.5516.1	0.7759	0.0173	550.08	1	6670.0%	1	R.YIPR.K
	TK270802_E14_cyto_2D_step04.2970.2970.1	1.3335	0.0066	1297.87	1	5000.0%	3	R.MVIPGGIDVHTR.F
	TK270802_E14_cyto_2D_step08.3244.3244.3	1.4223	0.0754	2116.67	7	2370.0%	1	K.QIGENLIVPGGVKTIEAHSR.M
*	TK270802_E14_cyto_2D_step07.3550.3550.2	1.6527	0.4324	2075.16	1	3750.0%	1	K.THNSALEYNIFEGMECR.G
*	TK270802_E14_cyto_2D_step13.4041.4041.2	1.4074	0.0247	2185.08	32	2060.0%	3	K.DRFQLTDSQIYEVLSVIR.D
	TK270802_E14_cyto_2D_step01.0429.0429.1	1.1075	0.2577	861.85	14	4380.0%	1	K.TVTPASSAK.T
*	TK270802_E14_cyto_2D_step12.2704.2704.2	2.0229	0.3451	2052.72	1	4330.0%	1	K.SCCDYSLHVDITEWHK.G
*	TK270802_E14_cyto_2D_step07.3778.3778.2	0.8549	0.3344	1915.32	43	1760.0%	1	R.ISVGSDADLVIWDPDSVK.T
	TK270802_E14_cyto_2D_step06.3143.3143.1	2.1629	0.3207	1141.65	1	6250.0%	2	R.KPFPDFVYK.R
UQ9CX8699.3%61810.5%305305309.3(Q9CX86) 3010025E17Rik protein 
	TK270802_E14_cyto_2D_step14.3148.3148.2	0.8833	0.0483	1694.61	104	2000.0%	1	K.LFIGGLNVQTSESGLR.G
	TK270802_E14_cyto_2D_step08.2896.2896.1	1.8112	0.1539	863.39	7	5710.0%	4	K.KLFVGGLK.G
	TK270802_E14_cyto_2D_step02.3662.3662.2	0.9074	0.0024	2685.92	85	1740.0%	1	-.MENSQLCKLFIGGLNVQTSESGLR.G
UQ9CU9099.3%114310.8%204215139.6(Q9CU90) 5133400F09Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step04.1658.1658.2	0.9171	0.0643	1085.77	29	3890.0%	3	R.LSEHATAPTR.G
	TK270802_E14_cyto_2D_step03.3738.3738.1	1.6935	0.1637	1252.68	11	3640.0%	3	R.GNVGVVLFNFGK.E
UQ96A5599.3%229.5%336391557.3(Q96A55) Hypothetical protein 
*	TK270802_E14_cyto_2D_step09.2242.2242.3	1.2911	0.0282	2267.87	52	1970.0%	1	R.GESIPIRLFLAGYELTPTMR.D
*	TK270802_E14_cyto_2D_step05.1942.1942.1	2.0812	0.388	1287.41	2	4550.0%	1	K.SMSHQAAIASQR.F
UQ9R1T299.2%358.0%350386205.4(Q9R1T2) mRNA similar to human SUA1, complete CDS (2400010M20RIK protein) 
*	TK270802_E14_cyto_2D_step01.4406.4406.2	1.3496	0.202	2236.65	1	3160.0%	1	R.NDVFDSLGISPDLLPDDFVR.Y
*	TK270802_E14_cyto_2D_step05.2674.2674.1	2.0928	0.3129	986.24	1	6430.0%	2	K.KPESFFTK.F
URL2B_HUMAN99.2%61022.4%1561769510.4(P29316) 60S ribosomal protein L23a (P29316) 60S ribosomal protein L23a 
	TK270802_E14_cyto_2D_step03.2723.2723.1	2.5672	0.3027	1067.08	1	6880.0%	2	K.KLYDIDVAK.V
	TK270802_E14_cyto_2D_step03.2412.2412.2	2.9079	0.4898	1244.87	1	7000.0%	1	K.VNTLIRPDGEK.K
	TK270802_E14_cyto_2D_step01.0450.0450.1	0.7827	0.2234	711.08	8	3330.0%	1	K.EAPAPPK.A
	TK270802_E14_cyto_2D_step04.2633.2633.1	1.9151	0.0757	974.67	7	6430.0%	2	K.LDHYAIIK.F
UQ9305299.2%336.7%612657467.4(Q93052) LIPOMA PREFERRED partner (LPP) 
*	TK270802_E14_cyto_2D_step03.2670.2670.2	2.8591	0.468	2274.63	1	4500.0%	1	R.METTHSFGNPSISVSTQQPPK.K
*	TK270802_E14_cyto_2D_step04.2198.2198.1	1.2851	0.1088	1221.31	6	4090.0%	1	K.STGEPLGHVPAR.M
*	TK270802_E14_cyto_2D_step08.2311.2311.1	1.5344	0.0887	1133.86	1	7140.0%	1	R.DFHVHCYR.C
UDCT2_MOUSE99.2%3317.2%402441175.3(Q99KJ8) Dynactin complex 50 kDa subunit (50 kDa dynein-associated polypeptide) (Dynamitin) (DCTN-50) (Dynactin 2) 
*	TK270802_E14_cyto_2D_step02.3618.3618.3	2.6417	0.5074	4698.94	1	1770.0%	1	R.NEPDVYETSDLPEDDQAEFDAEELSSTSVEHIIVNPNAAYDK.F
	TK270802_E14_cyto_2D_step05.2505.2505.1	2.3581	0.359	1288.37	1	6110.0%	1	K.VHQLYETIQR.W
	TK270802_E14_cyto_2D_step04.4138.4138.2	0.8959	0.023	2117.95	54	1880.0%	1	K.YQRLLHEVQELTTEVEK.I
URL10_MOUSE99.2%102617.4%2132447310.1(P45634) 60S ribosomal protein L10 (QM protein homolog) 
	TK270802_E14_cyto_2D_step06.2177.2177.1	2.0188	0.228	1191.02	1	5000.0%	4	R.GAFGKPQGTVAR.V
	TK270802_E14_cyto_2D_step07.2628.2628.1	1.6853	0.3282	767.09	1	8000.0%	1	K.KWGFTK.F
	TK270802_E14_cyto_2D_step04.2550.2550.1	1.5201	0.269	969.07	1	6430.0%	2	K.EHVIEALR.R
	TK270802_E14_cyto_2D_step12.2913.2913.2	1.3997	0.0069	1254.51	8	3500.0%	1	R.VHIGQVIMSIR.T
UQ8R1Q899.2%354.6%523566146.4(Q8R1Q8) Hypothetical 56.6 kDa protein 
*	TK270802_E14_cyto_2D_step01.1887.1887.3	1.1368	0.0425	1488.02	141	2050.0%	1	K.IPPEEMKEMEQK.L
	TK270802_E14_cyto_2D_step06.3291.3291.1	2.301	0.3715	1414.97	1	5450.0%	2	K.IGILHENFQTLK.V
UQ91YE499.2%61213.5%564666476.4(Q91YE4) 67 kDa polymerase-associated factor PAF67 
	TK270802_E14_cyto_2D_step03.3628.3628.1	1.4673	0.1693	861.69	3	7500.0%	1	R.IQLLVFK.H
	TK270802_E14_cyto_2D_step05.3585.3585.1	1.9671	0.2655	1520.83	1	5420.0%	1	R.LHSLLGDYYQAIK.V
	TK270802_E14_cyto_2D_step14.3679.3679.3	1.3555	0.0093	4413.19	8	1150.0%	1	-.MSYPADDYESEAAYDPYAYPGDYDMHTGDPKQDLAYER.Q
	TK270802_E14_cyto_2D_step10.3037.3037.2	2.0487	0.4611	2144.29	1	4120.0%	3	K.FLSPVVPNYDNVHPNYHK.E
UQ9JK2399.2%224.5%289331046.4(Q9JK23) Leucine rich protein 
*	TK270802_E14_cyto_2D_step04.3416.3416.2	2.7964	0.4838	1448.69	1	6250.0%	1	R.VTVEAFKPLLSSR.S
URS10_MOUSE99.2%101844.2%1651891610.2(P09900) 40S ribosomal protein S10 
	TK270802_E14_cyto_2D_step04.2733.2733.1	2.3251	0.3757	1571.87	1	5000.0%	2	K.KAEAGAGSATEFQFR.G
	TK270802_E14_cyto_2D_step02.3615.3615.2	0.9896	0.0033	1736.85	4	3210.0%	1	R.DYLHLPPEIVPATLR.R
	TK270802_E14_cyto_2D_step06.2629.2629.1	1.6872	0.2848	1051.87	3	5000.0%	1	K.NVPNLHVMK.A
*	TK270802_E14_cyto_2D_step06.2527.2527.1	1.0274	0.0145	1375.69	14	2730.0%	1	K.GPEGERPARFTR.G
	TK270802_E14_cyto_2D_step04.1805.1805.1	1.6141	0.2602	810.71	21	5830.0%	3	K.HPELADK.N
	TK270802_E14_cyto_2D_step03.1992.1992.1	1.407	0.3474	726.91	2	5000.0%	1	K.DVHMPK.H
	TK270802_E14_cyto_2D_step02.4098.4098.1	1.8449	0.0471	1110.96	4	5620.0%	1	R.IAIYELLFK.E
UQ9DC4699.2%3312.3%624715896.2(Q9DC46) 1200003I18Rik protein 
*	TK270802_E14_cyto_2D_step06.5052.5052.3	1.266	0.0954	4776.94	150	640.0%	1	K.INLHKVYQAIEEADFFAIDGEFSGISNGPSVTALTSGFDTPEER.Y
	TK270802_E14_cyto_2D_step06.2118.2118.1	2.2929	0.3608	1010.02	1	6670.0%	1	R.VIHAIANSGK.L
*	TK270802_E14_cyto_2D_step09.3403.3403.3	0.9267	0.0245	2574.55	30	1250.0%	1	R.KRPHMQGPCYHSNSFTAAGMLGK.R
UQ9CY9199.1%81213.0%601657005.1(Q9CY91) G1 to phase transition 2 
	TK270802_E14_cyto_2D_step10.3003.3003.1	1.5886	0.1421	1237.8	1	5500.0%	2	K.HFTILDAPGHK.S
	TK270802_E14_cyto_2D_step01.3347.3347.1	0.7779	0.0739	1231.79	102	2000.0%	1	R.MEWGAPVEPSK.D
	TK270802_E14_cyto_2D_step07.3381.3381.3	1.1582	0.0621	4281.99	57	990.0%	1	K.DGPLVSWEGSSSVVTMELSEPVVENGEVEMALEESWELK.E
	TK270802_E14_cyto_2D_step04.2032.2032.1	1.5692	0.3557	799.85	1	6670.0%	1	R.EHAMLAK.T
	TK270802_E14_cyto_2D_step03.2563.2563.1	1.2989	0.2896	1172.05	1	5000.0%	1	R.KGEFETGFEK.G
UPSB5_MOUSE99.1%81628.2%209229678.5(O55234) Proteasome subunit beta type 5 precursor (EC 3.4.25.1) (Proteasome epsilon chain) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome subunit X) (Proteasome chain 6) 
	TK270802_E14_cyto_2D_step03.4388.4388.3	1.6475	0.0056	3531.82	10	1210.0%	1	R.GPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDR.G
	TK270802_E14_cyto_2D_step01.1870.1870.1	2.1415	0.239	1301.94	1	6360.0%	2	R.VSSDNVADLHDK.Y
	TK270802_E14_cyto_2D_step05.2630.2630.2	2.4172	0.3168	1586.01	1	6150.0%	1	K.RGPGLYYVDSEGNR.I
	TK270802_E14_cyto_2D_step06.3013.3013.1	2.1541	0.3556	1286.73	1	4550.0%	3	K.FLHGVIVAADSR.A
UGUAA_HUMAN99.1%558.4%693767156.9(P49915) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Glutamine amidotransferase) (GMP synthetase) 
*	TK270802_E14_cyto_2D_step12.3407.3407.2	1.6903	0.3888	2348.91	3	2630.0%	1	K.ISQMPVILTPLHFDRDPLQK.Q
*	TK270802_E14_cyto_2D_step07.2429.2429.1	1.5141	0.1419	787.24	1	5830.0%	1	K.KLGIQVK.V
*	TK270802_E14_cyto_2D_step07.2396.2396.1	1.8674	0.3611	1236.73	1	6110.0%	1	K.THHNDTELIR.K
*	TK270802_E14_cyto_2D_step13.2322.2322.1	1.5149	0.2575	994.04	3	5710.0%	1	K.KPHTLLQR.V
*	TK270802_E14_cyto_2D_step01.4315.4315.1	1.2331	0.2501	1592.77	4	2920.0%	1	K.DEPDWESLIFLAR.L
UGLYG_MOUSE99.1%5135.1%332372715.3(Q9R062) Glycogenin-1 (EC 2.4.1.186) 
	TK270802_E14_cyto_2D_step08.2771.2771.1	1.096	0.0302	829.71	6	5830.0%	3	K.VVHFLGR.T
*	TK270802_E14_cyto_2D_step07.2864.2864.1	1.4961	0.2302	1128.05	1	5000.0%	2	K.RPELGITLTK.L
UALFA_HUMAN99.1%243.3%363392898.1(P04075) Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Muscle-type aldolase) (Lung cancer antigen NY-LU-1) 
*	TK270802_E14_cyto_2D_step06.2447.2447.1	1.8188	0.3534	1435.78	5	5000.0%	2	-.PYQYPALTPEQK.K
USTN2_MOUSE99.1%4810.1%179208288.3(P55821) Stathmin 2 (SCG10 protein) (Superior cervical ganglion-10 protein) 
	TK270802_E14_cyto_2D_step03.3182.3182.1	1.1698	0.103	943.85	4	5000.0%	2	K.TAMAYKEK.M
	TK270802_E14_cyto_2D_step01.1776.1776.1	1.9765	0.3558	1167.46	1	5560.0%	2	K.ALEENNNFSK.M
UKCRB_MOUSE99.1%164229.1%381427135.7(Q04447) Creatine kinase, B chain (EC 2.7.3.2) (B-CK) 
	TK270802_E14_cyto_2D_step01.4070.4070.1	2.0098	0.2792	1560.3	1	5000.0%	1	R.FCTGLTQIETLFK.S
	TK270802_E14_cyto_2D_step12.3948.3948.2	1.2675	0.1126	1851.41	1	3750.0%	2	R.LGFSEVELVQMVVDGVK.L
	TK270802_E14_cyto_2D_step05.2279.2279.1	1.8731	0.24	983.91	2	5000.0%	2	R.GIWHNDNK.T
	TK270802_E14_cyto_2D_step07.2493.2493.1	1.1742	0.0082	1232.88	13	3890.0%	2	R.GFCLPPHCSR.G
*	TK270802_E14_cyto_2D_step15.1890.1890.3	1.1944	0.0868	2240.07	3	1620.0%	1	K.LAVEALSSLDGDLSGRYYALK.S
*	TK270802_E14_cyto_2D_step05.3142.3142.2	1.0385	0.2807	2188.57	7	1940.0%	1	R.FPAEDEFPDLSSHNNHMAK.V
*	TK270802_E14_cyto_2D_step05.1767.1767.1	1.2828	0.0492	1254.57	2	4500.0%	1	R.HGGYQPSDEHK.T
	TK270802_E14_cyto_2D_step06.2009.2009.1	1.1904	0.1642	624.99	13	5000.0%	1	R.AGVHIK.L
*	TK270802_E14_cyto_2D_step11.2245.2245.1	1.0621	0.0579	666.92	1	6000.0%	5	K.LPHLGK.H
UQ8R0B299.1%115.5%236263696.8(Q8R0B2) Hypothetical 26.4 kDa protein (Fragment) 
	TK270802_E14_cyto_2D_step13.2530.2530.1	2.147	0.3751	1494.83	1	5000.0%	1	K.LFHTAPNVPHYAK.N
USKD1_MOUSE99.1%464.3%444493897.5(P46467) SKD1 protein (Vacuolar sorting protein 4b) 
	TK270802_E14_cyto_2D_step11.2998.2998.1	1.9096	0.3705	946.99	1	6430.0%	2	K.FPHLFTGK.R
	TK270802_E14_cyto_2D_step05.1941.1941.1	1.055	0.0039	918.87	155	5000.0%	1	K.VQSATHFK.K
	TK270802_E14_cyto_2D_step03.1518.1518.1	0.816	0.0246	403.94	2	7500.0%	1	K.KVR.G
UQ9CXT499.1%71120.5%200231614.4(Q9CXT4) 13 days embryo head cDNA, RIKEN full-length enriched library, clone:3110006M19, full insert sequence 
	TK270802_E14_cyto_2D_step06.2175.2175.1	1.6824	0.3411	884.19	1	6430.0%	2	K.HLNLSGNK.I
	TK270802_E14_cyto_2D_step04.2190.2190.1	2.249	0.3185	990.63	1	6430.0%	1	K.KLELSENR.I
	TK270802_E14_cyto_2D_step01.2696.2696.1	1.1622	0.0039	1175.91	5	5000.0%	1	R.ISGDLEVLAEK.C
	TK270802_E14_cyto_2D_step05.2038.2038.1	1.4691	0.0526	745.13	8	7000.0%	2	K.KLENLK.S
	TK270802_E14_cyto_2D_step01.2127.2127.1	1.1937	0.0792	990.97	1	6430.0%	1	K.ELVLDNCK.S
UQ91X9499.1%3314.4%257292839.3(Q91X94) Similar to heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein 1, 37kD) 
	TK270802_E14_cyto_2D_step13.1822.1822.1	2.1294	0.3554	1046.83	1	6880.0%	1	K.KYHNVGLSK.C
	TK270802_E14_cyto_2D_step01.0150.0150.1	1.1991	0.0437	1490.82	1	4620.0%	1	K.IFVGGLSPDTPEEK.I
	TK270802_E14_cyto_2D_step04.3665.3665.2	2.122	0.2994	1732.1	1	6150.0%	1	R.GFCFITFKEEEPVK.K
UGYG2_HUMAN99.1%3510.0%501552125.1(O15488) Glycogenin-2 (EC 2.4.1.186) (GN-2) (GN2) 
*	TK270802_E14_cyto_2D_step11.3982.3982.3	0.9913	0.0356	4579.73	246	770.0%	1	K.YNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYK.S
*	TK270802_E14_cyto_2D_step07.2864.2864.1	1.4961	0.2302	1128.05	1	5000.0%	2	K.RPELGLTLTK.L
UQ9D18499.1%113.3%330367465.1(Q9D184) 2810434B10Rik protein 
	TK270802_E14_cyto_2D_step08.2715.2715.1	1.8909	0.3562	1311.69	1	5500.0%	1	K.NLNHPNIIGYR.A
UQ9WTQ599.1%797.3%16841806944.4(Q9WTQ5) SSECKS (PKC binding protein SSECKS) 
*	TK270802_E14_cyto_2D_step10.3972.3972.3	1.7616	0.0693	2914.35	2	2190.0%	1	R.DSEVMEVARCQETESNEEQSISPEK.R
*	TK270802_E14_cyto_2D_step15.2245.2245.2	0.7633	0.2295	1263.58	24	2000.0%	1	R.EGITPWASFKK.M
*	TK270802_E14_cyto_2D_step03.2479.2479.1	1.4351	0.2373	1535.0	1	3850.0%	1	K.ELEVPVHTGPNSQK.T
*	TK270802_E14_cyto_2D_step05.3437.3437.1	1.8086	0.3451	1569.03	1	5000.0%	2	K.TLVHTVSVAVIDGTR.A
*	TK270802_E14_cyto_2D_step05.1971.1971.1	2.059	0.3778	1491.63	1	4230.0%	1	K.EHAADGPQHQSLAK.A
*	TK270802_E14_cyto_2D_step06.5247.5247.3	1.4538	0.0462	4302.18	3	1220.0%	1	R.SPEQPAESDTPSELELSGHGPAAEASGAAGDPADADPATKLPQK.N
UPRS4_HUMAN99.1%102410.9%440491856.2(Q03527) 26S protease regulatory subunit 4 (P26s4) (Q03527) 26S protease regulatory subunit 4 (P26s4) 
	TK270802_E14_cyto_2D_step07.2570.2570.1	1.355	0.2652	1004.05	1	5000.0%	3	R.IFQIHTSR.M
	TK270802_E14_cyto_2D_step10.2526.2526.2	2.2521	0.361	1324.15	1	6000.0%	3	K.LPLVTPHTQCR.L
	TK270802_E14_cyto_2D_step04.3181.3181.1	2.1022	0.3723	1218.28	1	5000.0%	1	R.KIEFPLPDEK.T
	TK270802_E14_cyto_2D_step15.2741.2741.3	1.2732	0.0188	2152.38	16	2220.0%	1	R.TMLELLNQLDGFDSRGDVK.V
UQ922W299.1%4612.7%416475106.1(Q922W2) Unknown (Protein for MGC:7055) 
	TK270802_E14_cyto_2D_step08.3263.3263.3	1.2659	0.1255	2528.89	31	1790.0%	1	R.FQEDLISSAVAELNYGLCLMTR.E
	TK270802_E14_cyto_2D_step09.3154.3154.2	0.7478	0.0094	2489.06	110	1250.0%	2	R.VTPLGYVLPSHVTEEMLWECK.Q
	TK270802_E14_cyto_2D_step06.2126.2126.1	1.9147	0.3762	1053.72	1	5560.0%	1	K.ALGIHQTGQK.V
UQ9DCS799.1%395.7%227257158.0(Q9DCS7) 0610011D08Rik protein 
	TK270802_E14_cyto_2D_step04.3274.3274.1	2.0562	0.3758	1482.85	1	5420.0%	3	K.YGYTHLSAGELLR.D
UQ8R4X399.1%669.7%10031036478.3(Q8R4X3) SWAN 
	TK270802_E14_cyto_2D_step01.4299.4299.2	0.8141	0.0131	2747.93	9	1350.0%	1	R.FETANLDIPPANASRSGPPPSSGMSSR.V
*	TK270802_E14_cyto_2D_step14.4279.4279.3	1.2184	0.1429	4153.88	33	1000.0%	1	R.SGPPPSSGMSSRVNLPATVPNFNNPSPSVVTATTSVHESNK.N
*	TK270802_E14_cyto_2D_step09.2205.2205.2	1.0129	0.205	1887.14	13	2060.0%	1	K.QSMGPSGQAHPPPQTLPR.S
	TK270802_E14_cyto_2D_step03.2839.2839.1	1.0417	0.0512	894.93	88	3570.0%	1	R.VDAVHLLK.D
	TK270802_E14_cyto_2D_step07.2694.2694.1	1.971	0.3754	1083.92	1	6880.0%	1	R.FIQVHPITK.K
	TK270802_E14_cyto_2D_step07.2182.2182.1	1.0297	0.0042	687.86	5	5000.0%	1	-.MAVVIR.L
UPEBB_MOUSE99.1%4617.1%187220305.8(Q08024) Core-binding factor, beta subunit (CBF-beta) (Polyomavirus enhancer binding protein 2 beta subunit) (PEBP2-beta) (PEA2-beta) (SL3-3 enhancer factor 1 beta subunit) (SL3/AKV core-binding factor beta subunit) 
	TK270802_E14_cyto_2D_step02.3027.3027.1	0.5807	0.0010	1099.87	35	1880.0%	1	-.MPRVVPDQR.S
	TK270802_E14_cyto_2D_step01.4380.4380.1	0.9254	0.0026	1499.63	21	2920.0%	1	K.APMILNGVCVIWK.G
	TK270802_E14_cyto_2D_step04.3009.3009.1	1.9053	0.3726	1334.95	1	5560.0%	2	R.SKFENEEFFR.K
UPSA6_MOUSE99.1%3511.4%246273726.7(Q9QUM9) Proteasome subunit alpha type 6 (EC 3.4.25.1) (Proteasome iota chain) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) 
	TK270802_E14_cyto_2D_step06.3001.3001.1	1.8782	0.371	1159.3	1	7220.0%	2	R.HITIFSPEGR.L
	TK270802_E14_cyto_2D_step04.3873.3873.2	1.9819	0.3814	1981.49	1	5000.0%	1	R.ILTEAEIDAHLVALAERD.-
UQ9EQ3099.1%798.2%11001237744.9(Q9EQ30) Ran binding protein 5 (Fragment) 
	TK270802_E14_cyto_2D_step04.3406.3406.2	2.1791	0.3009	1958.2	1	4710.0%	1	R.VQAHAAAALINFTEDCPK.S
*	TK270802_E14_cyto_2D_step03.2194.2194.1	1.9961	0.1856	1534.76	1	5830.0%	1	R.KQAEETYENIPGR.S
	TK270802_E14_cyto_2D_step04.1972.1972.1	2.0683	0.3641	1038.36	1	7500.0%	1	K.HIVENAVQK.E
	TK270802_E14_cyto_2D_step01.2004.2004.3	1.2945	0.0156	3703.15	72	1330.0%	1	K.LVLEQVVTSIASVADTAEEKFVPYYDLFMPSLK.H
*	TK270802_E14_cyto_2D_step01.1715.1715.1	1.6361	0.3239	856.21	1	6430.0%	1	R.VIQAPEAK.T
	TK270802_E14_cyto_2D_step13.3014.3014.1	1.3304	0.0641	1079.82	14	5000.0%	2	K.HLHSIMVLK.L
UHNT1_MOUSE99.0%62035.2%125136466.9(P70349) Histidine triad nucleotide-binding protein 1 (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) 
	TK270802_E14_cyto_2D_step12.4527.4527.2	1.6501	0.2826	2293.32	1	3160.0%	4	R.CLAFHDISPQAPTHFLVIPK.K
*	TK270802_E14_cyto_2D_step13.3657.3657.2	0.9415	0.3095	2549.44	1	2390.0%	2	R.MVVNEGADGGQSVYHIHLHVLGGR.Q
UQ9Z1A199.0%3510.6%397430205.1(Q9Z1A1) TFG protein (Trk-fused gene) 
	TK270802_E14_cyto_2D_step13.2892.2892.3	1.1536	0.0101	2900.05	21	1460.0%	1	K.YKDEDGDLITIFDSSDLSFAIQCSR.I
*	TK270802_E14_cyto_2D_step11.2426.2426.2	2.2565	0.491	1864.13	1	5000.0%	2	R.NRPPFGQGYAQPGPGYR.-
UUNRI_MOUSE99.0%6818.8%351385135.1(Q9Z1Z2) UNR-interacting protein (Serine-threonine kinase receptor-associated protein) 
	TK270802_E14_cyto_2D_step13.2433.2433.2	1.9438	0.4708	1181.51	1	6670.0%	1	K.GHFGPIHCVR.F
*	TK270802_E14_cyto_2D_step10.2559.2559.3	1.0419	0.2362	3443.78	5	730.0%	1	K.IGFPETAEEELAEEIASENSDSIYSSTPEVKA.-
	TK270802_E14_cyto_2D_step03.1964.1964.1	1.3199	0.2292	1028.79	1	5000.0%	1	K.EISGHTSGIK.K
*	TK270802_E14_cyto_2D_step05.3290.3290.1	2.4151	0.3336	1500.94	1	5770.0%	2	R.SIAFHSAVSLEPIK.S
UTBBQ_HUMAN99.0%2210.8%434484355.3(Q99867) Tubulin beta-4q chain 
*	TK270802_E14_cyto_2D_step01.3852.3852.1	0.8893	0.0425	1594.32	145	1920.0%	1	R.HGCYLTAAAIFRGR.M
	TK270802_E14_cyto_2D_step05.3731.3731.3	2.9435	0.4613	3442.11	1	2190.0%	1	R.KEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK.I
UQ9D02998.9%5918.4%309334495.6(Q9D029) DNA segment, Chr 7, Wayne state University 128, expressed (Unknown) (Protein for MGC:19443) 
	TK270802_E14_cyto_2D_step09.2753.2753.1	1.5504	0.3817	1392.81	1	5420.0%	2	K.IHSITGLPPAMQK.V
*	TK270802_E14_cyto_2D_step10.3965.3965.2	1.0354	0.0618	2913.22	15	1290.0%	1	R.GNLQPAPAQPPGDPAAQASVSNGEDAGGGVGK.E
	TK270802_E14_cyto_2D_step01.2927.2927.1	1.215	0.0156	1323.15	21	4090.0%	2	R.LPTVPLSGMYNK.S
UQ91Z5398.9%227.6%328353297.6(Q91Z53) Similar to glyoxylate reductase/hydroxypyruvate reductase 
*	TK270802_E14_cyto_2D_step07.3010.3010.2	2.8493	0.4625	1755.56	1	6000.0%	1	R.KDLEQGVVGAHGLLCR.L
	TK270802_E14_cyto_2D_step13.2101.2101.1	0.7465	0.051	1101.89	18	3120.0%	1	R.RLKPFGVQR.F
UK1CJ_HUMAN98.9%334.9%593595195.2(P13645) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) 
*	TK270802_E14_cyto_2D_step13.2698.2698.1	0.3912	0.1558	1047.15	46	1250.0%	1	-.MSVRYSSSK.H
	TK270802_E14_cyto_2D_step04.2549.2549.1	2.0779	0.3522	1235.11	1	6670.0%	1	R.LKYENEVALR.Q
*	TK270802_E14_cyto_2D_step04.3061.3061.1	1.0155	0.0103	1188.21	33	3890.0%	1	R.RVLDELTLTK.A
UCALM_HUMAN98.9%62620.3%148167064.2(P02593) Calmodulin (P02593) Calmodulin 
	TK270802_E14_cyto_2D_step01.2619.2619.1	1.9447	0.3508	958.75	1	7140.0%	5	K.EAFSLFDK.D
	TK270802_E14_cyto_2D_step02.3718.3718.2	1.8562	0.3875	2494.48	1	2620.0%	1	R.EADIDGDGQVNYEEFVQMMTAK.-
UO7036598.9%441.6%22382575615.4(O70365) Golgi autoantigen golgin subtype a4 
	TK270802_E14_cyto_2D_step04.1892.1892.1	1.1475	0.0711	1229.76	11	4440.0%	1	K.NLIEQLEQDK.G
*	TK270802_E14_cyto_2D_step10.1756.1756.2	0.9295	0.0791	952.86	65	4170.0%	1	R.DEHLRER.Q
*	TK270802_E14_cyto_2D_step05.2370.2370.1	2.0494	0.352	1237.94	4	5000.0%	1	K.YQQEKDALLK.E
*	TK270802_E14_cyto_2D_step04.2580.2580.1	0.963	0.1196	1102.97	84	2500.0%	1	K.QVVEMETHK.K
UO8856898.9%7711.9%798878926.3(O88568) Heterogenous nuclear ribonucleoprotein U 
	TK270802_E14_cyto_2D_step04.0334.0334.2	0.6505	0.0774	2604.81	206	710.0%	1	K.GNFTLPEVAECFDEITYVELQK.E
*	TK270802_E14_cyto_2D_step11.2327.2327.3	1.3863	0.0142	2065.31	351	1550.0%	1	R.GGGGGSGGIGYPYPRGPVFPGR.G
	TK270802_E14_cyto_2D_step07.4277.4277.2	1.0456	0.0882	3188.47	1	1730.0%	1	K.GNFTLPEVAECFDEITYVELQKEEAQK.L
	TK270802_E14_cyto_2D_step06.1905.1905.1	1.1556	0.1057	661.41	1	6250.0%	1	R.HLYTK.D
*	TK270802_E14_cyto_2D_step04.4170.4170.3	3.3534	0.3339	4346.82	1	1790.0%	1	K.TCNCETEDYGEKFDENDVITCFANFETDEVELSYAK.N
	TK270802_E14_cyto_2D_step08.1547.1547.1	0.5268	0.0148	612.73	4	2500.0%	1	R.EDHGR.G
*	TK270802_E14_cyto_2D_step03.4187.4187.2	1.1958	0.2982	2857.74	1	2830.0%	1	K.FDENDVITCFANFETDEVELSYAK.N
UQ6086498.8%7910.3%543625826.8(Q60864) MSTI1 
*	TK270802_E14_cyto_2D_step04.2161.2161.1	1.4623	0.2442	1069.34	9	3750.0%	1	K.HEANNLQLK.E
*	TK270802_E14_cyto_2D_step03.2414.2414.2	2.2093	0.508	1458.1	1	5000.0%	1	K.LDPQNHVLYSNR.S
	TK270802_E14_cyto_2D_step01.3064.3064.1	1.1133	0.0741	1490.04	3	4170.0%	1	R.LAYINPDLALEEK.N
	TK270802_E14_cyto_2D_step04.1994.1994.1	1.9682	0.0755	863.94	2	6670.0%	2	K.HYTEAIK.R
	TK270802_E14_cyto_2D_step03.2520.2520.1	1.8732	0.2868	1007.83	1	6430.0%	1	K.DAIHFYNK.S
	TK270802_E14_cyto_2D_step01.1588.1588.1	1.4813	0.3037	770.11	2	5830.0%	1	K.NPVIAQK.I
URL44_HUMAN98.8%247.6%1051231010.6(P09896) 60S ribosomal protein L44 (L36a) (P09896) 60S ribosomal protein L44 (L36a) 
	TK270802_E14_cyto_2D_step03.2504.2504.1	2.3052	0.3329	903.84	1	7140.0%	2	K.HFELGGDK.K
UQ9CVA398.8%227.5%161183749.1(Q9CVA3) 2210415M20Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step13.2378.2378.2	2.6619	0.459	1313.81	1	7270.0%	1	K.IVVHLHPAPSNK.E
UCAZ1_MOUSE98.8%2212.3%284327525.6(P47753) F-actin capping protein alpha-1 subunit (CapZ alpha-1) (Fragment) 
	TK270802_E14_cyto_2D_step05.3543.3543.2	2.2373	0.4908	2091.12	1	5880.0%	1	K.FITHAPPGEFNEVFNDVR.L
	TK270802_E14_cyto_2D_step06.2834.2834.2	2.4569	0.4038	2031.57	1	5000.0%	1	K.IQVHYYEDGNVQLVSHK.D
U2AAA_HUMAN98.7%6109.9%588650925.1(P30153) Serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform (PP2A, subunit A, PR65-alpha isoform) (PP2A, subunit A, R1-alpha isoform) (Medium tumor antigen-associated 61 KDA protein) 
	TK270802_E14_cyto_2D_step08.2930.2930.1	1.1633	0.1187	967.82	35	4290.0%	2	K.HMLPTVLR.M
	TK270802_E14_cyto_2D_step04.2896.2896.1	1.6373	0.181	1168.0	10	5000.0%	2	K.EWAHATIIPK.V
	TK270802_E14_cyto_2D_step14.2238.2238.3	1.1767	0.0923	2778.13	6	1440.0%	1	K.ELVSDANQHVKSALASVIMGLSPILGK.D
	TK270802_E14_cyto_2D_step03.2795.2795.2	2.4335	0.4647	1474.69	1	5830.0%	1	K.VLAMSGDPNYLHR.M
UDYNA_MOUSE98.6%101413.3%12811417276.0(O08788) Dynactin 1 (150 kDa dynein-associated polypeptide) (DP-150) (DAP-150) (p150-glued) 
	TK270802_E14_cyto_2D_step07.3792.3792.3	1.2554	0.0258	2951.86	144	1300.0%	1	K.EQVDAALGAEEMVEMLTDRNLNLEEK.V
	TK270802_E14_cyto_2D_step07.3369.3369.3	1.7885	0.1324	2105.4	39	2500.0%	1	K.EQVDAALGAEEMVEMLTDR.N
	TK270802_E14_cyto_2D_step13.2472.2472.2	0.7251	0.0294	1704.0	11	2310.0%	1	R.QQQPPPETFDFKIK.F
	TK270802_E14_cyto_2D_step06.2914.2914.2	2.0351	0.4988	2784.86	1	2500.0%	1	K.LATAMQEGEYDAERPPSKPPPVELR.A
*	TK270802_E14_cyto_2D_step07.4790.4790.3	1.1167	0.1199	4298.13	1	1310.0%	1	R.KHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFK.A
	TK270802_E14_cyto_2D_step08.3965.3965.3	1.7606	0.1158	4053.66	2	1470.0%	2	R.HMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICK.A
	TK270802_E14_cyto_2D_step10.2738.2738.2	2.38	0.4661	1704.96	1	4620.0%	2	R.LVLTQEQLHQLHSR.L
*	TK270802_E14_cyto_2D_step08.2707.2707.2	1.948	0.456	1737.05	1	5000.0%	1	K.LNQLSTHTHVVDITR.S
UQ9NYE598.6%172111.1%27252910206.0(Q9NYE5) Gamma-filamin 
	TK270802_E14_cyto_2D_step03.3235.3235.2	1.7131	0.2579	1300.05	1	4500.0%	1	K.VPQLPITNFNR.D
	TK270802_E14_cyto_2D_step12.3239.3239.3	1.796	0.0191	3919.98	5	1250.0%	1	R.GPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR.R
	TK270802_E14_cyto_2D_step15.0818.0818.2	0.7846	0.0917	2640.97	31	1740.0%	1	K.DNKDGTCTVSYLPTAPGDYSIIVR.F
	TK270802_E14_cyto_2D_step04.5008.5008.2	1.2128	0.1828	2710.48	1	1880.0%	1	R.EVRVEESTQVGGDPFPAVFGDFLGR.E
	TK270802_E14_cyto_2D_step08.2904.2904.2	1.6249	0.3865	1715.85	4	3670.0%	1	R.TGVEVGKPTHFTVLTK.G
	TK270802_E14_cyto_2D_step01.1516.1516.1	0.9017	0.1074	787.02	152	4170.0%	1	K.VVPNNDK.D
	TK270802_E14_cyto_2D_step06.2289.2289.1	1.5649	0.3759	929.72	1	6430.0%	1	K.HVTNSPFK.I
	TK270802_E14_cyto_2D_step13.2196.2196.3	1.3083	0.0353	1792.4	56	2660.0%	1	R.QAPSIATIGSTCDLNLK.I
	TK270802_E14_cyto_2D_step01.3851.3851.1	1.3883	0.2568	1440.22	1	4090.0%	2	K.YADQEVPRSPFK.I
	TK270802_E14_cyto_2D_step07.2925.2925.1	1.6045	0.1438	1001.1	12	5000.0%	2	R.HIGISFTPK.E
	TK270802_E14_cyto_2D_step03.4716.4716.1	0.4797	0.0069	489.79	1	2500.0%	1	R.GGETK.R
	TK270802_E14_cyto_2D_step05.3848.3848.3	1.0444	0.0138	4309.85	7	1220.0%	1	K.TDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPK.S
	TK270802_E14_cyto_2D_step10.4129.4129.3	1.2647	0.157	3469.55	14	1020.0%	1	K.SADFVVEAIGTEVGTLGFSIEGPSQAKIECDDK.G
	TK270802_E14_cyto_2D_step03.2030.2030.1	0.7558	0.2238	1599.2	22	1920.0%	1	K.YVVTITWGGYAIPR.S
	TK270802_E14_cyto_2D_step06.3775.3775.3	1.1109	0.0011	4796.85	74	810.0%	1	K.DGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDAR.R
URS8_HUMAN98.6%113329.0%2072407410.3(P09058) 40S ribosomal protein S8 (P09058) 40S ribosomal protein S8 
	TK270802_E14_cyto_2D_step08.2360.2360.1	0.9901	0.0705	1347.79	11	3180.0%	2	R.KYELGRPAANTK.I
	TK270802_E14_cyto_2D_step07.1749.1749.1	1.266	0.0736	781.98	6	7000.0%	1	R.RIHTVR.V
	TK270802_E14_cyto_2D_step04.3357.3357.2	2.4826	0.4276	1621.06	1	6250.0%	1	R.QWYESHYALPLGR.K
	TK270802_E14_cyto_2D_step01.2830.2830.1	1.5808	0.3678	1508.06	1	5420.0%	1	K.ISSLLEEQFQQGK.L
	TK270802_E14_cyto_2D_step12.3085.3085.2	1.0494	0.0412	1914.16	164	2000.0%	1	R.LDVGNFSWGSECCTRK.T
	TK270802_E14_cyto_2D_step07.1854.1854.1	0.7315	0.0085	627.6	12	6250.0%	5	R.IHTVR.V
UMOES_MOUSE98.6%8816.8%576676366.6(P26041) Moesin (Membrane-organizing extension spike protein) 
	TK270802_E14_cyto_2D_step03.1907.1907.2	2.4949	0.1815	1361.64	1	6500.0%	1	K.KAQQELEEQTR.R
	TK270802_E14_cyto_2D_step07.2557.2557.1	1.522	0.1343	1234.74	3	5000.0%	1	R.IQVWHEEHR.G
	TK270802_E14_cyto_2D_step05.2914.2914.1	1.8031	0.2013	962.05	1	6430.0%	1	R.KESPLLFK.F
	TK270802_E14_cyto_2D_step06.2471.2471.1	1.5243	0.2776	1532.77	2	3330.0%	1	K.KTANDMIHAENMR.L
*	TK270802_E14_cyto_2D_step15.3069.3069.3	1.2117	0.0233	2609.19	30	1140.0%	1	K.TQEQLASEMAELTARISQLEMAR.K
	TK270802_E14_cyto_2D_step14.3908.3908.2	0.9782	0.0224	2403.87	17	2110.0%	1	K.ESEAVEWQQKAQMVQEDLEK.T
	TK270802_E14_cyto_2D_step13.1613.1613.2	1.0345	0.01	1659.32	21	2920.0%	1	R.EVWFFGLQYQDTK.A
UP9731598.6%71528.5%193205838.6(P97315) CYSTEIN rich protein-1 (Similar to cysteine rich protein) 
	TK270802_E14_cyto_2D_step12.0365.0365.2	0.9604	0.0821	1844.49	6	2500.0%	3	K.HEEAPGHRPTTNPNASK.F
	TK270802_E14_cyto_2D_step03.5062.5062.1	0.7311	0.0129	1465.01	81	2730.0%	1	K.DGEIYCKGCYAK.N
	TK270802_E14_cyto_2D_step05.3023.3023.2	2.5622	0.3526	2046.98	1	4690.0%	2	K.TVYFAEEVQCEGNSFHK.S
	TK270802_E14_cyto_2D_step06.1806.1806.2	0.972	0.0681	1205.4	466	3750.0%	1	K.SCFLCMVCK.K
UQ9CSN898.6%5910.3%369422218.5(Q9CSN8) Nuclear distribution gene C homolog (Aspergillus) (Fragment) 
	TK270802_E14_cyto_2D_step13.2501.2501.2	2.5485	0.458	1795.3	1	5000.0%	2	K.LITQTFNHHNQLAQK.A
	TK270802_E14_cyto_2D_step04.2677.2677.2	2.7039	0.3873	1645.66	1	5710.0%	2	K.LKPNLGNGADLPNYR.W
	TK270802_E14_cyto_2D_step04.2397.2397.1	1.4915	0.1691	925.14	3	5710.0%	1	K.VVTVHLEK.I
UQ9D6E698.6%396.4%172198614.8(Q9D6E6) 2900073G15Rik protein 
	TK270802_E14_cyto_2D_step06.3113.3113.1	2.1889	0.3395	1390.78	1	5500.0%	3	K.KGNFNYIEFTR.I
UQ9ERD398.6%118.2%159175434.2(Q9ERD3) Telokin 
	TK270802_E14_cyto_2D_step01.3587.3587.1	1.8037	0.3421	1581.81	1	4170.0%	1	K.IEGYPDPEVVWFK.D
URL27_HUMAN98.6%61810.4%1351566710.6(P08526) 60S ribosomal protein L27 
*	TK270802_E14_cyto_2D_step03.2930.2930.1	1.3017	0.2348	827.93	30	5000.0%	3	K.VVLVLAGR.Y
*	TK270802_E14_cyto_2D_step07.2014.2014.1	1.352	0.2768	709.69	2	7000.0%	3	K.FMKPGK.V
UO5518198.6%4610.4%280318898.4(O55181) RBP associated molecule RAM14-1 
*	TK270802_E14_cyto_2D_step04.2576.2576.1	1.2287	0.2191	1197.68	1	7140.0%	1	R.YWHDNCFR.C
*	TK270802_E14_cyto_2D_step05.2858.2858.1	1.6381	0.3485	1489.83	1	4580.0%	1	K.CLHPLASETFVSK.D
*	TK270802_E14_cyto_2D_step04.1585.1585.1	0.9899	0.088	829.82	13	4290.0%	2	R.KPISADAK.E
UFAS_MOUSE98.6%131912.5%838912137.7(P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: EC 2.3.1.38; EC 2.3.1.39; EC 2.3.1.41; EC 1.1.1.100; EC 4.2.1.61; EC 1.3.1.10; EC 3.1.2.14] (Fragment) 
	TK270802_E14_cyto_2D_step06.1644.1644.1	0.8487	0.0298	841.91	164	3330.0%	1	R.CLAQHGR.F
	TK270802_E14_cyto_2D_step06.2586.2586.1	1.9182	0.3306	1264.13	1	4500.0%	2	K.VSVHIIEGDHR.T
	TK270802_E14_cyto_2D_step03.4927.4927.2	1.4786	0.2357	2453.67	12	2050.0%	2	R.TLLEGSGLESIINIIHSSLAEPR.V
	TK270802_E14_cyto_2D_step05.3479.3479.1	1.0152	0.2016	1398.78	10	2730.0%	1	R.ELSFAAVSFYHK.L
*	TK270802_E14_cyto_2D_step01.2811.2811.1	1.1314	0.0275	1268.49	38	3640.0%	1	K.KAVAHGDGDNQR.D
	TK270802_E14_cyto_2D_step07.2689.2689.1	1.246	0.0224	1074.88	28	5000.0%	2	K.YHGNVTLLR.A
	TK270802_E14_cyto_2D_step03.3127.3127.1	0.9696	0.1737	1110.04	2	3750.0%	1	R.EHDLVLPMR.E
	TK270802_E14_cyto_2D_step04.1880.1880.1	1.2381	0.212	951.78	2	5710.0%	1	R.KLQEMSSK.T
	TK270802_E14_cyto_2D_step08.2516.2516.2	1.5642	5.0E-4	1498.67	4	4580.0%	1	K.LQASVRCLAQHGR.F
	TK270802_E14_cyto_2D_step03.2152.2152.1	2.0657	0.1012	856.88	3	6430.0%	1	R.DGVVKPLK.C
UQ8R0U698.6%115.5%236265208.8(Q8R0U6) Hypothetical 26.5 kDa protein (Fragment) 
	TK270802_E14_cyto_2D_step04.2577.2577.1	1.7845	0.3444	1537.96	1	4580.0%	1	K.KIENCNYAVELGK.N
UCBG_MOUSE98.6%6821.7%397447695.2(Q06770) Corticosteroid-binding globulin precursor (CBG) (Transcortin) 
*	TK270802_E14_cyto_2D_step05.2390.2390.1	1.4249	0.2045	1015.9	74	4380.0%	1	K.RLVALNSDK.N
*	TK270802_E14_cyto_2D_step07.3060.3060.3	1.6759	0.0347	2821.73	13	1880.0%	1	K.DLFTNQSDFADTTKDTPLTLTVLHK.A
*	TK270802_E14_cyto_2D_step01.2003.2003.1	0.9655	0.181	861.17	2	5000.0%	1	R.LVALNSDK.N
*	TK270802_E14_cyto_2D_step15.0008.0008.3	1.2204	0.0943	4663.1	7	1100.0%	1	K.AMLQLDEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDK.Y
*	TK270802_E14_cyto_2D_step03.1802.1802.1	1.03	0.0651	1111.71	118	2780.0%	2	K.AGEQINNHVK.N
URL9_MOUSE98.6%71924.5%1922188110.0(P51410) 60S ribosomal protein L9 
	TK270802_E14_cyto_2D_step10.3735.3735.2	2.0095	0.3963	2486.7	1	2860.0%	3	R.SVYAHFPINVVIQENGSLVEIR.N
	TK270802_E14_cyto_2D_step05.2711.2711.1	2.2921	0.2268	1333.15	2	6000.0%	3	R.TICSHVQNMIK.G
	TK270802_E14_cyto_2D_step14.2057.2057.2	0.7501	0.032	1597.48	5	1920.0%	1	R.DFNHINVELSLLGK.K
URL28_MOUSE98.6%7736.8%1361560212.0(P41105) 60S ribosomal protein L28 
*	TK270802_E14_cyto_2D_step05.1893.1893.1	1.3408	5.0E-4	884.97	1	7140.0%	1	R.SQKPVVVK.R
	TK270802_E14_cyto_2D_step05.2110.2110.1	1.2537	0.0543	820.95	77	6000.0%	1	K.YRPDLR.M
	TK270802_E14_cyto_2D_step01.1623.1623.1	0.8629	0.1739	1043.77	11	2500.0%	1	K.TVGVEPAADGK.G
	TK270802_E14_cyto_2D_step06.1970.1970.1	1.391	0.1668	921.99	4	5710.0%	1	R.KPATSYVR.T
	TK270802_E14_cyto_2D_step09.2085.2085.1	0.9781	0.0895	556.61	14	6670.0%	1	R.HMIR.K
	TK270802_E14_cyto_2D_step05.1509.1509.1	0.8751	0.0219	758.17	4	4000.0%	1	K.RTRPTK.S
*	TK270802_E14_cyto_2D_step02.2618.2618.1	1.6564	0.3343	731.75	1	6670.0%	1	K.GVVVVMK.R
UPSA2_MOUSE98.6%246.0%233257948.3(P49722) Proteasome subunit alpha type 2 (EC 3.4.25.1) (Proteasome component C3) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) 
	TK270802_E14_cyto_2D_step05.3147.3147.1	1.7493	0.3368	1566.85	1	3850.0%	2	K.HIGLVYSGMGPDYR.V
UUBIQ_HUMAN98.6%124439.5%7685657.2(P02248) Ubiquitin (P02248) Ubiquitin 
	TK270802_E14_cyto_2D_step01.2034.2034.1	1.1719	0.0444	1082.04	7	5000.0%	1	R.TLSDYNIQK.E
	TK270802_E14_cyto_2D_step02.2860.2860.1	1.664	0.0097	765.94	7	8000.0%	1	-.MQIFVK.T
	TK270802_E14_cyto_2D_step04.3136.3136.1	2.0662	0.2789	1069.29	1	6250.0%	5	K.ESTLHLVLR.L
	TK270802_E14_cyto_2D_step01.2467.2467.1	2.0027	0.0639	650.92	3	8000.0%	4	R.LIFAGK.Q
UQ9CQX898.6%1112.7%1021110110.0(Q9CQX8) 1110018B13Rik protein (RIKEN cDNA 1110018B13 gene) 
*	TK270802_E14_cyto_2D_step13.2642.2642.2	2.9675	0.4391	1431.21	1	6670.0%	1	R.VVQVVKPHAPLIK.F
UQ9H85398.5%6185.0%241275468.4(Q9H853) Hypothetical protein FLJ13940 
*	TK270802_E14_cyto_2D_step04.3377.3377.2	1.7915	0.4106	1413.89	1	6820.0%	3	R.QIFHPEQLITGK.E
URL12_MOUSE98.5%61419.4%165177919.4(P35979) 60S ribosomal protein L12 
	TK270802_E14_cyto_2D_step08.3546.3546.2	1.7153	0.3224	1688.61	1	5000.0%	3	K.HSGNITFDEIVNIAR.Q
	TK270802_E14_cyto_2D_step03.1808.1808.1	1.0914	0.0047	844.5	3	5710.0%	1	K.KVGDDIAK.A
	TK270802_E14_cyto_2D_step03.2854.2854.1	1.5957	0.1662	884.03	3	6250.0%	2	K.IGPLGLSPK.K
UPSB3_MOUSE98.5%4107.3%205229656.5(Q9R1P1) Proteasome subunit beta type 3 (EC 3.4.25.1) (Proteasome theta chain) (Proteasome chain 13) (Proteasome component C10-II) 
*	TK270802_E14_cyto_2D_step05.3684.3684.1	2.2153	0.3017	1555.94	1	4640.0%	3	R.DAVSGMGVIVHVIEK.D
URL11_MOUSE98.5%4614.1%177201529.6(Q9CXW4) 60S ribosomal protein L11 
	TK270802_E14_cyto_2D_step06.2081.2081.1	1.4289	0.1283	955.98	17	5000.0%	2	K.IAVHCTVR.G
	TK270802_E14_cyto_2D_step03.1936.1936.1	1.63	0.3482	964.63	1	7140.0%	1	R.ISKEEAMR.W
	TK270802_E14_cyto_2D_step01.2606.2606.1	1.4723	0.1213	976.24	22	5620.0%	1	K.YDGIILPGK.-
URNT1_MOUSE98.4%575.5%11131226576.7(Q9EPU0) Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) 
	TK270802_E14_cyto_2D_step06.2379.2379.3	2.0518	0.0784	2409.59	17	1880.0%	1	R.FMTTAMYDAREAIIPGSVYDR.S
	TK270802_E14_cyto_2D_step01.1450.1450.1	0.8001	0.2029	1057.68	63	2220.0%	1	R.YGVIIVGNPK.A
*	TK270802_E14_cyto_2D_step10.4745.4745.2	1.2163	0.0638	1942.72	29	2670.0%	1	K.TDSDMRLMQGDEICLR.Y
	TK270802_E14_cyto_2D_step10.2646.2646.2	1.0305	0.2168	1492.81	1	3460.0%	2	R.GNTSGSHIVNHLVR.A
UADDA_MOUSE98.3%6615.1%735806475.9(Q9QYC0) Alpha adducin (Erythrocyte adducin alpha subunit) 
	TK270802_E14_cyto_2D_step10.3627.3627.3	1.4506	0.05	2871.56	9	2070.0%	1	K.LAAFYRLADLFGWSQLIYNHITTR.V
*	TK270802_E14_cyto_2D_step06.2731.2731.1	1.5718	0.2	1407.01	18	4550.0%	1	K.QKGSEENLDETR.E
	TK270802_E14_cyto_2D_step05.1950.1950.1	1.6238	0.3399	1473.86	1	4290.0%	1	R.AAVVTSPPPTTAPHK.E
	TK270802_E14_cyto_2D_step15.2482.2482.1	0.5306	0.0156	953.11	1	1880.0%	1	R.GSDSIAYDK.G
*	TK270802_E14_cyto_2D_step09.4014.4014.3	1.0049	0.076	4035.51	2	1000.0%	1	K.CGLLPISPEALSLGDVAYHDYHGILVDEEEKILIQK.N
*	TK270802_E14_cyto_2D_step01.2439.2439.1	1.0343	0.1827	1329.03	4	3930.0%	1	R.SPGTPAGEGSGSPPK.W
UQ6094998.3%111.0%11411292698.1(Q60949) Tbc1 
	TK270802_E14_cyto_2D_step07.2034.2034.1	1.619	0.3477	1106.93	1	5500.0%	1	K.VHSAVGQGVPR.H
UQ91V4198.3%5550.2%215238976.2(Q91V41) Adult male kidney cDNA, RIKEN full-length enriched library, clone:0610030G24, full insert sequence (Unknown) (Protein for MGC:6512) 
	TK270802_E14_cyto_2D_step12.3428.3428.3	1.2743	0.0601	3242.73	1	1470.0%	1	K.QFAEENGLLFLEASAKTGENVEDAFLEAAK.K
	TK270802_E14_cyto_2D_step04.2914.2914.1	1.0979	0.0998	1262.43	1	6110.0%	1	K.SCLLHQFTEK.K
	TK270802_E14_cyto_2D_step04.3429.3429.2	3.034	0.4244	1651.84	1	5770.0%	1	R.STYNHLSSWLTDAR.N
	TK270802_E14_cyto_2D_step06.2883.2883.2	1.1697	0.0946	3153.04	6	1550.0%	1	K.IYQNIQDGSLDLNAAESGVQHKPSAPQGGR.L
*	TK270802_E14_cyto_2D_step07.3784.3784.3	1.7005	0.0566	2716.54	2	2280.0%	1	-.MATAPYNYSYIFKYIIIGDMGVGK.S
UMCM2_MOUSE98.3%172315.4%9041020475.8(P97310) DNA replication licensing factor MCM2 
	TK270802_E14_cyto_2D_step09.2108.2108.1	1.0973	0.0295	804.81	18	6000.0%	1	R.LEIHHR.F
	TK270802_E14_cyto_2D_step01.5538.5538.1	1.2715	0.051	1276.35	113	3180.0%	1	K.VAVGELTDEDVK.M
*	TK270802_E14_cyto_2D_step13.2738.2738.1	0.7136	0.0462	1547.7	296	1920.0%	1	K.MITGLSKDQQIGEK.I
*	TK270802_E14_cyto_2D_step03.5168.5168.1	0.947	0.0468	1462.25	141	2310.0%	1	R.ISDPLTSSPGRSSR.R
	TK270802_E14_cyto_2D_step05.3482.3482.1	1.3741	0.0062	1309.18	4	4500.0%	2	R.ISHLPLVEELR.S
	TK270802_E14_cyto_2D_step05.2510.2510.1	1.0337	0.204	885.83	13	5830.0%	1	R.HIESMIR.M
	TK270802_E14_cyto_2D_step13.2004.2004.1	1.2259	0.3192	991.95	6	4290.0%	2	R.ITNHIHVR.I
*	TK270802_E14_cyto_2D_step04.1567.1567.1	1.126	0.0237	798.01	16	5000.0%	1	K.FNKFSR.D
	TK270802_E14_cyto_2D_step07.1869.1869.1	1.0571	0.0329	623.63	34	6250.0%	1	R.KTFAR.Y
*	TK270802_E14_cyto_2D_step04.3694.3694.2	0.914	0.0108	2637.99	29	1430.0%	2	R.DNNDLLLFILKQLVAEQVTYQR.N
	TK270802_E14_cyto_2D_step12.1662.1662.2	2.0093	0.472	1378.81	1	5450.0%	1	R.THVDSHGHNVFK.E
	TK270802_E14_cyto_2D_step07.2369.2369.1	1.2337	0.0615	901.99	21	5710.0%	1	R.FVVGSHVR.H
	TK270802_E14_cyto_2D_step01.5571.5571.1	0.89	0.1467	1546.93	13	2690.0%	1	R.EWTLEAGALVLADR.G
UPSB1_MOUSE98.3%395.8%240263727.8(O09061) Proteasome subunit beta type 1 (EC 3.4.25.1) (Proteasome component C5) (Macropain subunit C5) (Multicatalytic endopeptidase complex subunit C5) (Proteasome gamma chain) 
*	TK270802_E14_cyto_2D_step03.3072.3072.2	2.1697	0.3105	1668.77	1	5000.0%	3	K.NMQNVEHVPLTLDR.A
UZO1_MOUSE98.3%10129.5%17451947106.7(P39447) Tight junction protein ZO-1 (Zonula occludens 1 protein) (Zona occludens 1 protein) (Tight junction protein 1) 
	TK270802_E14_cyto_2D_step11.2602.2602.2	1.8543	0.3598	1971.37	1	4060.0%	1	R.LPEPQKPQVKPPEDIVR.S
*	TK270802_E14_cyto_2D_step08.2756.2756.3	1.4779	0.013	2892.17	24	2080.0%	1	R.KNNHHLFTTTINLNSMNDGWYGALK.E
	TK270802_E14_cyto_2D_step08.1523.1523.3	0.9493	0.0684	1452.56	34	1140.0%	1	R.LHTIKQIIDQDK.H
	TK270802_E14_cyto_2D_step06.1857.1857.1	1.3022	0.0127	1089.88	16	4440.0%	1	K.EISQDSLAAR.D
	TK270802_E14_cyto_2D_step13.2702.2702.2	2.244	0.4725	2178.44	1	5000.0%	1	K.FNHNLLPSETVHKPELSSK.T
*	TK270802_E14_cyto_2D_step15.4441.4441.3	1.0673	0.1418	3982.09	10	1070.0%	1	K.AHSSTQPPEFGSGVETFSVHTDKPKYQMNNISTMPK.A
	TK270802_E14_cyto_2D_step11.4083.4083.2	1.1472	0.0851	1731.36	5	3930.0%	1	K.ESPYGLSFNKGEVFR.V
*	TK270802_E14_cyto_2D_step05.4303.4303.2	1.1639	0.1137	2831.87	86	1250.0%	2	K.NEEYGLRPASHIFVKEISQDSLAAR.D
	TK270802_E14_cyto_2D_step09.3718.3718.2	0.9336	0.0427	1981.59	1	2810.0%	1	R.EDLSAQPVQTKFPAYER.V
UMYO6_MOUSE98.2%444.4%12651464098.8(Q64331) Myosin VI 
*	TK270802_E14_cyto_2D_step10.2537.2537.2	2.7452	0.4418	1849.0	1	4670.0%	1	R.LPQPSDQHFTSVVHQK.H
*	TK270802_E14_cyto_2D_step02.1688.1688.2	0.9052	0.0917	1402.01	86	3330.0%	1	K.EERNHHIFYR.L
	TK270802_E14_cyto_2D_step10.2815.2815.1	0.953	0.0193	911.85	13	5710.0%	1	K.RGAEILPR.Q
	TK270802_E14_cyto_2D_step07.4936.4936.2	1.0428	0.0824	2597.88	108	1430.0%	1	K.DRIYTYVANILIAVNPYFDIPK.I
UQ91V3198.2%247.8%295328384.9(Q91V31) 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510038E09, full insert sequence (37kDa oncofetal antigen) (Laminin receptor 1) (67kD, ribosomal protein SA) (ES cells cDNA, RIKEN full-length enriched library, clone:2410006B03, full insert sequence) (13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510019K07, full insert sequence) 
	TK270802_E14_cyto_2D_step07.3776.3776.2	2.3127	0.3326	2621.69	1	3180.0%	2	K.FLAAGTHLGGTNLDFQMEQYIYK.R
USMD1_HUMAN98.2%3337.0%1191328211.6(P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) (P13641) Small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1) (Sm-D autoantigen) 
	TK270802_E14_cyto_2D_step05.2795.2795.1	1.5791	0.1652	1270.98	10	4500.0%	1	K.LSHETVTIELK.N
	TK270802_E14_cyto_2D_step05.3087.3087.2	2.4713	0.4498	1556.29	1	5830.0%	1	K.NREPVQLETLSIR.G
	TK270802_E14_cyto_2D_step08.3175.3175.3	1.4281	0.1796	2287.3	2	2630.0%	1	R.YFILPDSLPLDTLLVDVEPK.V
UQ9DBY698.2%203826.8%407446548.5(Q9DBY6) 1200009K13Rik protein 
	TK270802_E14_cyto_2D_step05.2163.2163.1	2.0373	0.2325	1189.0	1	5450.0%	2	R.GGSGSHNWGTVK.D
	TK270802_E14_cyto_2D_step03.1812.1812.2	2.4711	0.3991	1243.79	1	7000.0%	2	R.RPDQQLQGDGK.L
	TK270802_E14_cyto_2D_step05.2459.2459.1	2.1028	0.3245	1114.82	1	5000.0%	1	R.SSFSHYSGLK.H
	TK270802_E14_cyto_2D_step13.2326.2326.1	1.8032	0.2145	829.02	4	6670.0%	1	K.KGFVLHK.S
	TK270802_E14_cyto_2D_step06.2485.2485.1	1.5667	0.1326	702.91	16	6000.0%	2	K.GFVLHK.S
	TK270802_E14_cyto_2D_step04.1862.1862.2	2.4226	0.1466	1232.81	1	7500.0%	3	R.KPNEGADGQWK.K
	TK270802_E14_cyto_2D_step09.3169.3169.3	1.5584	0.1742	3030.2	8	1700.0%	1	R.FEKPLEEKGEGGEFSVDRPIIERPIR.G
	TK270802_E14_cyto_2D_step08.2692.2692.2	1.0937	0.0422	2113.4	4	3820.0%	1	K.SKSEEAHAEDSVMDHHFR.K
	TK270802_E14_cyto_2D_step05.2354.2354.1	1.5502	0.1502	1322.97	2	4580.0%	2	K.NPLPPSVGVADKK.E
	TK270802_E14_cyto_2D_step07.2362.2362.1	1.8602	0.2206	1177.75	2	6250.0%	2	R.RFEKPLEEK.G
UTPM1_MOUSE98.2%82812.7%284326814.7(P58771) Tropomyosin 1 alpha chain (Alpha-tropomyosin) 
	TK270802_E14_cyto_2D_step03.1887.1887.1	1.5434	0.1188	897.25	1	5830.0%	5	R.KYEEVAR.K
	TK270802_E14_cyto_2D_step05.3035.3035.2	2.7177	0.3531	1402.84	1	7000.0%	1	R.RIQLVEEELDR.A
	TK270802_E14_cyto_2D_step05.3118.3118.1	1.1007	0.0293	1315.78	16	3500.0%	1	R.KLVIIESDLER.A
	TK270802_E14_cyto_2D_step01.1856.1856.1	1.4954	0.0338	744.83	1	7500.0%	1	R.LATALQK.L
UDNPE_MOUSE98.2%4410.6%473521677.1(Q9Z2W0) Aspartyl aminopeptidase (EC 3.4.11.21) 
*	TK270802_E14_cyto_2D_step06.2775.2775.1	1.6339	0.3254	1385.84	5	4550.0%	1	R.SPSPFHVVAECR.S
*	TK270802_E14_cyto_2D_step13.2752.2752.2	2.0778	0.1103	1247.44	4	6110.0%	1	R.LVHIERPILR.I
*	TK270802_E14_cyto_2D_step04.4390.4390.2	1.4096	0.3302	3070.46	1	1670.0%	1	R.MVTLYDNEEVGSESAQGAQSLLTELILR.R
USNXC_MOUSE98.2%3518.2%165191167.3(O70493) Sorting nexin 12 (SDP8 protein) 
	TK270802_E14_cyto_2D_step06.2030.2030.1	1.8227	0.159	1206.83	1	5000.0%	2	K.IAGHPLAQNER.C
*	TK270802_E14_cyto_2D_step04.3362.3362.3	1.3476	0.1083	2292.97	20	2220.0%	1	R.CLHMFLQEEAIDRNYVAGK.V
UQ9CYZ298.2%228.2%220240436.1(Q9CYZ2) 2810411G23Rik protein (RIKEN cDNA 2810411G23 gene) 
	TK270802_E14_cyto_2D_step03.1868.1868.1	1.839	0.3275	1318.75	1	5450.0%	1	K.KTQETLSQAGQK.T
	TK270802_E14_cyto_2D_step01.0401.0401.1	0.5891	8.0E-4	631.5	23	4000.0%	1	R.QVLAAK.E
UDDX3_MOUSE98.1%112.6%661729707.2(Q62167) DEAD-box protein 3 (DEAD-box RNA helicase DEAD3) (mDEAD3) (Embryonic RNA helicase) (D1PAS1 related sequence 2) 
*	TK270802_E14_cyto_2D_step07.2880.2880.2	2.3436	0.4475	1903.14	1	5000.0%	1	R.VRPCVVYGGAEIGQQIR.D
UQ9CZ5698.0%3331.1%132141939.2(Q9CZ56) 2810405J23Rik protein 
	TK270802_E14_cyto_2D_step13.2494.2494.2	2.2799	0.3777	1405.7	1	5000.0%	1	K.KGGDGIKPPPIIGR.F
	TK270802_E14_cyto_2D_step13.3950.3950.3	2.1369	0.2893	2854.15	1	2400.0%	1	K.GAHNGQGLGNAFLSHISACDGIFHLTR.K
UKC21_MOUSE98.0%4613.6%391451628.0(Q60737) Casein kinase II, alpha chain (CK II) (EC 2.7.1.37) 
	TK270802_E14_cyto_2D_step12.3732.3732.3	1.2069	0.0375	2307.45	15	2080.0%	2	R.LIDWGLAEFYHPGQEYNVR.V
	TK270802_E14_cyto_2D_step06.3755.3755.2	1.2724	0.1115	1866.71	2	2650.0%	1	R.GGPNIITLADIVKDPVSR.T
	TK270802_E14_cyto_2D_step11.2951.2951.2	2.2927	0.4551	2004.1	1	5000.0%	1	R.KEPFFHGHDNYDQLVR.I
UG3BP_MOUSE97.9%143223.2%465518295.6(P97855) Ras-GTPase-activating protein binding protein 1 (GAP SH3-domain binding protein 1) (G3BP-1) 
	TK270802_E14_cyto_2D_step04.3252.3252.1	1.7288	0.2186	1210.92	1	6880.0%	1	K.FYVHNDIFR.Y
	TK270802_E14_cyto_2D_step09.2948.2948.1	0.8823	0.0605	1234.88	46	3330.0%	1	K.VLSNRPIMFR.G
*	TK270802_E14_cyto_2D_step14.1817.1817.3	1.8239	0.2426	2599.09	7	2050.0%	2	K.VPASQPRPESKPDSQIPPQRPQR.D
*	TK270802_E14_cyto_2D_step08.2519.2519.2	1.9519	0.1565	1868.47	1	4170.0%	4	K.NLPPSGAVPVTGTPPHVVK.V
*	TK270802_E14_cyto_2D_step01.3990.3990.1	1.5379	0.2484	1587.34	1	3750.0%	1	K.DFFQNFGNVVELR.I
	TK270802_E14_cyto_2D_step04.2102.2102.1	1.8839	0.2172	1467.92	2	4550.0%	2	K.VMSQNFTNCHTK.I
	TK270802_E14_cyto_2D_step13.3060.3060.2	1.4311	0.2166	2543.14	1	2860.0%	1	R.HPDSHQLFIGNLPHEVDKSELK.D
USERC_MOUSE97.9%133524.9%370404738.0(Q99K85) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT) (Endometrial progesterone-induced protein) (EPIP) 
*	TK270802_E14_cyto_2D_step13.2570.2570.2	2.3174	0.3085	1242.78	1	7000.0%	1	K.KFGTVNIVHPK.L
*	TK270802_E14_cyto_2D_step05.3884.3884.2	2.2219	0.3369	2551.12	1	3500.0%	1	K.SQMIYEIIDNSQGFYVCPVER.Q
*	TK270802_E14_cyto_2D_step05.3403.3403.1	1.5921	0.0155	1300.99	5	4550.0%	1	R.GLGISVLEMSHR.S
*	TK270802_E14_cyto_2D_step01.3987.3987.3	0.7906	0.0568	4324.09	12	690.0%	1	R.ECPSVLDYKVQAGNNSLYNTPPCFSIYVMGMVLEWIK.N
	TK270802_E14_cyto_2D_step08.3156.3156.1	2.5124	0.2013	1279.05	1	6500.0%	5	K.LPHSVLLEIQK.Q
*	TK270802_E14_cyto_2D_step06.2726.2726.1	1.5475	0.0315	1114.09	21	5000.0%	2	K.FGTVNIVHPK.L
UQ9CRE797.9%81022.3%354399855.5(Q9CRE7) 2410174K12Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step10.2426.2426.3	2.0778	0.3222	2927.5	2	2070.0%	1	K.ALEQNPDDAQYYCQRAYCHILLGK.Y
*	TK270802_E14_cyto_2D_step06.2837.2837.1	1.4363	0.0019	1076.05	6	4380.0%	1	R.AYCHILLGK.Y
*	TK270802_E14_cyto_2D_step08.3175.3175.2	1.5807	0.1558	1525.2	10	3750.0%	2	R.LLHPIIPEQSTFK.V
*	TK270802_E14_cyto_2D_step03.3434.3434.1	0.8553	0.0731	1039.99	1	5000.0%	1	K.YRDGIADVK.K
*	TK270802_E14_cyto_2D_step07.3942.3942.3	1.6269	0.0038	2548.0	196	1310.0%	1	K.GICEYHEKDYASALETFAEGQK.L
*	TK270802_E14_cyto_2D_step13.2325.2325.1	0.3724	0.0239	1219.83	23	1500.0%	1	R.NAQAEAFLTPR.D
UQ9DBY097.9%225.7%795859817.1(Q9DBY0) 1200010K03Rik protein 
*	TK270802_E14_cyto_2D_step13.2620.2620.2	2.1736	0.5225	2235.85	1	3750.0%	1	K.VSPPLSHHPLPNGQPTVLTSR.R
*	TK270802_E14_cyto_2D_step03.3519.3519.3	1.5231	0.0886	2446.4	38	1850.0%	1	R.GQNPAPSPGLLSGVGGGLFRCLHR.T
URBB9_MOUSE97.9%118.6%186209126.0(O88851) Retinoblastoma-binding protein 9 (RBBP-9) (B5T overexpressed gene protein) (Bog protein) 
*	TK270802_E14_cyto_2D_step10.3396.3396.2	2.172	0.5131	1888.73	1	3670.0%	1	R.GHFQNTEFHELISVVK.S
UO8859897.8%4421.1%441492275.5(O88598) NEDD8-conjugating enzyme (Ubiquitin-activating enzyme E1C) (NEDD8 activating enzyme) 
*	TK270802_E14_cyto_2D_step10.0294.0294.3	0.9855	0.0595	3550.79	2	1290.0%	1	R.MLQWPKEQPFGDGVPLDGDDPEHIQWIFQK.S
	TK270802_E14_cyto_2D_step05.2549.2549.1	1.7689	0.3194	1315.92	2	5000.0%	1	R.LPEHCIEYVR.M
	TK270802_E14_cyto_2D_step13.3756.3756.2	1.1256	0.0684	1680.94	10	3000.0%	1	-.MAVDGGCGDTGDWEGR.W
	TK270802_E14_cyto_2D_step06.3283.3283.3	1.2382	0.1547	4213.58	3	1320.0%	1	K.ENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMK.S
UQ91VJ397.8%41015.0%361401496.2(Q91VJ3) Similar to Adenosin kinase 
*	TK270802_E14_cyto_2D_step04.3028.3028.1	2.3982	0.2789	1351.29	2	5500.0%	3	K.VAQWLIQEPHK.A
*	TK270802_E14_cyto_2D_step12.4329.4329.3	1.0449	0.1254	4656.3	1	1010.0%	1	K.AADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYK.K
UA1B1_MOUSE97.8%559.4%9431039795.1(O35643) Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta large chain) 
	TK270802_E14_cyto_2D_step05.3353.3353.2	0.9729	0.116	2292.34	2	2250.0%	1	K.LAPPLVTLLSAEPELQYVALR.N
*	TK270802_E14_cyto_2D_step12.3927.3927.3	2.3428	0.4534	3812.07	1	1670.0%	1	R.NSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLK.M
	TK270802_E14_cyto_2D_step01.3846.3846.1	1.1676	0.0568	1570.03	15	2860.0%	1	R.LASQANIAQVLAELK.E
	TK270802_E14_cyto_2D_step04.2996.2996.1	2.3821	0.2687	965.2	5	6430.0%	1	K.KGEIFELK.A
	TK270802_E14_cyto_2D_step12.2128.2128.1	0.8057	7.0E-4	1025.01	3	2860.0%	1	R.QMFLATWK.D
UQ922K697.7%3313.2%363406966.5(Q922K6) Unknown (Protein for MGC:7530) 
	TK270802_E14_cyto_2D_step03.1890.1890.1	0.937	0.0976	836.77	2	4290.0%	1	K.VMPAPPPK.E
*	TK270802_E14_cyto_2D_step14.2139.2139.3	1.1537	0.0905	2276.13	217	980.0%	1	K.VDVVGATQGQAGSCSRGPGDGGSR.D
	TK270802_E14_cyto_2D_step03.2834.2834.2	2.3769	0.4422	1534.9	1	4670.0%	1	R.AASIFGGAKPVDTAAR.E
USAHH_MOUSE97.6%133316.7%431475576.5(P50247) Adenosylhomocysteinase (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper binding protein) (CUBP) 
	TK270802_E14_cyto_2D_step05.2673.2673.1	1.4075	0.0746	1382.72	1	4170.0%	3	K.KLDEAVAEAHLGK.L
*	TK270802_E14_cyto_2D_step11.3775.3775.2	1.9126	0.3576	2302.34	1	3240.0%	1	K.GETDEEYLWCIEQTLHFK.D
	TK270802_E14_cyto_2D_step04.2266.2266.1	1.4045	0.0878	1062.22	2	5560.0%	1	K.RATDVMIAGK.V
	TK270802_E14_cyto_2D_step08.3067.3067.1	2.0668	0.3099	1158.79	1	5000.0%	4	K.YPVGVHFLPK.K
	TK270802_E14_cyto_2D_step01.2194.2194.1	1.5176	0.3306	1257.39	1	5910.0%	1	K.VPAINVNDSVTK.S
	TK270802_E14_cyto_2D_step04.2089.2089.1	1.7624	0.2594	1069.1	2	6250.0%	2	K.VNIKPQVDR.Y
UCAH2_MOUSE97.6%5912.0%259289607.0(P00920) Carbonic anhydrase II (EC 4.2.1.1) (Carbonate dehydratase II) (CA-II) 
	TK270802_E14_cyto_2D_step09.2190.2190.1	1.1251	0.115	1118.64	14	3750.0%	1	K.HNGPENWHK.D
	TK270802_E14_cyto_2D_step04.2806.2806.1	1.9599	0.2889	1011.85	1	5620.0%	2	K.VLEALHSIK.T
	TK270802_E14_cyto_2D_step11.3038.3038.2	2.8349	0.4107	1583.83	1	6250.0%	2	K.YAAELHLVHWNTK.Y
UQ9JL3597.6%113.7%406453124.4(Q9JL35) Nucleosome binding protein 1 (Nucleosome binding protein 45) (NBP-45) (GARP45 protein) 
	TK270802_E14_cyto_2D_step06.3442.3442.2	2.7029	0.4295	1656.13	1	6430.0%	1	R.LSAMPVPFTPELKPK.R
UDD15_MOUSE97.5%6812.3%758866117.2(O35286) Putative pre-mRNA splicing factor RNA helicase (DEAH box protein 15) 
	TK270802_E14_cyto_2D_step06.3377.3377.3	1.1122	0.0393	3791.55	82	880.0%	1	R.ALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAK.M
	TK270802_E14_cyto_2D_step07.1766.1766.1	0.8003	0.0464	715.99	81	3330.0%	1	K.QNGAIGR.K
	TK270802_E14_cyto_2D_step05.2769.2769.1	1.4108	0.3288	1445.78	1	3850.0%	1	R.HQSFVLVGETGSGK.T
	TK270802_E14_cyto_2D_step05.2350.2350.1	1.6207	0.3193	920.16	1	6430.0%	2	R.TGHYLTVK.D
	TK270802_E14_cyto_2D_step11.4701.4701.2	0.8974	0.0458	3048.4	1	1790.0%	1	K.VVVSTNIAETSLTIDGVVFVIDPGFAKQK.V
URL19_HUMAN97.4%71116.8%1962346611.5(P14118) 60S ribosomal protein L19 (P14118) 60S ribosomal protein L19 
	TK270802_E14_cyto_2D_step10.2582.2582.2	2.119	0.2316	1021.57	1	7140.0%	1	R.ILMEHIHK.L
	TK270802_E14_cyto_2D_step07.2025.2025.1	1.758	0.2062	644.36	1	8000.0%	2	R.HMGIGK.R
	TK270802_E14_cyto_2D_step04.2170.2170.1	1.6307	0.2183	1115.02	1	6110.0%	1	K.KLLADQAEAR.R
	TK270802_E14_cyto_2D_step13.2717.2717.1	2.1457	0.2035	1193.94	1	5620.0%	2	R.HMYHSLYLK.V
UO0879497.3%686.6%9661094046.2(O08794) Alpha glucosidase II, alpha subunit 
*	TK270802_E14_cyto_2D_step05.3339.3339.1	1.6499	0.133	1352.52	2	4500.0%	1	K.GHLETPIWIER.V
*	TK270802_E14_cyto_2D_step06.2253.2253.1	0.9022	0.0372	831.24	11	5000.0%	1	R.NHGLYVK.T
*	TK270802_E14_cyto_2D_step07.4030.4030.2	2.0909	0.4538	1628.73	1	4620.0%	2	R.FPQPLNMLEHLASK.R
*	TK270802_E14_cyto_2D_step15.1686.1686.2	0.737	0.0026	1670.7	33	1430.0%	1	R.YRVPDVLVADPPTAR.L
*	TK270802_E14_cyto_2D_step12.3065.3065.2	1.1479	0.1645	1846.26	11	3120.0%	1	R.VPFSDKVSLALGSVWDK.I
UPSDD_MOUSE97.2%242.4%376428095.7(Q9WVJ2) 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) 
	TK270802_E14_cyto_2D_step08.2774.2774.1	1.8998	0.3048	1156.1	1	6250.0%	2	R.VHMTWVQPR.V
URPBY_MOUSE97.2%116.8%117132515.9(O08740) DNA-directed RNA polymerase II 13.3 kDa polypeptide (EC 2.7.7.6) (RPB11) (RPB14) 
	TK270802_E14_cyto_2D_step13.1876.1876.1	1.7824	0.3157	956.99	1	7140.0%	1	K.VPHPLEHK.I
UADK_MOUSE97.2%355.4%279311037.4(P55264) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine 5'-phosphotransferase) (Fragment) 
	TK270802_E14_cyto_2D_step12.0703.0703.1	0.3335	0.0016	445.38	6	1670.0%	1	K.VNSK.R
	TK270802_E14_cyto_2D_step06.2733.2733.1	2.0353	0.3166	1158.14	1	7000.0%	2	R.AGHYAASVIIR.R
URL38_MOUSE97.2%2414.5%69807310.1(Q9JJI8) 60S ribosomal protein L38 
	TK270802_E14_cyto_2D_step03.3452.3452.1	1.9724	0.3164	1230.68	1	6670.0%	2	R.YLYTLVITDK.E
URS17_MOUSE97.2%61039.6%134153939.8(P06584) 40S ribosomal protein S17 
	TK270802_E14_cyto_2D_step02.3564.3564.2	1.6246	0.3422	2493.14	1	3100.0%	1	R.DNYVPEVSALDQEIIEVDPDTK.E
	TK270802_E14_cyto_2D_step07.2921.2921.1	1.3446	0.2471	1135.08	7	4440.0%	2	K.IAGYVTHLMK.R
	TK270802_E14_cyto_2D_step03.2092.2092.1	1.4284	0.0179	1047.94	4	5000.0%	2	R.LGNDFHTNK.R
	TK270802_E14_cyto_2D_step06.2869.2869.1	1.6448	0.1507	1416.16	32	4090.0%	1	K.RVCEEIAIIPSK.K
UCLUS_MOUSE97.1%113.6%448516565.7(Q06890) Clusterin precursor (Sulfated glycoprotein 2) (SGP-2) (Clustrin) (Apolipoprotein J) (Apo-J) 
*	TK270802_E14_cyto_2D_step13.3177.3177.2	2.4024	0.4298	1922.78	1	5330.0%	1	R.ELHDPHYFSPIGFPHK.R
UQ9CT0597.1%688.6%654753955.3(Q9CT05) 2610027H02Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step03.2154.2154.1	1.3341	0.1293	1279.82	2	4550.0%	1	R.ALSSEGKPYVTK.E
	TK270802_E14_cyto_2D_step05.2535.2535.1	0.9032	0.0405	1101.06	13	3750.0%	1	K.LLEAQSHFR.K
*	TK270802_E14_cyto_2D_step03.2116.2116.2	1.1155	0.1702	1153.02	1	4440.0%	1	K.HIQSKAIEAR.H
	TK270802_E14_cyto_2D_step05.2385.2385.1	2.2591	0.3041	1497.98	3	4550.0%	2	R.MQHNLEQQIQAR.N
	TK270802_E14_cyto_2D_step11.2651.2651.2	1.5578	0.0434	1590.6	2	4170.0%	1	K.KHEAFETDFTVHK.D
UUBP4_MOUSE97.0%335.0%9621082815.6(P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15) (Ubiquitin thiolesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) 
	TK270802_E14_cyto_2D_step08.2642.2642.3	1.362	0.1468	2431.47	31	1960.0%	1	K.KSRPSSASSGAVLYGQPLLVSVPK.H
	TK270802_E14_cyto_2D_step07.3364.3364.2	2.1569	0.4598	2302.04	1	2730.0%	1	K.SRPSSASSGAVLYGQPLLVSVPK.H
	TK270802_E14_cyto_2D_step08.3478.3478.3	1.2048	0.0732	2766.75	9	1520.0%	1	R.LNGKWYYFDDSSVSLASEDQIVTK.A
UQ925K497.0%393.5%454499475.7(Q925K4) Copine 1 protein (Fragment) 
	TK270802_E14_cyto_2D_step10.3368.3368.2	2.0352	0.4322	1785.77	1	4000.0%	3	R.LYGPTNFAPIINHVAR.F
UPSD6_MOUSE97.0%61410.0%389455365.5(Q99JI4) 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit S10) (p42A) 
	TK270802_E14_cyto_2D_step06.3181.3181.1	2.4371	0.2295	1481.88	1	5910.0%	2	R.IHAYSQLLESYR.S
	TK270802_E14_cyto_2D_step06.3402.3402.1	1.3972	0.2076	1113.99	8	4380.0%	3	R.FLLSLPEHR.G
	TK270802_E14_cyto_2D_step12.2267.2267.3	1.0416	0.0334	1943.39	77	2060.0%	1	K.VIKGAEILEVLHSLPAVR.Q
UQ9Z1F996.9%111517.9%638705695.2(Q9Z1F9) ARX 
	TK270802_E14_cyto_2D_step01.1318.1318.1	0.8786	0.099	612.78	41	5000.0%	2	K.QPNPR.K
	TK270802_E14_cyto_2D_step03.3710.3710.3	1.3915	0.1248	2798.44	14	1770.0%	1	K.NLVLTGFSHIDLIDLDTIDVSNLNR.Q
	TK270802_E14_cyto_2D_step08.4737.4737.2	0.7575	0.1153	2739.64	34	1200.0%	2	R.MCLAADVPLIESGTAGYLGQVTTIKK.G
	TK270802_E14_cyto_2D_step06.2151.2151.2	2.5816	0.4165	1864.38	1	4290.0%	1	K.GVTECYECHPKPTQR.T
	TK270802_E14_cyto_2D_step12.1564.1564.2	1.9088	0.2143	1991.59	2	4000.0%	1	K.KGVTECYECHPKPTQR.T
*	TK270802_E14_cyto_2D_step05.2855.2855.1	1.4164	0.0016	936.96	2	5710.0%	1	K.KLSDFGIR.N
	TK270802_E14_cyto_2D_step05.1873.1873.1	1.5301	0.0978	697.44	3	8000.0%	1	R.VHLAEK.G
	TK270802_E14_cyto_2D_step04.3113.3113.2	1.6918	0.3831	1653.68	1	4620.0%	1	R.NTPSEPIHCIVWAK.Y
	TK270802_E14_cyto_2D_step01.3452.3452.1	1.2021	0.0349	1485.49	1	3930.0%	1	R.VLVVGAGGIGCELLK.N
UQ9Z1Y496.9%51115.2%480509347.3(Q9Z1Y4) Zyxin related protein-1 (Thyroid hormone receptor interactor 6) (TRIP6) 
*	TK270802_E14_cyto_2D_step12.2705.2705.2	2.583	0.4107	1851.07	1	4720.0%	3	R.GASQASGPLPGPHFPLTGR.G
*	TK270802_E14_cyto_2D_step07.2288.2288.2	2.1557	0.4453	1381.6	1	6670.0%	1	R.GPTWVGSHGTPQR.L
*	TK270802_E14_cyto_2D_step09.4150.4150.3	1.7279	0.0978	4019.65	83	940.0%	1	R.EPGPGVPEGPSGVHIPAGGGRGGGHEPQGPLGQPPEEELER.L
UA1T1_MOUSE96.9%6811.1%413460035.7(P07758) Alpha-1-antitrypsin 1-1 precursor (Serine protease inhibitor 1-1) (Alpha-1 protease inhibitor 1) (Alpha-1-antiproteinase) (AAT) 
	TK270802_E14_cyto_2D_step08.2884.2884.1	1.3522	0.1833	981.84	8	5710.0%	1	R.LAQIHFPR.L
	TK270802_E14_cyto_2D_step04.2297.2297.1	1.508	0.3786	1217.16	1	4440.0%	2	K.MQHLEQTLSK.E
	TK270802_E14_cyto_2D_step10.3126.3126.2	1.8244	0.3796	2201.27	2	3060.0%	1	K.NHYQAEVFSVNFAESEEAK.K
	TK270802_E14_cyto_2D_step04.2562.2562.1	1.234	0.038	1091.94	27	4380.0%	1	K.KVINDFVEK.G
	TK270802_E14_cyto_2D_step09.3086.3086.2	1.4203	0.1963	2329.79	1	2630.0%	1	K.NHYQAEVFSVNFAESEEAKK.V
UPEBP_MOUSE96.8%4616.6%187208605.4(P70296) Phosphatidylethanolamine-binding protein (PEBP) 
	TK270802_E14_cyto_2D_step12.4355.4355.1	1.4111	0.3889	1442.34	1	4500.0%	1	R.EWHHFLVVNMK.G
*	TK270802_E14_cyto_2D_step05.2715.2715.1	1.6245	0.0264	927.29	1	7500.0%	2	K.FKVETFR.K
*	TK270802_E14_cyto_2D_step01.0162.0162.1	1.9228	0.3073	1365.83	1	5420.0%	1	R.VDYAGVTVDELGK.V
UQ9WVQ596.8%115.8%241269496.9(Q9WVQ5) MMRP19 (Monocyte macrophage 19) 
*	TK270802_E14_cyto_2D_step04.2450.2450.1	1.717	0.305	1513.81	1	4620.0%	1	K.HGNEIYIAPSGVQK.E
UQ8R1B496.8%332.7%9111055315.8(Q8R1B4) Similar to eukaryotic translation initiation factor 3, subunit 8 (110kD) 
	TK270802_E14_cyto_2D_step06.2431.2431.1	1.7412	0.3049	939.54	1	6670.0%	1	R.ILHTYYK.F
	TK270802_E14_cyto_2D_step03.2631.2631.1	1.4932	0.2698	1168.1	1	4500.0%	1	K.GTEITHAVVIK.K
	TK270802_E14_cyto_2D_step05.1722.1722.1	0.6826	0.1079	900.43	2	4170.0%	1	R.KNEGYMR.R
UQ9CZP296.8%113.1%291317788.5(Q9CZP2) 1110025F24Rik protein 
*	TK270802_E14_cyto_2D_step04.2090.2090.1	1.5613	0.3226	916.11	1	5620.0%	1	K.LAAGHFDGK.G
UPFTA_MOUSE96.8%4614.1%377440134.9(Q61239) Protein farnesyltransferase alpha subunit (EC 2.5.1.-) (CAAX farnesyltransferase alpha subunit) (RAS proteins prenyltransferase alpha) (FTase-alpha) 
*	TK270802_E14_cyto_2D_step03.3942.3942.3	1.2336	0.0101	2898.75	1	1900.0%	2	R.AEWADIDPVPQNDGPNPVVQIIYSEK.F
	TK270802_E14_cyto_2D_step15.2717.2717.3	1.3159	0.0923	2293.79	23	1940.0%	1	K.LTRDAIELNAANYTVWHFR.R
	TK270802_E14_cyto_2D_step13.2024.2024.1	1.5593	0.3202	1112.26	2	5710.0%	1	K.NYHAWQHR.Q
UPDA3_MOUSE96.8%445.8%504566216.4(P27773) Protein disulfide isomerase A3 precursor (EC 5.3.4.1) (Disulfide isomerase ER-60) (ERp60) (58 kDa microsomal protein) (p58) (ERp57) 
	TK270802_E14_cyto_2D_step03.2619.2619.1	1.4678	0.2705	1041.03	2	5000.0%	1	R.TADGIVSHLK.K
	TK270802_E14_cyto_2D_step08.2335.2335.1	1.3844	0.0788	915.72	12	5710.0%	1	K.KFLDAGHK.L
*	TK270802_E14_cyto_2D_step05.3010.3010.2	2.5138	0.4193	1261.3	1	7000.0%	1	R.FAHTNIESLVK.E
UPPI1_MOUSE96.7%4610.4%270317626.4(P53810) Phosphatidylinositol transfer protein alpha isoform (PtdIns transfer protein alpha) (PtdInsTP) (PI-TP-alpha) 
	TK270802_E14_cyto_2D_step03.2651.2651.1	1.2739	0.3353	868.93	1	5710.0%	1	R.GPLGPNWK.Q
	TK270802_E14_cyto_2D_step04.2898.2898.1	1.591	0.309	1424.64	1	5420.0%	2	R.MLAPEGALNIHEK.A
	TK270802_E14_cyto_2D_step06.2202.2202.1	1.8964	0.0652	889.42	1	6670.0%	1	K.IYHLQSK.V
UEF1G_MOUSE96.5%9418.9%437500616.7(Q9D8N0) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) 
	TK270802_E14_cyto_2D_step03.2522.2522.2	2.2902	0.2752	1574.02	1	6150.0%	1	R.KLDPGSEETQTLVR.E
*	TK270802_E14_cyto_2D_step04.3600.3600.1	1.8061	0.2723	1125.17	1	5560.0%	2	R.ILGLLDTHLK.T
	TK270802_E14_cyto_2D_step14.4606.4606.2	2.2323	0.4276	1711.51	1	5000.0%	6	R.VLSAPPHFHFGQTNR.T
UO8854496.5%5719.5%406462855.8(O88544) COP9 complex subunit 4 (COP9 (Constitutive PHOTOMORPHOGENIC), subunit 4) (ARABIDOPSIS) 
	TK270802_E14_cyto_2D_step06.4683.4683.3	0.7852	0.0373	4032.79	2	860.0%	1	K.AFVEAMVNENVSLVISRQLLTDFCTHLPNLPDSTAK.E
	TK270802_E14_cyto_2D_step04.2749.2749.1	2.1183	0.2599	1284.13	1	5450.0%	2	R.AVIEHNLLSASK.L
	TK270802_E14_cyto_2D_step05.4296.4296.2	2.0721	0.4385	1846.02	1	4670.0%	1	R.GNQLQEFAAMLMPHQK.A
	TK270802_E14_cyto_2D_step13.2541.2541.2	2.168	0.4338	1663.58	1	5710.0%	1	K.HALHCTILASAGQQR.S
UY153_HUMAN96.5%338.9%644744045.5(Q14166) Hypothetical protein KIAA0153 
*	TK270802_E14_cyto_2D_step02.2866.2866.2	0.8437	0.1763	1929.88	27	2500.0%	1	R.TELPQFVSYFQQRER.W
*	TK270802_E14_cyto_2D_step03.2422.2422.2	2.1406	0.4388	1738.88	1	4640.0%	1	K.FNQTYQLAHGTAEEK.M
	TK270802_E14_cyto_2D_step09.3149.3149.3	0.8589	0.0924	3092.18	89	770.0%	1	K.VIVTRESGLQAAHPNSIFLIDHAWTCR.V
UMAP4_HUMAN96.4%462.6%11521210195.4(P27816) Microtubule-associated protein 4 (MAP 4) 
	TK270802_E14_cyto_2D_step04.2716.2716.1	2.3706	0.2374	1592.77	3	4380.0%	1	K.VGSLDNVGHLPAGGAVK.T
*	TK270802_E14_cyto_2D_step07.1989.1989.1	1.5409	0.1449	1349.75	1	5000.0%	2	K.HVPGGGNVQIQNK.K
UQ9CWJ196.4%2215.5%283297695.0(Q9CWJ1) 2410043M02Rik protein 
	TK270802_E14_cyto_2D_step15.3831.3831.2	1.3698	0.2117	2867.63	6	1920.0%	1	R.EVIITPNSAWGGEGSLGCGIGYGYLHR.I
	TK270802_E14_cyto_2D_step11.3057.3057.2	2.4963	0.4214	1783.06	1	5000.0%	1	K.KISLPGQMTGTPITPLK.D
UTAGL_MOUSE96.3%4623.5%200224458.8(P37804) Transgelin (Smooth muscle protein 22-alpha) (SM22-alpha) (Actin-associated protein p27) 
*	TK270802_E14_cyto_2D_step04.1714.1714.3	1.1933	0.0745	1928.13	315	1470.0%	1	R.TLMALGSLAVTKNDGNYR.G
	TK270802_E14_cyto_2D_step07.2642.2642.1	1.8395	0.2829	1211.94	1	5500.0%	2	K.HVIGLQMGSNR.G
*	TK270802_E14_cyto_2D_step07.3425.3425.2	1.6424	0.1357	2096.84	1	4410.0%	1	R.LVEWIVVQCGPDVGRPDR.G
UFUMH_MOUSE96.3%3310.8%507543719.0(P97807) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) (EF-3) 
*	TK270802_E14_cyto_2D_step08.1832.1832.3	0.9503	0.0226	2352.35	48	1090.0%	1	R.VPSAGAAVSGEATTLPRCAPNVAR.M
*	TK270802_E14_cyto_2D_step04.2096.2096.1	1.6374	0.296	855.01	2	5710.0%	1	K.LHDALSAK.S
	TK270802_E14_cyto_2D_step13.4032.4032.2	0.7284	0.1738	2294.39	41	1140.0%	1	K.AAMPRIYELAAGGTAVGTGLNTR.I
UPA1B_MOUSE96.3%467.4%229254926.2(Q61206) Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit) 
	TK270802_E14_cyto_2D_step07.2070.2070.1	0.95	0.1795	960.76	50	4170.0%	2	R.WMSQHNR.F
	TK270802_E14_cyto_2D_step08.2723.2723.1	1.3214	0.0191	711.45	2	7500.0%	1	R.HVLWR.L
	TK270802_E14_cyto_2D_step09.2049.2049.1	0.4347	0.0076	589.75	32	2500.0%	1	R.QKNAK.V
UKAC_MOUSE96.3%41010.4%106117785.4(P01837) Ig kappa chain C region 
	TK270802_E14_cyto_2D_step06.1854.1854.1	1.6535	0.1768	1349.56	1	5500.0%	3	R.HNSYTCEATHK.T
UQ922B696.3%4106.1%594664877.0(Q922B6) Unknown (Protein for MGC:7807) 
	TK270802_E14_cyto_2D_step06.4309.4309.2	0.985	0.2175	3168.69	2	2040.0%	1	K.ELTGLNHWVRALVAAQSYLYSGSYQTIK.I
	TK270802_E14_cyto_2D_step01.2874.2874.1	1.9506	0.1417	958.32	6	5710.0%	3	K.MNLEAHLK.E
UPAK2_HUMAN96.3%339.5%524580056.0(Q13177) Serine/threonine-protein kinase PAK 2 (EC 2.7.1.-) (p21-activated kinase 2) (PAK-2) (PAK65) (Gamma-PAK) (S6/H4 kinase) 
*	TK270802_E14_cyto_2D_step06.2838.2838.2	2.5262	0.4057	2060.74	1	4440.0%	1	K.DPLSANHSLKPLPSVPEEK.K
*	TK270802_E14_cyto_2D_step07.2994.2994.1	1.3721	0.0527	1316.86	48	3500.0%	1	K.ELIINEILVMK.E
*	TK270802_E14_cyto_2D_step07.4118.4118.2	0.811	0.0198	1929.28	267	1580.0%	1	R.SVIDPVPAPVGDSHVDGAAK.S
URS18_HUMAN96.3%81424.3%1521771911.0(P25232) 40S ribosomal protein S18 (KE-3) (KE3) (P25232) 40S ribosomal protein S18 (KE-3) (KE3) 
	TK270802_E14_cyto_2D_step03.2131.2131.1	1.2393	0.04	931.97	52	5000.0%	1	K.LREDLER.L
	TK270802_E14_cyto_2D_step01.2426.2426.1	1.1715	0.0685	1072.95	28	4380.0%	1	R.VITIMQNPR.Q
	TK270802_E14_cyto_2D_step06.2489.2489.1	1.3791	0.0852	859.17	7	5830.0%	2	R.YAHVVLR.K
	TK270802_E14_cyto_2D_step03.2215.2215.1	1.9651	0.2251	906.2	1	6430.0%	2	R.KADIDLTK.R
	TK270802_E14_cyto_2D_step09.2512.2512.1	1.4348	0.1062	813.88	2	7000.0%	2	K.FQHILR.V
UQ8VC3096.2%5715.6%578596916.9(Q8VC30) Similar to DKFZP586B1621 protein 
	TK270802_E14_cyto_2D_step11.2883.2883.2	1.8926	0.4122	1963.55	1	3500.0%	2	R.VALLSGGGSGHEPAHAGFIGK.G
*	TK270802_E14_cyto_2D_step10.4639.4639.2	0.9315	0.0949	3063.34	18	1350.0%	1	K.IAPVDQIVTLMLDHMTNTSNIFHVPVR.S
*	TK270802_E14_cyto_2D_step01.5004.5004.3	1.5163	0.1843	3291.72	78	1330.0%	1	K.VARALVGTFMSALEMPGVSLTLMLVDEPVLK.L
*	TK270802_E14_cyto_2D_step15.1675.1675.2	0.6917	0.0683	1142.55	29	2500.0%	1	R.AILEVLQTQGA.-
UGDIB_MOUSE96.1%355.6%445505126.4(P50397) Rab GDP dissociation inhibitor beta (Rab GDI beta) (GDI-2) 
	TK270802_E14_cyto_2D_step02.3519.3519.2	1.3678	0.249	1780.05	1	3930.0%	1	K.EIRPALELLEPIEQK.F
	TK270802_E14_cyto_2D_step07.3081.3081.1	2.4385	0.1444	1182.26	1	6670.0%	2	R.VICILSHPIK.N
USEP7_MOUSE96.1%4165.3%436505508.6(O55131) Septin 7 (CDC10 protein homolog) 
	TK270802_E14_cyto_2D_step10.3976.3976.2	1.4669	0.1879	2611.57	6	1820.0%	4	K.STLINSLFLTDLYSPEYPGPSHR.I
UCDC2_MOUSE96.0%4614.1%297341078.4(P11440) Cell division control protein 2 homolog (EC 2.7.1.-) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1) 
	TK270802_E14_cyto_2D_step10.3441.3441.2	1.9808	0.2816	1803.27	1	4290.0%	1	K.KPLFHGDSEIDQLFR.I
	TK270802_E14_cyto_2D_step05.3707.3707.2	2.1286	0.4343	1853.85	1	4670.0%	1	R.HPNIVSLQDVLMQDSR.L
	TK270802_E14_cyto_2D_step13.2474.2474.1	1.8601	0.1533	1211.95	1	6000.0%	2	K.WKPGSLASHVK.N
UQ9NPL896.0%96510.9%285321938.2(Q9NPL8) C3orf1 hypothetical protein 
	TK270802_E14_cyto_2D_step12.4796.4796.3	2.2402	0.0583	3009.47	2	1830.0%	8	R.INVGLRGLVAGGIIGALLGTPVGGLLMAFQK.Y
UPHS3_HUMAN95.9%446.9%843966966.9(P11216) Glycogen phosphorylase, brain form (EC 2.4.1.1) 
*	TK270802_E14_cyto_2D_step13.2313.2313.3	1.7872	0.056	3011.45	36	1700.0%	1	R.HLEIIYAINQRHLDHVAALFPGDVDR.L
*	TK270802_E14_cyto_2D_step04.1885.1885.1	1.3222	0.2695	1124.76	2	4290.0%	1	R.TQQHYYER.D
*	TK270802_E14_cyto_2D_step07.3282.3282.1	1.5967	0.2988	1369.99	3	4000.0%	1	R.HLEIIYAINQR.H
*	TK270802_E14_cyto_2D_step12.4316.4316.2	1.178	0.024	2878.97	11	1520.0%	1	K.TCAYTNHTVLPEALERWPVSMFEK.L
URL31_HUMAN95.9%41012.0%1251446310.5(P12947) 60S ribosomal protein L31 (P12947) 60S ribosomal protein L31 
	TK270802_E14_cyto_2D_step03.2444.2444.1	1.4157	0.0359	1018.12	1	6430.0%	1	R.EYTINIHK.R
	TK270802_E14_cyto_2D_step08.2383.2383.1	1.7526	0.1008	759.88	1	7500.0%	3	R.IHGVGFK.K
UTRAL_MOUSE95.9%4104.0%706802096.7(Q9CQN1) Heat shock protein 75 kDa, mitochondrial precursor (HSP 75) (Tumor necrosis factor type 1 receptor associated protein) (TRAP-1) (TNFR-associated protein 1) 
*	TK270802_E14_cyto_2D_step14.3187.3187.2	0.9425	0.1199	1738.84	1	3460.0%	1	R.LSEKETEDLMAWMR.N
	TK270802_E14_cyto_2D_step01.2902.2902.1	2.104	0.2762	1516.09	1	4620.0%	3	R.GVVDSEDIPLNLSR.E
UQ9JJT995.9%114.2%385432475.3(Q9JJT9) Phosphorylated adaptor for RNA export 
*	TK270802_E14_cyto_2D_step06.2365.2365.2	2.5383	0.4018	1603.72	1	6000.0%	1	K.VLGGGSAACAPVSHYR.T
UQ9D8X595.9%94113.7%292335744.8(Q9D8X5) 1810022F04Rik protein (RIKEN cDNA 1810022F04 gene) 
	TK270802_E14_cyto_2D_step06.5019.5019.2	2.3031	0.1493	2881.97	1	2920.0%	6	K.FNLTEDMYSQDSIDLLANSGLQFQK.H
	TK270802_E14_cyto_2D_step14.5048.5048.3	0.8569	0.0060	4647.6	109	900.0%	1	K.GEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQK.H
UQOR_MOUSE95.8%5523.0%331352698.1(P47199) Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin) 
*	TK270802_E14_cyto_2D_step04.3177.3177.2	1.866	0.1547	1987.86	6	2650.0%	1	K.LQSDVVVPVPQSHQVLIK.V
*	TK270802_E14_cyto_2D_step07.2426.2426.1	1.284	0.0113	802.72	2	5830.0%	1	R.ALFHSAR.A
*	TK270802_E14_cyto_2D_step05.3777.3777.2	2.3221	0.4219	2217.0	1	4050.0%	1	R.KPALPYTPGSDVAGIIESVGDK.V
*	TK270802_E14_cyto_2D_step12.4137.4137.2	0.6132	0.0587	3118.61	29	1250.0%	1	K.GWVKPVIGSEYPLEKAAQAHEDIIHGSGK.T
*	TK270802_E14_cyto_2D_step05.2138.2138.1	1.4779	0.2009	1433.76	1	4620.0%	1	K.AAQAHEDIIHGSGK.T
UQ96IX395.7%2416.4%165180127.8(Q96IX3) Peptidylprolyl isomerase A (Cyclophilin A) 
*	TK270802_E14_cyto_2D_step12.3073.3073.2	2.9201	0.0428	2793.39	1	3460.0%	2	K.HTGPGILSMANAGPITNGSQFFICTAK.T
US11Y_HUMAN95.6%3910.6%104115098.6(Q9UDP3) Putative S100 calcium-binding protein H_NH0456N16.1 
*	TK270802_E14_cyto_2D_step03.3902.3902.1	2.2971	0.0923	1309.79	1	6500.0%	3	R.CIQSLIAVFQK.Y
UPYR1_HUMAN95.6%773.2%22252429146.4(P27708) CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] 
*	TK270802_E14_cyto_2D_step07.2254.2254.1	2.0306	0.2842	1220.01	1	5000.0%	1	R.HPQPGAVELAAK.H
*	TK270802_E14_cyto_2D_step01.2558.2558.1	0.8494	0.2321	1212.06	7	2270.0%	1	R.ASDPGLPAEEPK.E
*	TK270802_E14_cyto_2D_step01.1399.1399.1	0.8172	3.0E-4	702.7	13	5000.0%	1	R.MPPTVR.A
*	TK270802_E14_cyto_2D_step05.3022.3022.1	1.8494	0.1216	986.51	2	7140.0%	1	R.KEEILLIK.A
*	TK270802_E14_cyto_2D_step03.2174.2174.1	1.1311	0.019	1101.01	12	4440.0%	1	K.GEVRPELGSR.Q
*	TK270802_E14_cyto_2D_step12.2051.2051.2	1.0454	0.0465	1258.7	97	2920.0%	1	K.EATAGNPGGQTVR.E
*	TK270802_E14_cyto_2D_step04.2270.2270.1	1.5345	0.0037	1363.01	5	4000.0%	1	R.EYQLLRQTAIK.V
ULIS1_MOUSE95.6%469.0%409465397.4(P43035) Platelet-activating factor acetylhydrolase IB alpha subunit (EC 3.1.1.47) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) (Lissencephaly-1 protein) (LIS-1) 
	TK270802_E14_cyto_2D_step07.2693.2693.1	1.3849	0.0023	889.95	16	6670.0%	1	K.KWTSVIR.L
	TK270802_E14_cyto_2D_step03.2596.2596.2	1.6764	0.1022	2363.59	1	3750.0%	1	R.MVRPNQDGTLIASCSNDQTVR.V
	TK270802_E14_cyto_2D_step06.2617.2617.1	2.0456	0.2808	903.71	1	5000.0%	2	R.GVLFHSGGK.F
UQ9JM1495.6%116.5%200230765.5(Q9JM14) 5'(3')-deoxyribonucleotidase (5' nucleotidase, deoxy (Pyrimidine), cytosolic type C) 
	TK270802_E14_cyto_2D_step08.2907.2907.2	2.5929	0.3847	1636.17	1	5830.0%	1	R.RFPEEPHVPLEQR.R
UUBL3_MOUSE95.6%2212.6%230261525.0(Q9JKB1) Ubiquitin carboxyl-terminal hydrolase isozyme L3 (EC 3.4.19.12) (UCH-L3) (Ubiquitin thiolesterase L3) 
*	TK270802_E14_cyto_2D_step13.2126.2126.2	2.0841	0.2893	1039.38	3	6880.0%	1	R.KPFPINHGK.T
	TK270802_E14_cyto_2D_step04.2076.2076.2	2.585	0.3779	2168.11	1	5260.0%	1	R.VTHETSAHEGQTEAPSIDEK.V
UP9782595.6%6837.0%154160815.3(P97825) HEMATOLOGICAL and NEUROLOGICAL expressed sequence 1 (HN1) (HN1) 
*	TK270802_E14_cyto_2D_step05.1730.1730.1	1.1824	0.0791	1105.76	91	3890.0%	1	R.EDSESPGTQR.S
*	TK270802_E14_cyto_2D_step07.3296.3296.2	2.2984	0.4235	2529.36	1	2830.0%	2	R.VLRPPGGGSNFSLGFDEPAEQPVR.K
*	TK270802_E14_cyto_2D_step12.2788.2788.2	1.3238	0.0584	2655.13	13	1670.0%	1	R.VLRPPGGGSNFSLGFDEPAEQPVRK.N
	TK270802_E14_cyto_2D_step09.2393.2393.1	0.8027	0.3155	727.91	28	4170.0%	1	R.RNPPGGK.S
*	TK270802_E14_cyto_2D_step01.2062.2062.1	0.9234	0.057	1559.99	78	2140.0%	1	R.SNSSEASSGDFLDLK.G
UQ9P2E695.5%222.8%853970498.0(Q9P2E6) Hypothetical protein KIAA1401 (Fragment) 
*	TK270802_E14_cyto_2D_step07.1964.1964.1	0.8742	0.1495	970.8	220	3750.0%	1	R.ARPLGGDRK.R
*	TK270802_E14_cyto_2D_step12.2393.2393.2	2.07	0.5201	1652.45	1	4290.0%	1	K.DGPPHQVLVVPLHSR.I
UPDL1_MOUSE95.4%4619.0%326357176.8(O70400) PDZ and LIM domain protein 1 (LIM domain protein CLP-36) (C-terminal LIM domain protein 1) (Elfin) 
*	TK270802_E14_cyto_2D_step04.4176.4176.2	1.4289	0.2268	1895.85	1	3750.0%	2	K.QSTSFLVLQEILESDGK.G
	TK270802_E14_cyto_2D_step08.3176.3176.2	1.0245	0.2395	2104.07	1	2780.0%	1	K.MNLASEPQEVLHIGSAHNR.S
*	TK270802_E14_cyto_2D_step06.2790.2790.2	2.2733	0.4199	2677.53	1	2800.0%	1	K.TSASGEEANSRPVVQPHPSGSLIIDK.D
UQ9CRK995.3%2219.4%6773645.1(Q9CRK9) 9430077D24Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step07.2922.2922.2	1.7857	0.2835	1514.94	1	5000.0%	1	K.HTGPITCLQFNPK.F
URS20_HUMAN95.2%41020.2%119133739.9(P17075) 40S ribosomal protein S20 (P17075) 40S ribosomal protein S20 
	TK270802_E14_cyto_2D_step08.3096.3096.2	1.4799	0.1926	1508.41	1	3330.0%	1	K.RLIDLHSPSEIVK.Q
	TK270802_E14_cyto_2D_step04.2352.2352.1	2.0146	0.2867	1250.13	1	4500.0%	3	K.TPVEPEVAIHR.I
UCOPE_MOUSE95.0%3528.5%144162805.6(O89079) Coatomer epsilon subunit (Epsilon-coat protein) (Epsilon-COP) (Fragment) 
	TK270802_E14_cyto_2D_step13.4116.4116.2	1.9237	0.0933	2968.15	1	2500.0%	1	K.DSGHPETLINLIVLSQHLGKPPEVTNR.Y
	TK270802_E14_cyto_2D_step01.3639.3639.1	2.2981	0.2095	1591.52	4	4230.0%	2	R.WETAEGVLQEALDK.D
UTYB0_HUMAN95.0%3914.0%4348945.3(P13472) Thymosin beta-10 
*	TK270802_E14_cyto_2D_step01.0545.0545.1	1.9054	0.2704	675.84	2	8000.0%	3	K.NTLPTK.E
UNUCL_MOUSE95.0%121815.0%706765924.8(P09405) Nucleolin (Protein C23) 
*	TK270802_E14_cyto_2D_step08.2679.2679.2	2.0047	0.123	1673.69	21	3210.0%	2	K.GIAYIEFKSEADAEK.N
*	TK270802_E14_cyto_2D_step05.4129.4129.2	1.3778	0.2049	2545.44	1	3640.0%	1	K.QKVEGSEPTTPFNLFIGNLNPNK.S
*	TK270802_E14_cyto_2D_step10.2662.2662.2	1.0035	0.1381	1686.71	206	2310.0%	1	K.ETLEEVFEKATFIK.V
*	TK270802_E14_cyto_2D_step01.2068.2068.1	1.3565	0.1721	784.52	1	5710.0%	2	K.ALVPTPGK.K
*	TK270802_E14_cyto_2D_step01.1383.1383.1	0.9886	0.0457	774.72	13	5000.0%	1	K.EAPEAKK.Q
	TK270802_E14_cyto_2D_step01.3286.3286.1	0.739	0.0451	1309.05	62	2270.0%	1	K.EAMEDGEIDGNK.V
*	TK270802_E14_cyto_2D_step08.3152.3152.1	0.9651	0.1747	1138.17	35	3330.0%	1	K.ESFEGSVRAR.I
*	TK270802_E14_cyto_2D_step01.1599.1599.1	1.3681	0.0338	755.94	21	5710.0%	1	K.AAVPTPAK.K
*	TK270802_E14_cyto_2D_step01.0107.0107.1	1.0278	0.1744	1029.1	46	3750.0%	2	K.FAISELFAK.N
UQ99LT195.0%3314.2%358391765.8(Q99LT1) Hypothetical 39.2 kDa protein (Fragment) 
*	TK270802_E14_cyto_2D_step06.3358.3358.2	2.0693	0.4666	2595.41	1	3180.0%	1	K.APLKPYPVPTSDNILIQEQTQLK.G
*	TK270802_E14_cyto_2D_step01.4188.4188.3	1.0706	0.1291	4703.73	34	500.0%	1	R.YLNNVIESHTDFIFATIKAPLKPYPVPTSDNILIQEQTQLK.G
*	TK270802_E14_cyto_2D_step02.3626.3626.1	0.7181	0.0579	1040.18	2	2780.0%	1	K.TVVTSVFGVK.N
UQ91ZP194.9%115.9%236270548.1(Q91ZP1) Fibrinogen B-beta-chain (Fragment) 
*	TK270802_E14_cyto_2D_step04.2372.2372.1	1.5616	0.303	1508.78	1	6150.0%	1	K.AHYGGFTVQNEASK.Y
USYG_MOUSE94.9%335.3%729818786.7(Q9CZD3) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) 
	TK270802_E14_cyto_2D_step09.2605.2605.2	2.2041	0.2968	1450.52	1	5830.0%	1	K.VPLVAEKPLKEPK.T
	TK270802_E14_cyto_2D_step02.5086.5086.2	1.2924	0.0139	2681.35	3	2000.0%	1	R.LLSAPAQPAASRSSMDSAEELLAPLR.L
UR11A_MOUSE94.9%3322.2%216244036.7(Q9JLX1) Ras-related protein Rab-11A 
	TK270802_E14_cyto_2D_step04.2233.2233.1	1.8327	0.2858	1162.06	1	6250.0%	1	K.HLTYENVER.W
	TK270802_E14_cyto_2D_step10.4060.4060.3	1.2406	0.0283	3753.7	8	1520.0%	1	R.AFAEKNGLSFIETSALDSTNVEAAFQTILTEIYR.I
*	TK270802_E14_cyto_2D_step14.2289.2289.1	0.4237	0.0010	643.69	33	2500.0%	1	K.HMSDR.R
URS16_HUMAN94.9%8406.2%1451631410.2(P17008) 40S ribosomal protein S16 
*	TK270802_E14_cyto_2D_step04.1538.1538.2	1.342	0.3538	960.02	1	6880.0%	2	K.TATAVAHCK.R
US23B_MOUSE94.9%222.6%767864377.0(Q9D662) Protein transport protein Sec23B (SEC23-related protein B) 
*	TK270802_E14_cyto_2D_step15.2248.2248.1	0.3759	0.0915	765.13	38	1430.0%	1	K.KLAVSSAS.-
	TK270802_E14_cyto_2D_step03.1895.1895.1	1.7196	0.2756	1332.9	1	5000.0%	1	R.YINTEHGGSQAR.F
UR13A_MOUSE94.9%102018.8%2022333311.0(P19253) 60S ribosomal protein L13a (Transplantation antigen P198) (Tum-P198 antigen) 
	TK270802_E14_cyto_2D_step08.1711.1711.1	0.753	0.1447	608.01	20	5000.0%	2	K.MHYR.K
	TK270802_E14_cyto_2D_step05.2457.2457.1	1.6941	0.2778	940.15	1	7140.0%	1	R.LAHEVGWK.Y
*	TK270802_E14_cyto_2D_step06.1725.1725.1	1.1533	0.0432	901.02	20	3570.0%	1	K.RGQAALER.L
	TK270802_E14_cyto_2D_step08.2246.2246.1	1.3092	0.1811	654.2	1	7000.0%	3	R.GHLLGR.L
	TK270802_E14_cyto_2D_step09.2286.2286.1	1.1069	0.0211	778.13	13	4000.0%	2	R.GPYHFR.A
	TK270802_E14_cyto_2D_step07.2086.2086.1	1.1869	0.052	700.18	16	5000.0%	1	R.KVVVVR.C
UK6A1_MOUSE94.9%5512.3%724815958.1(P18653) Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.-) (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1) 
*	TK270802_E14_cyto_2D_step11.2799.2799.2	1.7081	0.2938	1745.81	2	3330.0%	1	R.TTQAPLHSVVQQLHGK.N
	TK270802_E14_cyto_2D_step01.3230.3230.1	1.3913	0.0951	1470.08	4	4170.0%	1	R.DILADVNHPFVVK.L
	TK270802_E14_cyto_2D_step07.2474.2474.1	1.1467	0.2138	1524.86	1	3750.0%	1	K.TVEYLHSQGVVHR.D
	TK270802_E14_cyto_2D_step09.4855.4855.3	1.2219	0.101	4260.91	7	900.0%	1	K.FYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIK.L
	TK270802_E14_cyto_2D_step05.2565.2565.1	1.808	0.2869	1194.03	1	6670.0%	1	K.LHYAFQTEGK.L
UDNL1_MOUSE94.9%669.6%9161022906.8(P37913) DNA ligase I (EC 6.5.1.1) (Polydeoxyribonucleotide synthase [ATP]) 
*	TK270802_E14_cyto_2D_step09.3062.3062.3	0.9425	0.0044	3375.93	52	1210.0%	1	R.LGLAEQSVLAALAQAVSLTPPGQEFPTVVVDAGK.G
*	TK270802_E14_cyto_2D_step03.4306.4306.1	1.1248	0.1458	1048.6	2	6250.0%	1	K.ETPSSIREK.E
*	TK270802_E14_cyto_2D_step07.3038.3038.2	1.4706	0.0911	1717.4	10	3330.0%	1	K.LSPGVPLKPMLAHPTR.G
*	TK270802_E14_cyto_2D_step13.3725.3725.2	1.9432	0.1002	1745.65	12	3120.0%	1	R.AEVAEKGDVGLVAENSR.S
	TK270802_E14_cyto_2D_step05.3661.3661.2	2.0982	0.4474	1391.71	1	7270.0%	1	R.IIPVLLEHGLER.L
UQ8VDM694.9%8816.4%859960026.6(Q8VDM6) Similar to E1B-55 kDa-associated protein 5 
	TK270802_E14_cyto_2D_step03.3511.3511.2	0.8069	0.0726	1967.71	211	2060.0%	1	R.IQKEALGGQALYPHVLVK.N
	TK270802_E14_cyto_2D_step01.4392.4392.3	0.9546	0.1041	3738.43	16	1130.0%	1	R.FENYGDKFAENDVIGCFADFECGNDVELSFTK.N
	TK270802_E14_cyto_2D_step04.4182.4182.1	1.9485	0.1583	1355.99	2	4550.0%	1	K.YNILGTNAIMDK.M
	TK270802_E14_cyto_2D_step14.2167.2167.2	0.7303	0.04	1483.97	7	1670.0%	1	K.KYNILGTNAIMDK.M
*	TK270802_E14_cyto_2D_step07.2876.2876.2	2.4533	0.4006	2110.68	1	5000.0%	1	R.RPLDMEPQQQVYHPELK.T
*	TK270802_E14_cyto_2D_step10.2009.2009.1	0.6781	0.0246	570.71	9	5000.0%	1	R.GTIGPK.S
	TK270802_E14_cyto_2D_step04.5205.5205.3	0.7884	0.0174	3499.1	22	520.0%	1	R.SPQPPAEEDEDDFDDTLVAIDTYNCDLHFK.V
	TK270802_E14_cyto_2D_step03.5159.5159.2	0.9146	0.0097	2711.48	3	2080.0%	1	R.SSGYPLTIEGFAYLWSGARASYGVR.R
UQ9D1J194.8%2218.8%266285988.0(Q9D1J1) 1110005F07Rik protein 
*	TK270802_E14_cyto_2D_step13.2974.2974.2	2.403	0.3977	1775.9	2	4440.0%	1	R.ARPTSAGGLSLLPPPPGGK.S
	TK270802_E14_cyto_2D_step06.4398.4398.3	1.533	0.0451	3312.35	17	1500.0%	1	K.LEDRTSGELFAQAPVDQFPGTAVESVTDSSR.Y
UAMPB_MOUSE94.7%447.4%650723435.3(Q8VCT3) Aminopeptidase B (EC 3.4.11.6) (Ap-B) (Arginyl aminopeptidase) (Arginine aminopeptidase) (Cytosol aminopeptidase IV) 
*	TK270802_E14_cyto_2D_step01.4423.4423.1	1.0579	0.2155	1469.13	45	2500.0%	1	K.KGVDSIPGFEFDR.W
*	TK270802_E14_cyto_2D_step13.2438.2438.2	2.3976	0.3947	1901.0	1	5000.0%	1	R.RPLHSAQAVDVASASSFR.A
*	TK270802_E14_cyto_2D_step14.3451.3451.2	0.7977	0.0395	1902.64	1	2810.0%	1	K.LGETYPKISNAQNAELR.L
UIF2G_MOUSE94.5%6628.0%471509348.4(Q9Z0N1) Eukaryotic translation initiation factor 2 subunit 3, X-linked (Eukaryotic translation initiation factor 2 gamma subunit, X-linked) (eIF-2-gamma X) 
*	TK270802_E14_cyto_2D_step05.2446.2446.1	1.3371	0.187	1536.78	2	3670.0%	1	-.AGGEGGVTLGQPHLSR.Q
	TK270802_E14_cyto_2D_step08.4245.4245.3	1.6329	0.0815	3309.42	25	1380.0%	1	R.ADRMVGQVLGAVGALPEIFTELEISYFLLR.R
	TK270802_E14_cyto_2D_step04.3917.3917.2	1.1748	0.1963	2573.07	1	2710.0%	1	K.IVSLFAEHNDLQYAAPGGLIGVGTK.I
	TK270802_E14_cyto_2D_step07.2841.2841.1	2.2851	0.1776	978.97	5	7140.0%	1	K.HILILQNK.I
	TK270802_E14_cyto_2D_step06.4179.4179.3	1.1584	0.0091	4524.01	84	960.0%	1	K.EQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVK.K
	TK270802_E14_cyto_2D_step11.2498.2498.2	0.8609	0.0049	1514.37	12	2920.0%	1	K.IPVPPRDFTSEPR.L
UCAPB_MOUSE94.4%119.0%277313455.7(P47757) F-actin capping protein beta subunit (CapZ beta) 
	TK270802_E14_cyto_2D_step01.4675.4675.2	2.1262	0.4288	2785.37	1	2920.0%	1	K.NLSDLIDLVPSLCEDLLSSVDQPLK.I
UGCAA_MOUSE94.4%228.2%330363897.4(P01863) Ig gamma-2A chain C region, A allele 
	TK270802_E14_cyto_2D_step04.3244.3244.2	2.3198	0.3961	1797.51	1	5000.0%	1	R.VVSALPIQHQDWMSGK.E
	TK270802_E14_cyto_2D_step09.2004.2004.2	1.6836	0.2897	1257.53	1	6000.0%	1	R.GPTIKPCPPCK.C
UMGD1_MOUSE94.4%3311.2%775856707.5(Q9QYH6) Melanoma-associated antigen D1 (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) (Dlxin-1) 
	TK270802_E14_cyto_2D_step10.3237.3237.3	1.5489	0.1723	2753.81	7	2270.0%	1	R.VPNSNPPEYEFLWGLRSYHETSK.M
*	TK270802_E14_cyto_2D_step12.4179.4179.3	1.1987	0.0178	4706.16	7	1010.0%	1	K.VPGADAQTQNVNQAKMADVGTSAGISEADGAAAQTSADGSQTQNVESR.T
*	TK270802_E14_cyto_2D_step05.2071.2071.1	1.6097	0.2804	1541.72	2	3000.0%	1	K.GPHAASDFSQAAPTGK.S
UPCNA_MOUSE94.4%225.7%261287854.8(P17918) Proliferating cell nuclear antigen (PCNA) (Cyclin) 
	TK270802_E14_cyto_2D_step01.2519.2519.1	1.3507	0.0347	872.88	41	5710.0%	1	R.LIQGSILK.K
	TK270802_E14_cyto_2D_step01.2588.2588.1	1.6175	0.2885	934.3	1	6670.0%	1	R.YLNFFTK.A
UCTE1_MOUSE94.4%61016.0%419461366.6(O55137) Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) 
	TK270802_E14_cyto_2D_step15.2205.2205.1	0.7	0.0575	1015.08	1	2500.0%	2	K.GPGIGLLGISK.G
*	TK270802_E14_cyto_2D_step06.3818.3818.3	1.8511	0.2322	2985.62	9	1850.0%	1	K.NMETMHMEYFEEAVNYLRSHPEVK.G
	TK270802_E14_cyto_2D_step08.2620.2620.1	1.6473	0.2213	897.04	2	6430.0%	2	R.HFLAPGVR.R
*	TK270802_E14_cyto_2D_step01.3451.3451.2	0.7278	0.0821	2732.51	3	1300.0%	1	-.MEATLNLEPSGRSCWDEPLSIAVR.G
UO5480794.4%111.1%11841298006.2(O54807) Ankhzn protein 
	TK270802_E14_cyto_2D_step06.3155.3155.1	1.4671	0.4345	1398.25	1	4580.0%	1	R.GQSPLHILGQYGK.E
UQ9UG9494.4%2410.6%132149719.5(Q9UG94) Hypothetical protein 
*	TK270802_E14_cyto_2D_step05.3683.3683.1	2.2873	0.1606	1549.85	1	6150.0%	2	K.HPELFKALGIAQPK.G
USNX3_MOUSE94.3%116.8%162187578.7(O70492) Sorting nexin 3 (SDP3 protein) 
	TK270802_E14_cyto_2D_step06.1907.1907.1	1.8402	0.2621	1191.76	1	5500.0%	1	K.VAGHPLAQNER.C
USMD2_HUMAN94.3%118.5%118135279.9(P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) (P43330) Small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) 
	TK270802_E14_cyto_2D_step05.2575.2575.1	1.6695	0.263	1243.91	2	6110.0%	1	R.HCNMVLENVK.E
UQ9ER6794.3%444.5%616654009.1(Q9ER67) Hypothetical 65.4 kDa protein 
	TK270802_E14_cyto_2D_step04.1956.1956.1	1.0614	0.0702	830.48	2	4170.0%	1	R.RALLSLR.S
	TK270802_E14_cyto_2D_step01.1636.1636.2	1.5393	0.2739	1437.9	1	4580.0%	1	K.LQSSQEPEAPPPR.D
	TK270802_E14_cyto_2D_step08.2290.2290.1	0.9494	0.0325	919.78	19	2860.0%	1	R.GPIAFWAR.R
UCRTC_MOUSE94.3%6613.5%416479954.5(P14211) Calreticulin precursor (CRP55) (Calregulin) (HACBP) (ERp60) 
*	TK270802_E14_cyto_2D_step05.1626.1626.1	0.6773	0.125	911.78	59	3330.0%	1	R.WVESKHK.S
*	TK270802_E14_cyto_2D_step03.2348.2348.1	1.2743	0.0541	868.36	4	5830.0%	1	K.FEPFSNK.G
*	TK270802_E14_cyto_2D_step01.2048.2048.1	1.2627	0.2052	1544.81	1	3750.0%	1	K.DPDAAKPEDWDER.A
	TK270802_E14_cyto_2D_step04.2284.2284.1	1.3117	0.0341	887.17	2	5000.0%	1	K.GKNVLINK.D
	TK270802_E14_cyto_2D_step03.2106.2106.1	1.5186	0.2743	1476.83	3	3750.0%	1	K.HEQNIDCGGGYVK.L
	TK270802_E14_cyto_2D_step07.2938.2938.1	1.8725	0.2667	1021.08	1	6430.0%	1	K.VHVIFNYK.G
UQ99PC994.1%466.2%594691398.6(Q99PC9) Protein phosphatase 2 regulatory subunit B56 delta isoform 
	TK270802_E14_cyto_2D_step02.4878.4878.2	1.2823	0.0016	2357.8	76	1820.0%	1	K.DGGGENTDEAQPQPQSQSPSSNK.R
	TK270802_E14_cyto_2D_step08.1938.1938.2	2.0735	0.4326	1511.89	1	5380.0%	2	K.RPSNSTPPPTQLSK.I
UQ9ULH593.9%114.0%8921014704.9(Q9ULH5) Hypothetical protein KIAA1245 (Fragment) 
*	TK270802_E14_cyto_2D_step03.3822.3822.3	2.7651	0.3803	4056.61	4	1360.0%	1	R.NLQESEEEEVPQESWDEGYSTLSIPPERTSVGSSEK.G
UQ9CUZ093.7%113.3%244269557.4(Q9CUZ0) 2900010D03Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step04.3093.3093.1	1.538	0.2917	958.91	1	6430.0%	1	R.YLHLLDGK.E
UQ9CYW193.4%113.2%316341967.0(Q9CYW1) 0610027F08Rik protein 
*	TK270802_E14_cyto_2D_step07.2996.2996.1	1.4679	0.3888	1057.92	1	6110.0%	1	R.NHGLALASFK.R
UQ9BWX293.4%5711.3%10271173779.1(Q9BWX2) Protein kinase NYD-SP5 
*	TK270802_E14_cyto_2D_step10.2266.2266.3	1.3288	0.1411	3007.77	21	1600.0%	1	-.MAQNTENHDPVGSILIQIHEDLYQLK.E
*	TK270802_E14_cyto_2D_step06.4877.4877.3	2.7409	0.4109	4323.93	1	1790.0%	2	R.GTEAYIVSGLLHRDDLAVADMLDIPILGSEPELAHLYSTK.S
*	TK270802_E14_cyto_2D_step15.4243.4243.3	1.1348	0.0587	4514.35	11	1250.0%	1	K.RVFDSANVAVPPGIYDIYSQQQMIEQLSQLITDHLQIQR.W
*	TK270802_E14_cyto_2D_step02.5006.5006.1	1.0175	0.0766	1255.06	46	3500.0%	1	R.QHSSSLPVFPR.A
URS5_MOUSE93.3%5723.0%204228899.7(P97461) 40S ribosomal protein S5 
	TK270802_E14_cyto_2D_step03.3707.3707.2	2.3652	0.387	2325.04	1	4740.0%	1	K.WSTDDVQINDISLQDYIAVK.E
	TK270802_E14_cyto_2D_step05.2055.2055.1	1.2037	0.014	1100.93	68	4380.0%	1	R.KAQCPIVER.L
	TK270802_E14_cyto_2D_step06.2406.2406.1	1.6449	0.0049	1177.73	2	5560.0%	1	R.LTNSMMMHGR.N
	TK270802_E14_cyto_2D_step07.1952.1952.1	1.3163	0.0518	901.85	9	5710.0%	2	K.YLPHSAGR.Y
UQ921C393.3%553.7%23042590248.4(Q921C3) WDR9 protein, form A 
	TK270802_E14_cyto_2D_step12.3795.3795.2	1.4501	0.1664	2865.92	3	1820.0%	1	R.YHDMPDVIDLLVLRPFYDEARQR.N
	TK270802_E14_cyto_2D_step03.1578.1578.3	1.5178	0.0392	1997.95	36	1710.0%	1	R.CHGSDHGPSSTGDPSTSGQK.L
	TK270802_E14_cyto_2D_step06.4873.4873.2	1.0058	0.0619	3189.92	20	1300.0%	1	R.FMKPKVTMIAWNQDDSTVVTAVNDHVLK.V
	TK270802_E14_cyto_2D_step07.3640.3640.1	1.5707	0.272	743.91	1	7500.0%	1	K.VPLSATR.K
	TK270802_E14_cyto_2D_step03.1720.1720.1	1.0635	0.0904	968.78	3	5830.0%	1	R.LVNRFYR.R
UQ99LF493.0%4412.5%505552497.2(Q99LF4) Hypothetical 55.2 kDa protein 
	TK270802_E14_cyto_2D_step04.3380.3380.2	2.0776	0.4186	1642.45	1	5670.0%	1	R.GLGHQVATDALVAMEK.A
	TK270802_E14_cyto_2D_step06.2378.2378.1	1.0837	0.1774	738.84	31	6000.0%	1	R.TLLVHR.K
*	TK270802_E14_cyto_2D_step06.3469.3469.2	1.7651	0.0306	1401.04	31	4500.0%	1	R.NYNDELQFLDK.I
	TK270802_E14_cyto_2D_step12.3901.3901.3	1.3684	0.0597	3221.29	31	1210.0%	1	R.GLPQLGTLGAGNHYAEIQVVDEIFNEYAAK.K
UIMD1_MOUSE92.9%51114.6%514552946.8(P50096) Inosine-5'-monophosphate dehydrogenase 1 (EC 1.1.1.205) (IMP dehydrogenase 1) (IMPDH-I) (IMPD 1) 
*	TK270802_E14_cyto_2D_step04.3546.3546.2	1.7801	0.3512	1897.2	1	4170.0%	3	R.FGVPVIADGGIQTVGHVVK.A
	TK270802_E14_cyto_2D_step03.3960.3960.3	1.7289	0.099	4058.85	23	1150.0%	1	K.NLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYK.V
*	TK270802_E14_cyto_2D_step06.3433.3433.2	1.376	0.0408	1965.55	1	3530.0%	1	K.GKLPIVNDQDELVAIIAR.T
ULDHB_MOUSE92.9%112.7%333364416.1(P16125) L-lactate dehydrogenase B chain (EC 1.1.1.27) (LDH-B) (LDH heart subunit) (LDH-H) 
	TK270802_E14_cyto_2D_step07.2404.2404.1	1.5346	0.3036	1011.33	1	5620.0%	1	R.IHPVSTMVK.G
U143B_MOUSE92.8%205239.6%245279554.8(Q9CQV8) 14-3-3 protein beta/alpha (Protein kinase C inhibitor protein-1) (KCIP-1) 
	TK270802_E14_cyto_2D_step01.0142.0142.1	1.2367	0.0292	910.3	6	5710.0%	5	R.NLLSVAYK.N
*	TK270802_E14_cyto_2D_step01.1938.1938.1	0.8169	0.1325	1196.92	3	4000.0%	1	R.YLSEVASGENK.Q
	TK270802_E14_cyto_2D_step01.1815.1815.1	1.6495	0.0198	1598.85	8	3460.0%	1	K.AVTEQGHELSNEER.N
	TK270802_E14_cyto_2D_step01.3931.3931.1	1.7847	0.0703	1192.68	1	6670.0%	3	K.DSTLIMQLLR.D
	TK270802_E14_cyto_2D_step04.2020.2020.1	1.3796	0.1362	1111.26	1	5000.0%	1	K.EMQPTHPIR.L
	TK270802_E14_cyto_2D_step01.4086.4086.2	1.2296	0.0541	2161.4	14	2500.0%	1	K.TAFDEAIAELDTLNEESYK.D
	TK270802_E14_cyto_2D_step01.1840.1840.1	2.2339	0.1631	906.28	5	6430.0%	2	R.VISSIEQK.T
	TK270802_E14_cyto_2D_step01.0022.0022.1	1.2898	0.0445	616.06	22	7000.0%	2	K.NVVGAR.R
	TK270802_E14_cyto_2D_step01.2560.2560.1	1.4896	0.2194	669.8	4	7500.0%	2	K.VFYLK.M
	TK270802_E14_cyto_2D_step01.0416.0416.1	1.2207	0.0087	816.84	19	5830.0%	1	K.LAEQAER.Y
U143S_MOUSE92.8%243.2%248277134.8(O70456) 14-3-3 protein sigma (Stratifin) 
	TK270802_E14_cyto_2D_step01.1840.1840.1	2.2339	0.1631	906.28	5	6430.0%	2	R.VLSSIEQK.S
UWDR5_HUMAN92.8%114.8%334365898.3(Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) (Q9UGP9) WD-repeat protein 5 (WD repeat protein BIG-3) 
	TK270802_E14_cyto_2D_step09.2722.2722.2	2.1392	0.3965	1749.38	1	5330.0%	1	K.TLPAHSDPVSAVHFNR.D
UQ9D87092.7%113.8%365413494.6(Q9D870) 2010110O17Rik protein 
	TK270802_E14_cyto_2D_step03.2524.2524.1	1.5552	0.2895	1549.93	1	4230.0%	1	K.KITESVTETAQTIK.K
UQ99JY392.7%117.3%219245547.0(Q99JY3) Similar to hypothetical protein FLJ11110 
*	TK270802_E14_cyto_2D_step03.2687.2687.2	2.556	0.357	1780.65	1	6000.0%	1	R.SSHELGNQDQGIPQLR.I
UCYPB_MOUSE92.6%2212.0%208227139.5(P24369) Peptidyl-prolyl cis-trans isomerase B precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) 
	TK270802_E14_cyto_2D_step08.2850.2850.1	1.4593	0.3543	1474.65	1	4620.0%	1	K.HYGPGWVSMANAGK.D
	TK270802_E14_cyto_2D_step03.0597.0597.1	0.5968	0.0031	1242.72	7	1000.0%	1	K.IEVEKPFAIAK.E
UVAB2_MOUSE92.6%113.9%511565515.8(P50517) Vacuolar ATP synthase subunit B, brain isoform (EC 3.6.3.14) (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) 
	TK270802_E14_cyto_2D_step07.3573.3573.2	2.0279	0.4379	2180.22	1	4210.0%	1	K.IPIFSAAGLPHNEIAAQICR.Q
UCOPA_HUMAN92.3%777.1%12241383317.7(P53621) Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) [Contains: Xenin (Xenopsin-related peptide); Proxenin] 
*	TK270802_E14_cyto_2D_step07.1944.1944.1	1.3538	0.2641	962.64	33	4290.0%	1	K.HVLEGHDR.G
*	TK270802_E14_cyto_2D_step07.2914.2914.1	1.216	0.0177	1595.86	2	3750.0%	1	R.KLDALCNIHENIR.V
*	TK270802_E14_cyto_2D_step03.2611.2611.1	1.404	0.223	1303.87	1	4550.0%	1	K.YAVTTGDHGIIR.T
*	TK270802_E14_cyto_2D_step07.2936.2936.1	1.7046	0.2501	842.14	1	8330.0%	1	R.MHSLLIK.N
*	TK270802_E14_cyto_2D_step05.3961.3961.2	1.0068	0.1895	2256.19	1	2000.0%	1	R.GVNWAAFHPTMPLIVSGADDR.Q
*	TK270802_E14_cyto_2D_step04.4288.4288.2	1.0989	0.0259	1861.05	51	2500.0%	1	R.ECRPRVLTIDPTEFK.F
*	TK270802_E14_cyto_2D_step14.2421.2421.1	0.5769	0.0015	1263.31	114	1500.0%	1	K.GYPEVALHFVK.D
UPRS7_MOUSE92.3%133314.3%433486485.9(P46471) 26S protease regulatory subunit 7 (MSS1 protein) 
	TK270802_E14_cyto_2D_step05.2553.2553.1	1.6918	0.2531	1016.18	1	6880.0%	2	K.KINELTGIK.E
	TK270802_E14_cyto_2D_step03.1527.1527.3	1.1978	0.0577	1686.66	9	2310.0%	1	K.LREVVETPLLHPER.F
	TK270802_E14_cyto_2D_step07.2270.2270.1	1.4361	0.1735	645.81	2	7500.0%	1	R.THIFK.I
	TK270802_E14_cyto_2D_step08.3135.3135.1	0.8369	0.0719	1208.49	16	2220.0%	4	K.YQIHIPLPPK.I
	TK270802_E14_cyto_2D_step10.3098.3098.3	2.5005	0.4186	2226.91	1	3420.0%	1	K.VLMATNRPDTLDPALMRPGR.L
	TK270802_E14_cyto_2D_step09.0315.0315.1	0.734	0.0015	496.7	3	5000.0%	3	K.IHAR.S
URS24_HUMAN92.3%134522.6%1331542310.8(P16632) 40S ribosomal protein S24 (S19) (P16632) 40S ribosomal protein S24 (S19) 
	TK270802_E14_cyto_2D_step06.1853.1853.1	2.0391	0.1261	705.01	1	7500.0%	5	R.THFGGGK.T
	TK270802_E14_cyto_2D_step10.1948.1948.1	0.4516	0.0073	613.48	9	3750.0%	1	K.KNEPK.H
	TK270802_E14_cyto_2D_step04.4917.4917.1	1.0893	0.0271	1239.38	4	3000.0%	3	K.QMVIDVLHPGK.A
	TK270802_E14_cyto_2D_step08.3625.3625.1	0.8665	0.0178	1367.93	7	2730.0%	1	R.KQMVIDVLHPGK.A
	TK270802_E14_cyto_2D_step05.1966.1966.1	1.1921	0.2785	747.11	4	6000.0%	3	R.HGLYEK.K
URET1_MOUSE92.2%396.7%134157155.2(Q00915) Retinol-binding protein I, cellular (Cellular retinol-binding protein) (CRBP) (mCRBPI) 
	TK270802_E14_cyto_2D_step04.2614.2614.1	2.2009	0.0308	1014.22	1	6880.0%	3	K.IANLLKPDK.E
UQ6104392.2%553.1%21682491675.0(Q61043) Ninein 
*	TK270802_E14_cyto_2D_step10.4563.4563.3	0.8984	0.0399	3244.99	32	600.0%	1	R.VIPEGSAALLGLQDKHLQQEATIAELELEK.Q
	TK270802_E14_cyto_2D_step01.0478.0478.1	1.6623	0.2592	804.47	1	8000.0%	1	R.RLSWDK.L
*	TK270802_E14_cyto_2D_step13.1153.1153.1	0.4785	0.0127	694.75	10	3000.0%	1	R.TESDLK.S
*	TK270802_E14_cyto_2D_step12.3084.3084.2	0.9933	0.0336	1879.71	3	3570.0%	1	R.ENSCLQEELRLVETR.Y
*	TK270802_E14_cyto_2D_step08.1899.1899.1	1.3129	0.0119	1239.65	34	2780.0%	1	R.QLQMAFDEEK.A
USYK_MOUSE92.2%468.1%595678405.9(Q99MN1) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase) (LysRS) 
	TK270802_E14_cyto_2D_step04.2285.2285.1	1.6378	0.2569	971.31	1	7140.0%	1	R.IAPELYHK.M
*	TK270802_E14_cyto_2D_step15.2557.2557.3	1.2851	0.0115	3197.72	48	1480.0%	1	K.GELSIIPQEITLLSPCLHMLPHLHFGLK.D
	TK270802_E14_cyto_2D_step05.2959.2959.2	1.3506	0.0311	1410.16	40	3180.0%	2	K.LIFYDLRGEGVK.L
UH105_MOUSE92.1%446.3%858964935.6(Q61699) Heat-shock protein 105 kDa (Heat shock-related 100 kDa protein E7I) (HSP-E7I) (Heat shock 110 kDa protein) (42 degrees C-HSP) 
*	TK270802_E14_cyto_2D_step07.3265.3265.3	0.9468	0.0482	2790.12	170	1040.0%	1	K.EDLEGKNNLGAEAPHQNGECHPNEK.G
	TK270802_E14_cyto_2D_step06.1539.1539.1	0.9156	0.1949	759.79	9	6000.0%	1	R.LQHYAK.I
*	TK270802_E14_cyto_2D_step04.1917.1917.1	1.1036	0.0218	919.0	66	4290.0%	1	K.ETAENNLK.K
*	TK270802_E14_cyto_2D_step04.2249.2249.2	2.6624	0.2676	1690.7	2	4640.0%	1	K.NQQITHANNTVSSFK.R
UEZRI_MOUSE92.0%11179.4%585692156.1(P26040) Ezrin (p81) (Cytovillin) (Villin 2) 
	TK270802_E14_cyto_2D_step05.3294.3294.1	0.9666	0.1335	1310.96	4	4500.0%	1	K.KAPDFVFYAPR.L
	TK270802_E14_cyto_2D_step08.2330.2330.1	0.6796	0.0162	825.84	6	3330.0%	1	-.PKPINVR.V
	TK270802_E14_cyto_2D_step11.2646.2646.2	2.1147	0.0445	1088.55	2	7500.0%	2	K.KFVIKPIDK.K
	TK270802_E14_cyto_2D_step09.2617.2617.1	1.0664	0.0949	1177.56	1	4380.0%	2	R.IQVWHAEHR.G
	TK270802_E14_cyto_2D_step05.2753.2753.1	1.8733	0.2421	960.92	1	6430.0%	1	K.FVIKPIDK.K
	TK270802_E14_cyto_2D_step08.2358.2358.2	1.7997	0.338	1476.04	6	5910.0%	1	R.RKPDTIEVQQMK.A
	TK270802_E14_cyto_2D_step02.3578.3578.1	1.7454	0.0779	896.1	38	6670.0%	1	K.LFFLQVK.D
UQ9EPX192.0%81011.5%687779946.1(Q9EPX1) Thimet oligopeptidase (EC 3.4.24.15) 
	TK270802_E14_cyto_2D_step08.1787.1787.1	0.6676	0.0634	764.18	1	5000.0%	1	R.GLPFDGR.I
	TK270802_E14_cyto_2D_step06.3693.3693.2	0.9527	0.1535	2702.8	30	1520.0%	1	K.TSQTVATFLDELAQKLKPLGEQER.A
*	TK270802_E14_cyto_2D_step05.2382.2382.1	1.3575	0.2169	1133.17	1	5000.0%	1	R.FKQEGVLSPK.V
*	TK270802_E14_cyto_2D_step04.3229.3229.1	1.8949	0.245	1556.97	1	4170.0%	2	R.NILDFPQHVSPCK.D
	TK270802_E14_cyto_2D_step10.2942.2942.2	1.5062	0.3608	2021.37	13	3240.0%	1	R.EGKYGHAACFGLQPGCLR.Q
	TK270802_E14_cyto_2D_step08.2976.2976.2	1.6153	0.2856	1708.37	1	4290.0%	1	K.YGHAACFGLQPGCLR.Q
*	TK270802_E14_cyto_2D_step06.2759.2759.1	1.235	0.1255	929.68	2	5830.0%	1	R.IHAWDMR.Y
URTC1_MOUSE92.0%4417.8%366392267.9(Q9D7H3) RNA 3'-terminal phosphate cyclase (EC 6.5.1.4) (RNA-3'-phosphate cyclase) (RNA cyclase) 
*	TK270802_E14_cyto_2D_step04.3246.3246.2	0.9322	0.0579	3005.06	12	1730.0%	1	R.HGGTVDEYLQDQLIIFMALANGISRIK.T
*	TK270802_E14_cyto_2D_step13.2418.2418.3	1.3113	0.0567	1916.0	198	2170.0%	1	K.EIRDLYVSIQPVQEAR.D
	TK270802_E14_cyto_2D_step01.1580.1580.1	1.0577	0.026	644.88	8	6250.0%	1	R.VQKIR.A
*	TK270802_E14_cyto_2D_step13.2862.2862.2	2.3617	0.3768	1879.87	1	4380.0%	1	R.STPGLRPQHLSGLEMVR.D
UO0881792.0%356.3%653704088.8(O08817) CW17 protein 
	TK270802_E14_cyto_2D_step08.2662.2662.2	2.2238	0.3859	1375.32	1	6500.0%	1	R.ILRPWQSSETR.S
	TK270802_E14_cyto_2D_step10.3565.3565.3	0.6801	0.0399	3355.25	203	340.0%	2	R.HTLITEMVALNPDFKPPADYKPPATRVSDK.V
ULSM4_MOUSE91.8%248.8%1371507610.1(Q9QXA5) U6 snRNA-associated Sm-like protein LSm4 
	TK270802_E14_cyto_2D_step05.2898.2898.1	2.1452	0.1876	1382.96	2	4550.0%	2	K.TAQNHPMLVELK.N
UQ91ZH191.7%8166.2%15951772865.2(Q91ZH1) DM505L19.1 (Novel protein) (Fragment) 
	TK270802_E14_cyto_2D_step03.3404.3404.3	1.348	0.0143	2939.5	96	1560.0%	3	R.DFDFLDVELEDGEGESMDNFNWGVR.R
*	TK270802_E14_cyto_2D_step07.3090.3090.1	1.5471	0.2688	1166.07	1	5560.0%	2	K.SAEQLSNFLR.H
	TK270802_E14_cyto_2D_step01.2336.2336.1	1.2818	0.0174	802.49	10	5830.0%	1	R.EALNILK.L
*	TK270802_E14_cyto_2D_step02.0703.0703.3	1.0085	0.0042	4371.6	21	450.0%	1	R.NLKEATAAIATDPLYIEGAWSEPTFTSTEAAIQSMLECLK.N
	TK270802_E14_cyto_2D_step11.2382.2382.3	1.4314	0.1959	2133.73	43	2030.0%	1	K.FSVLELQEYLDTYNNRK.E
USPCN_MOUSE91.5%4412.8%382435155.3(P16546) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) (Fragment) 
	TK270802_E14_cyto_2D_step07.3840.3840.2	0.6769	0.0361	2331.34	4	1250.0%	1	K.NQALNTDNYGHDLASVQALQR.K
	TK270802_E14_cyto_2D_step04.2317.2317.1	1.9725	0.235	1325.89	1	5450.0%	1	R.SQLLGSAHEVQR.F
*	TK270802_E14_cyto_2D_step10.2183.2183.3	0.9189	0.0096	1764.03	144	1330.0%	1	K.SARLMVHTVASFNSIK.E
UAAC2_MOUSE91.4%444.8%8941036535.5(Q9JI91) Alpha-actinin 2 (Alpha actinin skeletal muscle isoform 2) (F-actin cross linking protein) 
	TK270802_E14_cyto_2D_step08.2427.2427.1	1.5939	0.2522	1301.4	1	5560.0%	1	K.HTNYTMEHIR.V
	TK270802_E14_cyto_2D_step09.2209.2209.2	1.4246	0.2503	1755.75	3	3930.0%	1	R.KHEAFESDLAAHQDR.V
	TK270802_E14_cyto_2D_step01.3295.3295.1	1.2705	0.188	1200.82	2	3330.0%	1	R.DLLLDPAWEK.Q
	TK270802_E14_cyto_2D_step04.2313.2313.1	1.3228	0.1575	995.75	4	5000.0%	1	R.ASFNHFDR.R
UP9739891.3%71918.6%323377098.0(P97398) NIPI-like protein 
	TK270802_E14_cyto_2D_step05.2643.2643.1	1.9793	0.1656	1248.79	6	6110.0%	1	K.TCHSFIINEK.M
	TK270802_E14_cyto_2D_step03.1510.1510.1	1.104	0.1083	840.87	31	4290.0%	4	R.EHVVAASK.A
*	TK270802_E14_cyto_2D_step01.0488.0488.1	1.0381	0.0694	460.8	2	8330.0%	1	R.XISK.Q
	TK270802_E14_cyto_2D_step13.0299.0299.3	1.1578	0.0571	4479.54	28	1010.0%	1	R.QVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARR.R
UQ9CWW891.2%6819.4%432484305.9(Q9CWW8) 2410002G23Rik protein 
	TK270802_E14_cyto_2D_step01.1499.1499.1	1.3204	0.1311	1362.57	2	3330.0%	1	K.QYIGPPSAAAIFK.I
*	TK270802_E14_cyto_2D_step10.3445.3445.3	0.9198	0.0372	3355.68	34	750.0%	1	R.KLPFLAHALYIQAPSVTIEGFLQALSLAVDK.Q
*	TK270802_E14_cyto_2D_step08.4789.4789.2	1.0303	0.0676	3064.79	42	1300.0%	1	-.MDEAVGDLKQALPCVAESPAVHVEVLQR.S
	TK270802_E14_cyto_2D_step11.2471.2471.2	2.0501	0.3152	1176.5	1	5000.0%	2	R.VVLLHGPPGTGK.T
UQ99JX491.2%5525.9%374425175.7(Q99JX4) Similar to dendritic cell protein 
	TK270802_E14_cyto_2D_step03.3052.3052.3	1.135	0.0644	3500.51	7	1500.0%	1	K.DVESVMNSVVSLLLILEPDKQEALIESLCEK.L
	TK270802_E14_cyto_2D_step07.4117.4117.2	1.7499	0.2269	1969.97	3	3440.0%	1	K.DPNAFLFDHLLTLKPVK.F
	TK270802_E14_cyto_2D_step10.1775.1775.1	0.6829	0.1776	1021.83	2	3120.0%	1	K.VVVSHSTHR.T
	TK270802_E14_cyto_2D_step11.4177.4177.2	1.406	0.2118	3041.19	2	2310.0%	1	K.EISFDTMQQELQIGADDVEAFVIDAVR.T
	TK270802_E14_cyto_2D_step05.4105.4105.2	2.0836	0.3953	1518.89	1	5830.0%	1	R.LQLLSNLFHGMDK.N
UQ9DBC791.1%355.2%381431855.3(Q9DBC7) 1300018C22Rik protein (Protein kinase, cAMP dependent regulatory, type 1, alpha) (RIKEN cDNA 1300018C22 gene) 
	TK270802_E14_cyto_2D_step03.2546.2546.1	1.5051	0.1044	1451.84	1	3640.0%	1	R.RSENEEFVEVGR.L
	TK270802_E14_cyto_2D_step06.2778.2778.1	1.7592	0.2441	938.78	1	7140.0%	2	K.HNIQALLK.D
UQ9D22491.1%1115.3%203226269.3(Q9D224) A030010B05Rik protein 
*	TK270802_E14_cyto_2D_step08.2874.2874.2	2.0154	0.4115	3118.37	1	2170.0%	1	K.SKPELPPGLSPEATTPVTPSRPEGGETGLSK.T
USPEE_MOUSE91.1%61232.5%302339955.5(Q64674) Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) 
	TK270802_E14_cyto_2D_step10.4113.4113.2	1.8971	0.4037	2605.36	1	2860.0%	3	R.ETCSLWPGQALSLQVEQLLHHR.R
*	TK270802_E14_cyto_2D_step10.3663.3663.2	1.2569	0.2339	2402.36	8	2250.0%	1	K.HPSVESVVQCEIDEDVIEVSK.K
	TK270802_E14_cyto_2D_step06.4571.4571.3	1.1587	0.0343	3772.44	4	1480.0%	1	K.QNQDAFDVIITDSSDPMGPAESLFKESYYQLMK.T
	TK270802_E14_cyto_2D_step10.3349.3349.3	1.2722	0.0712	2650.42	33	1900.0%	1	R.DEFSYQEMIANLPLCSHPNPRK.V
UPYR5_MOUSE91.0%3310.0%481522926.6(P13439) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] 
	TK270802_E14_cyto_2D_step05.2906.2906.1	1.2644	0.2645	1219.23	38	3500.0%	1	K.GLQEVGLPLHR.A
	TK270802_E14_cyto_2D_step11.3095.3095.2	0.9545	0.1027	1873.58	137	2190.0%	1	R.ELLQLADALGPSICMLK.T
*	TK270802_E14_cyto_2D_step04.3810.3810.2	2.4916	0.3587	2021.2	1	3950.0%	1	K.IASWADIVNAHVVPGSGVVK.G
UPYR5_HUMAN91.0%114.2%480522227.2(P11172) Uridine 5'-monophosphate synthase (UMP synthase) [Includes: Orotate phosphoribosyltransferase (EC 2.4.2.10) (OPRtase); Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMPdecase)] 
*	TK270802_E14_cyto_2D_step04.3810.3810.2	2.4916	0.3587	2021.2	1	3950.0%	1	K.IASWADLVNAHVVPGSGVVK.G
UMK04_HUMAN90.9%226.3%557626236.5(P31152) Mitogen-activated protein kinase 4 (EC 2.7.1.-) (Extracellular signal-regulated kinase 4) (ERK-4) (MAP kinase isoform p63) (p63-MAPK) 
*	TK270802_E14_cyto_2D_step03.3531.3531.1	2.1657	0.0362	1110.81	2	6110.0%	1	K.GTDLQGELFK.F
*	TK270802_E14_cyto_2D_step12.3448.3448.2	0.9145	0.0469	2728.58	2	1880.0%	1	R.FVDFQPLGFGVNGLVLSAVDSRACR.K
U143T_MOUSE90.8%91139.2%245277784.8(P35216) 14-3-3 protein tau (14-3-3 protein theta) 
	TK270802_E14_cyto_2D_step01.2267.2267.1	1.6949	0.2311	1320.84	1	5910.0%	1	K.YLIANATNPESK.V
	TK270802_E14_cyto_2D_step14.4030.4030.3	1.2367	0.0823	4063.8	54	1100.0%	1	K.EMQPTHPIRLGLALNFSVFYYEILNNPELACTLAK.T
	TK270802_E14_cyto_2D_step01.4270.4270.1	1.2438	0.0185	1393.78	46	4090.0%	1	R.SICTTVLELLDK.Y
	TK270802_E14_cyto_2D_step08.3791.3791.3	1.8665	0.1122	2977.41	86	1600.0%	1	R.LGLALNFSVFYYEILNNPELACTLAK.T
	TK270802_E14_cyto_2D_step01.0470.0470.1	0.6923	0.0128	601.93	4	5000.0%	1	K.NVVGGR.R
	TK270802_E14_cyto_2D_step07.2680.2680.1	1.5864	0.0345	743.0	2	7000.0%	1	K.KLQLIK.D
*	TK270802_E14_cyto_2D_step03.2922.2922.2	2.1337	0.3851	2160.79	1	3890.0%	2	R.KQTIENSQGAYQEAFDISK.K
	TK270802_E14_cyto_2D_step14.1794.1794.1	0.4992	0.0050	729.32	14	2000.0%	1	K.TELIQK.A
UQ9H1B790.7%4412.9%796826598.2(Q9H1B7) Polyglutamine-containing protein 
*	TK270802_E14_cyto_2D_step12.3381.3381.3	1.3324	0.03	3189.34	12	1640.0%	1	K.EGVPGADMLPQPYLDASCPMLPTALVSLSR.A
*	TK270802_E14_cyto_2D_step11.3605.3605.2	0.9553	0.0159	2915.1	55	1500.0%	1	K.LTMSAGGFAAPGHAAGGPPPPPPPLGPHSNR.T
*	TK270802_E14_cyto_2D_step03.1816.1816.3	1.5299	0.1729	2298.65	1	1900.0%	1	R.APSAPPGTGALPPAAPSGRGAAASLR.K
	TK270802_E14_cyto_2D_step05.2529.2529.2	2.2229	0.3792	1882.85	1	4330.0%	1	R.LEDTHFVQCPSVPSHK.F
UQ923R990.5%1181.0%2123804.4(Q923R9) Sterolin 2 (Fragment) 
*	TK270802_E14_cyto_2D_step10.2466.2466.2	2.081	0.3906	1921.09	1	3440.0%	1	K.TKEETQLWNGTVLQDAS.-
U2A5E_HUMAN90.5%227.3%467546996.9(Q16537) Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon isoform (PP2A, B subunit, B' epsilon isoform) (PP2A, B subunit, B56 epsilon isoform) (PP2A, B subunit, PR61 epsilon isoform) (PP2A, B subunit, R5 epsilon isoform) 
*	TK270802_E14_cyto_2D_step13.4104.4104.2	1.0264	0.075	1980.23	488	2220.0%	1	-.MSSAPTTPPSVDKVDGFSR.K
*	TK270802_E14_cyto_2D_step06.3746.3746.2	2.2032	0.3831	1635.13	1	4640.0%	1	R.SQGKPIELTPLPLLK.D
UTYSY_MOUSE90.4%112.3%307349586.5(P07607) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase) 
*	TK270802_E14_cyto_2D_step05.2153.2153.1	1.491	0.3237	852.07	1	7500.0%	1	R.HFGAEYK.D
UQ9Z2X190.4%228.7%415457305.5(Q9Z2X1) Ribonucleoprotein F 
	TK270802_E14_cyto_2D_step06.2734.2734.2	2.1974	0.3807	2214.37	1	3330.0%	1	R.YGDSEFTVQSTTGHCVHMR.G
	TK270802_E14_cyto_2D_step13.2393.2393.2	1.3881	0.1475	1936.7	89	2190.0%	1	K.FMSVQRPGPYDRPGTAR.R
UPIP3_HUMAN90.3%335.4%12341387995.9(Q01970) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 3 (EC 3.1.4.11) (PLC-beta-3) (Phospholipase C-beta-3) 
*	TK270802_E14_cyto_2D_step12.2907.2907.3	1.4611	0.0398	4128.78	4	1280.0%	1	R.RPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELR.G
*	TK270802_E14_cyto_2D_step04.2065.2065.1	1.7781	0.2378	1116.88	1	5000.0%	1	R.EVLGFGGPDAR.L
*	TK270802_E14_cyto_2D_step05.4877.4877.2	1.3482	0.091	1958.05	3	3330.0%	1	R.SESIRPDEFSLEIFER.F
UCDK4_MOUSE90.1%4612.5%303337516.6(P30285) Cell division protein kinase 4 (EC 2.7.1.-) (Cyclin-dependent kinase 4) (PSK-J3) (CRK3) 
*	TK270802_E14_cyto_2D_step06.2391.2391.2	0.9527	0.05	1756.73	15	3210.0%	1	R.ALQHSYLHKEESDAE.-
	TK270802_E14_cyto_2D_step09.2894.2894.2	2.0087	0.2841	1468.66	1	5450.0%	2	R.RLEAFEHPNVVR.L
	TK270802_E14_cyto_2D_step08.2496.2496.1	1.5357	0.0159	1209.96	2	4000.0%	1	R.DPHSGHFVALK.S
UQ91WQ390.1%71113.1%528591057.0(Q91WQ3) Similar to tyrosyl-tRNA synthetase (Hypothetical 59.1 kDa protein) (Expressed sequence AL024047) 
*	TK270802_E14_cyto_2D_step07.2509.2509.1	0.6733	0.101	1021.91	63	2780.0%	1	K.QKPPAKGPAK.N
	TK270802_E14_cyto_2D_step09.3174.3174.2	2.1714	0.2246	1582.41	2	4290.0%	2	R.VHLMNPMVPGLTGSK.M
	TK270802_E14_cyto_2D_step04.1481.1481.1	0.7732	0.0072	800.06	15	4170.0%	1	R.LDIRVGK.I
	TK270802_E14_cyto_2D_step08.3162.3162.3	1.4006	0.3793	3381.48	6	1500.0%	1	K.AGAEVVKQVEHPLLSGLLYPGLQALDEEYLK.V
	TK270802_E14_cyto_2D_step09.2562.2562.1	1.1754	0.1168	753.48	13	6000.0%	2	K.LHLITR.N
URL18_MOUSE89.9%5719.8%1872151311.8(P35980) 60S ribosomal protein L18 
	TK270802_E14_cyto_2D_step07.1564.1564.1	0.9641	0.0023	488.91	1	6670.0%	1	R.HFGK.A
	TK270802_E14_cyto_2D_step08.2434.2434.2	1.8746	0.2225	1143.14	2	5000.0%	2	R.TNRPPLSLSR.M
*	TK270802_E14_cyto_2D_step03.3132.3132.1	0.9412	0.0599	1031.02	27	4440.0%	1	R.GTVLLSGPRK.G
*	TK270802_E14_cyto_2D_step01.3414.3414.1	1.7573	0.1189	1476.97	2	5000.0%	1	K.ILTFDQLALESPK.G
USPCO_MOUSE89.7%885.5%23632744216.0(Q62261) Spectrin beta chain, brain 1 (Spectrin, non-erythroid beta chain 1) (Beta-II spectrin) (Fodrin beta chain) 
	TK270802_E14_cyto_2D_step05.3418.3418.2	1.1001	0.0369	2321.53	1	2630.0%	1	K.DALLSALSIQNYHLECNETK.S
	TK270802_E14_cyto_2D_step05.3828.3828.2	1.1331	0.0656	2363.15	17	1900.0%	1	K.TKVIESTQDLGNDLAGVMALQR.K
	TK270802_E14_cyto_2D_step06.2283.2283.1	1.9532	0.0893	783.87	1	7500.0%	1	K.HNLLASK.E
	TK270802_E14_cyto_2D_step06.3362.3362.2	2.4036	0.3442	1834.86	1	5710.0%	1	R.QNLLSQSHAYQQFLR.D
*	TK270802_E14_cyto_2D_step10.2329.2329.3	1.9806	0.1879	3013.04	1	2140.0%	1	K.SALPAQSAATLPARTLETPAAQMEGFLNR.K
	TK270802_E14_cyto_2D_step01.0488.0488.1	1.0381	0.0694	460.8	2	8330.0%	1	R.LLSK.H
	TK270802_E14_cyto_2D_step10.3344.3344.2	1.0888	0.0234	2037.91	12	2350.0%	1	R.AFEDEMSGRSGHFEQAIK.E
	TK270802_E14_cyto_2D_step06.3274.3274.1	0.9055	0.0409	1587.43	88	1920.0%	1	R.EIGQSVDEVEKLIK.R
UGDIC_MOUSE89.5%4618.4%445505376.2(Q61598) Rab GDP dissociation inhibitor beta-2 (Rab GDI beta-2) (GDI-3) 
	TK270802_E14_cyto_2D_step03.3604.3604.3	1.2442	0.028	2999.45	2	2000.0%	1	K.VLHMDQNPYYGGESASITPLEDLYKR.F
	TK270802_E14_cyto_2D_step04.5005.5005.3	0.9088	0.0594	4778.01	3	950.0%	1	K.SPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGK.V
	TK270802_E14_cyto_2D_step13.2726.2726.2	1.9483	0.0661	1387.79	23	3750.0%	2	R.FKLPGQPPASMGR.G
UQ9CZK189.2%226.6%437472475.6(Q9CZK1) 1300012C15Rik protein 
	TK270802_E14_cyto_2D_step10.2978.2978.2	1.3299	0.1018	1889.17	27	2500.0%	1	K.GVKTLTTAAVSTAQPILSK.L
	TK270802_E14_cyto_2D_step08.2108.2108.1	2.1326	0.0076	1155.67	1	6670.0%	1	R.NHAYEHSLGK.L
UGBB1_HUMAN89.2%3312.6%340373776.0(P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) (P04901) Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1) 
	TK270802_E14_cyto_2D_step09.2428.2428.1	1.4538	0.4061	805.54	1	6670.0%	1	K.VHAIPLR.S
	TK270802_E14_cyto_2D_step04.1969.1969.1	1.4905	0.1449	1009.69	73	3890.0%	1	R.AGVLAGHDNR.V
	TK270802_E14_cyto_2D_step10.3396.3396.3	1.6861	0.1153	2832.58	2	2200.0%	1	R.VSCLGVTDDGMAVATGSWDSFLKIWN.-
UO8849389.1%6122.6%26572868818.6(O88493) Type VI collagen alpha 3 subunit 
*	TK270802_E14_cyto_2D_step06.3426.3426.3	1.1644	0.0298	3422.23	5	1790.0%	1	R.LHWERPEPSSSFFYDLTVTSAHDQSLVLR.Q
*	TK270802_E14_cyto_2D_step09.3388.3388.2	1.1063	0.0487	1606.92	238	2500.0%	1	K.SVEDAQDVSLALTQK.G
*	TK270802_E14_cyto_2D_step12.4269.4269.1	1.7562	0.2268	1575.99	2	3750.0%	3	K.RFWYGGCGGNENR.F
*	TK270802_E14_cyto_2D_step03.2358.2358.1	0.7403	0.0431	1519.83	116	2080.0%	1	R.FIEELDVKPDGTR.V
UGR78_MOUSE88.9%91118.3%655724225.2(P20029) 78 kDa glucose-regulated protein precursor (GRP 78) (Immunoglobulin heavy chain binding protein) (BIP) 
	TK270802_E14_cyto_2D_step03.1814.1814.1	0.8943	0.121	498.96	2	6670.0%	2	K.LIPR.N
	TK270802_E14_cyto_2D_step11.2957.2957.2	2.2935	0.3643	2017.43	1	4120.0%	1	K.KVTHAVVTVPAYFNDAQR.Q
	TK270802_E14_cyto_2D_step01.3655.3655.1	1.1863	0.0852	1539.25	4	3460.0%	1	K.TFAPEEISAMVLTK.M
	TK270802_E14_cyto_2D_step09.4847.4847.1	0.6109	0.0938	1195.1	29	1670.0%	1	K.ETMEKAVEEK.I
	TK270802_E14_cyto_2D_step03.2164.2164.1	1.2744	0.0853	1191.92	67	3890.0%	1	K.VYEGERPLTK.D
	TK270802_E14_cyto_2D_step06.5072.5072.3	1.1136	0.0409	4568.18	1	1130.0%	1	K.NILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQR.V
	TK270802_E14_cyto_2D_step05.2658.2658.1	1.3026	0.102	903.73	2	6670.0%	1	R.VMEHFIK.L
	TK270802_E14_cyto_2D_step05.2921.2921.1	0.8879	0.0789	1462.04	89	2690.0%	1	K.SDIDEIVLVGGSTR.I
UQ9CZM588.8%335.7%614716606.8(Q9CZM5) 2700050M05Rik protein 
	TK270802_E14_cyto_2D_step13.2156.2156.2	2.4415	0.3249	1237.83	1	7500.0%	1	K.RPNKPAELIAK.Y
	TK270802_E14_cyto_2D_step06.2597.2597.1	1.2652	0.1347	1355.01	3	3750.0%	1	K.SASVDAEKSMLSK.L
	TK270802_E14_cyto_2D_step13.1554.1554.1	0.6261	0.091	1364.57	171	2500.0%	1	R.EVPEYLHHVNK.R
UUBPE_MOUSE88.8%355.5%492558715.2(Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15) (Ubiquitin thiolesterase 14) (Ubiquitin-specific processing protease 14) (Deubiquitinating enzyme 14) 
*	TK270802_E14_cyto_2D_step14.2209.2209.3	0.9318	0.0825	1506.71	135	1960.0%	1	R.ETDSSSAPAVTPSKK.K
*	TK270802_E14_cyto_2D_step04.2768.2768.1	1.3688	0.1751	1352.16	1	5000.0%	2	R.SSSSGHYVSWVR.R
UQ8R3E688.4%115.0%338381175.5(Q8R3E6) Similar to chromosome 14 open reading frame 3 
	TK270802_E14_cyto_2D_step11.3783.3783.2	2.3395	0.3575	1965.67	1	4380.0%	1	K.SWPEGHFATITLTFIDK.N
UQ8VD7888.3%467.2%483507716.9(Q8VD78) Hypothetical 50.8 kDa protein 
*	TK270802_E14_cyto_2D_step05.2379.2379.2	2.2142	0.3709	1862.55	1	3610.0%	1	R.GAVEAAHQAAPGWGAQSPR.A
*	TK270802_E14_cyto_2D_step13.2317.2317.2	1.6373	0.2805	1328.51	1	6000.0%	1	R.RKPVLTSQLER.H
	TK270802_E14_cyto_2D_step11.2046.2046.1	0.3544	0.1438	544.01	2	2500.0%	2	R.GPVLR.L
UQ9QXD887.6%225.8%668714216.4(Q9QXD8) LIM domains containing protein 1 
	TK270802_E14_cyto_2D_step09.1925.1925.2	1.0166	0.0244	2356.23	7	1840.0%	1	R.CVICNECLDGVPFTVDSENK.I
*	TK270802_E14_cyto_2D_step08.2391.2391.2	2.1856	0.3613	2187.78	1	3610.0%	1	K.SCGDHHPYQPQLSTVCSGR.S
UQ96GV287.4%115.6%1952210110.9(Q96GV2) Hypothetical protein 
*	TK270802_E14_cyto_2D_step05.3205.3205.1	1.5494	0.2403	1346.97	1	5500.0%	1	R.EDAAQLQRLFR.R
UCFAI_HUMAN87.1%5115.8%583657207.5(P05156) Complement factor I precursor (EC 3.4.21.45) (C3B/C4B inactivator) 
	TK270802_E14_cyto_2D_step06.2127.2127.1	0.7043	0.0495	1153.05	85	2500.0%	3	K.KYTHLSCDK.V
*	TK270802_E14_cyto_2D_step10.2697.2697.2	1.1374	0.0726	1462.15	15	3640.0%	1	K.LISNCSKFYGNR.F
	TK270802_E14_cyto_2D_step01.0492.0492.1	0.7923	0.0888	1455.73	80	1670.0%	1	R.GLETSLAECTFTK.R
UCKS1_HUMAN87.0%41020.3%7996608.9(P33551) Cyclin-dependent kinases regulatory subunit 1 (CKS-1) (Sid1334) (PNAS-16 / PNAS-143) (P33551) Cyclin-dependent kinases regulatory subunit 1 (CKS-1) (Sid1334) (PNAS-16 / PNAS-143) 
	TK270802_E14_cyto_2D_step04.2752.2752.1	1.2165	0.174	1276.36	3	5000.0%	1	K.THLMSESEWR.N
	TK270802_E14_cyto_2D_step07.2370.2370.1	1.5013	0.2478	726.95	1	8000.0%	3	R.HVMLPK.D
UQ9DBQ487.0%558.2%720815267.5(Q9DBQ4) 1200016L19Rik protein 
	TK270802_E14_cyto_2D_step07.3777.3777.2	1.7379	0.195	1857.8	1	3930.0%	1	K.AFIHWVSQPLVCEIR.L
*	TK270802_E14_cyto_2D_step03.1999.1999.1	1.1311	0.0038	1138.77	187	2780.0%	1	R.SHPQDPIDTK.D
	TK270802_E14_cyto_2D_step11.2323.2323.2	0.9871	0.1142	1122.2	29	3750.0%	1	K.FHKPGENYK.T
	TK270802_E14_cyto_2D_step09.1865.1865.3	1.2166	0.1149	1626.6	102	1430.0%	1	R.FPPEPNGILHIGHAK.A
*	TK270802_E14_cyto_2D_step11.2725.2725.2	2.0457	0.3746	1162.13	1	7780.0%	1	K.GHNPLPSPWR.D
UQ6148086.9%447.9%558641547.6(Q61480) TRAF5 
	TK270802_E14_cyto_2D_step10.3996.3996.2	2.5482	0.1497	1484.06	7	4580.0%	1	R.AALQDHMLLVLEK.N
	TK270802_E14_cyto_2D_step04.2966.2966.1	1.2133	0.0462	1114.01	20	3330.0%	1	K.QLEGACYSGK.L
	TK270802_E14_cyto_2D_step13.0311.0311.2	0.6946	0.0875	1425.28	64	1820.0%	1	K.GTHLSLYFVVMR.G
	TK270802_E14_cyto_2D_step10.2107.2107.2	0.867	0.0020	1122.69	226	3120.0%	1	K.RGNLLEHER.A
UQ9Y6F586.9%6613.8%842922615.1(Q9Y6F5) Serine phosphatase FCP1a 
	TK270802_E14_cyto_2D_step01.1604.1604.1	1.1049	0.1717	519.89	32	6000.0%	1	R.SAAGGR.G
	TK270802_E14_cyto_2D_step06.2262.2262.1	1.5223	0.2774	853.78	2	5710.0%	1	R.ATHLIAAR.A
	TK270802_E14_cyto_2D_step11.2114.2114.2	0.7819	0.0368	1307.12	6	1820.0%	1	K.LNEEDAASESSR.E
*	TK270802_E14_cyto_2D_step13.3109.3109.3	1.6923	0.101	3482.06	32	1490.0%	1	K.AAPEGAGALAQGSSLDAGRPAAPSVPGEAEPGAHAPDK.E
	TK270802_E14_cyto_2D_step09.2318.2318.3	1.4448	0.0313	3194.37	25	1470.0%	1	K.LNEEDAASESSRESSNEDEGSSSEADEMAK.A
	TK270802_E14_cyto_2D_step12.3141.3141.3	1.6753	0.0413	3429.67	34	1440.0%	1	R.VAPGQRPAQGATGTDLDFDLSSDSESSSESEGTK.S
UIF2A_HUMAN86.7%116.4%314359815.1(P05198) Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 alpha subunit) (eIF-2-alpha) (EIF-2alpha) (EIF-2A) 
*	TK270802_E14_cyto_2D_step08.3607.3607.2	2.2336	0.3451	2435.62	1	5000.0%	1	R.HVAEVLEYTKDEQLESLFQR.T
URL13_MOUSE86.7%598.1%2102417411.5(P47963) 60S ribosomal protein L13 (A52) 
*	TK270802_E14_cyto_2D_step13.2674.2674.1	1.6061	0.2564	1323.9	7	4500.0%	2	R.NGMILKPHFHK.D
	TK270802_E14_cyto_2D_step07.1648.1648.1	1.0416	0.0637	628.03	5	5000.0%	2	R.KPSAPK.K
UO6031186.6%8169.7%641757786.8(O60311) Hypothetical protein KIAA0565 (Fragment) 
	TK270802_E14_cyto_2D_step15.1977.1977.2	0.8928	0.2137	1435.25	8	2730.0%	1	R.LSQLQSENMLLR.Q
*	TK270802_E14_cyto_2D_step05.1579.1579.1	1.4216	0.0695	1203.75	2	3890.0%	2	K.QILSLQEKNK.E
*	TK270802_E14_cyto_2D_step01.1808.1808.1	1.5831	0.0428	732.82	1	8000.0%	1	K.NDNLQK.I
*	TK270802_E14_cyto_2D_step06.5185.5185.2	0.9396	0.1204	2422.49	9	1430.0%	1	K.TSSTIQDQFHSAAKNLQAESEK.Q
*	TK270802_E14_cyto_2D_step02.4086.4086.1	1.5115	0.2634	1370.96	1	5000.0%	3	R.DALGRESLILER.V
UMK01_MOUSE86.6%91325.1%358412767.0(P27703) Mitogen-activated protein kinase 1 (EC 2.7.1.-) (Extracellular signal-regulated kinase 2) (ERK-2) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) (P42-MAPK) (ERT1) 
	TK270802_E14_cyto_2D_step06.2689.2689.1	1.6603	0.133	988.92	4	5710.0%	1	K.MLTFNPHK.R
	TK270802_E14_cyto_2D_step10.2922.2922.3	1.8714	0.0857	2779.07	4	1630.0%	1	R.DLKPSNLLLNTTCDLKICDFGLAR.V
	TK270802_E14_cyto_2D_step05.3074.3074.1	1.5079	0.1417	1086.32	1	6250.0%	1	R.NYLLSLPHK.N
	TK270802_E14_cyto_2D_step14.4082.4082.2	0.7621	0.029	2962.63	280	1200.0%	2	R.YTNLSYIGEGAYGMVCSAYDNLNKVR.V
	TK270802_E14_cyto_2D_step12.2000.2000.2	1.6471	0.3521	1213.26	1	5000.0%	1	K.YIHSANVLHR.D
	TK270802_E14_cyto_2D_step04.2526.2526.1	1.1127	0.0565	1566.99	1	3640.0%	2	K.ISPFEHQTYCQR.T
	TK270802_E14_cyto_2D_step11.2494.2494.2	1.7572	0.1661	1695.03	1	4580.0%	1	K.KISPFEHQTYCQR.T
UPSA1_MOUSE86.5%155122.1%263295476.4(Q9R1P4) Proteasome subunit alpha type 1 (EC 3.4.25.1) (Proteasome component C2) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome nu chain) 
	TK270802_E14_cyto_2D_step06.3241.3241.2	1.5639	0.1494	1335.01	10	5000.0%	2	R.FVFDRPLPVSR.L
	TK270802_E14_cyto_2D_step03.1729.1729.2	1.4501	0.0427	1084.54	3	5560.0%	1	R.AQSELAAHQK.K
	TK270802_E14_cyto_2D_step08.1960.1960.2	2.0509	0.3672	1239.68	2	6000.0%	1	K.RAQSELAAHQK.K
*	TK270802_E14_cyto_2D_step14.2510.2510.2	0.7927	0.1202	1885.91	12	2140.0%	1	R.HMSEFMECNLDELVK.H
	TK270802_E14_cyto_2D_step04.2981.2981.1	1.2594	0.0219	1432.03	249	2270.0%	2	R.IHQIEYAMEAVK.Q
	TK270802_E14_cyto_2D_step06.2850.2850.1	1.8376	0.1644	953.95	1	6250.0%	6	K.THAVLVALK.R
UAATC_MOUSE86.5%338.7%412461007.2(P05201) Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A) (Glutamate oxaloacetate transaminase-1) 
*	TK270802_E14_cyto_2D_step04.3944.3944.2	2.2388	0.3402	1994.0	1	4170.0%	1	-.APPSVFAQVPQAPPVLVFK.L
	TK270802_E14_cyto_2D_step05.1562.1562.1	0.3216	0.055	465.14	4	5000.0%	1	K.EWK.G
*	TK270802_E14_cyto_2D_step05.3445.3445.2	1.1369	0.0256	1657.4	35	3080.0%	1	R.TDESQPWVLPVVRK.V
UPTB_MOUSE86.4%4417.8%527564788.3(P17225) Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) 
	TK270802_E14_cyto_2D_step04.3893.3893.2	1.1555	0.1286	2244.74	1	2890.0%	1	K.NNQFQALLQYADPVSAQHAK.L
	TK270802_E14_cyto_2D_step04.1904.1904.3	0.7216	0.118	3164.49	1	750.0%	1	R.GSDELFSTCVSNGPFIMSSSASAANGNDSKK.F
	TK270802_E14_cyto_2D_step05.2849.2849.1	1.8715	0.2158	1432.98	3	4550.0%	1	R.GQPIYIQFSNHK.E
	TK270802_E14_cyto_2D_step14.2631.2631.3	1.2616	0.2207	3508.5	40	1170.0%	1	K.MALIQMGSVEEAVQALIELHNHDLGENHHLR.V
UQ9UNI586.3%224.5%11511281436.5(Q9UNI5) Zinc finger protein FOG-2 
	TK270802_E14_cyto_2D_step07.2537.2537.2	2.2055	0.3552	2273.54	3	2890.0%	1	R.CDIFPGIVSKHLETSLTINK.C
	TK270802_E14_cyto_2D_step13.2930.2930.3	1.0119	0.0172	3324.46	26	1290.0%	1	K.SPSWISENPLAANENVSPGIPSAEEQLSSIAK.G
UQ91WJ886.1%4610.0%651685407.9(Q91WJ8) Similar to far upstream element (FUSE) binding protein 1 
*	TK270802_E14_cyto_2D_step13.2585.2585.2	1.7465	0.2147	2493.45	2	3100.0%	2	K.KVPPQNDSFGAQLPPMHQQQSR.S
	TK270802_E14_cyto_2D_step11.3761.3761.2	0.7242	0.0333	2485.9	118	1040.0%	1	R.QIAAKIGGDAGTSLNSNDYGYGGQK.R
	TK270802_E14_cyto_2D_step03.2794.2794.2	1.2407	0.1869	1972.61	1	3820.0%	1	K.MVMIQDGPQNTGADKPLR.I
URL23_HUMAN86.0%123419.3%1401486510.5(P23131) 60S ribosomal protein L23 (L17) (P23131) 60S ribosomal protein L23 (L17) 
	TK270802_E14_cyto_2D_step03.3208.3208.1	1.6567	0.0497	951.85	19	6430.0%	3	K.NLYIISVK.G
	TK270802_E14_cyto_2D_step13.2222.2222.2	1.6621	0.3779	1021.53	1	6880.0%	2	K.KVHPAVVIR.Q
	TK270802_E14_cyto_2D_step01.1826.1826.1	0.9615	0.0419	900.8	3	4440.0%	1	K.GSAITGPVAK.E
	TK270802_E14_cyto_2D_step08.2410.2410.1	1.1653	0.1123	892.94	14	5000.0%	4	K.VHPAVVIR.Q
UMO25_MOUSE85.7%225.3%341398427.2(Q06138) MO25 protein 
	TK270802_E14_cyto_2D_step01.4019.4019.1	1.4594	0.0896	1083.13	17	3890.0%	1	K.SPADIVKNLK.E
	TK270802_E14_cyto_2D_step06.2666.2666.1	1.4357	0.3501	992.04	1	7140.0%	1	R.HNFTIMTK.Y
UQ6116685.7%4421.6%268300165.2(Q61166) APC-binding protein EB1 homolog 
	TK270802_E14_cyto_2D_step03.2744.2744.1	1.4055	0.0305	1320.21	1	4440.0%	1	K.LEHEYIQNFK.I
	TK270802_E14_cyto_2D_step03.2704.2704.1	0.8826	0.1918	1205.14	1	3330.0%	1	K.KFFDANYDGK.E
*	TK270802_E14_cyto_2D_step04.2954.2954.2	1.3744	0.2382	1993.76	7	2110.0%	1	R.QGQETAVAPSLVAPALSKPK.K
*	TK270802_E14_cyto_2D_step13.1980.1980.2	1.982	0.3886	1881.02	1	4120.0%	1	K.KPLGSSTAAPQRPIATQR.T
UO8817985.6%577.6%550605155.4(O88179) Guanine nucleotide regulatory protein (Fragment) 
*	TK270802_E14_cyto_2D_step01.1704.1704.1	1.087	0.1584	895.05	1	3890.0%	1	K.SAVAPPGAPK.K
	TK270802_E14_cyto_2D_step09.2996.2996.1	1.7978	0.2089	950.96	3	6430.0%	2	K.HLIVLINK.M
	TK270802_E14_cyto_2D_step06.2303.2303.2	1.2473	0.0989	1873.01	3	3120.0%	1	K.STIGGQIMYLTGMVDKR.T
	TK270802_E14_cyto_2D_step07.2149.2149.1	1.3903	0.1277	790.26	7	7500.0%	1	K.KVGFNPK.K
UCTB2_MOUSE85.3%2214.8%445489576.9(P56546) C-terminal binding protein 2 (CtBP2) 
	TK270802_E14_cyto_2D_step05.3996.3996.2	2.162	0.3517	2023.59	1	4410.0%	1	K.VLNEAVGAMMYHTITLTR.E
*	TK270802_E14_cyto_2D_step08.3539.3539.3	1.1836	0.1226	4732.87	22	900.0%	1	R.YPPGIVGVAPGGLPPAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTK.H
UIF2B_MOUSE85.2%336.9%331380925.8(Q99L45) Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 beta subunit) (eIF-2-beta) 
	TK270802_E14_cyto_2D_step01.4287.4287.1	0.7354	0.1203	1326.85	10	2500.0%	1	R.KFVMKPPQVVR.V
	TK270802_E14_cyto_2D_step09.2817.2817.2	1.5094	0.2362	1201.95	13	3890.0%	1	K.FVMKPPQVVR.V
	TK270802_E14_cyto_2D_step04.3228.3228.1	1.4284	0.3374	1462.28	1	5000.0%	1	K.KTSFVNFTDICK.L
UCO3_MOUSE85.0%887.2%16631864826.8(P01027) Complement C3 precursor (HSE-MSF) [Contains: C3A anaphylatoxin] 
*	TK270802_E14_cyto_2D_step03.2111.2111.1	1.5192	0.2541	1451.99	1	3750.0%	1	R.DNHLAPGQQTTLR.I
*	TK270802_E14_cyto_2D_step01.3575.3575.1	1.049	0.0365	1238.19	15	4440.0%	1	R.YFQTIKIPPK.S
*	TK270802_E14_cyto_2D_step03.5072.5072.3	1.1428	0.161	4064.59	2	1040.0%	1	K.SLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTK.T
*	TK270802_E14_cyto_2D_step04.3230.3230.1	1.341	0.2172	1406.0	1	4580.0%	1	K.AAVFNHFISDGVK.K
*	TK270802_E14_cyto_2D_step03.1487.1487.3	1.2917	0.0298	1463.86	5	1880.0%	1	K.NGISTKVMNIFLK.D
*	TK270802_E14_cyto_2D_step01.3682.3682.1	0.7383	0.2323	1572.24	45	1790.0%	1	R.VVIEDGVGDAVLTRK.V
*	TK270802_E14_cyto_2D_step07.1858.1858.1	1.0525	0.0328	703.2	108	4000.0%	1	K.KPEEAK.N
*	TK270802_E14_cyto_2D_step07.3414.3414.1	1.2814	0.1226	1531.82	7	4170.0%	1	K.DLNMDVSFHLPSR.S
UTRFL_MOUSE85.0%6261.1%707778668.6(P08071) Lactotransferrin precursor (Lactoferrin) 
*	TK270802_E14_cyto_2D_step06.1733.1733.1	1.7826	0.1189	889.83	6	5000.0%	5	R.SCHTGIGR.S
URS25_HUMAN84.8%2214.4%1251374210.1(P25111) 40S ribosomal protein S25 (P25111) 40S ribosomal protein S25 
	TK270802_E14_cyto_2D_step08.1705.1705.2	0.9012	0.1776	1144.71	3	3120.0%	1	K.HRAQVIYTR.N
	TK270802_E14_cyto_2D_step01.0219.0219.1	1.776	0.2142	1076.58	1	7500.0%	1	K.LNNLVLFDK.A
UQ9D51284.7%115.0%258301454.8(Q9D512) 4930528G08Rik protein 
	TK270802_E14_cyto_2D_step05.2683.2683.1	1.7541	0.2149	1501.87	2	4170.0%	1	R.HSNASQSLCEIVR.L
UPP1A_HUMAN84.6%4103.0%330375126.3(P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) (P08129) Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit (EC 3.1.3.16) (PP-1A) 
	TK270802_E14_cyto_2D_step04.1583.1583.2	1.0476	0.2762	1159.9	1	5560.0%	1	R.GNHECASINR.I
UPGM5_HUMAN84.0%226.9%506556137.2(Q15124) Phosphoglucomutase-like protein 5 (Phosphoglucomutase-related protein) (PGM-RP) (Aciculin) 
	TK270802_E14_cyto_2D_step06.3183.3183.2	1.9595	0.382	2155.5	1	3410.0%	1	K.AAGGIILTASHCPGGPGGEFGVK.F
*	TK270802_E14_cyto_2D_step14.2211.2211.2	0.5962	0.018	1286.02	166	1820.0%	1	K.GLLTGPSQLKIR.I
UGAT3_MOUSE84.0%114.1%443479689.4(P23772) Trans-acting T-cell specific transcription factor GATA-3 
*	TK270802_E14_cyto_2D_step12.2519.2519.2	1.9497	0.3845	1970.86	3	3530.0%	1	K.ALSSHHTASPWNLSPFSK.T
UO7514584.0%443.4%12671411436.1(O75145) Hypothetical protein KIAA0654 (Fragment) 
*	TK270802_E14_cyto_2D_step06.3118.3118.1	1.1399	0.0342	1571.94	1	4620.0%	1	K.AETLPEIEAQLAQR.V
*	TK270802_E14_cyto_2D_step05.0595.0595.1	0.642	0.1049	1443.37	12	1820.0%	1	R.QLAEWLDDAKQK.L
*	TK270802_E14_cyto_2D_step02.2074.2074.1	0.7751	0.0502	830.85	51	3570.0%	1	K.GRMGPPGR.D
*	TK270802_E14_cyto_2D_step03.2371.2371.1	2.0987	0.036	1088.99	1	7500.0%	1	K.LQDELLLNK.E
UQ9DD2183.8%226.6%303344927.3(Q9DD21) 0610006A11Rik protein 
	TK270802_E14_cyto_2D_step13.2665.2665.1	1.6879	0.2156	882.11	1	7500.0%	1	R.HISIHFK.S
	TK270802_E14_cyto_2D_step08.2334.2334.2	1.0593	0.2204	1569.81	33	2920.0%	1	R.ILHCLELASDIQR.L
UUBL5_MOUSE83.8%114.3%329376175.3(Q9WUP7) Ubiquitin carboxyl-terminal hydrolase isozyme L5 (EC 3.4.19.12) (UCH-L5) (Ubiquitin thiolesterase L5) (Ubiquitin C-terminal hydrolase UCH37) 
	TK270802_E14_cyto_2D_step04.3266.3266.2	2.4873	0.2102	1619.85	1	6540.0%	1	K.TLAEHQQLIPLVEK.A
UQ8TDG483.7%158913.5%11011241756.5(Q8TDG4) DNA helicase HEL308 
	TK270802_E14_cyto_2D_step13.3450.3450.2	0.7907	0.1839	2485.23	67	1300.0%	1	R.NRPSLGCIFGAPTAAELEPGDEGK.E
*	TK270802_E14_cyto_2D_step13.3298.3298.2	0.7966	0.0392	1846.7	9	2860.0%	1	K.NCENVAEMICKFLSK.E
*	TK270802_E14_cyto_2D_step09.3660.3660.2	0.9901	0.0014	3137.17	26	1350.0%	1	K.KMDPDHLVALVTEVIPNYSCLVFCPSK.K
*	TK270802_E14_cyto_2D_step07.4732.4732.2	2.1159	0.3106	2405.33	2	2620.0%	9	K.SLYIATIEKGHSLVNSLIETGR.I
*	TK270802_E14_cyto_2D_step01.4616.4616.3	1.4524	0.1128	4404.86	33	1070.0%	2	K.FNMPRGYIQNLLTGTASFSSCVLHFCEELEEFWVYR.A
*	TK270802_E14_cyto_2D_step15.4889.4889.2	0.9898	0.1023	2619.93	2	2290.0%	1	R.QFSQLSPAEQNVAAILGVSESFIGK.K
UQ9CZ0583.6%1111.9%118133257.9(Q9CZ05) 2810423G08Rik protein 
	TK270802_E14_cyto_2D_step03.2212.2212.1	1.5147	0.2426	1587.82	4	3850.0%	1	K.LHCSDNVDLEEAGK.E
UO3575383.6%4611.0%456502146.4(O35753) TIP49 protein (RUVB-like protein 1) 
	TK270802_E14_cyto_2D_step03.4018.4018.2	0.6145	0.0229	2730.79	16	1360.0%	1	R.QGRCDTYATEFDLEAEEYVPLPK.G
	TK270802_E14_cyto_2D_step06.3099.3099.1	1.5086	0.2401	1082.05	1	5000.0%	2	K.TISHVIIGLK.T
	TK270802_E14_cyto_2D_step12.2027.2027.2	0.9914	0.1368	1941.58	7	2190.0%	1	K.VPFCPMVGSEVYSTEIK.K
UQ9JID583.5%222.7%594689677.5(Q9JID5) Acetyltransferase Tubedown-1 
*	TK270802_E14_cyto_2D_step05.2299.2299.1	1.6584	0.2085	1107.14	1	6250.0%	1	R.LFHSVCESK.D
*	TK270802_E14_cyto_2D_step06.3399.3399.2	0.9303	0.0146	1919.22	12	2670.0%	1	R.LFHSVCESKDLPETVR.T
UQ9BQR683.4%2210.5%429487096.5(Q9BQR6) A20-binding inhibitor of NF-kappaB activation-2 
	TK270802_E14_cyto_2D_step09.3130.3130.2	1.9723	0.3766	2164.41	2	3240.0%	1	R.IQELEEKVASLLHQVSWR.Q
*	TK270802_E14_cyto_2D_step11.3247.3247.3	1.813	0.033	2874.78	70	1630.0%	1	R.DPGSGGWEEAPRAAAALCTLYHEAGQR.L
UQ9JJF482.9%2211.5%393428724.7(Q9JJF4) Brain cDNA, clone MNCb-5873, similar to AF151022 HSPC188 (Homo sapiens) 
	TK270802_E14_cyto_2D_step10.2718.2718.1	1.4826	0.2787	1492.76	5	3640.0%	1	R.ELHSWEPEPDVR.M
*	TK270802_E14_cyto_2D_step06.3585.3585.3	0.9252	0.0397	3577.44	140	550.0%	1	R.LVNALCTPSYNAAAPLHCLGPLLSNLSQQAEVR.A
UQ9QY3782.9%6612.0%9551064796.4(Q9QY37) Protein with characteristics of a rhoGAP 
*	TK270802_E14_cyto_2D_step08.1777.1777.3	0.9677	0.0232	1728.61	1	2670.0%	1	R.LELGTPPEALGPSRHR.R
*	TK270802_E14_cyto_2D_step15.3024.3024.2	0.7592	0.0154	1950.47	82	1560.0%	1	R.RPCLVPTSPEGHVEMDK.A
*	TK270802_E14_cyto_2D_step03.5074.5074.2	0.9821	0.0218	3172.98	1	2000.0%	1	K.ATLKALLEAVASEDGDILDSLQASPSTESLK.S
*	TK270802_E14_cyto_2D_step03.2752.2752.1	1.4804	0.2823	1524.77	2	3640.0%	1	R.DLLQELAEFMRR.R
*	TK270802_E14_cyto_2D_step15.2050.2050.2	1.0119	0.2379	2628.42	8	1600.0%	1	R.SALSTTTTTSATTTTTTTTVETGPHR.K
*	TK270802_E14_cyto_2D_step12.2383.2383.2	1.4612	0.1404	1664.99	1	5000.0%	1	K.SHPPHPRFQYNQR.L
UQ9JK3182.7%445.2%13061384884.8(Q9JK31) ATFa-associated factor 
*	TK270802_E14_cyto_2D_step08.2936.2936.1	0.9326	0.042	1248.79	23	2000.0%	1	K.ETPCMPNVAVK.N
*	TK270802_E14_cyto_2D_step05.4148.4148.2	1.2206	0.2228	1861.02	4	3440.0%	1	R.IVAENQTNKTVDSSINK.K
*	TK270802_E14_cyto_2D_step03.4307.4307.2	0.8032	0.0323	2681.51	49	1360.0%	1	R.YMDEEYEAEFQVKITAGGDINQK.L
	TK270802_E14_cyto_2D_step13.2342.2342.2	2.1587	0.3362	1814.75	2	4060.0%	1	R.LPPEAASTSLPQKPHLK.L
UQ9Y40582.7%2215.5%323347789.0(Q9Y405) Hypothetical protein (Fragment) 
*	TK270802_E14_cyto_2D_step10.3183.3183.3	1.4152	0.0493	2277.91	109	1900.0%	1	K.FTHGGTGSSQTAPTCGRESSPR.E
	TK270802_E14_cyto_2D_step01.4179.4179.2	2.4797	0.1961	2968.93	5	2590.0%	1	R.GLSLLCFGEGAQCVLTMAGGQVFLLEAK.Y
UQ9CY2682.7%355.0%298333665.5(Q9CY26) 2700085E05Rik protein 
	TK270802_E14_cyto_2D_step09.3148.3148.1	1.4301	0.1992	862.76	1	6670.0%	2	R.ALHFVFK.V
	TK270802_E14_cyto_2D_step08.3187.3187.1	1.1273	0.0723	1081.92	11	5000.0%	1	R.FQTVHFFR.D
UQ9CSU082.6%2217.1%269306235.6(Q9CSU0) 2610304G08Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step13.2881.2881.1	1.4826	0.2631	1259.07	1	5500.0%	1	K.HAGPIVSVWHR.E
	TK270802_E14_cyto_2D_step05.3909.3909.3	1.4856	0.0931	3999.43	1	1620.0%	1	K.RTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIK.A
UFRAP_MOUSE82.5%14168.7%25492887347.1(Q9JLN9) FKBP-rapamycin associated protein (FRAP) 
	TK270802_E14_cyto_2D_step12.3907.3907.2	0.8889	0.0796	2730.23	12	1960.0%	1	K.LLVVGITDPDPDIRYCVLASLDER.F
	TK270802_E14_cyto_2D_step13.2750.2750.3	1.331	0.2053	2321.69	7	1750.0%	1	R.YHPQALIYPLTVASKSTTTAR.H
	TK270802_E14_cyto_2D_step08.2572.2572.3	1.17	0.0715	2628.97	12	1980.0%	1	R.TDSYSAGQSVEILDGVELGEPAHKK.A
	TK270802_E14_cyto_2D_step10.3083.3083.2	0.8169	0.0808	2053.0	8	2500.0%	1	K.GYTLADEEEDPLIYQHR.M
	TK270802_E14_cyto_2D_step10.2550.2550.1	1.1059	0.1384	847.91	13	5000.0%	1	R.IIHPIVR.T
	TK270802_E14_cyto_2D_step15.2788.2788.2	0.781	0.0864	1552.86	1	2500.0%	1	K.VLQYYSAATEHDR.S
	TK270802_E14_cyto_2D_step03.2675.2675.1	0.6637	0.0087	773.36	69	3000.0%	1	K.DFAHKR.Q
	TK270802_E14_cyto_2D_step15.2480.2480.2	0.8343	0.0535	1933.03	9	2500.0%	1	R.KLTLMGSNGHEFVFLLK.G
	TK270802_E14_cyto_2D_step09.3130.3130.3	1.5165	0.0894	3246.12	1	1670.0%	1	R.LAAFRPSAFTDTQYLQDTMNHVLSCVKK.E
	TK270802_E14_cyto_2D_step07.2725.2725.3	1.465	0.1263	1752.01	38	2500.0%	1	K.HFGELEIQATWYEK.L
	TK270802_E14_cyto_2D_step15.4253.4253.3	1.3659	0.1642	3984.28	193	930.0%	2	R.SIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLR.D
	TK270802_E14_cyto_2D_step13.2536.2536.1	1.4675	0.2695	1282.79	1	3500.0%	1	K.KLHVSTINLQK.A
	TK270802_E14_cyto_2D_step08.1724.1724.1	0.55	0.053	516.63	18	5000.0%	1	R.VRDK.L
UKC2B_HUMAN82.5%4423.3%215249425.6(P13862) Casein kinase II beta chain (CK II) (Phosvitin) (G5a) (P13862) Casein kinase II beta chain (CK II) (Phosvitin) (G5a) 
	TK270802_E14_cyto_2D_step10.4671.4671.3	1.1136	0.0598	4276.82	37	860.0%	1	R.HHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPR.L
	TK270802_E14_cyto_2D_step10.2310.2310.2	2.364	0.3111	1086.24	1	8120.0%	1	K.RPANQFVPR.L
	TK270802_E14_cyto_2D_step05.3242.3242.2	2.2529	0.3083	1689.15	1	5380.0%	1	K.FNLTGLNEQVPHYR.Q
UQ9UFU882.4%61211.1%917994396.9(Q9UFU8) Hypothetical protein (Fragment) 
*	TK270802_E14_cyto_2D_step06.3393.3393.2	1.0776	0.0299	2258.7	35	1750.0%	1	K.AVDVLAKEIGLLADEIEIYGK.S
*	TK270802_E14_cyto_2D_step08.3390.3390.3	1.4677	0.0104	3862.42	19	1250.0%	1	K.DAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADK.I
*	TK270802_E14_cyto_2D_step12.3732.3732.2	2.1727	0.04	1538.64	6	4670.0%	3	K.MHGGGPSVTAGVPLKK.E
*	TK270802_E14_cyto_2D_step03.4014.4014.2	1.1393	0.0452	2806.64	7	2040.0%	1	R.MVVASDKSGQPVTADDLGVTGALTVLMK.D
UP2CA_MOUSE82.0%114.2%382424335.4(P49443) Protein phosphatase 2C alpha isoform (EC 3.1.3.16) (PP2C-alpha) (IA) (Protein phosphatase 1A) 
	TK270802_E14_cyto_2D_step13.2849.2849.2	1.8721	0.4557	1924.56	1	4000.0%	1	K.VHFFTQDHKPSNPLEK.E
UBAG1_MOUSE81.8%112.8%355397408.5(Q60739) BAG-family molecular chaperone regulator-1 (BCL-2 binding athanogene-1) (BAG-1) 
*	TK270802_E14_cyto_2D_step05.2318.2318.1	2.0455	0.111	1181.13	1	6670.0%	1	K.IANHLQELNK.E
UQ9Z33281.7%354.9%553593357.9(Q9Z332) Keratin 6 alpha 
	TK270802_E14_cyto_2D_step12.3037.3037.2	0.7685	0.0487	1885.34	34	2500.0%	1	R.QNLEPMFEQYISNLR.R
	TK270802_E14_cyto_2D_step01.3830.3830.1	1.8783	0.1861	1305.1	1	5450.0%	2	R.SLDLDSIIAEVK.A
USNX5_MOUSE81.7%225.0%404467976.6(Q9D8U8) Sorting nexin 5 
	TK270802_E14_cyto_2D_step05.2167.2167.1	1.5243	0.2271	968.19	1	6880.0%	1	R.LSSHPVLSK.D
	TK270802_E14_cyto_2D_step04.2698.2698.1	1.4878	0.192	1316.92	1	5000.0%	1	K.TVSTHEVFLQR.L
URL29_MOUSE81.2%6822.0%1591745611.8(P47915) 60S ribosomal protein L29 
*	TK270802_E14_cyto_2D_step10.2469.2469.2	0.6547	0.0308	1706.47	56	2000.0%	1	R.AEAIKALVKPQAIKPK.M
	TK270802_E14_cyto_2D_step05.3788.3788.1	0.8073	0.0482	1312.62	17	3000.0%	1	K.SKNHTTHNQSR.K
*	TK270802_E14_cyto_2D_step07.2688.2688.1	1.2097	0.0095	896.93	12	5710.0%	1	R.LAFIAHPK.L
*	TK270802_E14_cyto_2D_step13.2196.2196.2	2.2576	0.3248	1195.27	1	7000.0%	1	K.ALVKPQAIKPK.M
UAA27_MOUSE81.1%2233.2%199213365.1(P56873) Sjogren's syndrome/scleroderma autoantigen 1 homolog (Autoantigen p27 homolog) 
	TK270802_E14_cyto_2D_step14.3850.3850.3	1.5462	0.0285	3337.3	37	1470.0%	1	K.IYCVACQELDSDVDKDNPALNAQAALSQAR.E
	TK270802_E14_cyto_2D_step15.2145.2145.3	2.6327	0.494	3765.31	1	1640.0%	1	R.EHQLASSTEPASSSRPPSQPPVPRPEHCEGAAAGLK.A
US23A_MOUSE81.0%339.8%623704248.2(Q01405) Protein transport protein Sec23A (SEC23-related protein A) (Fragment) 
	TK270802_E14_cyto_2D_step05.2374.2374.1	1.5698	0.2054	957.97	1	6430.0%	1	K.HFEALANR.A
*	TK270802_E14_cyto_2D_step07.5061.5061.3	1.2831	0.1907	4032.51	88	1070.0%	1	K.ESMQTTFSLFPPTALVGLITFGRIVQVHELGCEHSK.S
*	TK270802_E14_cyto_2D_step11.2201.2201.2	0.8918	0.0563	1879.39	48	2500.0%	1	K.DIHGQFKMGFGGTLEIK.T
UMTAP_MOUSE80.3%51111.0%283310627.1(Q9CQ65) 5'-methylthioadenosine phosphorylase (EC 2.4.2.28) (MTA phosphorylase) (MTAPase) 
*	TK270802_E14_cyto_2D_step07.2740.2740.2	1.3215	0.2753	1986.46	7	3120.0%	3	R.TSLRPQTFYDGSHCSAR.G
	TK270802_E14_cyto_2D_step06.3103.3103.2	1.6768	0.125	1644.7	3	4230.0%	1	R.GVCHIPMAEPFCPK.T
*	TK270802_E14_cyto_2D_step11.3881.3881.3	1.0888	0.0067	3606.72	63	1170.0%	1	R.TSLRPQTFYDGSHCSARGVCHIPMAEPFCPK.T
US24C_HUMAN80.3%222.8%11251211126.5(P53992) Protein transport protein Sec24C (SEC24-related protein C) 
	TK270802_E14_cyto_2D_step15.2465.2465.2	0.7949	0.013	1708.91	6	2310.0%	1	K.AYMCPFMQFIEGGR.R
	TK270802_E14_cyto_2D_step15.3701.3701.2	1.9208	0.3718	1965.66	1	3820.0%	1	R.ETETVFVPVIQAGMEALK.A
UNUEM_HUMAN80.3%5522.3%377425109.8(Q16795) NADH-ubiquinone oxidoreductase 39 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-39KD) (CI-39KD) 
*	TK270802_E14_cyto_2D_step10.4828.4828.2	0.7121	0.1046	2231.97	9	1320.0%	1	K.VVRDAFPEAIIVKPSDIFGR.E
*	TK270802_E14_cyto_2D_step13.3226.3226.2	1.8281	0.1925	1396.03	10	5450.0%	1	K.FIHVSHLNANIK.S
*	TK270802_E14_cyto_2D_step11.3075.3075.3	1.0389	0.0246	3033.9	25	1670.0%	1	K.YDIMHLRPMGDLGQLLFLEWDARDK.D
*	TK270802_E14_cyto_2D_step07.3088.3088.3	1.6623	0.0202	2766.0	3	2020.0%	1	R.SSVSGIVATVFGATGFLGRYVVNHLGR.M
UMYG1_MOUSE80.1%339.2%380427237.0(Q9JK81) MYG1 protein (Gamm1 protein) 
*	TK270802_E14_cyto_2D_step15.1592.1592.1	0.3811	0.0087	707.0	1	2000.0%	1	K.GGCPWK.E
*	TK270802_E14_cyto_2D_step04.4314.4314.1	0.9558	0.0626	1324.84	239	2500.0%	1	K.RPRNNLMAPPR.I
*	TK270802_E14_cyto_2D_step04.3276.3276.2	1.8272	0.478	2102.44	2	2940.0%	1	R.TFTETMSSLCPGKPWQTK.L
UQ9CQR679.6%227.2%305351595.7(Q9CQR6) 2310003C10Rik protein (Similar to protein phosphatase 6, catalytic subunit) 
	TK270802_E14_cyto_2D_step04.2961.2961.1	1.7847	0.1869	1428.03	3	4550.0%	1	K.VTNEFVHINNLK.L
	TK270802_E14_cyto_2D_step09.2261.2261.1	1.3985	0.2183	1181.55	1	5560.0%	1	R.AHQLVHEGYK.F
UDSC2_MOUSE79.6%6813.7%902999615.0(P55292) Desmocollin 2A/2B precursor (Epithelial type 2 desmocollin) 
*	TK270802_E14_cyto_2D_step15.2958.2958.3	0.9572	0.1487	3972.39	11	660.0%	1	K.VYSTNGLTTQTMGASGQTAFTTMGTGVKSGGQETIEMVK.G
*	TK270802_E14_cyto_2D_step11.4582.4582.3	1.4827	0.0516	4622.21	4	1320.0%	1	R.RWAPIPCSMLENSLGPFPLFLQQIQSDTAQNYTIYYSIR.G
*	TK270802_E14_cyto_2D_step07.2702.2702.3	1.0359	0.0124	2828.34	62	1150.0%	1	R.LGLSSVTTLNVLVCDCITESDCTLR.S
*	TK270802_E14_cyto_2D_step04.2378.2378.1	2.0651	0.011	1377.86	3	6000.0%	2	R.ELIDKYQLLIK.V
*	TK270802_E14_cyto_2D_step03.2375.2375.1	1.0123	0.0576	1221.94	86	2780.0%	1	K.RPHTEKVLSR.A
UQ96SF979.6%241.1%696777356.4(Q96SF9) BA395N17.1 (Hypothetical protein KIAA0918) 
	TK270802_E14_cyto_2D_step05.2830.2830.1	2.0415	0.1235	1029.2	8	7140.0%	2	K.EWLENIPK.N
UQ9D9F579.5%112.9%279307854.9(Q9D9F5) 1700082G03Rik protein 
	TK270802_E14_cyto_2D_step05.3190.3190.1	1.6887	0.1942	1000.91	1	5710.0%	1	R.KLEWPLSK.V
UQ9EQC879.5%114.7%491523024.9(Q9EQC8) Papillary renal cell carcinoma-associated protein 
*	TK270802_E14_cyto_2D_step07.2982.2982.2	1.8732	0.3841	2242.12	1	2950.0%	1	K.TKPASLAPVLGTTTTTPSPSAIK.A
USEP2_MOUSE79.5%5522.4%361415266.5(P42208) Septin 2 (NEDD5 protein) 
	TK270802_E14_cyto_2D_step08.2662.2662.3	1.4372	0.0768	2062.48	2	3170.0%	1	R.DCFKTIISYIDEQFER.Y
	TK270802_E14_cyto_2D_step06.3441.3441.3	2.3286	0.411	2955.05	1	2000.0%	1	K.QQPTQFINPETPGYVGFANLPNQVHR.K
	TK270802_E14_cyto_2D_step07.3872.3872.2	1.886	0.3833	2865.89	1	3180.0%	1	R.TMLITHMQDLQEVTQDLHYENFR.S
	TK270802_E14_cyto_2D_step10.2513.2513.2	0.8707	0.0025	1754.75	334	1670.0%	1	R.LTVVDTPGYGDAINCR.D
UO7056579.5%41012.5%295329364.8(O70565) Cp27 protein 
	TK270802_E14_cyto_2D_step06.2826.2826.2	1.5134	0.3017	2065.27	2	2750.0%	3	R.EKPQALVTSPATPLPAGSGIK.R
	TK270802_E14_cyto_2D_step01.2188.2188.2	1.1504	0.0871	1775.36	1	4000.0%	1	K.VAEETEEISSNKPLVK.A
UPESC_MOUSE79.4%338.7%584677966.8(Q9EQ61) Pescadillo homolog 1 
*	TK270802_E14_cyto_2D_step03.5224.5224.2	0.6729	0.0056	2757.94	3	1400.0%	1	K.ISEDTYALDSESSMEKLAALSASLAR.V
	TK270802_E14_cyto_2D_step04.1375.1375.2	0.8116	0.0411	1327.01	62	2270.0%	1	K.GSTAARTFYLIK.D
*	TK270802_E14_cyto_2D_step01.2662.2662.1	1.9861	0.1424	1567.69	1	4580.0%	1	K.DIKFLLHEPIVNK.F
UQ9BYS379.2%73710.7%401442305.6(Q9BYS3) Rab interacting lysosomal protein 
	TK270802_E14_cyto_2D_step05.4348.4348.3	1.7131	0.0069	2941.42	31	1430.0%	6	R.EAAGSASAAELVYHLAGALGTELQDLARR.F
	TK270802_E14_cyto_2D_step08.1696.1696.3	1.6223	0.1208	1572.79	51	1920.0%	1	K.LAAMQTQLRAAQDR.E
UQ8QZV779.2%354.1%732827506.9(Q8QZV7) Similar to hypothetical protein FLJ10637 
	TK270802_E14_cyto_2D_step01.3011.3011.1	1.2518	0.0136	1175.65	35	4380.0%	2	R.IMYDIFPFK.K
	TK270802_E14_cyto_2D_step14.2683.2683.2	0.7861	0.1097	2309.11	10	1000.0%	1	R.SILEDPPSISEGCGGRVTDYR.I
UQ9H1H979.1%333.4%18052022585.6(Q9H1H9) Kinesin-like protein RBKIN1 
	TK270802_E14_cyto_2D_step08.4089.4089.3	1.2428	0.0145	4106.06	9	1220.0%	1	R.SPTTSSITSGYFSHSASNATLSDMVVPSSDSSDQLAIQTK.D
	TK270802_E14_cyto_2D_step01.4922.4922.1	1.0315	0.0174	972.87	5	4380.0%	1	R.QPQSSGPDR.L
	TK270802_E14_cyto_2D_step06.1910.1910.1	1.4638	0.2544	1396.84	2	2920.0%	1	K.RGAIVSEPAIQVR.R
UTRL3_HUMAN78.8%336.0%10171166816.1(Q9HCF6) Long transient receptor potential channel 3 (LTrpC3) (Fragment) 
*	TK270802_E14_cyto_2D_step13.1990.1990.1	1.6287	0.1936	998.85	2	5710.0%	1	-.QELNHNSR.D
*	TK270802_E14_cyto_2D_step09.3282.3282.2	0.843	0.1707	2274.46	3	1050.0%	1	R.LLDIFGVNKYLGPYVMMIGK.M
*	TK270802_E14_cyto_2D_step07.4858.4858.3	1.279	0.0329	4127.96	25	860.0%	1	R.YQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCR.W
UARS1_MOUSE78.4%242.6%348388234.9(O54984) Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) 
	TK270802_E14_cyto_2D_step08.2974.2974.1	1.6172	0.1919	1074.91	1	5620.0%	2	K.LPLLPHEVR.G
UTLR7_HUMAN78.3%449.0%10491209228.2(Q9NYK1) Toll-like receptor 7 precursor 
*	TK270802_E14_cyto_2D_step12.3013.3013.3	1.1676	0.0902	3454.22	94	1160.0%	1	K.EIGDAKFLHFLPSLIQLDLSFNFELQVYR.A
*	TK270802_E14_cyto_2D_step06.3295.3295.3	1.2361	0.0867	4182.23	2	1180.0%	1	K.IQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCK.N
*	TK270802_E14_cyto_2D_step07.2181.2181.1	1.8656	0.1768	755.16	1	8000.0%	1	R.LQIKPR.S
*	TK270802_E14_cyto_2D_step03.4919.4919.2	0.9645	0.2312	2921.84	102	1090.0%	1	R.LCGSSVLEWPTNPQAHPYFWQCLK.N
UIF4H_MOUSE78.3%2213.3%248273417.2(Q9WUK2) Eukaryotic translation initiation factor 4H (eIF-4H) (Williams-Beuren syndrome chromosome region 1 protein homolog) 
	TK270802_E14_cyto_2D_step07.2181.2181.1	1.8656	0.1768	755.16	1	8000.0%	1	R.LQLKPR.T
	TK270802_E14_cyto_2D_step12.4280.4280.2	0.9483	0.0256	3084.31	9	1540.0%	1	K.GFCYVEFDEVDSLKEALTYDGALLGDR.S
UQ8R3Y878.3%2220.4%289302037.4(Q8R3Y8) Hypothetical 30.2 kDa protein 
	TK270802_E14_cyto_2D_step04.3917.3917.3	1.3562	0.0042	3859.1	5	1280.0%	1	R.LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCR.E
*	TK270802_E14_cyto_2D_step04.1653.1653.2	2.1558	0.3214	1792.65	1	4440.0%	1	R.AGGASPAASSTTQPPAQHR.L
UTPMT_MOUSE78.1%2211.2%240275866.4(O55060) Thiopurine S-methyltransferase (EC 2.1.1.67) (Thiopurine methyltransferase) 
*	TK270802_E14_cyto_2D_step07.3145.3145.1	1.431	0.302	1514.1	1	4230.0%	1	K.HAGPPFYVPSAELK.R
*	TK270802_E14_cyto_2D_step11.2479.2479.2	0.7594	0.0271	1472.18	227	2500.0%	1	K.HLDTFLKGQSGLR.V
UIDE_MOUSE78.0%4410.2%10191177726.5(Q9JHR7) Insulin-degrading enzyme (EC 3.4.24.56) (Insulysin) (Insulinase) (Insulin protease) 
*	TK270802_E14_cyto_2D_step11.4099.4099.3	1.1475	0.0708	4444.6	98	970.0%	1	K.LHYYPLNGVLTAEYLLEEFRPDLIDMVLDKLRPENVR.V
	TK270802_E14_cyto_2D_step08.2992.2992.2	2.1378	0.3146	1847.23	1	6430.0%	1	R.FIIQSEKPPHYLESR.V
*	TK270802_E14_cyto_2D_step13.3620.3620.3	1.618	0.1645	4766.86	4	1070.0%	1	R.LHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLLPSQLVR.Y
	TK270802_E14_cyto_2D_step13.0276.0276.2	0.5802	0.0675	2487.08	321	950.0%	1	K.AFIPQLLSRLHIEALLHGNITK.Q
UP9729377.8%114.6%347392967.4(P97293) MAP kinase kinase 3B (Mitogen activated protein kinase kinase 3) 
*	TK270802_E14_cyto_2D_step08.2136.2136.2	1.9871	0.3371	1737.52	1	4000.0%	1	R.ISCVSKPPVSNPTPPR.N
USPCN_HUMAN77.6%792.3%24722842815.3(Q13813) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain) 
	TK270802_E14_cyto_2D_step04.0661.0661.1	0.7116	0.031	1343.9	5	2730.0%	1	R.WSQLLANSAARK.K
	TK270802_E14_cyto_2D_step09.2786.2786.1	1.2527	0.2377	849.07	12	6000.0%	2	R.LHQFFR.D
*	TK270802_E14_cyto_2D_step01.2058.2058.1	1.1475	0.0265	1249.83	194	3500.0%	1	K.GEIDAHEDSFK.S
*	TK270802_E14_cyto_2D_step13.2929.2929.3	1.1328	0.0292	2240.35	15	1380.0%	1	K.EPIVGSTDYGKDEDSAEALLK.K
	TK270802_E14_cyto_2D_step14.1801.1801.1	0.6413	0.0268	832.18	45	2500.0%	1	K.RDTINGR.F
*	TK270802_E14_cyto_2D_step03.5027.5027.1	0.9192	0.0568	1167.19	33	3000.0%	1	K.EPIVGSTDYGK.D
UQ9CTD477.4%113.5%259301634.7(Q9CTD4) 6030455P07Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step06.2319.2319.1	1.592	0.1986	1110.91	1	5620.0%	1	R.AWIAHTQQR.H
UBAG3_MOUSE77.2%112.1%577618287.5(Q9JLV1) BAG-family molecular chaperone regulator-3 (BCL-2 binding athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) 
*	TK270802_E14_cyto_2D_step06.2190.2190.1	1.5848	0.1987	1308.09	5	4550.0%	1	R.SGTPVHCPSPIR.V
UQ9Z2E577.1%1110.7%1491656910.2(Q9Z2E5) Transcription factor MATH5 
*	TK270802_E14_cyto_2D_step13.1992.1992.2	1.9183	0.3555	1884.5	2	3000.0%	1	K.YETLQMALSYIIALTR.I
UQ9CRI077.0%3315.8%139160025.7(Q9CRI0) ES cells cDNA, RIKEN full-length enriched library, clone:2410013L13, full insert sequence (Fragment) 
	TK270802_E14_cyto_2D_step04.3013.3013.1	1.3204	0.0389	1170.95	1	5000.0%	1	K.EDTEEYNLR.D
	TK270802_E14_cyto_2D_step05.2327.2327.2	1.9052	0.3594	1382.46	2	5830.0%	1	R.EDSVKPGAHLTVK.K
UENOG_MOUSE77.0%131096.9%433471655.1(P17183) Gamma enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Neural enolase) (NSE) (Enolase 2) 
	TK270802_E14_cyto_2D_step07.4080.4080.3	2.644	0.1972	3029.37	2	1980.0%	3	R.HIAQLAGNSDLILPVPAFNVINGGSHAGNK.L
UQ9EPK676.9%73710.5%465524035.2(Q9EPK6) Sil1 protein precursor 
*	TK270802_E14_cyto_2D_step10.3389.3389.2	2.3387	0.2041	1621.38	1	5710.0%	6	K.LLVILATNQPLPAKK.K
*	TK270802_E14_cyto_2D_step13.4556.4556.3	0.9206	0.0673	4005.81	143	530.0%	1	K.LQQYRQVQLLPGLQEQGWCEITAQLLALPEHDAR.E
UTIE2_HUMAN76.7%308424.1%11241258116.9(Q02763) Angiopoietin 1 receptor precursor (EC 2.7.1.112) (Tyrosine-protein kinase receptor TIE-2) (Tyrosine-protein kinase receptor TEK) (P140 TEK) (Tunica interna endothelial cell kinase) (CD202b antigen) 
*	TK270802_E14_cyto_2D_step10.3161.3161.3	1.2922	0.0056	2113.92	5	2650.0%	1	K.GLQCNEACHPGFYGPDCK.L
*	TK270802_E14_cyto_2D_step11.3967.3967.3	1.9213	0.0803	3034.15	65	1300.0%	29	K.MLLIAILGSAGMTCLTVLLAFLIILQLK.R
UQ8TE0076.7%2213.4%404440227.8(Q8TE00) DERP13 (Dermal papilla derived protein 13) 
	TK270802_E14_cyto_2D_step06.3627.3627.2	0.9279	0.2787	2729.26	5	1600.0%	1	K.ILDLTRVLAGPFATMNLGDLGAEVIK.V
	TK270802_E14_cyto_2D_step15.4495.4495.3	2.6247	0.3572	3109.96	1	2220.0%	1	K.GLFIDCNLLSSQVACLSHIAANYLIGQK.E
UQ8TEC476.6%243.4%235265776.6(Q8TEC4) Hypothetical protein FLJ23656 
*	TK270802_E14_cyto_2D_step01.2338.2338.1	1.4548	0.247	898.15	3	5710.0%	2	R.KDDGVAHR.D
UQ9DCH576.5%118.2%196220486.5(Q9DCH5) 0610037L13Rik protein (RIKEN cDNA 0610037L13 gene) 
*	TK270802_E14_cyto_2D_step04.3734.3734.2	2.005	0.3289	1821.56	1	4330.0%	1	K.AQESVGIFEVTHQFVK.C
UCOPB_MOUSE76.5%336.1%9531070666.0(Q9JIF7) Coatomer beta subunit (Beta-coat protein) (Beta-COP) 
	TK270802_E14_cyto_2D_step10.3023.3023.2	1.0421	0.0623	2542.8	34	1740.0%	1	R.GFLLDGDFFVAASLATTLTKIALR.Y
	TK270802_E14_cyto_2D_step03.3332.3332.2	1.4995	0.0259	1785.02	3	3570.0%	1	K.DLQHPNEFIRGSTLR.F
	TK270802_E14_cyto_2D_step10.3281.3281.2	1.9636	0.3338	2093.52	1	3330.0%	1	K.LVEKPSPLTLAPHDFANIK.A
UDHA1_MOUSE76.4%7726.6%500543197.8(P24549) Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Aldehyde dehydrogenase, cytosolic) (ALDH class 1) (ALHDII) (ALDH-E1) 
	TK270802_E14_cyto_2D_step05.2651.2651.1	1.2591	0.1507	972.99	85	4380.0%	1	K.RVTLELGGK.S
*	TK270802_E14_cyto_2D_step01.3048.3048.1	0.9339	0.0243	1544.86	27	3210.0%	1	R.ANNTTYGLAAGLFTK.D
*	TK270802_E14_cyto_2D_step07.4800.4800.3	0.8656	0.0609	3951.79	125	740.0%	1	K.SPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASR.I
*	TK270802_E14_cyto_2D_step07.3142.3142.2	1.9003	0.3455	2155.9	1	3950.0%	1	K.KYVLGNPLTPGINQGPQIDK.E
	TK270802_E14_cyto_2D_step07.1721.1721.1	0.6937	0.165	845.83	6	3570.0%	1	K.ADVDKAVK.A
*	TK270802_E14_cyto_2D_step08.4046.4046.3	1.9284	0.0755	4133.84	9	1400.0%	1	K.EAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGK.L
*	TK270802_E14_cyto_2D_step08.2611.2611.2	1.1074	0.101	2014.29	3	2220.0%	1	R.ANNTTYGLAAGLFTKDLDK.A
UQ9D1G176.4%227.5%201221875.7(Q9D1G1) 1110011F09Rik protein (RIKEN cDNA 1110011F09 gene) 
	TK270802_E14_cyto_2D_step06.2145.2145.2	1.9076	0.3555	1443.45	1	5000.0%	1	R.MGPGAASGGERPNLK.I
UQ9UNJ276.4%664.0%25482927058.8(Q9UNJ2) Myosin-IXa 
	TK270802_E14_cyto_2D_step08.2787.2787.2	1.889	0.341	1955.83	1	3750.0%	1	K.NTDHMRPDIVALLRSSK.N
	TK270802_E14_cyto_2D_step07.4936.4936.3	1.1528	0.0332	3896.31	2	1640.0%	1	R.ASDDETLESEASIGTADSSENLNMESEYAISEKSER.S
	TK270802_E14_cyto_2D_step02.0008.0008.2	0.6996	0.0177	2503.87	146	1430.0%	1	K.TVDPDCTSNQQLALFGNNEFMV.-
	TK270802_E14_cyto_2D_step14.2303.2303.2	0.8087	0.0749	1507.89	22	1920.0%	1	K.GSPCQSSTVKELSK.T
	TK270802_E14_cyto_2D_step12.1949.1949.1	0.4958	0.111	1216.76	21	1110.0%	1	R.AFFRAMVAFR.E
	TK270802_E14_cyto_2D_step14.1869.1869.3	1.3898	0.0524	1909.99	89	2330.0%	1	R.EKNTDHMRPDIVALLR.S
UPSA7_MOUSE75.9%355.6%248278558.5(Q9Z2U0) Proteasome subunit alpha type 7 (EC 3.4.25.1) (Proteasome subunit RC6-1) 
	TK270802_E14_cyto_2D_step06.1509.1509.1	0.6003	0.013	664.79	1	5000.0%	1	R.EFLEK.N
	TK270802_E14_cyto_2D_step05.1881.1881.1	1.4539	0.2594	875.07	5	5620.0%	2	K.KGSTAVGVR.G
UUBCN_HUMAN75.4%1118.4%152171386.6(Q16781) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19) (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (UBC13) 
*	TK270802_E14_cyto_2D_step02.4238.4238.2	1.9823	0.3273	3020.8	1	2590.0%	1	R.TVLLSIQALLSAPNPDDPLANDVAEQWK.T
UQ9D85275.4%3310.9%459487109.6(Q9D852) 2010300C02Rik protein 
*	TK270802_E14_cyto_2D_step15.2417.2417.3	0.9573	0.0111	2614.37	17	1300.0%	1	K.AVVPPARPRPTQAATSGGPERTALGR.K
*	TK270802_E14_cyto_2D_step01.3207.3207.1	0.8634	0.0622	1357.14	31	2920.0%	1	R.LPEYSAHVPAGGR.A
*	TK270802_E14_cyto_2D_step12.2887.2887.2	1.9911	0.3302	1245.87	1	5000.0%	1	R.LIPVILPPEPR.K
UQ91W4875.3%337.4%511572306.2(Q91W48) Archain 1 
*	TK270802_E14_cyto_2D_step12.3649.3649.2	0.9969	0.0037	2727.0	8	1880.0%	1	K.SGSLEFSIPGQPNDFFPVQVSFISK.K
	TK270802_E14_cyto_2D_step04.2116.2116.1	1.7216	0.1253	1336.01	1	4550.0%	1	K.GVQLQTHPNVDK.K
	TK270802_E14_cyto_2D_step09.2233.2233.2	2.1273	0.3113	1464.8	1	5420.0%	1	K.KGVQLQTHPNVDK.K
UFUS_MOUSE75.3%244.6%518526739.4(P56959) RNA-binding protein FUS (Pigpen protein) 
	TK270802_E14_cyto_2D_step09.2170.2170.2	1.4354	0.2473	2254.27	1	3260.0%	2	K.APKPDGPGGGPGGSHMGGNYGDDR.R
UTES_MOUSE75.2%61215.1%423479838.3(P47226) Testin (TES1/TES2) 
	TK270802_E14_cyto_2D_step08.4931.4931.2	0.7914	0.0134	2603.24	60	1820.0%	1	K.KNVSINTVTYEWAPPVQNQALAR.Q
*	TK270802_E14_cyto_2D_step06.1418.1418.1	1.1925	0.3547	851.91	1	4380.0%	3	R.HAPAAVASK.D
	TK270802_E14_cyto_2D_step13.2818.2818.1	0.9333	0.1636	1391.93	281	2920.0%	1	K.QPVAGSEGAQYRK.K
	TK270802_E14_cyto_2D_step07.2366.2366.2	1.9455	0.3322	2206.79	3	3330.0%	1	K.NHAVVCQGCHNAIDPEVQR.V
UQ922F675.2%354.1%491569405.1(Q922F6) Unknown (Protein for IMAGE:3584589) (Fragment) 
*	TK270802_E14_cyto_2D_step05.2231.2231.1	1.7962	0.1647	1012.47	2	6430.0%	2	K.EKFEGLCK.V
*	TK270802_E14_cyto_2D_step05.3769.3769.1	0.5469	0.0442	1395.24	1	1820.0%	1	K.EGLKLDESEDEK.K
UO9503675.1%114.9%2472903710.7(O95036) WUGSC:H_RG054D04.1 protein 
*	TK270802_E14_cyto_2D_step05.2558.2558.1	2.0248	0.0135	1320.91	1	5910.0%	1	R.KAGNYFVPAEPK.L
UDYLL_HUMAN75.0%247.9%89105356.9(Q9Y3P0) Putative dynein light chain protein DJ8B22.1 
*	TK270802_E14_cyto_2D_step03.2199.2199.1	1.5953	0.1902	769.7	3	7500.0%	2	K.DIAAHLK.K
UQ1456875.0%111219.0%312356744.6(Q14568) Heat shock protein 86 (Fragment) 
*	TK270802_E14_cyto_2D_step06.4159.4159.3	2.4592	0.1816	2946.79	1	1850.0%	11	K.QDQTLTIVDTGIGMTKADLINNLGTIAK.S
UGELS_MOUSE75.0%449.9%730807465.8(P13020) Gelsolin (Actin-depolymerizing factor) (ADF) (Brevin) 
	TK270802_E14_cyto_2D_step05.2357.2357.1	1.4949	0.2218	1275.83	1	5500.0%	1	K.HVVPNEVVVQR.L
*	TK270802_E14_cyto_2D_step08.3275.3275.2	0.789	0.0259	2307.4	28	1580.0%	1	R.AVQHREVQGFESSTFSGYFK.S
*	TK270802_E14_cyto_2D_step04.4228.4228.3	1.6015	0.0898	2799.41	1	2080.0%	1	K.NWRDPDQTDGPGLGYLSSHIANVER.V
*	TK270802_E14_cyto_2D_step05.1448.1448.3	1.0704	0.096	1529.74	259	1170.0%	1	K.GGTSRDGGQTAPASIR.L
UQ9Y2S574.7%113.9%337386096.4(Q9Y2S5) HSPC015 
	TK270802_E14_cyto_2D_step10.3317.3317.2	2.3284	0.2047	1523.52	5	5420.0%	1	R.NILHQGQEAILQR.Y
UQ9CXI574.7%119.5%179203748.1(Q9CXI5) 3230402M22Rik protein 
	TK270802_E14_cyto_2D_step13.2673.2673.2	2.349	0.2039	1926.92	1	4690.0%	1	K.IINEVSKPLAHHIPVEK.I
UAP19_MOUSE74.6%41020.7%111121629.1(P56212) cAMP-regulated phosphoprotein 19 (ARPP-19) 
	TK270802_E14_cyto_2D_step13.2781.2781.2	1.8384	0.3541	1673.42	1	5000.0%	1	R.YPHLGQKPGGSDFLR.K
	TK270802_E14_cyto_2D_step06.2041.2041.1	1.411	0.0791	830.01	1	4290.0%	3	R.KPSLVASK.L
UQ9CUQ574.6%224.7%342387319.5(Q9CUQ5) C330027G06Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step10.2481.2481.1	1.4368	0.2749	787.14	1	6670.0%	1	R.KPGIFPK.T
*	TK270802_E14_cyto_2D_step05.2639.2639.1	0.9837	0.0662	1141.94	2	3750.0%	1	K.NVTHSWIER.V
UQ99N4274.5%111.7%471493367.0(Q99N42) Thymidine phosphorylase 
*	TK270802_E14_cyto_2D_step04.1986.1986.1	1.4541	0.2344	991.92	1	6430.0%	1	R.RQLLPHAR.E
UO1463774.3%81012.6%14861624966.6(O14637) Laminin alpha 3b chain (Fragment) 
*	TK270802_E14_cyto_2D_step14.2533.2533.3	0.9949	0.0658	3865.94	14	1090.0%	2	R.VNLTLDLGQLFHVAYILIKFANSPRPELWVLER.S
*	TK270802_E14_cyto_2D_step13.1994.1994.3	1.0982	0.0245	3264.03	1	1550.0%	1	R.IVPLENGEVVVSLINGRPGAKNFTFSHTLR.G
*	TK270802_E14_cyto_2D_step06.3790.3790.2	2.1179	0.3028	1829.07	3	3670.0%	1	R.VLVVPAENYDSQILHK.K
*	TK270802_E14_cyto_2D_step14.1897.1897.3	1.2048	0.0461	1895.5	51	2060.0%	1	R.DGTEPGVCDPGTGACLCK.E
*	TK270802_E14_cyto_2D_step05.2777.2777.2	1.0712	0.0395	2677.73	4	2170.0%	1	R.AQLHPTYFNLAEAEDLATATCGER.G
*	TK270802_E14_cyto_2D_step06.4871.4871.2	0.9255	0.033	3022.85	20	1480.0%	1	K.EPAFVTLPGNGFADPFSITPGMWVACIK.A
*	TK270802_E14_cyto_2D_step08.3166.3166.3	0.9891	0.0237	4214.66	13	1150.0%	1	R.AGSFHASFCPHVLGCRDQVIAEQIEFDISEPEVAATVK.V
UZN75_HUMAN74.3%118.7%289336849.6(P51815) Zinc finger protein 75 
*	TK270802_E14_cyto_2D_step07.3418.3418.2	1.9201	0.3356	2665.91	1	2920.0%	1	K.NDTGNDHPISVSTSEIQTSGCEVSK.K
UQ9CR7074.0%118.1%148158248.1(Q9CR70) 1110049G11Rik protein 
*	TK270802_E14_cyto_2D_step06.2251.2251.1	1.6669	0.1766	1176.78	4	5000.0%	1	K.AVIPSGAHPVAR.A
UQ9DC9974.0%114.4%272302798.2(Q9DC99) 0710007A14Rik protein 
	TK270802_E14_cyto_2D_step07.2802.2802.2	2.3651	0.1636	1425.89	1	6360.0%	1	K.FAAQNLHQNLIR.K
UQ9JHJ374.0%486.7%404438046.1(Q9JHJ3) Kidney predominant protein (RIKEN cDNA 0610031J06 gene) 
*	TK270802_E14_cyto_2D_step06.4804.4804.2	2.3533	0.171	2881.93	2	2500.0%	2	R.LLEFDSTNASEGAQPPGKPYPPYSLAK.F
UQ6162773.7%467.6%10091122446.7(Q61627) Glutamate receptor delta-1 subunit precursor 
*	TK270802_E14_cyto_2D_step06.3453.3453.2	1.3592	0.1554	2188.78	9	2630.0%	1	R.ADSIIHIGAIFEENAAKDDR.V
*	TK270802_E14_cyto_2D_step06.3922.3922.2	2.3107	0.0419	2624.7	1	3180.0%	2	K.DDRVFQLAVSDLSLNDDILQSEK.I
	TK270802_E14_cyto_2D_step12.4901.4901.3	1.1477	0.0020	4344.88	4	1390.0%	1	R.ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRK.L
UQ9D6U573.7%2218.5%173197596.2(Q9D6U5) 2310057C03Rik protein 
	TK270802_E14_cyto_2D_step05.2701.2701.1	1.84	0.1402	995.93	2	6430.0%	1	K.NIHLNLDR.R
	TK270802_E14_cyto_2D_step11.4057.4057.2	1.0723	0.1776	2742.67	1	2390.0%	1	R.SVEGWILFVTGVHEEATEEDIHDK.F
UQ8WYI373.7%393.1%2232614410.1(Q8WYI3) MSTP023 
	TK270802_E14_cyto_2D_step07.2392.2392.1	1.3179	0.0241	916.12	6	6670.0%	3	K.QYALYKK.M
UK2C8_MOUSE73.6%242.5%488543185.6(P11679) Keratin, type II cytoskeletal 8 (Cytokeratin 8) (Cytokeratin endo A) 
	TK270802_E14_cyto_2D_step01.3192.3192.1	1.4323	0.0824	1386.17	12	4090.0%	2	K.SLNNKFASFIDK.V
UQ9CQC673.6%116.2%419480435.9(Q9CQC6) 1200015E15Rik protein (KIAA0005 gene product) 
	TK270802_E14_cyto_2D_step01.4622.4622.2	1.775	0.3798	2901.29	1	2800.0%	1	R.FDPTQFQDCIIQGLTETGTDLEAVAK.F
UCBP_MOUSE73.2%352.0%24412654718.4(P45481) CREB-binding protein 
*	TK270802_E14_cyto_2D_step13.4494.4494.3	1.2227	0.1462	4574.19	16	1070.0%	1	R.VPTPSTVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESK.G
	TK270802_E14_cyto_2D_step06.2854.2854.1	1.2288	0.0623	860.24	5	5830.0%	2	K.QLSELLR.G
UQ6060373.2%463.7%9891113147.5(Q60603) Potassium channel subunit 
*	TK270802_E14_cyto_2D_step01.2895.2895.1	1.0388	0.0465	1269.17	8	3640.0%	1	K.LHAPGSECLGPK.A
	TK270802_E14_cyto_2D_step06.2854.2854.1	1.2288	0.0623	860.24	5	5830.0%	2	K.QLSEILR.I
	TK270802_E14_cyto_2D_step10.2838.2838.2	1.2358	0.2085	1932.58	10	2940.0%	1	R.GVLQQLAPSVQKGENVHK.H
UQ9D0V473.1%245.7%157177895.2(Q9D0V4) 2700047N05Rik protein 
	TK270802_E14_cyto_2D_step07.2300.2300.1	1.7237	0.1631	880.61	1	5620.0%	2	R.HVALAVGGR.E
UQ9CRS272.7%4417.6%586664786.4(Q9CRS2) 4432404J10Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step06.5012.5012.3	0.9148	0.0701	4381.21	25	590.0%	1	K.VQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIK.A
*	TK270802_E14_cyto_2D_step10.2729.2729.3	2.5907	0.3995	2976.35	1	1920.0%	1	R.RPGNEELPPAAATGATSLVAAPHSSSSSPSK.D
	TK270802_E14_cyto_2D_step14.3730.3730.2	0.6936	0.0406	2178.87	9	2220.0%	1	R.SSDIVSSVRRPMSDPSWNR.R
	TK270802_E14_cyto_2D_step12.1993.1993.2	0.6528	0.0089	1500.22	70	1150.0%	1	R.LSAQAQVAEDILDK.Y
UELV1_MOUSE72.6%3310.4%326360699.2(P70372) ELAV-like protein 1 (Hu-antigen R) (HuR) (Elav-like generic protein) (MelG) 
	TK270802_E14_cyto_2D_step13.1838.1838.2	2.251	0.2658	1234.86	1	6000.0%	1	R.FGGPVHHQAQR.F
	TK270802_E14_cyto_2D_step03.2527.2527.3	1.5375	0.0204	2539.89	20	1930.0%	1	K.VSYARPSSEVIKDANLYISGLPR.T
UGDIR_MOUSE72.5%3310.3%204234075.2(Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) (GDI-1) 
	TK270802_E14_cyto_2D_step06.2557.2557.1	1.612	0.1713	850.34	1	6670.0%	1	K.KQSFVLK.E
	TK270802_E14_cyto_2D_step05.1995.1995.1	1.5523	0.0374	982.89	3	6670.0%	1	K.YIQHTYR.K
	TK270802_E14_cyto_2D_step01.1912.1912.1	1.1768	0.0512	763.98	6	5830.0%	1	R.EIVSGMK.Y
UQ8VEJ472.5%112.5%485531487.2(Q8VEJ4) Hypothetical 53.1 kDa protein 
	TK270802_E14_cyto_2D_step03.3386.3386.1	1.6114	0.173	1228.62	1	5450.0%	1	K.YLASGSGDTTVR.F
UQ9Y63272.5%112.2%12461321156.9(Q9Y632) APC2 protein (Fragment) 
	TK270802_E14_cyto_2D_step01.3279.3279.2	1.9489	0.3192	2702.66	2	1730.0%	1	K.FQPPTLGPEPAARTPEGSPVHGSGPSK.D
UCSN2_HUMAN72.5%4614.2%443515975.5(Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15) (Q15647) COP9 signalosome complex subunit 2 (Signalosome subunit 2) (SGN2) (Thyroid receptor interacting protein 15) (TRIP15) 
	TK270802_E14_cyto_2D_step03.4112.4112.2	1.1492	0.0362	2018.4	7	2810.0%	1	R.QLHQSCQTDDGEDDLKK.G
	TK270802_E14_cyto_2D_step04.4401.4401.3	1.3278	0.0197	3774.13	62	1330.0%	1	R.IHIPFISKELNIDVADVESLLVQCILDNTIHGR.I
	TK270802_E14_cyto_2D_step10.3433.3433.2	1.967	0.3188	1406.55	1	5000.0%	2	K.SAIPHPLIMGVIR.E
UQ9D81972.5%224.5%289326675.6(Q9D819) 2010317E03Rik protein (RIKEN cDNA 2010317E03 gene) 
*	TK270802_E14_cyto_2D_step04.2276.2276.1	1.4335	0.2823	937.56	1	5830.0%	1	K.STHDYWK.A
*	TK270802_E14_cyto_2D_step08.2366.2366.1	1.4389	0.1121	874.53	5	6000.0%	1	K.WFHQQK.N
UQ9BUR472.5%243.3%548593094.6(Q9BUR4) Hypothetical protein 
	TK270802_E14_cyto_2D_step05.4328.4328.2	2.2877	0.2533	2006.81	1	4120.0%	2	K.WAPDGSCILTNSADNILR.I
UTGR2_MOUSE72.4%8389.8%592671226.3(Q62312) TGF-beta receptor type II precursor (EC 2.7.1.37) (TGFR-2) (TGF-beta type II receptor) 
*	TK270802_E14_cyto_2D_step11.4103.4103.2	1.7715	0.3616	2915.04	1	2610.0%	6	K.QNTSEQFETVAVKIFPYEEYSSWK.T
*	TK270802_E14_cyto_2D_step07.2832.2832.2	0.7717	0.0903	1660.27	21	2690.0%	1	R.QQKLSPSWESSKPR.K
*	TK270802_E14_cyto_2D_step09.4647.4647.2	0.6378	0.0090	2388.37	36	1050.0%	1	R.YMAPEVLESRMNLENVESFK.Q
UQ9Z1R172.2%685.5%21572290729.4(Q9Z1R1) BAT2 
	TK270802_E14_cyto_2D_step13.2626.2626.2	1.9233	0.2683	1322.74	5	5000.0%	1	R.RMPPPANLPSLK.A
	TK270802_E14_cyto_2D_step15.4173.4173.2	0.9218	0.0248	2939.84	6	2080.0%	1	K.EFDQLDQENDDGWAGAHEEVDYTEK.L
*	TK270802_E14_cyto_2D_step09.2172.2172.2	2.1407	0.2928	1734.84	1	4380.0%	1	K.RPPTAPENTPSVPSGVK.S
	TK270802_E14_cyto_2D_step13.3213.3213.2	1.5508	0.1865	2348.45	16	1900.0%	1	R.LDQVIHSNPAGIQQALAQLSSR.Q
*	TK270802_E14_cyto_2D_step10.4119.4119.3	1.6256	0.0155	4625.99	5	1190.0%	2	K.TAWTENARPSETEPAPPTPKPPPPPPHRGPVGNWGPPGDYPDR.G
UQ96L9172.2%332.4%31243401469.2(Q96L91) P400 SWI2/SNF2-related protein 
*	TK270802_E14_cyto_2D_step02.4274.4274.2	1.0664	0.0538	3101.35	15	1550.0%	1	K.AIQPQAAQGPATVQQKITAQQITTPGAQQK.V
*	TK270802_E14_cyto_2D_step09.4498.4498.2	0.6666	0.0155	3031.42	11	1110.0%	1	K.TQFLTTPISQAQKLAGAQQVQTQIQVAK.L
*	TK270802_E14_cyto_2D_step13.2593.2593.2	2.0793	0.3091	2014.6	2	3440.0%	1	R.EHAAPYFQQLRQTTAPR.L
UP2CG_MOUSE72.1%3310.5%542587284.4(Q61074) Protein phosphatase 2C gamma isoform (EC 3.1.3.16) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1C) (Fibroblast growth factor inducible protein 13) (FIN13) 
	TK270802_E14_cyto_2D_step01.2262.2262.1	0.9211	0.1758	1329.28	5	2920.0%	1	R.GKQLIVANAGDSR.C
*	TK270802_E14_cyto_2D_step12.2673.2673.3	1.0044	0.1421	4150.24	27	710.0%	1	K.VADEDDVDNEEAALLHEEATMTIEELLTRYGQNCQK.V
	TK270802_E14_cyto_2D_step04.2430.2430.1	1.7873	0.155	951.04	1	5710.0%	1	R.AIGDHFYK.R
UQ96L2072.1%223.8%419472328.9(Q96L20) Hypothetical protein 
	TK270802_E14_cyto_2D_step06.2903.2903.1	1.7873	0.157	889.47	4	5710.0%	1	R.VGNESLNR.A
	TK270802_E14_cyto_2D_step02.3026.3026.1	1.0384	0.0653	907.84	5	5710.0%	1	R.NLISDSMK.A
UBCAM_MOUSE72.1%114.7%275307938.4(O35855) Branched-chain amino acid aminotransferase, mitochondrial precursor (EC 2.6.1.42) (BCAT(m)) (Fragment) 
	TK270802_E14_cyto_2D_step03.2846.2846.2	1.8835	0.3322	1514.48	1	5420.0%	1	R.KLLPVPWLLCGSK.R
UKIP2_MOUSE71.5%4104.8%187217044.6(Q9Z309) Kinase interacting protein 2 (KIP 2) 
	TK270802_E14_cyto_2D_step06.1823.1823.1	2.009	0.0288	633.94	7	7500.0%	1	R.ENPFK.E
	TK270802_E14_cyto_2D_step09.0315.0315.1	0.734	0.0015	496.7	3	5000.0%	3	K.LHAR.F
UQ96L1970.9%2211.1%234256267.9(Q96L19) Similar to lactate dehydrogenase 1, A chain 
*	TK270802_E14_cyto_2D_step12.2799.2799.2	0.8283	0.1825	2393.18	15	1580.0%	1	R.NVSIFKLMIPNITQYSPHCK.L
*	TK270802_E14_cyto_2D_step01.2120.2120.1	1.4303	0.2361	649.44	5	7000.0%	1	K.LSGFPK.N
UQ96MZ870.9%4410.5%618678798.7(Q96MZ8) Hypothetical protein FLJ31638 
*	TK270802_E14_cyto_2D_step07.4860.4860.2	1.0138	0.1675	2882.41	7	1850.0%	1	R.STLPRQTLPISGSQTGSSGVISPQELLK.K
	TK270802_E14_cyto_2D_step11.2086.2086.3	0.7269	0.0476	2555.89	162	830.0%	1	R.IPATAAPSLLMSPMVFAQPTSVPPK.E
	TK270802_E14_cyto_2D_step07.1829.1829.2	1.7449	0.1028	1459.49	1	6360.0%	1	K.QLCPAIQKLMVR.S
URL35_HUMAN70.7%468.2%1221442011.0(P42766) 60S ribosomal protein L35 
*	TK270802_E14_cyto_2D_step13.2514.2514.1	0.8807	0.0504	1259.43	7	2780.0%	1	K.KYKPLDLRPK.K
*	TK270802_E14_cyto_2D_step09.2666.2666.1	1.1219	0.0381	1131.93	94	3750.0%	2	K.YKPLDLRPK.K
UQ8VI3770.7%113.2%557608126.3(Q8VI37) Paxillin alpha 
*	TK270802_E14_cyto_2D_step07.2612.2612.2	1.7701	0.3583	1959.88	2	4120.0%	1	R.YAHQQPPSPLPVYSSSAK.N
UTYB4_MOUSE70.5%41612.0%5056795.0(P20065) Thymosin beta-4 (T beta 4) 
	TK270802_E14_cyto_2D_step01.1466.1466.1	1.5106	0.1474	657.86	5	7000.0%	4	K.NPLPSK.E
UHS9B_HUMAN70.5%101001.0%723831335.0(P08238) Heat shock protein HSP 90-beta (HSP 84) (HSP 90) 
*	TK270802_E14_cyto_2D_step02.3358.3358.1	1.5389	0.0517	831.83	3	5830.0%	10	R.ALLFIPR.R
USTM2_MOUSE70.2%1728915.8%146173216.3(P83093) Stromal interaction molecule 2 (Fragment) 
	TK270802_E14_cyto_2D_step11.3645.3645.3	1.9158	0.0168	2676.99	3	2160.0%	17	K.LQLKALDVVLFGPLTRPPHNWMK.D
UCOA1_HUMAN70.1%10522.4%23462650386.5(Q13085) Acetyl-CoA carboxylase 1 (EC 6.4.1.2) (ACC-alpha) [Includes: Biotin carboxylase (EC 6.3.4.14)] 
*	TK270802_E14_cyto_2D_step02.3846.3846.2	0.6969	0.0884	2658.5	15	1300.0%	1	K.IIEEAPATIATPAVFEHMEQCAVK.L
*	TK270802_E14_cyto_2D_step08.2004.2004.1	0.9844	0.2084	1179.67	96	2500.0%	1	K.QVNYEVDRR.F
*	TK270802_E14_cyto_2D_step07.1653.1653.3	0.9787	0.0137	1269.73	117	1820.0%	1	K.SVHSSVPLLNSK.D
*	TK270802_E14_cyto_2D_step07.4189.4189.2	2.1652	0.2012	1504.05	10	4090.0%	7	K.RILNVPQELYEK.G
UQ9BRU970.1%2210.4%2492843010.1(Q9BRU9) Hypothetical protein 
*	TK270802_E14_cyto_2D_step04.3450.3450.2	1.049	0.0145	2100.11	1	3120.0%	1	R.EQLPRYLMGETQLCTTR.C
*	TK270802_E14_cyto_2D_step04.4334.4334.1	1.9635	0.0989	1003.46	2	6250.0%	1	R.SNPKVLSEK.Q
UK1CJ_MOUSE70.1%241.2%569577115.1(P02535) Keratin, type I cytoskeletal 10 (Cytokeratin 10) (56 kDa cytokeratin) (Keratin, type I cytoskeletal 59 kDa) 
	TK270802_E14_cyto_2D_step04.2517.2517.1	1.7939	0.0419	997.34	2	6670.0%	2	K.IKEWYEK.H
UQ9CUA469.8%115.0%2182398810.6(Q9CUA4) 4933439C10Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step07.3070.3070.1	1.7438	0.1474	1208.13	5	5000.0%	1	R.RSPHLSGSLPR.L
UQ9JKT369.8%4626.3%2973420210.0(Q9JKT3) Candidate taste receptor T2R8 
*	TK270802_E14_cyto_2D_step05.5157.5157.3	1.3324	0.0173	4497.08	14	1120.0%	2	R.NDTSFDLSDGILTLVASLVLNSLLQFMLNVTFASLLIHSLR.R
*	TK270802_E14_cyto_2D_step03.2615.2615.1	1.6628	0.1605	969.93	3	5000.0%	1	R.FPEHIIGR.N
*	TK270802_E14_cyto_2D_step03.3720.3720.3	0.9036	0.0956	3229.72	38	710.0%	1	R.ILFSLAITRFLTLGLFLLNSVYIATNTGR.S
UN214_HUMAN69.8%442.5%20902137657.4(P35658) Nuclear pore complex protein Nup214 (Nucleoporin Nup214) (214 kDa nucleoporin) (CAN protein) 
	TK270802_E14_cyto_2D_step13.3408.3408.2	1.2123	0.0199	1829.25	22	2060.0%	1	K.YGLVFAGGASGLQIFPTK.N
*	TK270802_E14_cyto_2D_step10.2313.2313.1	0.7676	0.1017	1049.73	103	2780.0%	1	K.DAAGMVIDMK.W
	TK270802_E14_cyto_2D_step01.3004.3004.1	1.0967	0.0078	1205.14	20	3000.0%	1	K.ERSSLLAVSNK.Y
	TK270802_E14_cyto_2D_step05.3037.3037.1	1.6663	0.1626	1516.9	3	4230.0%	1	K.ETTESLHGDISSLK.T
UFABE_MOUSE69.8%51136.3%135151376.5(Q05816) Fatty acid-binding protein, epidermal (E-FABP) (Psoriasis-associated fatty acid-binding protein homolog) (PA-FABP) (Keratinocyte lipid-binding protein) 
*	TK270802_E14_cyto_2D_step03.3771.3771.2	0.9069	0.1839	2409.26	24	1750.0%	1	R.LMESHGFEEYMKELGVGLALR.K
*	TK270802_E14_cyto_2D_step02.5031.5031.2	0.9974	0.1456	3137.39	5	1730.0%	1	K.TETVCTFQDGALVQHQQWDGKESTITR.K
*	TK270802_E14_cyto_2D_step04.3056.3056.2	1.71	0.2232	2577.34	1	2620.0%	3	R.KTETVCTFQDGALVQHQQWDGK.E
UITN2_HUMAN69.7%557.8%16961933298.1(Q9NZM3) Intersectin 2 (SH3 domain-containing protein 1B) (SH3P18) (SH3P18-like WASP associated protein) 
*	TK270802_E14_cyto_2D_step09.2912.2912.3	0.9003	0.0389	3249.53	1	1420.0%	1	R.TVSPGSVSPIHGQGQVVENLKAQALCSWTAK.K
*	TK270802_E14_cyto_2D_step03.3194.3194.3	1.5242	0.0757	3267.72	28	1440.0%	1	K.HDIITVLEQQENWWFGEVHGGRGWFPK.S
*	TK270802_E14_cyto_2D_step04.4909.4909.1	1.4656	0.2092	1309.77	2	4500.0%	1	K.RETASVLVNYR.A
*	TK270802_E14_cyto_2D_step09.3192.3192.3	1.6145	0.0063	2809.38	489	1070.0%	1	K.QCDLEIMEIKQLQQELQEYQNK.L
*	TK270802_E14_cyto_2D_step06.4489.4489.3	1.7548	0.2201	4403.14	1	1560.0%	1	K.SMSGYLSGFQARNALLQSNLSQTQLATIWTLADVDGDGQLK.A
UQ9DBF169.5%3313.1%510555146.4(Q9DBF1) Aldehyde dehydrogenase family 7, member A1 (EC 1.2.1.3) (Antiquitin 1) 
	TK270802_E14_cyto_2D_step08.1773.1773.1	0.3081	0.0	753.6	3	2500.0%	1	K.QYMRR.S
*	TK270802_E14_cyto_2D_step04.3757.3757.2	1.8031	0.3314	1922.98	1	3750.0%	1	R.VGNPWDPNILYGPLHTK.Q
*	TK270802_E14_cyto_2D_step07.4690.4690.3	1.5768	0.0295	4540.78	86	850.0%	1	K.GAPTTSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMAR.D
UVAA1_HUMAN69.2%111.5%617683045.5(P38606) Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform (EC 3.6.3.14) (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) (Isoform VA68) 
*	TK270802_E14_cyto_2D_step05.2742.2742.1	1.6159	0.1585	1105.8	2	6250.0%	1	R.EHMGDILYK.L
UHUNK_MOUSE69.2%336.0%714796039.1(O88866) Hormonally upregulated neu tumor-associated kinase (EC 2.7.1.-) (Serine/threonine protein kinase MAK-V) 
	TK270802_E14_cyto_2D_step07.2626.2626.1	1.1312	0.1132	1259.79	9	3330.0%	1	R.REGQIQQMIR.H
*	TK270802_E14_cyto_2D_step07.3190.3190.2	1.3806	0.0876	2402.54	159	1670.0%	1	K.MVDKAMNPLPTQLSTGAVNFLR.S
*	TK270802_E14_cyto_2D_step07.2833.2833.1	1.4228	0.2892	1325.86	4	5000.0%	1	K.RHQSLQPSSER.S
UQ9Y45068.6%356.3%684754736.6(Q9Y450) ERFS (HBS1 (S. CEREVISIAE)-like) 
*	TK270802_E14_cyto_2D_step06.3342.3342.3	1.2415	0.0467	2117.46	249	1670.0%	1	R.LCVSDVFKDQGSGFCITGK.I
*	TK270802_E14_cyto_2D_step04.3169.3169.2	1.8516	0.3244	2681.43	1	2830.0%	2	K.IEAGYIQTGDRLLAMPPNETCTVK.G
UQ91YT168.6%3311.5%442461666.0(Q91YT1) Hypothetical 46.2 kDa protein 
*	TK270802_E14_cyto_2D_step04.3428.3428.2	1.0461	0.0346	2194.69	4	2220.0%	1	K.SLLNVSRTDWHLAFTGMSR.R
*	TK270802_E14_cyto_2D_step01.3628.3628.1	1.4526	0.2279	1533.54	3	3210.0%	1	R.GQDDAPAGGIWGFIK.G
*	TK270802_E14_cyto_2D_step08.1912.1912.2	0.8185	0.1246	2015.07	16	1560.0%	1	K.WFDIGCLVVEDPVHGIR.L
UKAPA_MOUSE68.5%4422.3%350404398.8(P05132) cAMP-dependent protein kinase, alpha-catalytic subunit (EC 2.7.1.37) (PKA C-alpha) 
	TK270802_E14_cyto_2D_step01.1515.1515.1	0.7567	0.0208	745.36	17	6000.0%	1	K.ILDKQK.V
	TK270802_E14_cyto_2D_step13.1746.1746.3	1.1216	0.0038	2912.43	3	1880.0%	1	R.DLKPENLLIDQQGYIQVTDFGFAKR.V
	TK270802_E14_cyto_2D_step06.3621.3621.3	1.718	0.0419	4189.43	58	1040.0%	1	K.AVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGK.V
	TK270802_E14_cyto_2D_step05.2710.2710.1	1.4439	0.2299	1165.02	3	5000.0%	1	R.FPSHFSSDLK.D
UQ9D9H468.5%112.1%2813217710.0(Q9D9H4) 1700069O15Rik protein 
	TK270802_E14_cyto_2D_step01.0493.0493.1	1.4238	0.2512	685.08	2	7000.0%	1	K.KPALKK.L
UQ6214168.5%445.8%9541093946.6(Q62141) Paired amphipathic helix protein SIN3B 
*	TK270802_E14_cyto_2D_step05.2706.2706.2	1.1148	0.0181	1546.34	54	3180.0%	1	R.EQEREQLLCEGR.R
	TK270802_E14_cyto_2D_step12.3333.3333.2	0.9292	0.1565	2647.8	2	1820.0%	1	K.EVLNDTWVSFPSWSEDSTFVSSK.K
	TK270802_E14_cyto_2D_step01.0493.0493.1	1.4238	0.2512	685.08	2	7000.0%	1	R.QPAIQK.E
	TK270802_E14_cyto_2D_step10.2321.2321.3	1.0797	0.037	1738.77	27	1920.0%	1	K.YGTLQEFSFFDKVR.R
UQ99J3568.4%3512.8%375410266.5(Q99J35) Hypothetical 41.0 kDa protein 
*	TK270802_E14_cyto_2D_step10.3264.3264.2	1.0485	0.1158	1845.52	32	2500.0%	1	R.RDVAVSEEVGQAACEAR.R
*	TK270802_E14_cyto_2D_step11.2869.2869.3	1.8344	0.0315	3281.17	2	1830.0%	2	K.GSSVHPPPGHAIPSEEELPPPPEEPVTLPER.E
UQ1677368.2%228.8%422478756.5(Q16773) Glutamine--phenylpyruvate aminotransferase (EC 2.6.1.64) (Glutamine transaminase K) 
*	TK270802_E14_cyto_2D_step01.0204.0204.1	1.5065	0.1908	1353.97	1	4580.0%	1	K.ALVLNTPNNPLGK.V
*	TK270802_E14_cyto_2D_step07.3672.3672.3	1.8193	0.2002	2733.28	2	2280.0%	1	R.TVHQNSVFHCPTQSQAAVAESFER.E
UQ96M7468.0%2212.9%434483437.4(Q96M74) Hypothetical protein FLJ32778 
*	TK270802_E14_cyto_2D_step03.2272.2272.1	1.7491	0.1462	1571.82	4	3460.0%	1	R.IPDPSHLPLVAPWK.T
*	TK270802_E14_cyto_2D_step06.2931.2931.3	1.6075	0.1974	4166.88	4	1160.0%	1	K.GNIGTGLLGLPLAAKNAGIVMGPISLLIIGIVAVHCMGILVK.C
UAGP2_MOUSE68.0%112.4%496566175.6(O35608) Angiopoietin-2 precursor (ANG-2) 
*	TK270802_E14_cyto_2D_step05.2854.2854.1	1.7619	0.1314	1415.14	3	4550.0%	1	K.EQKDELQVLVSK.Q
UPI52_MOUSE67.7%114.2%405461527.0(O70172) Phosphatidylinositol-4-phosphate 5-kinase type II alpha (EC 2.7.1.68) (PIP5KII-alpha) (1-phosphatidylinositol-4-phosphate kinase) (PtdIns(4)P-5-kinase B isoform) (Diphosphoinositide kinase) 
	TK270802_E14_cyto_2D_step03.2480.2480.2	2.0619	0.2928	1790.33	1	4690.0%	1	K.HGAGAEISTVNPEQYSK.R
UPHS1_MOUSE67.6%572.8%850974317.1(Q9ET01) Glycogen phosphorylase, liver form (EC 2.4.1.1) 
	TK270802_E14_cyto_2D_step07.2217.2217.1	1.1163	0.0314	772.75	6	6000.0%	1	R.RQISIR.G
	TK270802_E14_cyto_2D_step03.1814.1814.1	0.8943	0.121	498.96	2	6670.0%	2	K.LLPR.H
	TK270802_E14_cyto_2D_step03.2132.2132.1	1.6666	0.062	759.82	2	8000.0%	1	K.QENKLK.F
	TK270802_E14_cyto_2D_step13.3078.3078.1	1.7558	0.1332	996.14	4	5000.0%	1	R.HLHFTLVK.D
UQ9CXA267.4%114.8%354378046.7(Q9CXA2) 2810055F11Rik protein 
*	TK270802_E14_cyto_2D_step07.2916.2916.2	1.9114	0.3083	1734.53	1	5310.0%	1	R.IVHAGCPEVAGPTLLAK.R
UR35A_MOUSE67.4%82617.3%1101254010.9(O55142) 60S ribosomal protein L35a 
	TK270802_E14_cyto_2D_step04.2261.2261.1	1.2465	0.0664	812.72	2	7500.0%	1	R.EHTALLK.I
	TK270802_E14_cyto_2D_step04.1708.1708.2	1.7186	0.1902	1229.73	1	5450.0%	4	K.NNTVTPGGKPNK.T
UQ9CVI667.4%114.8%147170825.1(Q9CVI6) 1200015E15Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step06.3286.3286.1	1.9469	0.0304	950.18	7	6670.0%	1	K.KFVEWLK.N
UQ8WUC767.4%3522.1%1041054011.6(Q8WUC7) Hypothetical protein (Fragment) 
*	TK270802_E14_cyto_2D_step01.3342.3342.1	1.8281	0.0073	1599.13	3	3330.0%	2	R.RPGGAAMLAESPSVPR.L
*	TK270802_E14_cyto_2D_step14.2015.2015.1	0.3945	0.0084	742.59	12	1670.0%	1	R.TRPGGTR.A
UQ9H0G567.4%111.3%558663908.8(Q9H0G5) Hypothetical protein 
*	TK270802_E14_cyto_2D_step05.2413.2413.1	1.9449	0.0666	901.89	9	7500.0%	1	K.YIHNLLK.A
UQ9D0N467.2%4611.5%419480646.9(Q9D0N4) 1110001I24Rik protein 
	TK270802_E14_cyto_2D_step03.3463.3463.1	1.7022	0.1529	882.16	1	6670.0%	1	K.IVVLFYK.A
*	TK270802_E14_cyto_2D_step03.3552.3552.3	1.1606	0.017	4185.66	3	1400.0%	2	K.QXRPLLAVFSSQGQSELVLLQKVQEYCYDNIHFMK.A
	TK270802_E14_cyto_2D_step02.3632.3632.1	1.5227	0.1159	747.3	24	7000.0%	1	K.LLLFLK.A
UQ9D0M167.1%114.5%356394327.2(Q9D0M1) 5730409F23Rik protein 
	TK270802_E14_cyto_2D_step06.3778.3778.2	1.7158	0.43	1723.13	2	3330.0%	1	K.NATVHPGLELPLMMAK.E
UGTM5_MOUSE67.1%2410.3%224266357.2(P48774) Glutathione S-transferase Mu 5 (EC 2.5.1.18) (GST class-mu 5) (Fibrous sheath component 2) (Fsc2) 
*	TK270802_E14_cyto_2D_step07.3338.3338.2	1.8764	0.3098	2804.81	1	2500.0%	2	R.LCYNSNHENLKPQYLEQLPAQLK.Q
UUBF1_MOUSE67.1%336.0%765895095.8(P25976) Nucleolar transcription factor 1 (Upstream binding factor 1) (UBF-1) 
	TK270802_E14_cyto_2D_step07.4177.4177.1	0.6997	0.1462	1103.53	4	2780.0%	1	R.EAALKAQSER.K
	TK270802_E14_cyto_2D_step07.3093.3093.1	1.5579	0.16	1408.93	1	5000.0%	1	R.EDHPDLIQNAKK.S
	TK270802_E14_cyto_2D_step04.0700.0700.2	0.9205	0.0756	2842.31	36	1300.0%	1	R.WSQEDMLTLLECMKNNLPSNDSSK.F
UPDA4_MOUSE67.1%575.5%638719735.3(P08003) Protein disulfide isomerase A4 precursor (EC 5.3.4.1) (Protein ERp-72) (ERp72) 
	TK270802_E14_cyto_2D_step07.2142.2142.1	1.2976	0.0106	714.98	5	7000.0%	1	K.EILTLK.Q
*	TK270802_E14_cyto_2D_step03.1876.1876.1	1.2452	0.0865	1196.7	1	5000.0%	1	K.KGQAVDYDGSR.T
*	TK270802_E14_cyto_2D_step13.2528.2528.1	1.6653	0.4108	1001.59	12	5000.0%	2	K.HALPLVGHR.K
	TK270802_E14_cyto_2D_step11.2383.2383.2	1.2418	0.0511	979.67	3	5000.0%	1	K.RSPPIPLAK.V
UAKAC_HUMAN67.0%794.3%17811914384.4(Q02952) A-kinase anchor protein 12 (A-kinase anchor protein 250 kDa) (AKAP 250) (Myasthenia gravis autoantigen gravin) 
*	TK270802_E14_cyto_2D_step12.4411.4411.2	1.2907	2.0E-4	2614.65	3	1880.0%	1	R.GGGDEESGEHTQVPADSPDSQEEQK.G
*	TK270802_E14_cyto_2D_step02.3736.3736.3	0.904	0.0217	4053.15	36	810.0%	1	K.VVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVK.S
*	TK270802_E14_cyto_2D_step07.2238.2238.1	1.8298	0.1164	889.59	1	7500.0%	2	K.KEQEPEK.V
*	TK270802_E14_cyto_2D_step14.3300.3300.2	0.7161	0.0237	2769.07	14	1200.0%	1	K.RGGGDEESGEHTQVPADSPDSQEEQK.G
*	TK270802_E14_cyto_2D_step06.3451.3451.3	1.2047	0.0264	2752.46	10	1700.0%	1	K.APQVTESIESSELVTTCQAETLAGVK.S
*	TK270802_E14_cyto_2D_step09.1956.1956.1	0.5002	0.1158	666.3	4	3000.0%	1	K.SELTES.-
USIA9_MOUSE66.9%3312.5%359412457.5(O88829) Lactosylceramide alpha-2,3-sialyltransferase (EC 2.4.99.9) (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase) (Ganglioside GM3 synthase) (ST3Gal V) (Sialyltransferase 9) 
	TK270802_E14_cyto_2D_step06.2823.2823.1	1.9074	0.0697	1423.88	5	4550.0%	1	K.RAQSYAQEVLQK.E
	TK270802_E14_cyto_2D_step09.1863.1863.1	0.8507	0.1022	683.51	14	5000.0%	1	K.VPLQPK.H
	TK270802_E14_cyto_2D_step08.4125.4125.3	1.5467	0.1106	3291.25	1	2020.0%	1	K.CTLVAFGVWLLYILILNYTAEECDMKR.M
UAC15_MOUSE66.6%668.8%11311259859.3(P35601) Activator 1 140 kDa subunit (Replication factor C large subunit) (A1 140 kDa subunit) (RF-C 140 kDa subunit) (Activator 1 large subunit) (A1-P145) (Differentiation specific element binding protein) (ISRE-binding protein) 
	TK270802_E14_cyto_2D_step15.2294.2294.2	0.9474	0.0488	2000.79	86	2190.0%	1	K.RIIYDSDSESEETVQVK.N
*	TK270802_E14_cyto_2D_step01.3927.3927.1	1.4986	0.1879	1303.94	1	5500.0%	1	K.YEMAAEAEMKK.E
*	TK270802_E14_cyto_2D_step03.1468.1468.3	1.0541	0.174	1377.35	1	1880.0%	1	K.VNNSGKEDASKPK.Q
*	TK270802_E14_cyto_2D_step03.3800.3800.3	1.5315	0.1068	2892.17	119	1600.0%	1	K.TTTASLVCQELGYSYVELNASDTRSK.N
*	TK270802_E14_cyto_2D_step07.3045.3045.2	1.4307	0.0575	1915.71	8	3120.0%	1	K.NIIGQQGDQSCANKLLR.W
	TK270802_E14_cyto_2D_step09.1490.1490.3	1.0267	0.1473	1994.0	137	1070.0%	1	R.SLVHYCFDLRFQRPR.V
UO1498066.4%6611.9%10711233866.1(O14980) CRM1 protein 
*	TK270802_E14_cyto_2D_step04.2794.2794.1	1.9344	0.1112	1171.98	6	5000.0%	1	R.MAQEVLTHLK.E
*	TK270802_E14_cyto_2D_step01.4258.4258.1	0.9086	0.108	1383.58	13	2270.0%	1	K.TSSDPTCVEKEK.V
*	TK270802_E14_cyto_2D_step14.2838.2838.3	0.8507	0.0733	4410.81	4	880.0%	1	R.TNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFK.H
*	TK270802_E14_cyto_2D_step14.4059.4059.2	1.1691	0.0809	2204.28	28	2060.0%	1	R.IMTEKLHNQVNGTEWSWK.N
*	TK270802_E14_cyto_2D_step05.4187.4187.1	1.6397	0.0604	1185.85	5	5560.0%	1	K.LNMILVQILK.Q
*	TK270802_E14_cyto_2D_step02.4963.4963.3	1.2855	0.1289	4653.84	4	1250.0%	1	K.HLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLR.F
UQ96H8466.3%4103.1%9771096586.4(Q96H84) Hypothetical protein 
*	TK270802_E14_cyto_2D_step04.4926.4926.2	1.3085	0.1786	2460.6	1	2620.0%	1	R.HEDEDQISEQDIFEGLPGALSK.C
*	TK270802_E14_cyto_2D_step08.2954.2954.1	1.3053	0.078	952.08	13	5710.0%	3	R.LCALGFLR.T
UG6PI_HUMAN66.1%222.5%558631478.3(P06744) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Neuroleukin) (NLK) (Sperm antigen-36) (SA-36) 
*	TK270802_E14_cyto_2D_step01.1350.1350.1	1.248	0.0805	762.02	1	6000.0%	1	R.DPQFQK.L
*	TK270802_E14_cyto_2D_step01.2674.2674.1	1.9015	0.0124	995.11	1	7860.0%	1	K.EWFLQAAK.D
UPPI2_MOUSE66.0%225.6%270313566.9(P53811) Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta) 
	TK270802_E14_cyto_2D_step06.2202.2202.1	1.8964	0.0652	889.42	1	6670.0%	1	K.IYHLKSK.V
*	TK270802_E14_cyto_2D_step08.3461.3461.1	0.815	0.0312	1058.2	130	2860.0%	1	K.RIFTNLHR.Q
UO9498665.9%10305.3%13001500895.4(O94986) Hypothetical protein KIAA0912 (Fragment) 
*	TK270802_E14_cyto_2D_step06.4159.4159.2	2.2475	0.148	1964.86	1	5000.0%	4	R.QMVQDFDHDKQEAVDR.C
*	TK270802_E14_cyto_2D_step11.2881.2881.2	0.7809	0.1367	2216.58	70	1670.0%	1	K.AFQDTLPLLVENADPEWKK.R
*	TK270802_E14_cyto_2D_step14.4378.4378.2	1.1202	0.0552	2927.46	2	2080.0%	3	R.IQLEIYQYEEDILTVLGVLLSDTQK.E
*	TK270802_E14_cyto_2D_step03.4167.4167.1	0.8858	0.0668	1049.06	58	3120.0%	2	K.LDQTIKAMK.K
UQ9D0Q865.8%117.1%168193278.8(Q9D0Q8) 2600005K24Rik protein 
	TK270802_E14_cyto_2D_step07.2446.2446.1	1.4791	0.1934	1376.79	3	4090.0%	1	K.RIEPADAHVLQK.N
UQ9H5R965.8%112.2%268306804.7(Q9H5R9) Hypothetical protein FLJ23129 
*	TK270802_E14_cyto_2D_step07.2261.2261.1	1.4815	0.199	697.98	1	7000.0%	1	R.QLPVLK.E
UNTC1_HUMAN65.7%352.0%25562725545.2(P46531) Neurogenic locus notch homolog protein 1 precursor (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) 
*	TK270802_E14_cyto_2D_step09.4526.4526.3	1.1442	0.0537	3585.92	1	1290.0%	1	R.SPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGK.K
*	TK270802_E14_cyto_2D_step10.3066.3066.2	2.1238	0.2219	1600.14	1	4670.0%	2	R.AAEGWAAPDALLGQVK.A
UQ9JKB365.7%3510.5%361387429.8(Q9JKB3) RNA binding protein MSY4 
	TK270802_E14_cyto_2D_step05.1706.1706.1	1.8729	0.0902	660.59	1	8000.0%	2	K.KVLATK.V
	TK270802_E14_cyto_2D_step14.3036.3036.2	0.9743	0.1048	2964.86	11	1290.0%	1	-.MSEAGEATTGGTTLPQAAADAPAAAPPDPAPK.S
UFAF1_MOUSE65.6%335.9%649738344.9(P54731) FAS-associated factor 1 (FAF1 protein) 
	TK270802_E14_cyto_2D_step05.5031.5031.1	0.8915	0.0060	1068.27	7	3570.0%	1	K.REQDEAYR.L
*	TK270802_E14_cyto_2D_step07.3041.3041.1	1.5369	0.1639	1229.17	3	4500.0%	1	R.HFGSVIAQTIR.T
*	TK270802_E14_cyto_2D_step06.4907.4907.2	1.0944	0.2698	2276.01	4	2500.0%	1	K.LQIVFDFVASKGFPWDEFK.L
UCLP1_MOUSE65.5%3510.4%297333569.0(Q08091) Calponin H1, smooth muscle (Basic calponin) (Calponin 1) 
	TK270802_E14_cyto_2D_step06.4215.4215.3	1.4797	0.0338	2809.96	13	1770.0%	1	R.QIFEPGLGMEHCDTLNVSLQMGSNK.G
	TK270802_E14_cyto_2D_step04.2118.2118.1	1.7029	0.1423	774.53	2	8000.0%	2	R.HLYDPK.L
UQ8R0F264.4%110.5%13921555926.4(Q8R0F2) Hypothetical 155.6 kDa protein 
*	TK270802_E14_cyto_2D_step07.2113.2113.1	1.6348	0.1488	840.9	1	8330.0%	1	K.HLSSQLR.A
UMYO6_HUMAN64.2%110.6%12621460478.5(Q9UM54) Myosin VI 
	TK270802_E14_cyto_2D_step07.2885.2885.1	1.4777	0.1878	1013.29	1	6670.0%	1	R.NYHIFYR.L
UQ9BQQ464.2%223.3%12141344046.9(Q9BQQ4) Hypothetical protein KIAA0298 
*	TK270802_E14_cyto_2D_step15.5011.5011.2	0.7545	0.2024	3126.74	28	1300.0%	1	K.LKPQKNDQDGSFLLIIECGTESSSMSIK.V
*	TK270802_E14_cyto_2D_step01.1444.1444.1	1.3736	0.3717	1350.67	2	3180.0%	1	R.MSFRLANSISQV.-
UTBCA_MOUSE64.2%2227.1%107126265.3(P48428) Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A) 
	TK270802_E14_cyto_2D_step01.2482.2482.1	1.1834	0.1702	1482.9	69	2730.0%	1	K.DLEEAEEYKEAR.V
*	TK270802_E14_cyto_2D_step07.3716.3716.2	2.0334	0.2824	2009.85	1	5310.0%	1	R.RLEAAYTDLQQILESEK.D
UQ9D7W864.0%115.3%171200479.3(Q9D7W8) 2210019E14Rik protein 
*	TK270802_E14_cyto_2D_step13.2468.2468.1	1.7871	0.1017	1030.97	1	7500.0%	1	R.HHLLAAVNR.Q
UQ8WVJ564.0%115.5%200214634.8(Q8WVJ5) Similar to RIKEN cDNA 2310035L15 gene 
*	TK270802_E14_cyto_2D_step07.3076.3076.1	1.8826	0.101	1180.04	6	5000.0%	1	R.QTAGQLSFSIK.V
UPRI2_MOUSE63.9%7916.6%505584088.3(P33610) DNA primase large subunit (EC 2.7.7.-) (DNA primase 58 kDa subunit) (P58) 
*	TK270802_E14_cyto_2D_step06.4920.4920.3	1.4626	0.0564	2937.67	69	1500.0%	1	K.IILTNPPGQGDYHGCPFRHSDAELLK.Q
	TK270802_E14_cyto_2D_step08.1855.1855.1	0.7244	0.2422	573.48	39	5000.0%	1	K.FSYR.E
	TK270802_E14_cyto_2D_step05.1445.1445.1	0.7663	0.0393	805.9	11	5000.0%	1	R.ENHHLR.H
	TK270802_E14_cyto_2D_step06.2282.2282.2	1.0709	0.0080	1402.06	32	3500.0%	1	K.SFPPCMRQLHK.A
*	TK270802_E14_cyto_2D_step06.1959.1959.2	1.7384	0.3149	1836.54	3	3670.0%	1	K.EISQPETPQHKPSTQK.T
*	TK270802_E14_cyto_2D_step11.2966.2966.2	1.2668	0.211	2431.2	5	2500.0%	2	R.LQPLLNHLSHSYTGQDYSTQK.N
UQ8WZ4263.9%891054.6%3435038161116.3(Q8WZ42) Titin 
	TK270802_E14_cyto_2D_step06.4279.4279.3	1.2724	0.1395	4297.94	4	1250.0%	1	R.VAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTK.R
	TK270802_E14_cyto_2D_step09.3622.3622.2	1.2027	0.0491	2090.59	69	2350.0%	1	K.ELPLIFITPLSDVKVFEK.D
	TK270802_E14_cyto_2D_step02.3244.3244.1	1.0137	0.0126	662.05	13	5000.0%	1	K.DGSNIR.E
	TK270802_E14_cyto_2D_step08.2171.2171.1	0.7549	0.1138	1070.21	2	2780.0%	1	K.GTYTVTASNR.L
	TK270802_E14_cyto_2D_step14.3754.3754.3	1.22	0.0723	3615.78	2	1670.0%	1	K.KPHPIETLKGADVHLECELQGTPPFHVSWYK.D
	TK270802_E14_cyto_2D_step05.1590.1590.1	1.0339	0.0567	749.35	22	5000.0%	1	R.ELSADSK.H
	TK270802_E14_cyto_2D_step10.4756.4756.3	0.9777	0.1162	4455.56	44	610.0%	1	K.FSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMER.R
	TK270802_E14_cyto_2D_step13.2118.2118.1	1.2766	0.1329	836.82	34	3570.0%	1	K.KVPAPVPK.K
	TK270802_E14_cyto_2D_step06.4379.4379.3	1.2864	0.0595	4250.92	30	1180.0%	1	K.NFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVK.L
	TK270802_E14_cyto_2D_step08.2416.2416.2	1.101	0.1121	1391.36	15	4090.0%	1	K.DGLPLKESEFVR.F
	TK270802_E14_cyto_2D_step09.1998.1998.1	0.9347	0.0035	682.68	11	5000.0%	1	K.KVVIPK.K
	TK270802_E14_cyto_2D_step08.5051.5051.3	1.4234	0.0806	3897.42	21	1030.0%	1	R.VSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFR.D
	TK270802_E14_cyto_2D_step07.2716.2716.2	0.9253	0.1665	2381.09	132	1430.0%	1	K.AGTNVCLDATVFGKPMPTVSWK.K
	TK270802_E14_cyto_2D_step06.4963.4963.3	0.8681	0.0324	4212.82	18	710.0%	1	K.EASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIR.I
	TK270802_E14_cyto_2D_step13.1177.1177.1	0.6133	0.0018	675.72	2	3000.0%	1	R.VGQTIR.I
	TK270802_E14_cyto_2D_step05.2031.2031.1	0.8207	0.0601	1549.48	19	2310.0%	1	R.LFVPIKGRPAPEVK.W
	TK270802_E14_cyto_2D_step10.4268.4268.2	0.9772	0.0496	2934.26	122	1300.0%	1	K.DATLQDMGTYVVMVGAARAAAHLTVIEK.L
	TK270802_E14_cyto_2D_step12.3272.3272.2	1.1731	0.1876	2727.08	4	2500.0%	1	K.LYVEPAAPLGAPTYIPTLEPVSRIR.S
	TK270802_E14_cyto_2D_step01.5178.5178.2	0.8246	0.0067	2734.64	125	1300.0%	1	R.ELAESVIAKDILHPPEVELDVTCR.D
	TK270802_E14_cyto_2D_step09.2321.2321.2	0.7321	0.0767	2548.84	4	1140.0%	1	R.ETSRPNWAQVSATVPITSCSVEK.L
	TK270802_E14_cyto_2D_step14.2022.2022.3	0.8294	0.0049	2453.37	24	1250.0%	1	K.LYVEPAAPLGAPTYIPTLEPVSR.I
	TK270802_E14_cyto_2D_step10.4795.4795.2	0.9927	0.2862	2216.24	44	1750.0%	1	R.LDQTGGVDFQAANVKSSAHLR.V
	TK270802_E14_cyto_2D_step06.0507.0507.1	0.8862	0.0648	747.04	23	4170.0%	1	R.EIRSGGK.Y
	TK270802_E14_cyto_2D_step04.2373.2373.1	1.2385	0.1508	1375.96	25	3330.0%	1	K.VLDRPGPPEGPLK.V
	TK270802_E14_cyto_2D_step09.4952.4952.2	0.8639	0.0243	2907.03	8	1670.0%	1	R.IFAENRYGQSFALESDPIVAQYPYK.E
	TK270802_E14_cyto_2D_step06.3026.3026.1	1.0872	0.055	1315.88	48	3180.0%	2	R.AGLSIRIFVPIK.G
	TK270802_E14_cyto_2D_step15.3241.3241.2	0.8097	0.0403	1826.71	93	1330.0%	1	K.TKYDKPGRPDPPEVTK.V
	TK270802_E14_cyto_2D_step05.1997.1997.1	1.0668	0.1818	809.06	30	5000.0%	1	K.ELTSDNK.Y
	TK270802_E14_cyto_2D_step11.2830.2830.3	1.8354	0.1087	2834.47	7	1880.0%	1	K.DSMVIQWHEPVNNGGSPVIGYHLER.K
	TK270802_E14_cyto_2D_step04.5165.5165.3	0.9727	0.0895	3868.41	6	810.0%	1	K.VTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCR.E
	TK270802_E14_cyto_2D_step01.4050.4050.1	0.7782	0.0011	1596.48	48	2080.0%	1	K.DLIPNGEYFFRVK.A
	TK270802_E14_cyto_2D_step06.5152.5152.2	0.8357	0.0078	2833.14	1	1960.0%	1	R.HEVSAEEEWSYSEEEEGVSISVYR.E
	TK270802_E14_cyto_2D_step10.4861.4861.2	1.3492	0.1657	2687.18	33	1960.0%	1	R.AQIEVTSSFTMLVIDNVTRFDSGR.Y
	TK270802_E14_cyto_2D_step05.3816.3816.3	1.0805	0.164	3243.77	3	1200.0%	1	K.FLHDGQEYTLLLIEAFPEDAAVYTCEAK.N
	TK270802_E14_cyto_2D_step07.1810.1810.1	1.1234	0.0693	641.06	1	8000.0%	1	K.KVAVPK.K
	TK270802_E14_cyto_2D_step08.4815.4815.2	0.6687	0.0785	2577.01	61	910.0%	3	K.CSLTWSPPLQDGGSDISHYVVEK.R
	TK270802_E14_cyto_2D_step11.1572.1572.2	0.7162	0.0108	1056.95	40	2780.0%	1	K.LELAAAPKIK.T
	TK270802_E14_cyto_2D_step01.3640.3640.2	1.0206	0.1102	2777.49	1	1880.0%	1	K.QEGYVASSSEAEMRETTLTTSTQIR.T
	TK270802_E14_cyto_2D_step05.3206.3206.1	1.1951	0.1086	1473.91	1	4090.0%	1	K.DDQELQITDRIK.I
	TK270802_E14_cyto_2D_step07.1738.1738.1	0.6269	0.0996	821.6	162	2500.0%	1	K.RVEPPPK.V
	TK270802_E14_cyto_2D_step11.3594.3594.2	1.2183	0.0093	1684.79	26	4290.0%	1	R.TTARDPIYPPDPPIK.L
	TK270802_E14_cyto_2D_step01.2840.2840.1	0.8447	0.0152	1150.75	9	2780.0%	1	K.GLPDLCYLAK.E
	TK270802_E14_cyto_2D_step11.4495.4495.3	1.2142	0.1143	4311.11	3	1150.0%	1	K.SLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLK.E
	TK270802_E14_cyto_2D_step09.4634.4634.3	1.0563	0.0989	3533.44	6	1030.0%	1	R.YEEHEEYITEPEKPIPVKPVPEEPVPTKPK.A
	TK270802_E14_cyto_2D_step01.2103.2103.1	0.7342	0.0096	1075.38	1	3570.0%	1	K.DSCYLTWK.E
	TK270802_E14_cyto_2D_step03.5164.5164.1	1.0956	0.01	1164.04	83	3000.0%	1	K.GWSIVASDVTK.R
	TK270802_E14_cyto_2D_step07.4745.4745.2	1.2663	0.1628	3140.71	1	2040.0%	1	R.ESDNIWISYSENIATLQFSRVEPANAGK.Y
	TK270802_E14_cyto_2D_step15.2550.2550.3	1.1463	0.0341	2935.8	32	1440.0%	1	R.AEPTPLPQFPFADTPDTYKSEAGVEVK.K
	TK270802_E14_cyto_2D_step02.0669.0669.3	0.8371	0.0283	4498.23	1	850.0%	1	R.IVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVK.V
	TK270802_E14_cyto_2D_step04.5101.5101.2	0.9303	0.083	2710.56	6	1820.0%	1	R.ETSHLAWTICEGELQMTSCKVTK.L
	TK270802_E14_cyto_2D_step03.3250.3250.1	1.0486	0.0029	898.86	179	3120.0%	1	R.VLGVPVIAK.D
	TK270802_E14_cyto_2D_step05.1766.1766.3	1.6306	0.1355	1624.43	55	2170.0%	1	K.NAFVTPGPPGIPEVTK.I
	TK270802_E14_cyto_2D_step03.2232.2232.1	0.9727	0.0911	1457.35	19	2500.0%	1	K.LKPPPPKVPEEPK.K
	TK270802_E14_cyto_2D_step06.4911.4911.2	1.1874	0.1837	2875.45	15	1880.0%	1	R.DSMEVQWNEPISDGGSRVIGYHLER.K
	TK270802_E14_cyto_2D_step08.1547.1547.1	0.5268	0.0148	612.73	4	2500.0%	1	R.KDHGR.Y
	TK270802_E14_cyto_2D_step13.2168.2168.1	0.9119	0.0332	1574.59	138	1540.0%	1	K.TTDQKGMHISSQIK.K
	TK270802_E14_cyto_2D_step11.2642.2642.2	0.8414	0.0041	1522.42	47	2310.0%	1	R.AVPVPTVSWHKDGK.E
	TK270802_E14_cyto_2D_step08.1829.1829.1	0.5933	0.135	707.71	10	3000.0%	1	K.TVVEEK.R
	TK270802_E14_cyto_2D_step06.1711.1711.1	1.2304	0.1577	930.75	24	5000.0%	1	K.EDRDAPTK.A
	TK270802_E14_cyto_2D_step10.2375.2375.2	1.0564	0.0127	1296.89	186	3000.0%	1	R.CENVNKYDAGK.Y
	TK270802_E14_cyto_2D_step07.5088.5088.3	1.4847	0.0942	3604.98	41	1090.0%	3	R.NRSSVTLYVNAPEPPQVLQELQPVTVQSGKPAR.F
	TK270802_E14_cyto_2D_step03.3431.3431.3	1.1164	0.0108	2784.88	10	1560.0%	1	K.DSMTISWHEPLSDGGSPILGYHVER.K
	TK270802_E14_cyto_2D_step09.3367.3367.2	1.1571	0.0262	1910.6	3	3750.0%	1	R.ARTEIISTDNHTLLTVK.D
	TK270802_E14_cyto_2D_step08.2514.2514.3	1.4743	0.0586	2136.64	1	3330.0%	1	K.WTVPEKDGGSPITNYIVEK.R
	TK270802_E14_cyto_2D_step06.4339.4339.2	2.2026	0.1559	2006.65	1	5000.0%	2	R.TPVQEEVIEVKVPAVHTK.K
	TK270802_E14_cyto_2D_step03.4511.4511.2	1.6518	0.1801	2556.59	14	2390.0%	1	R.SIATVEMVIDGAAGQQLPHKTPHR.I
	TK270802_E14_cyto_2D_step13.1180.1180.3	1.0689	0.013	2047.91	44	1560.0%	1	K.TSFHVTNLVPGNEYYFR.V
	TK270802_E14_cyto_2D_step03.2554.2554.3	1.9216	0.2588	2009.25	11	2360.0%	1	K.NPFVVPDAPKAPEVTTVTK.D
	TK270802_E14_cyto_2D_step11.4739.4739.2	0.8796	0.0776	3021.77	193	1150.0%	1	R.DENVPPIVEFGPEYFDGLIIKSGESLR.I
	TK270802_E14_cyto_2D_step10.2339.2339.3	1.1419	0.0089	1591.62	2	2880.0%	1	K.LVPELTYKVTGLEK.G
	TK270802_E14_cyto_2D_step12.3843.3843.2	0.8042	0.0095	3195.04	67	1300.0%	1	K.NVTVIEGESVTLECHISGYPSPTVTWYR.E
	TK270802_E14_cyto_2D_step05.1987.1987.1	1.1768	0.0212	754.03	111	5000.0%	1	K.HIKDIK.V
	TK270802_E14_cyto_2D_step10.3344.3344.3	1.5489	0.3321	3056.36	7	1700.0%	1	K.VSVGDSASLQCQLAGTPEIGVSWYKGDTK.L
	TK270802_E14_cyto_2D_step03.2158.2158.1	0.7467	0.0835	1305.65	65	2500.0%	1	K.GEYVCDCGTDK.T
	TK270802_E14_cyto_2D_step15.1792.1792.1	0.5879	0.0171	824.87	98	2500.0%	1	K.KPVPEEK.K
	TK270802_E14_cyto_2D_step11.3027.3027.3	1.4269	0.0863	1900.18	6	2660.0%	1	R.LEADVSGRPPPTMEWSK.D
	TK270802_E14_cyto_2D_step11.4705.4705.3	1.1827	0.0944	3058.96	149	1500.0%	1	K.ENCTISWENPLDNGGSEITNFIVEYR.K
	TK270802_E14_cyto_2D_step14.3104.3104.3	1.046	0.1908	3486.31	3	1000.0%	1	R.FDEIKADSVILSWDVPEDNGGGEITCYSIEK.R
	TK270802_E14_cyto_2D_step05.2825.2825.1	1.3511	0.1618	1075.09	114	3000.0%	1	R.VCAENAAGPGK.F
	TK270802_E14_cyto_2D_step03.4931.4931.2	1.2273	0.0162	2519.13	3	2050.0%	1	K.NDGGSPVTHYIVECLAWDPTGTK.K
	TK270802_E14_cyto_2D_step06.3589.3589.2	0.6752	0.2005	3029.19	19	960.0%	1	K.VDADIYGKPIPTIQWIKGDQELSNTAR.L
	TK270802_E14_cyto_2D_step02.2307.2307.1	1.4358	4.0E-4	795.83	12	5830.0%	1	K.EKVPPPK.V
	TK270802_E14_cyto_2D_step14.2813.2813.3	1.1348	0.0263	3215.97	5	880.0%	1	R.YGVQEQVTISGAAGAAASVSASASYAAEAVATGAK.E
UQ8R0H963.9%112.4%635699725.3(Q8R0H9) Similar to golgi associated, gamma adaptin ear containing, ARF binding protein 1 
*	TK270802_E14_cyto_2D_step10.3256.3256.2	1.7087	0.3514	1688.88	1	4290.0%	1	K.LPEDAIFPLPPPRPK.N
UQ9DCZ663.8%114.1%244273865.2(Q9DCZ6) 2410007D12Rik protein (RIKEN cDNA 2410007D12 gene) 
*	TK270802_E14_cyto_2D_step10.2342.2342.2	1.8883	0.2972	1133.48	1	5560.0%	1	R.IHVIDHSGVR.L
UHXK2_MOUSE63.7%224.1%9171025356.1(O08528) Hexokinase type II (EC 2.7.1.1) (HK II) 
*	TK270802_E14_cyto_2D_step14.4010.4010.2	0.9761	0.1312	2962.92	5	1880.0%	1	R.MCINMEWGAFGDDGTLNDIRTEFDR.E
	TK270802_E14_cyto_2D_step05.2131.2131.1	1.4411	0.207	1224.81	3	4170.0%	1	K.GLGATTHPTAAVK.M
UQ9CT1763.4%113.8%3653983311.8(Q9CT17) 2610019N13Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step07.2884.2884.1	1.4265	0.2279	1405.88	3	3850.0%	1	K.LNHVAAGLVSPSLK.S
UIPSP_HUMAN63.4%356.9%406457029.3(P05154) Plasma serine protease inhibitor precursor (PCI) (Protein C inhibitor) (Plasminogen activator inhibitor-3) (PAI3) (Acrosomal serine protease inhibitor) 
*	TK270802_E14_cyto_2D_step08.4666.4666.1	0.9554	0.0633	1302.82	12	3000.0%	1	K.FSIEGSYQLEK.V
*	TK270802_E14_cyto_2D_step01.3075.3075.2	2.221	0.1014	1990.59	1	4060.0%	2	K.NLDSNAVVIMVNYIFFK.A
UNSDL_HUMAN63.4%226.2%373419008.1(Q15738) NAD(P)-dependent steroid dehydrogenase (EC 1.1.1.-) (H105e3 protein) 
*	TK270802_E14_cyto_2D_step01.2256.2256.1	1.6733	0.1392	1147.23	2	6110.0%	1	-.MEPAVSEPMR.D
*	TK270802_E14_cyto_2D_step01.3527.3527.1	0.9202	0.0548	1479.55	10	3330.0%	1	K.NVIETCKEAGVQK.L
UQ9NP8163.4%243.5%518582838.1(Q9NP81) Seryl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.11) 
*	TK270802_E14_cyto_2D_step05.4277.4277.2	2.2047	0.0333	1963.95	9	3240.0%	2	K.LPNQTHPDVPVGDESQAR.V
UQ9JHK463.2%449.7%567649905.8(Q9JHK4) RAB geranylgeranyl transferase alpha subunit (Rab geranylgeranyl transferase, a subunit) 
	TK270802_E14_cyto_2D_step13.2150.2150.1	1.498	0.1718	818.76	1	6670.0%	1	R.VLHLAHK.D
*	TK270802_E14_cyto_2D_step05.4901.4901.2	1.081	0.1787	2811.53	2	1880.0%	1	R.CLEVLQASDNVLENLDGVANLPRLR.E
*	TK270802_E14_cyto_2D_step14.3770.3770.2	0.8091	0.0286	2540.23	55	1590.0%	1	R.CLEVLQASDNVLENLDGVANLPR.L
	TK270802_E14_cyto_2D_step08.4601.4601.2	1.0363	0.2405	2739.17	97	1140.0%	1	K.DLTVLCHLEQLLLVTHLDLSHNR.L
UCALX_MOUSE63.1%51111.5%591672784.6(P35564) Calnexin precursor 
	TK270802_E14_cyto_2D_step02.0775.0775.3	0.7186	0.083	4441.12	83	380.0%	1	K.THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR.E
*	TK270802_E14_cyto_2D_step07.4004.4004.2	1.4533	0.0385	2803.66	18	1600.0%	3	K.APVPTGEVYFADSFDRGSLSGWILSK.A
*	TK270802_E14_cyto_2D_step04.3002.3002.1	1.044	0.0819	1250.39	3	3640.0%	1	R.GSLSGWILSKAK.K
UNU50_MOUSE63.0%3311.6%466494956.2(Q9JIH2) Nucleoporin 50 kDa (Nuclear pore-associated protein 60 kDa-like) 
*	TK270802_E14_cyto_2D_step12.2805.2805.2	0.8588	0.0901	2697.06	70	1040.0%	1	R.ADTNLGNILLNVLIAPNMPCTRTGK.N
*	TK270802_E14_cyto_2D_step13.2360.2360.2	1.8401	0.2907	1452.02	1	4620.0%	1	K.GVGTLHLKPTATQK.T
	TK270802_E14_cyto_2D_step05.3905.3905.2	1.0934	0.1008	1770.29	1	4290.0%	1	K.HVNTNPLCDLTPIFK.D
UABC1_HUMAN62.7%554.6%22612542846.9(O95477) ATP-binding cassette, sub-family A, member 1 (ATP-binding cassette transporter 1) (ATP-binding cassette 1) (ABC-1) (Cholesterol efflux regulatory protein) 
*	TK270802_E14_cyto_2D_step10.4117.4117.2	1.0529	0.0111	2862.62	3	1730.0%	1	R.IAGSNPDLKPVQDFFGLAFPGSVPKEK.H
*	TK270802_E14_cyto_2D_step05.4033.4033.2	1.0158	0.0265	2701.73	6	1740.0%	1	K.FWAGIVFTGITPGSIELPHHVKYK.I
*	TK270802_E14_cyto_2D_step04.2969.2969.1	1.5643	0.1559	1377.98	4	4500.0%	1	K.SYWFGEESDEK.S
*	TK270802_E14_cyto_2D_step01.4046.4046.1	0.5989	0.0729	1576.03	10	1920.0%	1	R.KQNTADILQDLTGR.N
*	TK270802_E14_cyto_2D_step05.4993.4993.3	1.1896	0.0606	3410.62	18	1520.0%	1	R.QVMAEVNKTFQELAVFHDLEGMWEELSPK.I
UGRK4_HUMAN62.7%4411.1%578665557.7(P32298) G protein-coupled receptor kinase GRK4 (EC 2.7.1.-) (ITI1) 
*	TK270802_E14_cyto_2D_step09.4604.4604.2	0.6882	0.084	2998.22	22	1000.0%	1	K.DVLDIEQFSAVKGIYLDTADEDFYAR.F
*	TK270802_E14_cyto_2D_step09.2398.2398.2	0.8926	0.0203	1424.16	157	2310.0%	1	R.GEGAAGVKQHPVFK.D
*	TK270802_E14_cyto_2D_step01.2880.2880.1	1.3638	0.3858	1542.22	5	2920.0%	1	K.DYSSLCDKQPIGR.R
*	TK270802_E14_cyto_2D_step13.3490.3490.1	0.8885	0.1269	1176.54	4	2000.0%	1	R.GGCLTMVPSEK.E
UQ9CSF262.4%118.8%159182849.2(Q9CSF2) 2810405K07Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step03.2568.2568.1	1.7575	0.1035	1588.7	1	4620.0%	1	R.DCGKAFYGVTSLNR.H
UQ8R0K162.4%121223.2%749872806.8(Q8R0K1) Hypothetical 87.3 kDa protein (Fragment) 
	TK270802_E14_cyto_2D_step11.3967.3967.2	1.6032	0.0359	2023.1	1	4380.0%	11	K.TFNEPGSEYFIFLLSTR.A
	TK270802_E14_cyto_2D_step14.1702.1702.1	0.5679	0.0056	813.56	53	2500.0%	1	R.RPSRGSR.A
UTDT_MOUSE62.3%227.0%530603317.9(P09838) DNA nucleotidylexotransferase (EC 2.7.7.31) (Terminal addition enzyme) (Terminal deoxynucleotidyltransferase) (TDT) (Terminal transferase) 
*	TK270802_E14_cyto_2D_step04.2764.2764.1	1.7137	0.1171	1392.57	4	4500.0%	1	R.FRDLVLFILEK.K
*	TK270802_E14_cyto_2D_step03.5146.5146.2	0.8875	0.0195	2678.13	225	800.0%	1	R.HQLVVNRNSSPSPVPGSQNVPAPAVK.K
UQ9BZB462.2%467.5%584663878.5(Q9BZB4) IL-5 promoter REII-region-binding protein 
	TK270802_E14_cyto_2D_step03.4192.4192.1	1.1317	0.05	1299.89	32	2780.0%	2	K.LHFQDIIWVK.L
	TK270802_E14_cyto_2D_step08.0293.0293.3	1.5436	0.3311	4032.86	11	1060.0%	1	K.GGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCR.A
UFLO1_HUMAN62.2%359.5%591648688.9(P41440) Folate transporter 1 (Placental folate transporter) (FOLT) (Reduced folate carrier protein) (RFC) (Intestinal folate carrier) (IFC-1) 
	TK270802_E14_cyto_2D_step04.0473.0473.3	0.8828	0.0291	4264.7	8	810.0%	2	R.LWSLWWVFNSAGYYLVVYYVHILWNEVDPTTNSAR.V
	TK270802_E14_cyto_2D_step08.3151.3151.2	1.7996	0.293	2166.35	3	2750.0%	1	K.LLIAGVTATQAGLVFLLAHTR.H
ULSM5_HUMAN62.1%396.7%9098064.5(Q9Y4Y9) U6 snRNA-associated Sm-like protein LSm5 
*	TK270802_E14_cyto_2D_step08.2512.2512.1	1.6593	0.1387	742.24	2	8000.0%	3	R.IHIVMK.S
ULKHA_HUMAN62.1%241.1%610691546.2(P09960) Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) (Leukotriene A(4) hydrolase) 
*	TK270802_E14_cyto_2D_step13.2098.2098.1	1.7524	0.1016	907.34	4	6670.0%	2	R.TKHLHLR.C
UQ9BYJ062.0%3526.0%223245818.9(Q9BYJ0) Ksp37 (HBp17-related protein) (Ksp37 protein) 
*	TK270802_E14_cyto_2D_step03.5114.5114.2	1.4135	0.0393	2574.77	2	2500.0%	2	K.FVPCLLLVTLSCLGTLGQAPRQK.Q
*	TK270802_E14_cyto_2D_step02.3970.3970.3	1.3882	0.0568	3827.78	50	1320.0%	1	K.QGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLR.V
UQ9CXW762.0%359.4%1391660510.8(Q9CXW7) 3010033P07Rik protein 
	TK270802_E14_cyto_2D_step01.2826.2826.1	1.6979	0.1259	934.91	1	7140.0%	1	K.LDYILGLK.I
	TK270802_E14_cyto_2D_step06.1971.1971.1	0.9471	0.2041	677.34	25	6250.0%	2	R.RPFEK.S
UREQC_MOUSE61.9%396.5%356401276.8(P58269) Zinc-finger protein cer-d4 
*	TK270802_E14_cyto_2D_step07.3997.3997.3	2.6467	0.28	2675.79	1	2390.0%	3	R.VLENDENVEEGNEEEDLEEDVPK.R
UQ9CQ7961.9%2214.2%226262606.0(Q9CQ79) Palate, lung, and nasal epithelium expressed transcript 
*	TK270802_E14_cyto_2D_step09.4186.4186.2	1.2459	0.0625	2921.33	8	2080.0%	1	K.LVENHLDSEIQKLDQIGEDELELLK.E
*	TK270802_E14_cyto_2D_step07.2761.2761.1	1.4047	0.2406	766.35	1	6670.0%	1	R.HLAILAK.K
UUBP7_HUMAN61.8%7713.2%11021282725.6(Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15) (Ubiquitin thiolesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus associated ubiquitin-specific protease) 
*	TK270802_E14_cyto_2D_step03.2512.2512.2	1.7879	0.1028	1882.05	3	3570.0%	1	R.FEFPEQLPLDEFLQK.T
*	TK270802_E14_cyto_2D_step09.4754.4754.3	0.9119	0.1253	4726.9	82	670.0%	1	R.ITQNPVINGNVALSDGHNTAEEDMEDDTSWRSEATFQFTVER.F
*	TK270802_E14_cyto_2D_step01.5006.5006.1	0.7309	0.0014	825.51	73	2860.0%	1	R.DGPGNPLR.H
*	TK270802_E14_cyto_2D_step13.2969.2969.1	1.809	0.0915	1029.84	1	7140.0%	1	R.ISHLFFHK.E
*	TK270802_E14_cyto_2D_step12.3887.3887.2	1.0797	0.1126	2612.51	131	1590.0%	1	K.TIPNDPGFVVTLSNRMNYFQVAK.T
*	TK270802_E14_cyto_2D_step13.3346.3346.3	1.5597	0.1019	2719.16	12	2160.0%	1	K.DFEPQPGNMSHPRPWLGLDHFNK.A
*	TK270802_E14_cyto_2D_step07.4873.4873.2	1.0742	0.0592	3032.45	8	1600.0%	1	K.ENEMLVTVAHFHKEVFGTFGIPFLLR.I
UQ924A261.7%6810.4%16061638948.6(Q924A2) Capicua protein 
*	TK270802_E14_cyto_2D_step13.4468.4468.3	1.3778	0.0592	4595.73	1	1200.0%	2	K.EPAESAAVAHEQPPGGTGGADPGRPPGAVCPESPGPGPPLTLGGVDPGK.S
*	TK270802_E14_cyto_2D_step14.2645.2645.3	0.8851	0.1066	3493.12	2	1000.0%	1	K.RPESVGSLEAPGPSVIAAPPSGGGNLLQTLVLPPSK.E
*	TK270802_E14_cyto_2D_step03.5236.5236.3	0.8975	0.0993	3605.03	40	620.0%	1	K.VFSPVIRSSFTHCRPTLDPEPPGPPDPPAAFSK.G
*	TK270802_E14_cyto_2D_step03.5054.5054.1	1.3744	0.3216	1599.08	1	3440.0%	1	K.SSSEAKPASLGLAGGHK.E
*	TK270802_E14_cyto_2D_step06.4987.4987.3	1.679	0.1047	3030.93	10	1610.0%	1	K.GPPASATATPAPTSPFPSATAGSMTYSLVAPK.A
USNXD_HUMAN61.7%4102.1%9681122616.5(Q9Y5W8) Sorting nexin 13 (RGS domain- and PHOX domain-containing protein) (RGS-PX1) 
*	TK270802_E14_cyto_2D_step06.2281.2281.1	1.599	0.1414	1402.87	1	4550.0%	3	K.QSFFKVPPLIPK.T
*	TK270802_E14_cyto_2D_step08.2039.2039.2	1.1822	0.2192	953.99	12	4290.0%	1	K.TDSDPEHR.R
UQ8TE0661.6%1116.4%6773478.2(Q8TE06) SLTP004 
*	TK270802_E14_cyto_2D_step08.2451.2451.1	1.8558	0.0597	1330.63	4	4000.0%	1	K.QTLSCPVYSFK.L
UQ9HCH561.5%354.9%9131026798.4(Q9HCH5) Hypothetical protein KIAA1597 (Fragment) 
*	TK270802_E14_cyto_2D_step03.2724.2724.1	1.6205	0.1299	1257.14	2	5000.0%	2	K.KRPQIAAEQSK.D
*	TK270802_E14_cyto_2D_step02.3022.3022.3	0.9084	0.2069	4161.31	4	830.0%	1	K.TTNPIFNHTMVYDGFRPEDLMEVCVELTVWDHYK.L
UHPS4_HUMAN61.1%224.7%708769195.4(Q9NQG7) Hermansky-Pudlak syndrome 4 protein (Light-ear protein homolog) 
*	TK270802_E14_cyto_2D_step10.2358.2358.3	1.1429	0.2541	2479.88	105	1500.0%	1	R.LTPAESCMGLVRMNLYTHCVK.G
*	TK270802_E14_cyto_2D_step01.3886.3886.1	1.4315	0.2206	1481.96	3	4090.0%	1	K.IFNSLWNLDQTK.V
UCN2A_HUMAN61.0%334.7%9411057175.4(O00408) cGMP-dependent 3',5'-cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP stimulated phosphodiesterase) (CGS-PDE) (cGSPDE) 
*	TK270802_E14_cyto_2D_step02.3139.3139.2	0.8688	0.1447	2584.01	6	1820.0%	1	K.NENQEVIGVAELVNKINGPWFSK.F
*	TK270802_E14_cyto_2D_step10.4172.4172.2	1.7758	0.2945	2643.77	2	1590.0%	1	R.NILCFPIKNENQEVIGVAELVNK.I
*	TK270802_E14_cyto_2D_step10.1962.1962.3	1.3192	0.0504	1592.41	234	1880.0%	1	K.VLQYLQQETRASR.C
UQ9CSV960.9%111.9%373428016.5(Q9CSV9) 2610111M19Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step03.1938.1938.1	1.4551	0.183	854.99	5	5830.0%	1	R.QHLEVTK.V
UQ9ULM360.8%335.3%14871571649.1(Q9ULM3) Hypothetical protein KIAA1197 (Fragment) 
*	TK270802_E14_cyto_2D_step11.4006.4006.2	1.7125	0.3232	2502.41	2	2950.0%	1	K.QSHEPVPDTSVEKGFPASTEAER.H
*	TK270802_E14_cyto_2D_step03.3347.3347.3	1.1754	0.1194	2609.91	18	1480.0%	1	K.QEEVKFYLPPTPGSEFIGDVTQK.I
*	TK270802_E14_cyto_2D_step10.3643.3643.3	1.6126	0.1717	3522.66	163	1170.0%	1	R.HSLGEDCIYPQSSESDISDAPPSLPLTIPAPVK.A
UQ9NU6160.7%7118.8%12931441298.0(Q9NU61) DJ93K22.1 (Novel protein (contains DKFZP564B116)) 
	TK270802_E14_cyto_2D_step01.0115.0115.1	1.8416	0.032	1146.98	5	5000.0%	1	R.SLDVLSDGVLK.D
	TK270802_E14_cyto_2D_step07.1948.1948.1	1.04	0.0974	610.01	19	5000.0%	2	K.KVSFK.G
	TK270802_E14_cyto_2D_step03.3706.3706.2	1.0734	0.028	2018.81	297	1580.0%	1	K.DIALSLVAASDGATVCVTTR.G
	TK270802_E14_cyto_2D_step07.5026.5026.3	1.8014	0.0091	4204.17	13	1320.0%	1	K.NTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSR.S
	TK270802_E14_cyto_2D_step15.4271.4271.3	1.2759	0.2513	4403.13	8	1060.0%	2	R.AVSVSTDPSGCNFAILQSDPKTSLYEIPAVSSSSFFEEFGK.L
UITB4_HUMAN60.6%8108.1%18222021506.1(P16144) Integrin beta-4 precursor (GP150) (CD104 antigen) 
*	TK270802_E14_cyto_2D_step06.5236.5236.3	1.1776	0.0579	2799.53	14	1670.0%	1	R.FHVQLSNPKFGAHLGQPHSTTIIIR.D
*	TK270802_E14_cyto_2D_step14.1577.1577.1	0.2318	0.0031	1307.4	28	450.0%	1	R.VLDGGKSQVSYR.T
*	TK270802_E14_cyto_2D_step05.2314.2314.1	1.309	0.0438	987.81	33	5000.0%	1	R.IRSNLDIR.A
*	TK270802_E14_cyto_2D_step05.3672.3672.2	0.9756	0.0080	2102.33	13	2630.0%	1	R.LLLAALISVSLSGTLANRCK.K
*	TK270802_E14_cyto_2D_step04.4884.4884.1	1.6859	0.1192	1314.9	1	6670.0%	1	R.TCEECNFKVK.M
*	TK270802_E14_cyto_2D_step02.2810.2810.3	1.0938	0.221	4004.14	18	450.0%	1	R.HFELEVFEPLESPVDLYILMDFSNSMSDDLDNLK.K
*	TK270802_E14_cyto_2D_step11.3646.3646.3	1.1366	0.0101	4352.21	8	1180.0%	2	R.GRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGR.G
UQ8VCA560.5%5255.3%435474966.6(Q8VCA5) Similar to transmembrane protease, serine 4 
*	TK270802_E14_cyto_2D_step08.4227.4227.2	1.8505	0.276	2357.98	1	2500.0%	5	K.VGIPIIAVLLSLIALVIVALLIK.V
UQ9NS8160.4%246.2%178189257.5(Q9NS81) PEST-containing nuclear protein 
	TK270802_E14_cyto_2D_step04.1678.1678.1	1.1933	0.3023	1235.7	1	4000.0%	2	K.SHLGNVHDQDN.-
UQ9D0D660.2%337.3%723816017.8(Q9D0D6) 2610024N01Rik protein 
	TK270802_E14_cyto_2D_step01.4167.4167.3	1.0541	0.0254	4093.38	16	710.0%	1	K.LWEQSGHWEHYRADMFSLKPPGTDGVDNSQSGHPAR.C
	TK270802_E14_cyto_2D_step14.3167.3167.3	1.1441	0.1508	2871.43	104	870.0%	1	R.ADMFSLKPPGTDGVDNSQSGHPARCPK.D
	TK270802_E14_cyto_2D_step04.4997.4997.1	1.4436	0.1932	1488.16	3	3460.0%	1	R.GPHLRHTGQIGALK.L
UGLGB_HUMAN60.2%116710.3%702804446.3(Q04446) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen branching enzyme) (Brancher enzyme) 
*	TK270802_E14_cyto_2D_step09.2240.2240.3	1.6223	0.0282	3129.69	7	1640.0%	1	-.MAAPMTPAARPEDYEAALNAALADVPELAR.L
*	TK270802_E14_cyto_2D_step09.3890.3890.3	1.3938	0.0157	2449.5	78	1900.0%	1	K.NSADGLNMFDGTDSCYFHSGPR.G
*	TK270802_E14_cyto_2D_step03.2640.2640.1	1.1053	0.0527	1155.87	17	4380.0%	1	R.YKQFSQILK.N
*	TK270802_E14_cyto_2D_step05.4377.4377.1	1.7982	0.0835	1147.09	71	4000.0%	8	K.NIGENEGGIDK.F
UQ9D0U360.2%118.4%119135988.0(Q9D0U3) 1190001G19Rik protein 
	TK270802_E14_cyto_2D_step03.2674.2674.1	1.8411	0.2027	1274.91	7	5000.0%	1	K.YIIELNHMIK.D
UILK1_HUMAN59.8%114.4%452514198.1(Q13418) Integrin-linked protein kinase 1 (EC 2.7.1.-) (ILK-1) (59 kDa serine/threonine protein kinase) (p59ILK) 
	TK270802_E14_cyto_2D_step13.3232.3232.2	1.8115	0.2849	2142.64	1	3160.0%	1	K.VALEGLRPTIPPGISPHVCK.L
UQ8R08159.6%4420.5%555601237.1(Q8R081) Similar to heterogeneous nuclear ribonucleoprotein L 
	TK270802_E14_cyto_2D_step13.3418.3418.2	1.2254	0.2173	2736.95	1	2080.0%	1	K.NDQDTWDYTNPNLSGQGDPGSNPNK.R
	TK270802_E14_cyto_2D_step13.4092.4092.3	1.5629	0.2043	4391.4	4	1030.0%	1	R.QALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQK.I
	TK270802_E14_cyto_2D_step08.2384.2384.1	1.3676	0.2913	1076.84	1	5560.0%	1	K.TPASPVVHIR.G
*	TK270802_E14_cyto_2D_step01.2318.2318.3	1.4273	0.1511	4170.2	30	860.0%	1	R.GPSRYGPQYGHPPPPPPPPDYGPHADSPVLMVYGLDQSK.M
UARP2_HUMAN59.3%339.1%394447616.7(O15142) Actin-like protein 2 (Actin-related protein 2) 
*	TK270802_E14_cyto_2D_step05.2285.2285.1	1.6977	0.1125	801.48	1	5830.0%	1	R.RLDIAGR.D
*	TK270802_E14_cyto_2D_step01.2720.2720.1	1.4699	0.164	1354.86	4	4550.0%	1	K.ILLTEPPMNPTK.N
*	TK270802_E14_cyto_2D_step14.2490.2490.2	1.1845	0.1498	2184.44	9	2190.0%	1	R.NWDDMKHLWDYTFGPEK.L
UQ9EST559.2%6819.9%272310794.0(Q9EST5) Proliferation related acidic leucine rich protein PAL31 (Similar to acidic protein rich in leucines) 
	TK270802_E14_cyto_2D_step06.2813.2813.1	1.6055	0.0972	781.92	1	8000.0%	2	R.IHLELR.N
*	TK270802_E14_cyto_2D_step14.2879.2879.2	0.7572	0.1104	1931.33	37	1670.0%	1	K.SLDLFGCEVTNRSDYR.E
	TK270802_E14_cyto_2D_step01.0444.0444.1	1.1148	0.1681	615.08	6	6000.0%	1	R.TPAAVR.E
*	TK270802_E14_cyto_2D_step01.2463.2463.1	1.6273	0.1247	778.5	4	7500.0%	1	R.IFGGLDR.L
*	TK270802_E14_cyto_2D_step03.3568.3568.2	1.5858	0.403	2065.0	1	3060.0%	1	R.LAEELPSLTHLNLSGNNLK.D
UMK14_MOUSE58.9%356.4%360412875.9(P47811) Mitogen-activated protein kinase 14 (EC 2.7.1.-) (Mitogen-activated protein kinase p38) (MAP kinase p38) (CRK1) 
	TK270802_E14_cyto_2D_step03.5167.5167.1	1.3791	0.0481	1486.65	10	3330.0%	1	R.TLFPGTDHIDQLK.L
	TK270802_E14_cyto_2D_step08.2574.2574.1	1.6105	0.1228	1226.44	5	3890.0%	2	K.YIHSADIIHR.D
UQ96A4958.9%7493.7%352399334.5(Q96A49) SYAP1 
*	TK270802_E14_cyto_2D_step01.2956.2956.1	1.3785	0.0877	1469.08	1	4170.0%	7	R.EQDLPLAEAVRPK.T
UQ9H7U858.8%111.7%696796375.0(Q9H7U8) Hypothetical protein FLJ14235 
*	TK270802_E14_cyto_2D_step05.3431.3431.1	1.4756	0.1645	1462.99	1	4090.0%	1	K.SLTAHVIENYWK.A
UFSP1_HUMAN58.7%5118.3%756867178.7(Q92674) Leucine-rich primary response protein 1 (Follicle-stimulating hormone primary response protein) 
	TK270802_E14_cyto_2D_step04.3437.3437.2	2.0345	0.2608	1972.99	1	3330.0%	3	K.NGLASEEIDILLNIALSGK.F
*	TK270802_E14_cyto_2D_step04.4878.4878.3	1.2261	0.2658	4207.68	3	1100.0%	1	K.TYQEFNYYLTSMVGCLWTSKPFAKGIYIDPEILEK.T
	TK270802_E14_cyto_2D_step13.1374.1374.1	0.6744	0.0917	943.88	213	2500.0%	1	K.GPIKASQNK.D
UQ96NJ658.6%112.0%502576627.3(Q96NJ6) Hypothetical protein FLJ30726 
*	TK270802_E14_cyto_2D_step07.2153.2153.1	1.5458	0.1438	1248.75	1	5560.0%	1	R.RTSHLIVHQR.I
UQ96QC258.5%12247.8%20902267305.5(Q96QC2) Hypothetical protein KIAA0170 
	TK270802_E14_cyto_2D_step15.4055.4055.2	0.9227	0.1163	2203.93	47	1840.0%	1	R.CNVEPVGRLHIFSGAHGPEK.D
	TK270802_E14_cyto_2D_step08.2076.2076.2	1.2385	0.1461	1112.69	1	5560.0%	1	R.VGPERGPLER.E
	TK270802_E14_cyto_2D_step13.3964.3964.2	1.6456	0.3454	2277.76	1	3000.0%	3	K.HLAPPPLLSPLLPSIKPTVRK.T
*	TK270802_E14_cyto_2D_step14.3970.3970.3	1.035	0.0377	3444.42	3	1560.0%	1	R.SSVKTPETVVPAAPELQPPTSTDQPVTPEPTSR.A
	TK270802_E14_cyto_2D_step05.2809.2809.1	0.7894	0.1024	1453.72	3	3640.0%	1	K.QHAEIEILAWDK.A
	TK270802_E14_cyto_2D_step04.5102.5102.2	0.9958	0.0157	2541.71	15	1820.0%	1	K.EEEEDTAEKPGKEEDVVTPKPGK.R
	TK270802_E14_cyto_2D_step08.2466.2466.1	1.3104	0.036	953.91	13	5000.0%	1	K.VPKVILER.D
	TK270802_E14_cyto_2D_step01.4266.4266.3	1.5075	0.0543	3829.52	6	1430.0%	3	R.TNMSSVKTPETVVPTAPELQISTSTDQPVTPKPTSR.T
UUCR1_MOUSE58.5%359.6%480527696.1(Q9CZ13) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor (EC 1.10.2.2) 
	TK270802_E14_cyto_2D_step02.3486.3486.2	1.2925	0.1154	2551.1	7	2050.0%	1	K.NILRNALVSHLDGTTPVCEDIGR.S
*	TK270802_E14_cyto_2D_step05.4395.4395.2	1.845	0.2734	2740.66	1	2050.0%	2	K.YFYDQCPAVAGYGPIEQLPDYNR.I
UQ8R0M358.2%112.8%434486617.8(Q8R0M3) Hypothetical 48.7 kDa protein (Fragment) 
*	TK270802_E14_cyto_2D_step09.2906.2906.1	1.8086	0.0485	1316.86	3	5000.0%	1	K.SAFKAVLNQPLK.A
UQ99NH258.2%444.2%13331490607.8(Q99NH2) PAR-3 180 kDa isoform 
	TK270802_E14_cyto_2D_step05.4894.4894.1	0.762	0.0372	1353.19	68	2220.0%	1	R.RFEQAQHMFR.Q
	TK270802_E14_cyto_2D_step03.2731.2731.1	0.9228	0.0178	1384.86	107	2270.0%	1	K.QFSDASQLDFVK.T
*	TK270802_E14_cyto_2D_step06.4230.4230.2	2.1809	0.0822	1964.68	2	5000.0%	1	R.ISHSLYSGIEGLDESPTR.N
*	TK270802_E14_cyto_2D_step11.2725.2725.3	1.3425	0.0426	1742.68	6	2330.0%	1	R.DNARSSLSASHPMVDR.W
UKNG_MOUSE58.1%449.2%661731026.5(O08677) Kininogen precursor [Contains: Bradykinin] 
	TK270802_E14_cyto_2D_step13.2806.2806.1	1.2255	0.245	1062.16	2	3750.0%	1	R.RPPGFSPFR.S
*	TK270802_E14_cyto_2D_step14.3650.3650.3	1.4939	0.1524	3582.97	1	1580.0%	1	K.CPGRPWKPASWEDPNTETTEFSDFDLLDALS.-
	TK270802_E14_cyto_2D_step05.3399.3399.2	1.9893	0.2606	2447.24	1	3500.0%	1	K.EVLGHSIAQLNAENDHPFYYK.I
UQ96AV058.0%2214.8%237263347.8(Q96AV0) Hypothetical protein 
*	TK270802_E14_cyto_2D_step01.1611.1611.1	1.4679	0.1573	862.53	1	6430.0%	1	R.CIVSPAGR.H
*	TK270802_E14_cyto_2D_step06.4835.4835.2	1.4928	0.1712	2909.23	8	1730.0%	1	R.NHQDVAGVFALSSFLNKASAVYQALQK.S
UPCFB_HUMAN57.0%331.6%16541839808.9(O94913) Pre-mRNA cleavage complex II protein Pcf11 (Fragment) 
*	TK270802_E14_cyto_2D_step03.2276.2276.1	0.8628	0.0169	1127.66	13	3330.0%	1	R.NKIINGIVQK.Q
*	TK270802_E14_cyto_2D_step06.1511.1511.1	1.6638	0.1143	746.78	2	5830.0%	1	R.LAGSRNK.I
*	TK270802_E14_cyto_2D_step09.3124.3124.2	0.9319	0.0176	1444.77	132	3180.0%	1	K.QSHMEEFTPPSR.E
UQ99JT457.0%1117.1%4147219.8(Q99JT4) Hypothetical 4.7 kDa protein 
*	TK270802_E14_cyto_2D_step09.2657.2657.1	1.6446	0.1114	944.96	1	6670.0%	1	-.MHLYLLR.L
UQ9CQ2156.9%116.6%181204379.1(Q9CQ21) 2400002F11Rik protein 
	TK270802_E14_cyto_2D_step05.3191.3191.1	1.4626	0.1615	1485.86	1	5000.0%	1	K.YPFILPHQQVDK.G
UQ9DBB456.8%335.4%8641012848.4(Q9DBB4) 1300019C06Rik protein 
*	TK270802_E14_cyto_2D_step09.2521.2521.1	1.0784	0.0168	695.19	7	6000.0%	1	K.ESALFK.R
	TK270802_E14_cyto_2D_step03.2547.2547.1	1.7504	0.095	1234.01	1	6000.0%	1	K.FAEHGETLAMK.G
*	TK270802_E14_cyto_2D_step14.3288.3288.3	0.9296	0.1183	3646.58	426	690.0%	1	R.EGTSAMENLNEMQCMWFETECISAYQRLGR.Y
UQ9CS6456.7%117.9%1651837210.5(Q9CS64) 5730508B09Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step05.3713.3713.1	1.3779	0.2753	1431.3	1	3750.0%	1	R.RWDVLGQEAAAGR.R
UQ9NXM656.7%337.0%685787547.9(Q9NXM6) Hypothetical protein FLJ20156 
*	TK270802_E14_cyto_2D_step05.2258.2258.1	1.6316	0.111	1430.0	5	5000.0%	1	R.DFYNEKLEEIK.E
*	TK270802_E14_cyto_2D_step03.3150.3150.3	1.3188	0.0233	2752.16	40	1600.0%	1	R.SVSGRAANNVNCGLHLVIQTSSLPEK.N
*	TK270802_E14_cyto_2D_step01.3203.3203.1	1.047	0.129	1416.04	1	4500.0%	1	K.FCKTYIEDLVK.E
UBLM_MOUSE56.7%442.4%14161583657.3(O88700) Bloom's syndrome protein homolog (EC 3.6.1.-) (mBLM) 
	TK270802_E14_cyto_2D_step01.0216.0216.1	1.0177	0.0732	1017.24	293	4290.0%	1	K.KFGLHNFR.T
*	TK270802_E14_cyto_2D_step10.2489.2489.1	1.3832	0.2466	1159.78	2	4380.0%	1	K.RNFFKPPPR.K
	TK270802_E14_cyto_2D_step07.1806.1806.1	0.7507	0.0259	544.84	4	6670.0%	1	K.IFHK.K
	TK270802_E14_cyto_2D_step01.2224.2224.1	0.8354	0.0090	1596.78	16	1670.0%	1	K.ILRPQVFSMSFNR.H
UPNPH_MOUSE56.4%113.8%289322776.2(P23492) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) 
*	TK270802_E14_cyto_2D_step03.2476.2476.1	1.3682	0.2595	1184.7	1	6500.0%	1	K.ANHMEVLDAGK.A
UQ922B856.4%225.1%740826137.3(Q922B8) Similar to DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1 
	TK270802_E14_cyto_2D_step08.5081.5081.2	0.7337	0.0044	2879.54	123	1250.0%	1	R.GIDIHGVPYVINVTLPDEKQNYVHR.I
	TK270802_E14_cyto_2D_step05.2431.2431.1	1.3784	0.2593	1541.69	1	5000.0%	1	R.MHNQIPQITCDGK.R
UART1_HUMAN56.4%446.6%9291058476.4(Q9NZ08) Adipocyte-derived leucine aminopeptidase precursor (EC 3.4.11.-) (A-LAP) (ARTS-1) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator) 
	TK270802_E14_cyto_2D_step06.2463.2463.1	1.3784	0.2485	1117.96	5	5000.0%	1	K.GFPLITITVR.G
	TK270802_E14_cyto_2D_step02.3442.3442.1	0.5393	0.0226	836.73	16	6000.0%	1	K.QEHYMK.G
	TK270802_E14_cyto_2D_step05.3493.3493.2	1.3004	0.1286	2277.57	4	3060.0%	1	R.EMFDDVSYDKGACILNMLR.E
	TK270802_E14_cyto_2D_step05.2494.2494.3	1.3047	0.0229	2701.86	15	1800.0%	1	K.GTHTAVSSNDRASLINNAFQLVSIGK.L
UQ9Y5T456.4%118.7%1501628410.0(Q9Y5T4) DNAJ domain-containing protein MCJ (Similar to DNAJ domain-containing) 
*	TK270802_E14_cyto_2D_step09.2688.2688.1	1.7981	0.1005	1469.84	6	4170.0%	1	K.RPDADVDQQGLVR.S
UUB5B_HUMAN56.2%1112.2%147167357.8(P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) (P51669) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(17)KB 2) 
	TK270802_E14_cyto_2D_step04.3620.3620.2	1.6607	0.4471	2101.42	2	2650.0%	1	R.IYHPNINSNGSICLDILR.S
UQ9D30356.2%2210.5%353409997.8(Q9D303) 9130002C22Rik protein 
*	TK270802_E14_cyto_2D_step08.4341.4341.2	0.7663	0.0946	2704.77	14	1740.0%	1	K.GSTASGWLDLFCDHLGSNLVFPRR.D
*	TK270802_E14_cyto_2D_step13.2548.2548.2	2.0503	0.2521	1450.02	1	5420.0%	1	K.FTGKGSIPDLWTK.I
UMAT3_HUMAN56.1%335.8%847946236.3(P43243) Matrin 3 
	TK270802_E14_cyto_2D_step10.2219.2219.2	1.6692	0.3959	1474.26	1	5450.0%	1	K.NTHCSSLPHYQK.L
*	TK270802_E14_cyto_2D_step10.2539.2539.2	1.4122	0.0413	1852.19	3	3240.0%	1	R.GNLGAGNGNLQGPRHMQK.G
	TK270802_E14_cyto_2D_step11.2959.2959.2	1.6189	0.1351	2038.88	2	3610.0%	1	R.VIHLSNLPHSGYSDSAVLK.L
UO6037756.0%1113.8%1882080810.2(O60377) P1.11659_5 (Fragment) 
	TK270802_E14_cyto_2D_step12.4823.4823.2	1.6965	0.3106	3031.35	1	2400.0%	1	R.LFLVPVGEEGNANPTHRLLCYLLHLR.F
UQ9C0C956.0%335.0%13131434775.2(Q9C0C9) Hypothetical protein KIAA1734 (Fragment) 
*	TK270802_E14_cyto_2D_step13.4401.4401.3	1.2359	0.0191	4445.33	27	1150.0%	1	K.GPTRTPYEDGLYLFDIQLPNIYPAVPPHFCYLSQCSGR.L
*	TK270802_E14_cyto_2D_step05.3342.3342.2	0.9195	0.1025	2022.35	5	2060.0%	1	K.GEVFSVLEFAPSNHSFKK.I
*	TK270802_E14_cyto_2D_step07.2966.2966.1	1.3696	0.2387	971.99	3	5620.0%	1	R.GSVHFGLVR.L
UQ9CXF455.5%225.2%671765275.3(Q9CXF4) 4432405K22Rik protein 
	TK270802_E14_cyto_2D_step15.2104.2104.2	0.7982	0.0096	1886.72	31	1670.0%	1	K.IIYEQEGVYIHSSCGK.A
*	TK270802_E14_cyto_2D_step09.3983.3983.2	1.9006	0.2615	2017.42	1	3890.0%	1	K.DDSPTQTLASPNACRLTPA.-
UOXRP_HUMAN55.4%8227.8%9991113355.2(Q9Y4L1) 150 kDa oxygen-regulated protein precursor (Orp150) (Hypoxia up-regulated 1) 
*	TK270802_E14_cyto_2D_step03.4791.4791.2	1.082	0.0574	2555.76	9	2140.0%	4	K.GARLIPEMDQIFTEVEMTTLEK.V
*	TK270802_E14_cyto_2D_step10.4517.4517.2	1.3319	0.0145	3137.63	24	1380.0%	1	R.VPGPVQQALQSAEMSLDEIEQVILVGGATR.V
*	TK270802_E14_cyto_2D_step04.3098.3098.1	1.099	0.0222	1524.91	72	2500.0%	1	R.DAVVYPILVEFTR.E
*	TK270802_E14_cyto_2D_step05.4761.4761.3	1.3679	0.095	4776.63	5	1010.0%	2	R.VEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATR.V
UQ9D2R055.1%113.0%672752006.7(Q9D2R0) 2210408B16Rik protein (Acetoacetyl-coenzyme a synthetase) (RIKEN cDNA 2210408B16 gene) 
	TK270802_E14_cyto_2D_step13.2772.2772.2	1.6965	0.3072	2270.07	2	2630.0%	1	R.FSQIQPKLIFSVEAVVYNGK.E
USPA1_MOUSE55.0%464.7%10371120666.4(P46062) Signal-induced proliferation associated protein 1 (Sipa-1) (GTPase-activating protein Spa-1) 
*	TK270802_E14_cyto_2D_step01.3482.3482.1	1.5973	0.1049	1477.29	1	5450.0%	2	R.RSFSELYMLSLK.E
*	TK270802_E14_cyto_2D_step04.3850.3850.3	1.4872	0.0089	2962.04	8	1830.0%	1	R.LFTDPLALLGLPAEEPEPTFPPVLEPR.W
*	TK270802_E14_cyto_2D_step02.3250.3250.1	0.8197	0.1625	1229.75	5	3890.0%	1	K.VSHLESMLWK.L
UBIN1_MOUSE55.0%337.3%588644705.0(O08539) Myc box dependent interacting protein 1 (Bridging integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (SH3-domain containing protein 9) 
	TK270802_E14_cyto_2D_step07.1853.1853.1	1.1763	0.0091	885.84	16	4380.0%	1	K.GPPVPPPPK.H
	TK270802_E14_cyto_2D_step09.2142.2142.1	1.5536	0.1231	1213.58	1	5560.0%	1	R.HHYESLQTAK.K
*	TK270802_E14_cyto_2D_step07.5154.5154.3	1.1256	0.0106	2702.84	287	1300.0%	1	K.LNQNLNDVLVSLEKQHGSNTFTVK.A
UQ99K4155.0%9239.8%10171075855.3(Q99K41) Similar to elastin microfibril interface located protein 
*	TK270802_E14_cyto_2D_step13.4433.4433.2	0.736	0.0195	2654.77	3	1460.0%	1	R.HVAGLWAAVRESNSTSLTQAALLEK.L
*	TK270802_E14_cyto_2D_step08.3557.3557.3	1.3804	0.169	2748.35	4	1760.0%	2	R.GYSLYTGGTGALSPGGPQAQNSPRPASR.H
*	TK270802_E14_cyto_2D_step07.2684.2684.2	1.7437	0.2848	1726.19	5	3330.0%	4	R.TCGQICSGAPGEQDSR.V
*	TK270802_E14_cyto_2D_step13.1472.1472.2	0.7576	0.023	1129.62	6	3000.0%	1	R.VAFSAALSLPR.S
	TK270802_E14_cyto_2D_step02.4874.4874.2	1.2174	0.0196	2192.37	6	2630.0%	1	R.FRGLEEGQAQAGQCPSLEGR.L
UQ8R4H455.0%3311.7%436491518.6(Q8R4H4) Metallocarboxypeptidase A5 
*	TK270802_E14_cyto_2D_step08.2526.2526.1	0.5987	0.0505	1086.62	45	1880.0%	1	R.DLETQKPQK.V
*	TK270802_E14_cyto_2D_step06.5163.5163.3	1.6743	0.0339	4202.5	17	1110.0%	1	R.DTGQYGFLLPASQIVPTAEETWMALQTIMKHTLNHPY.-
	TK270802_E14_cyto_2D_step07.2129.2129.1	1.5262	0.1322	567.94	1	7500.0%	1	K.IHIGK.S
USMA4_MOUSE55.0%110.9%551604177.1(P97471) Mothers against decapentaplegic homolog 4 (SMAD 4) (Mothers against DPP homolog 4) (Deletion target in pancreatic carcinoma 4 homolog) (Smad4) 
	TK270802_E14_cyto_2D_step07.2129.2129.1	1.5262	0.1322	567.94	1	7500.0%	1	R.LHIGK.G
UO5497254.9%224.4%620680867.5(O54972) ETO/MTG8-related protein ETO-2 
*	TK270802_E14_cyto_2D_step03.3244.3244.2	1.0542	0.0308	2342.5	1	2750.0%	1	R.VRTLVLGLVNSTLTIEEFHAK.L
*	TK270802_E14_cyto_2D_step08.2658.2658.1	1.7949	0.0412	745.09	9	6000.0%	1	R.QLNKLK.R
UTENX_HUMAN54.9%772.5%42894644615.3(P22105) Tenascin-X precursor (TN-X) (Hexabrachion-like) 
*	TK270802_E14_cyto_2D_step05.4141.4141.3	1.9695	0.0804	2460.69	3	2280.0%	1	R.MGPLSVVIVTAPATEASKPPLEPR.L
	TK270802_E14_cyto_2D_step03.1458.1458.1	0.2748	0.0749	446.54	3	2000.0%	1	R.SPAGGG.-
*	TK270802_E14_cyto_2D_step02.2796.2796.1	0.8269	0.0244	1161.21	27	2000.0%	1	R.VGGQESKVTVR.G
	TK270802_E14_cyto_2D_step13.2433.2433.3	1.7224	0.1554	1771.76	1	3120.0%	1	R.VRGEESEVTVGGLEPGR.K
*	TK270802_E14_cyto_2D_step01.0168.0168.1	1.7944	0.0356	1566.7	9	4230.0%	1	R.EVSVPGLDPAHRYK.L
*	TK270802_E14_cyto_2D_step09.2532.2532.3	1.6506	0.0645	2244.31	19	2120.0%	1	K.VVRVPGHEDGVTISGLEPDHK.Y
	TK270802_E14_cyto_2D_step05.3173.3173.1	1.0741	0.0151	1571.97	90	3330.0%	1	K.YKMNLYGFHGGQR.M
URS2_MOUSE54.9%7915.0%2933121710.2(P25444) 40S ribosomal protein S2 (S4) (LLREP3 protein) 
	TK270802_E14_cyto_2D_step01.1787.1787.1	1.3874	0.0012	717.41	4	7000.0%	1	K.IMPVQK.Q
	TK270802_E14_cyto_2D_step01.2143.2143.1	1.0712	0.2595	1025.96	5	4500.0%	1	R.GTGIVSAPVPK.K
	TK270802_E14_cyto_2D_step01.3276.3276.1	1.1701	0.3754	1388.09	1	4000.0%	1	K.TYSYLTPDLWK.E
	TK270802_E14_cyto_2D_step13.1713.1713.1	1.9712	0.1542	1138.97	28	4440.0%	2	K.IGKPHTVPCK.V
	TK270802_E14_cyto_2D_step02.2395.2395.1	0.9673	0.0459	666.67	7	6000.0%	1	R.LIPAPR.G
UORC2_MOUSE54.8%6812.0%576658946.8(Q60862) Origin recognition complex subunit 2 
	TK270802_E14_cyto_2D_step07.1806.1806.1	0.7507	0.0259	544.84	4	6670.0%	1	K.LFHK.W
*	TK270802_E14_cyto_2D_step07.2381.2381.1	0.8463	0.0017	1219.76	33	2730.0%	1	R.NIQESLGNGSAK.D
*	TK270802_E14_cyto_2D_step11.2503.2503.3	0.8987	0.0239	2994.91	144	1350.0%	1	R.IIASRSHYDSESEYSASSSEDDEEATK.D
*	TK270802_E14_cyto_2D_step05.2571.2571.2	1.8294	0.2577	1636.53	5	3850.0%	2	K.DEEEDTNVARLSQK.S
	TK270802_E14_cyto_2D_step01.3959.3959.1	1.1464	0.059	1377.64	13	3180.0%	1	R.EAFLVNSDLTLR.A
UUBPQ_MOUSE54.8%559.1%835954867.8(Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15) (Ubiquitin thiolesterase 26) (Ubiquitin-specific processing protease 26) (Deubiquitinating enzyme 26) 
*	TK270802_E14_cyto_2D_step13.4980.4980.2	0.8705	0.0112	2926.3	18	1600.0%	1	R.LVNIINHIGNSPNGGHYINDAFDFKR.Q
*	TK270802_E14_cyto_2D_step12.1792.1792.2	0.6439	0.0656	1574.64	85	1540.0%	1	R.FLDKTSQGSIRPAR.S
*	TK270802_E14_cyto_2D_step08.2092.2092.1	1.0943	0.0064	700.77	2	5000.0%	1	K.KAKPTR.K
*	TK270802_E14_cyto_2D_step03.2372.2372.3	1.8068	0.1149	2200.15	93	1880.0%	1	K.VQQENSGKGDTAHIVGSELTK.E
*	TK270802_E14_cyto_2D_step04.1717.1717.1	1.5927	0.1037	969.99	1	6250.0%	1	K.ETQSTSTSK.G
UVINE_MOUSE54.6%338.2%733823499.2(Q9R1Z8) Vinexin (SH3-containing adapter molecule-1) (SCAM-1) (SH3 domain-containing protein SH3P3) 
*	TK270802_E14_cyto_2D_step09.4980.4980.3	1.0268	0.1313	4622.48	26	910.0%	1	R.DGSLNPDPAWYQTWPGPGSRPSMSPKPPASQHAQNWSATWTK.D
*	TK270802_E14_cyto_2D_step09.4944.4944.3	1.2414	0.0024	4776.8	6	1070.0%	1	R.RDGSLNPDPAWYQTWPGPGSRPSMSPKPPASQHAQNWSATWTK.D
*	TK270802_E14_cyto_2D_step06.2287.2287.2	1.6379	0.3874	1821.96	1	4060.0%	1	R.SQTQSLNTPGPTLSHPR.A
UQ8VCE054.5%337.2%10531159695.6(Q8VCE0) ATPase, Na+K+ transporting, alpha 3 subunit 
	TK270802_E14_cyto_2D_step05.3767.3767.2	2.1096	0.2155	1554.28	1	5770.0%	1	R.LNIPVSQVNPRDAK.A
*	TK270802_E14_cyto_2D_step06.3503.3503.3	1.013	0.1608	3523.14	1	950.0%	1	R.VSTPCASQMCPFFFLFPLSPPCLSLSFQVR.L
	TK270802_E14_cyto_2D_step03.4686.4686.3	1.543	0.0264	3778.2	6	1290.0%	1	K.EAFQNAYLELGGLGERVLGFCHYYLPEEQFPK.G
UQ9CWA754.4%3327.3%183210429.7(Q9CWA7) 0610010F05Rik protein (Fragment) 
*	TK270802_E14_cyto_2D_step01.2412.2412.1	1.5447	0.117	1498.77	5	3850.0%	1	R.LEAQVRASVPVTAR.Q
*	TK270802_E14_cyto_2D_step04.5180.5180.3	0.7498	0.1	3411.7	19	600.0%	1	K.QQSLFSEEEEYTTGSEVTEDEVGDEEEIAK.K
*	TK270802_E14_cyto_2D_step01.1452.1452.1	0.8682	0.1577	680.18	7	4000.0%	1	R.QNSSDK.N
UMU18_HUMAN54.4%449.8%646717945.8(P43121) Cell surface glycoprotein MUC18 precursor (Melanoma-associated antigen MUC18) (Melanoma-associated antigen A32) (S-endo 1 endothelial-associated antigen) (CD146 antigen) (Melanoma adhesion molecule) 
	TK270802_E14_cyto_2D_step05.2749.2749.1	1.2969	0.1872	1171.23	4	4440.0%	1	K.QEITLPPSRK.T
*	TK270802_E14_cyto_2D_step12.2799.2799.3	1.0433	0.0089	3589.27	3	1290.0%	1	R.YECQAWNLDTMISLLSEPQELLVNYVSDVR.V
	TK270802_E14_cyto_2D_step04.0817.0817.2	0.7084	0.0653	1559.21	10	1430.0%	1	K.LPEEMGLLQGSSGDK.R
	TK270802_E14_cyto_2D_step07.2065.2065.1	1.5456	0.1192	867.26	2	5710.0%	1	K.REAGGGYR.C
UFRZB_MOUSE54.4%2210.2%323360118.3(P97401) Frizzled-related protein precursor (Frzb-1) (Frezzled) (Fritz) (Secreted frizzled-related sequence protein 3) (sFRP-3) 
	TK270802_E14_cyto_2D_step08.2212.2212.1	1.3525	0.2875	624.61	1	6000.0%	1	R.HLGLGK.T
*	TK270802_E14_cyto_2D_step05.4324.4324.2	0.9964	0.1135	2852.59	9	1540.0%	1	R.GVCISPEAIVTADGADFPMDSSTGHCR.G
UQ9D2I854.4%2231.3%131145258.4(Q9D2I8) 4930430J20Rik protein 
*	TK270802_E14_cyto_2D_step13.3050.3050.2	1.8168	0.2632	2087.94	1	3440.0%	1	-.MVCTVVCPHVRVVFLLR.R
*	TK270802_E14_cyto_2D_step08.3555.3555.3	1.7422	0.1182	2669.7	15	1960.0%	1	R.IPPTLLCRDVASNKPAASCSLELR.E
UQ96P5554.2%225.7%530620417.3(Q96P55) Putative ion channel protein CATSPER2 variant 2 
*	TK270802_E14_cyto_2D_step06.4717.4717.2	0.9645	0.0467	1941.79	2	3330.0%	1	R.FSIKPQRIEQISHAQR.L
*	TK270802_E14_cyto_2D_step06.3111.3111.2	2.1558	0.1302	1623.52	2	4230.0%	1	R.QIQIIILVLVRALK.S
UQ9JHC954.2%3316.9%593632036.4(Q9JHC9) Ets family transcription factor ELF2A2 
	TK270802_E14_cyto_2D_step06.3393.3393.3	1.1945	0.2262	3387.54	33	1060.0%	1	K.SNLTGSGSINIVGTPLAVRALTPVSIAHGTPVMR.L
*	TK270802_E14_cyto_2D_step15.4195.4195.3	1.3399	0.1097	4784.42	32	890.0%	1	K.ISAVAVQSVNAGTGSPLITSTSPASASSPKVVIQTVPTVMPASTENGDR.I
*	TK270802_E14_cyto_2D_step04.4044.4044.2	2.158	0.1118	1773.47	3	4380.0%	1	K.TQQSPVSNGSPELGIKK.K
UQ8VEZ654.2%118.3%315353878.4(Q8VEZ6) Olfactory receptor MOR135-28 
*	TK270802_E14_cyto_2D_step01.3075.3075.3	2.4463	0.3826	2985.38	1	2300.0%	1	K.LCLCLVALSWLLTTVISLSHTLLMAR.L
UO1502154.0%554.4%21372317938.5(O15021) Hypothetical protein KIAA0303 (Fragment) 
*	TK270802_E14_cyto_2D_step12.3951.3951.2	1.2427	0.1316	2142.17	25	2250.0%	1	R.HPSSIPPPPLTAKDLSSPAAR.Q
*	TK270802_E14_cyto_2D_step06.0397.0397.1	0.4876	0.0083	838.96	40	2500.0%	1	R.KSPSEYK.L
*	TK270802_E14_cyto_2D_step10.2543.2543.2	0.8786	0.0034	1451.46	1	4170.0%	1	K.LAKQPSPLLHTSR.S
*	TK270802_E14_cyto_2D_step12.4207.4207.3	1.3943	0.1679	4604.03	2	1140.0%	1	R.STPDFPSGTNSSQSSSPSSSAPNSPAGSGHIRPSTLHGLAPKLGGQR.Y
*	TK270802_E14_cyto_2D_step07.1969.1969.1	1.5706	0.1139	685.07	3	6000.0%	1	R.SSPHKK.A
UDPD2_MOUSE54.0%113.6%469513695.8(O35654) DNA polymerase delta subunit 2 (EC 2.7.7.7) 
*	TK270802_E14_cyto_2D_step09.2845.2845.2	1.9003	0.2573	1726.46	1	4690.0%	1	R.AHTLLAPPSASNATFAR.V
UQ8VEY753.9%113.7%326365928.3(Q8VEY7) Olfactory receptor MOR276-2 
*	TK270802_E14_cyto_2D_step01.1976.1976.1	1.5344	0.1168	1287.99	3	4550.0%	1	R.DVIGALQKGLDR.C
UQ8R2Y653.7%81227.8%320354248.1(Q8R2Y6) Hypothetical 35.4 kDa protein 
	TK270802_E14_cyto_2D_step04.5130.5130.3	1.3945	0.2816	4498.0	1	1340.0%	1	K.MIHTPDADLDVTNILQADEPTTLATNTLDLNSVLGKDYGALK.D
	TK270802_E14_cyto_2D_step07.1946.1946.1	1.3529	0.2194	794.99	3	5830.0%	1	R.LPNVHSK.T
	TK270802_E14_cyto_2D_step07.4617.4617.3	1.1566	0.0321	4593.62	8	990.0%	1	K.AAVDGLSKMIHTPDADLDVTNILQADEPTTLATNTLDLNSVLGK.D
	TK270802_E14_cyto_2D_step10.2293.2293.2	1.0889	0.0555	1297.27	12	3640.0%	2	R.VLSTVHTHSSVK.N
	TK270802_E14_cyto_2D_step04.4288.4288.3	1.5131	0.0271	2791.08	1	2400.0%	1	K.DYGALKDIVINANPASPPLSLLVLHR.L
UQ9CZJ953.7%112.8%357414348.8(Q9CZJ9) 2700075B01Rik protein 
*	TK270802_E14_cyto_2D_step04.1826.1826.1	1.4289	0.1784	1022.94	1	5560.0%	1	-.MATTLGSGER.W
UQ1519853.7%9815.6%375418618.5(Q15198) PDGF receptor beta-like tumor suppressor (Similar to platelet-derived growth factor receptor-like) 
*	TK270802_E14_cyto_2D_step07.3662.3662.2	1.2438	0.0328	2335.26	5	2500.0%	9	R.FQKPAATLSLLAGQTVELRCK.G
URET_HUMAN53.7%241.8%11141243196.6(P07949) Proto-oncogene tyrosine-protein kinase receptor ret precursor (EC 2.7.1.112) (C-ret) 
	TK270802_E14_cyto_2D_step09.4111.4111.2	1.7753	0.114	2505.04	3	2630.0%	2	R.LHENNWICIQEDTGLLYLNR.S
UTIE1_MOUSE53.4%223.4%11341246996.8(Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC 2.7.1.112) 
	TK270802_E14_cyto_2D_step06.3569.3569.2	2.115	0.1454	2226.69	1	3570.0%	1	R.GFSKPSDLVGVFSCVGGAGARR.T
	TK270802_E14_cyto_2D_step08.2963.2963.2	1.0684	0.0729	1673.05	98	2000.0%	1	R.DLAARNVLVGENLASK.I
UQ9NXE853.3%447.1%4254964810.2(Q9NXE8) Hypothetical protein FLJ20291 
*	TK270802_E14_cyto_2D_step05.2865.2865.1	1.2987	0.121	1541.76	1	3460.0%	1	R.NQGLQGPLTAEQKR.G
*	TK270802_E14_cyto_2D_step06.1761.1761.1	1.0974	0.1693	848.02	59	4170.0%	1	R.RETGQTR.S
*	TK270802_E14_cyto_2D_step02.3099.3099.2	0.9447	0.0214	1859.9	2	3120.0%	1	R.NSDRNQGLQGPLTAEQK.R
*	TK270802_E14_cyto_2D_step07.1917.1917.1	1.7213	0.0745	600.23	4	7500.0%	1	K.LHNSK.V
UQ9UJR053.1%116.3%189220428.0(Q9UJR0) DJ1043E3.1 (Novel protein) (Fragment) 
*	TK270802_E14_cyto_2D_step01.3196.3196.1	1.5435	0.1137	1417.59	4	5000.0%	1	R.DNEINILVNMLK.K
UA2AA_HUMAN53.0%113.1%450489579.7(P08913) Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor) (Alpha-2AAR subtype C10) 
*	TK270802_E14_cyto_2D_step07.2538.2538.1	1.5393	0.1118	1297.77	1	5000.0%	1	R.GPDAVAAPPGGTER.R
UQ9EQZ753.0%797.3%15301728629.2(Q9EQZ7) Rim2 
	TK270802_E14_cyto_2D_step01.4183.4183.1	1.7657	0.0496	1494.0	1	4580.0%	2	K.VYLLDNGVCIAKK.K
*	TK270802_E14_cyto_2D_step10.4907.4907.3	1.0782	0.1417	3138.96	6	1070.0%	1	R.GRPAPTPAASQPPPQPEMPDLSHLTEEER.K
	TK270802_E14_cyto_2D_step08.2359.2359.1	1.1272	0.1163	718.05	61	6000.0%	1	K.KTLEPK.W
*	TK270802_E14_cyto_2D_step02.0007.0007.1	0.7815	0.0918	1435.38	91	1670.0%	1	R.GTRATGHYNTISR.M
*	TK270802_E14_cyto_2D_step02.0721.0721.1	0.6213	0.0436	1455.79	5	1360.0%	1	R.RSPIPLDRPDMR.R
*	TK270802_E14_cyto_2D_step07.4280.4280.3	1.1229	0.0011	4166.91	42	1010.0%	1	R.QVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQK.G
URA18_MOUSE52.9%71312.8%509574127.2(Q9QXK2) Postreplication repair protein RAD18 (mRAD18Sc) 
*	TK270802_E14_cyto_2D_step15.1802.1802.1	0.5368	0.039	649.18	15	3750.0%	1	R.NDQNR.E
	TK270802_E14_cyto_2D_step14.1966.1966.1	0.545	0.0549	738.94	35	2000.0%	1	K.RKPLPK.T
*	TK270802_E14_cyto_2D_step14.3726.3726.2	0.774	0.0732	3162.58	2	1670.0%	1	K.ETSLLGKPVLGLSDANGPVTPSTSTMKLDTK.V
*	TK270802_E14_cyto_2D_step01.2751.2751.1	1.4624	0.0018	1566.7	3	4230.0%	3	K.SAAEIVQEIESMEK.T
*	TK270802_E14_cyto_2D_step03.3367.3367.1	0.7491	0.0482	1101.02	186	2500.0%	1	R.EVSPQQTRR.T
UCNE3_HUMAN52.8%469.7%537601315.8(O75131) Copine III 
*	TK270802_E14_cyto_2D_step05.1749.1749.2	1.095	0.1896	1441.07	11	4090.0%	1	R.SSPVEFECINEK.K
*	TK270802_E14_cyto_2D_step06.3854.3854.3	1.6255	0.0311	2717.81	13	1960.0%	1	K.TIELSDDDFLGECECTLGQIVSSK.K
*	TK270802_E14_cyto_2D_step07.3386.3386.2	1.5468	0.3955	1800.98	1	3670.0%	2	K.LYGPTNFSPIINHVAR.F
UQ9NQ8652.8%225.6%728830136.2(Q9NQ86) Zinc-binding protein 
*	TK270802_E14_cyto_2D_step13.2484.2484.2	1.5985	0.4012	2311.91	2	2810.0%	1	R.INMYCELCRRPVCHLCK.L
*	TK270802_E14_cyto_2D_step11.4945.4945.2	0.8687	0.1546	2818.25	124	1090.0%	1	K.IHHPWGTIKAQHEYVGPTTNFRPK.I
UQ9H5K852.8%392.8%507554045.8(Q9H5K8) Hypothetical protein FLJ23342 
*	TK270802_E14_cyto_2D_step07.3289.3289.1	1.5324	0.113	1486.92	4	3460.0%	3	R.YQQLEGAGTVFGSK.A
UQ9DAS652.8%114.8%2092412110.2(Q9DAS6) Adult female placenta cDNA, RIKEN full-length enriched library, clone:1600029O15, full insert sequence 
*	TK270802_E14_cyto_2D_step07.3208.3208.1	1.5303	0.1133	1129.08	1	5560.0%	1	R.GSNLPVHFKK.T
UPGCV_HUMAN52.7%10165.2%33963728214.5(P13611) Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP) 
*	TK270802_E14_cyto_2D_step07.4134.4134.3	1.1545	0.0718	4110.09	37	1320.0%	1	R.SPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAK.E
*	TK270802_E14_cyto_2D_step02.2903.2903.3	1.7013	0.2858	3292.33	8	1550.0%	1	R.TTPIIPLVDELPVIPTEFPPVGNIVSFEQK.A
*	TK270802_E14_cyto_2D_step07.3444.3444.2	2.0123	0.128	1401.63	1	5910.0%	3	K.KPTENIIIDLDK.E
*	TK270802_E14_cyto_2D_step08.5007.5007.3	1.0417	0.0054	4320.98	6	920.0%	1	R.DTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKIAFAR.A
*	TK270802_E14_cyto_2D_step01.1832.1832.1	1.6808	0.0832	1400.94	4	5000.0%	1	R.TEIELFPYSGDK.I
*	TK270802_E14_cyto_2D_step05.2859.2859.1	1.1539	0.0165	1081.31	115	3750.0%	1	R.MILESKTEK.K
*	TK270802_E14_cyto_2D_step01.4763.4763.2	0.5273	0.0015	3120.54	135	740.0%	1	R.GFSTGFPLEEDFSGDFREYSTVSHPIAK.E
*	TK270802_E14_cyto_2D_step09.2342.2342.2	1.9609	0.2504	1347.52	1	4580.0%	1	R.STILPTAEVEGTK.A
UQ9P2L852.6%112.8%574650568.2(Q9P2L8) Hypothetical protein KIAA1328 (Fragment) 
*	TK270802_E14_cyto_2D_step06.3121.3121.2	2.1182	0.0885	1967.04	1	4330.0%	1	K.ECPHLKPTPSQCCGHR.L
UQ9BY4452.6%449.5%609678519.0(Q9BY44) CDA02 
*	TK270802_E14_cyto_2D_step15.3964.3964.2	0.839	0.0236	2195.02	4	2780.0%	1	K.LHLQKINDFVLSPGPQPYK.V
*	TK270802_E14_cyto_2D_step13.4920.4920.3	1.0446	0.1811	3364.32	9	860.0%	1	K.LISKPVASDSTYFAWCPDGEHILTATCAPR.L
*	TK270802_E14_cyto_2D_step03.2298.2298.1	1.7778	0.0312	1131.11	3	6250.0%	1	K.QLEKNQLEK.I
*	TK270802_E14_cyto_2D_step07.2078.2078.1	1.2899	0.022	637.66	5	7500.0%	1	K.LHLQK.I
UQ8QZX252.4%352.6%570663095.3(Q8QZX2) Similar to hypothetical protein MGC4701 (Hypothetical 66.3 kDa protein) 
*	TK270802_E14_cyto_2D_step05.2077.2077.1	1.0886	0.0027	782.03	79	6000.0%	1	K.LHQVER.-
*	TK270802_E14_cyto_2D_step01.2424.2424.1	1.4231	0.0814	971.29	1	5620.0%	2	K.DKVLPAVVK.E
UABCR_HUMAN52.4%7113.9%22732559416.3(P78363) Retinal-specific ATP-binding cassette transporter (RIM ABC transporter) (RIM protein) (RMP) (Stargardt disease protein) 
*	TK270802_E14_cyto_2D_step03.4922.4922.1	1.6232	0.0186	1279.27	47	3000.0%	2	K.DIACSEALLER.F
*	TK270802_E14_cyto_2D_step12.3983.3983.2	1.3028	0.0347	2255.79	17	1820.0%	2	K.TTTLSILTGLLPPTSGTVLVGGR.D
*	TK270802_E14_cyto_2D_step09.3480.3480.2	1.0447	0.0634	1805.26	131	2350.0%	1	K.VTEDSDSGPLFAGGAQQK.R
*	TK270802_E14_cyto_2D_step11.3605.3605.3	1.0381	0.1065	4372.15	2	1390.0%	1	K.SILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYAR.L
UQ99K4352.3%7378.3%603702627.6(Q99K43) Similar to protein regulator of cytokinesis 1 
*	TK270802_E14_cyto_2D_step03.3698.3698.2	1.9263	0.2488	2521.03	1	2860.0%	6	R.DILCMPPCDVDSTSVPTLEELK.L
*	TK270802_E14_cyto_2D_step04.3406.3406.3	1.7897	0.0515	2936.79	12	1760.0%	1	K.SGKMNTTTMSSATPNSSIRPVFGGSVYR.S
UQ9UPX452.1%226.7%519560769.0(Q9UPX4) Hypothetical protein KIAA1026 (Fragment) 
*	TK270802_E14_cyto_2D_step10.2575.2575.3	2.2896	0.5065	2400.39	2	2050.0%	1	R.GLGDRCSSSSFSSSFFSSASSPR.R
*	TK270802_E14_cyto_2D_step03.1622.1622.3	0.9852	0.0030	1524.46	489	1590.0%	1	R.LQEEVHLLRQMK.E
UTUL2_HUMAN52.0%223.8%520586408.1(O00295) Tubby related protein 2 (Tubby-like protein 2) 
*	TK270802_E14_cyto_2D_step07.2460.2460.1	0.8961	0.0445	1395.75	19	3640.0%	1	K.FTIFDNGVNPDR.E
*	TK270802_E14_cyto_2D_step07.2264.2264.1	1.3863	0.213	895.93	1	6430.0%	1	R.HEASLAIR.S
URS9_HUMAN52.0%338.8%1932246010.7(P46781) 40S ribosomal protein S9 
*	TK270802_E14_cyto_2D_step08.1670.1670.1	0.65	0.0188	1005.77	135	2220.0%	1	R.SPYGGGRPGR.V
*	TK270802_E14_cyto_2D_step05.2933.2933.1	1.3892	0.2116	887.82	1	7500.0%	1	K.HIDFSLR.S
UABE1_HUMAN51.9%222.3%599673148.3(Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68) (Q96B10) ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) (HuHP68) 
	TK270802_E14_cyto_2D_step04.2097.2097.1	1.5024	0.1221	910.67	5	5000.0%	1	R.IAIVNHDK.C
	TK270802_E14_cyto_2D_step07.2565.2565.1	1.0006	0.061	729.04	7	5000.0%	1	R.FILHAK.K
UCDNC_MOUSE51.9%394.9%348373324.3(P49919) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (P57KIP2) 
	TK270802_E14_cyto_2D_step15.3307.3307.2	1.1609	0.1022	1783.23	3	3440.0%	3	R.LQLGPRPPPVAVAVIPR.S
UPA1G_MOUSE51.8%92147.8%232258536.9(Q61205) Platelet-activating factor acetylhydrolase IB gamma subunit (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH gamma subunit) (PAFAH gamma subunit) 
	TK270802_E14_cyto_2D_step07.4942.4942.3	0.8688	0.069	4403.09	151	740.0%	1	R.AHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCR.A
	TK270802_E14_cyto_2D_step08.2023.2023.1	0.7506	0.0037	920.74	46	4290.0%	4	R.GQHPNPLR.E
	TK270802_E14_cyto_2D_step13.2254.2254.1	0.788	0.0475	1128.27	2	3120.0%	1	K.NRQVNELVR.A
	TK270802_E14_cyto_2D_step14.4190.4190.2	1.4092	0.2038	2931.16	1	2390.0%	1	K.DKEPEVVFIGDSLVQLMHQCEIWR.E
*	TK270802_E14_cyto_2D_step08.4714.4714.2	1.2059	0.1924	2697.17	5	2170.0%	1	R.ELFSPLHALNFGIGGDSTQHVLWR.L
	TK270802_E14_cyto_2D_step09.3089.3089.1	1.4046	0.1538	923.11	2	5710.0%	1	R.ALHSLLLR.L
UQ9H6H551.7%113.5%315342818.0(Q9H6H5) Hypothetical protein FLJ22276 
	TK270802_E14_cyto_2D_step03.3375.3375.1	1.344	0.2903	1299.43	1	5000.0%	1	R.HHSLALTSFKR.Q
UQ9CV1951.7%114.9%283309566.6(Q9CV19) 2310057K23Rik protein (Fragment) 
	TK270802_E14_cyto_2D_step01.4282.4282.1	1.3396	0.2739	1453.19	2	4230.0%	1	R.VSAENKYGVGEGLK.S
UDLP2_HUMAN51.6%71910.8%10191137847.0(Q9P1A6) Disks large-associated protein 2 (DAP-2) (SAP90/PSD-95-associated protein 2) (SAPAP2) (PSD-95/SAP90 binding protein 2) (Fragment) 
*	TK270802_E14_cyto_2D_step02.4119.4119.2	0.7958	0.1136	2757.27	42	1400.0%	1	R.GLYNSTDSLDSNKAMNLALETAAAQR.H
*	TK270802_E14_cyto_2D_step13.4240.4240.3	1.4906	0.0324	4516.61	142	900.0%	1	R.KSSLNLDKPLLHQDAKPALRPCHYLQVPQDEWGGYPTGGK.D
	TK270802_E14_cyto_2D_step06.1537.1537.1	0.7708	0.1687	656.42	18	4000.0%	4	K.KPPKGK.F
*	TK270802_E14_cyto_2D_step08.5086.5086.3	1.0552	0.0615	4051.41	52	880.0%	1	K.SIGQRPLGEHQTQTYLQAASDVPVGHSLDPAANYNSPK.F
UIN35_HUMAN51.6%229.1%286315146.1(P80217) Interferon-induced 35 kDa protein (IFP 35) 
*	TK270802_E14_cyto_2D_step03.3231.3231.1	1.3465	0.2493	744.77	1	8000.0%	1	K.IPLVFR.G
*	TK270802_E14_cyto_2D_step08.2867.2867.2	1.0736	0.0588	2193.78	5	2890.0%	1	-.MSAPLDAALHALQEEQARLK.M
UQ8VGZ151.6%3317.9%319358198.6(Q8VGZ1) Olfactory receptor MOR14-4 
*	TK270802_E14_cyto_2D_step10.2359.2359.3	1.519	0.0559	3026.18	5	1830.0%	1	K.AFSTCVSHIAAVAVFYIPMFSLSLVHR.Y
*	TK270802_E14_cyto_2D_step05.2287.2287.1	1.7684	0.0355	1105.42	1	6110.0%	1	R.KAILSLLFAK.-
*	TK270802_E14_cyto_2D_step15.2449.2449.3	1.113	0.0565	2383.08	3	2240.0%	1	R.YTMILTNSRIIQIGFLVIMR.T
UT2EA_MOUSE51.6%71517.5%440495934.9(Q9D0D5) Transcription initiation factor IIE, alpha subunit (TFIIE-alpha) (General transcription factor IIE 56 kDa subunit) 
*	TK270802_E14_cyto_2D_step13.1769.1769.1	0.9112	0.0165	1365.87	12	2730.0%	1	K.EGGIDVDTFQER.E
*	TK270802_E14_cyto_2D_step11.2185.2185.2	1.0217	0.0621	1391.34	1	3670.0%	3	R.AATAAGAAGLAGGHHR.E
*	TK270802_E14_cyto_2D_step01.4907.4907.3	0.9476	0.3593	4781.97	7	520.0%	2	K.KTSSVTAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAAAPPHHHR.D
UQ99LU051.6%114.0%199221248.1(Q99LU0) Similar to CHMP1.5 protein 
	TK270802_E14_cyto_2D_step05.2053.2053.1	1.4325	0.1641	924.06	3	6430.0%	1	R.IHAENAIR.Q
UQ8VCN451.4%449.1%716833675.4(Q8VCN4) Hypothetical 83.4 kDa protein 
*	TK270802_E14_cyto_2D_step10.3808.3808.3	2.6651	0.2255	2672.44	1	2740.0%	1	K.LLLLQSQLEQLQEENFRLESSR.E
	TK270802_E14_cyto_2D_step01.1967.1967.1	1.4358	0.0018	1206.86	4	5000.0%	1	K.DADLRAMEER.Y
*	TK270802_E14_cyto_2D_step09.2629.2629.1	1.0631	0.0363	1129.93	93	3330.0%	1	R.QALSLRPTDK.H
*	TK270802_E14_cyto_2D_step11.2350.2350.3	1.0856	0.0691	2554.08	11	1480.0%	1	R.EVAELQQRNQALTSLSQEAQALK.D
UQ9BQX051.4%2410.6%132150635.7(Q9BQX0) DJ691N24.1.6 (KIAA0980 protein, isoform 6) (Fragment) 
	TK270802_E14_cyto_2D_step05.3234.3234.2	1.5749	0.3561	1633.38	2	3850.0%	2	K.EIVEVVEKLSDSER.L
UA1G1_MOUSE51.3%449.9%821912196.8(P22892) Adapter-related protein complex 1 gamma 1 subunit (Gamma-adaptin) (Adaptor protein complex AP-1 gamma-1 subunit) (Golgi adaptor HA1/AP1 adaptin gamma-1 subunit) (Clathrin assembly protein complex 1 gamma-1 large chain) 
	TK270802_E14_cyto_2D_step03.3491.3491.2	1.144	0.0667	2216.44	1	3330.0%	1	K.VPELMEMFLPATKNLLNEK.N
	TK270802_E14_cyto_2D_step11.4141.4141.2	1.5808	0.3381	2008.5	1	3240.0%	1	K.NVGNAILYETVLTIMDIK.S
	TK270802_E14_cyto_2D_step03.1746.1746.1	0.9372	0.1377	458.77	9	8330.0%	1	R.ILGR.N
	TK270802_E14_cyto_2D_step15.4928.4928.3	1.2426	0.1533	4643.37	49	710.0%	1	R.QDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCR.D
UM10L_HUMAN51.2%223.4%12111352936.5(Q9BXT6) Moloney leukemia virus 10-like protein 1 (MOV10-like 1) 
*	TK270802_E14_cyto_2D_step11.3086.3086.2	2.1074	0.1839	1915.36	2	4410.0%	1	R.DENAFGACGAHNPLLVTK.L
*	TK270802_E14_cyto_2D_step14.3515.3515.2	1.1411	0.2474	2686.79	2	2050.0%	1	R.LAMAYGLNVSFLERLMSRPAYQR.D
UITAG_HUMAN51.0%337.7%11671275746.7(O75578) Integrin alpha-10 precursor 
*	TK270802_E14_cyto_2D_step02.4099.4099.1	1.4069	0.2031	1005.08	3	5620.0%	1	R.TIASDPDER.F
*	TK270802_E14_cyto_2D_step06.5161.5161.3	0.8502	0.097	4749.46	2	720.0%	1	R.LDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAISVVQR.D
*	TK270802_E14_cyto_2D_step02.3716.3716.3	1.3097	0.0382	3921.45	29	1320.0%	1	R.LCSVGHPVFQTGAKVTFLLEFEFSCSSLLSQVFGK.L
USI8A_HUMAN51.0%112.2%356405199.3(Q92185) Alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase (EC 2.4.99.8) (Ganglioside GD3 synthase) (Ganglioside GT3 synthase) (Alpha-2,8-sialyltransferase 8A) (ST8Sia I) 
*	TK270802_E14_cyto_2D_step01.0084.0084.1	1.6394	0.0945	1063.98	2	7140.0%	1	R.FQNLLWSR.K
UMYBB_MOUSE50.9%4105.3%704791037.0(P48972) Myb-related protein B (B-Myb) 
	TK270802_E14_cyto_2D_step12.2867.2867.2	0.9308	0.0461	1350.69	69	2500.0%	1	R.WLRVLNPDLVK.G
*	TK270802_E14_cyto_2D_step10.4153.4153.2	1.6793	0.2876	2600.89	1	2600.0%	3	R.GELIPISPSTEFGGSGIGTPPSVLKR.Q
UQ9P0H750.9%335.3%12301363615.8(Q9P0H7) TIP120 protein 
	TK270802_E14_cyto_2D_step06.3303.3303.1	1.4517	0.1485	1116.11	2	5620.0%	1	R.QYLLLHSLK.E
	TK270802_E14_cyto_2D_step15.2016.2016.3	1.7737	0.2185	1944.18	22	2350.0%	1	R.ACPKEGPAVVGQFIQDVK.N
	TK270802_E14_cyto_2D_step06.2011.2011.3	0.8389	0.0839	4348.85	1	610.0%	1	K.QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHK.Q
UQ91ZE550.8%355.5%689770457.9(Q91ZE5) EGF-like module-containing mucin-like receptor EMR4 
	TK270802_E14_cyto_2D_step12.4899.4899.2	1.0606	0.0133	2649.76	3	2140.0%	1	K.YPLFNWVAGIINIDHPDCYVNK.S
	TK270802_E14_cyto_2D_step04.2348.2348.2	1.617	0.3035	1697.58	1	4670.0%	2	K.EHNSGGETAVAFIAYK.S
UPOL2_MOUSE50.8%332.5%13001518299.7(P11369) Retrovirus-related POL polyprotein [Contains: Reverse transcriptase (EC 2.7.7.49); Endonuclease] 
	TK270802_E14_cyto_2D_step06.1809.1809.1	1.3998	0.046	712.92	9	6000.0%	1	K.KPRIAK.S
	TK270802_E14_cyto_2D_step07.3861.3861.2	1.7196	0.2587	1873.51	1	3570.0%	1	K.WGSELNKEFSPEEYR.M
	TK270802_E14_cyto_2D_step03.3356.3356.1	0.8434	0.0032	1316.66	13	3180.0%	1	K.EIEAVINSLPTK.K
UQ9CXY250.8%3518.6%129149906.7(Q9CXY2) 1110049F12Rik protein 
*	TK270802_E14_cyto_2D_step06.3523.3523.2	0.7625	0.0797	2809.22	2	1960.0%	1	R.HEVTICNYEASPTQQTTGCIRSPR.R
*	TK270802_E14_cyto_2D_step09.3462.3462.2	1.7191	0.2621	2469.55	1	3000.0%	2	R.HEVTICNYEASPTQQTTGCIR.S
UQ9D26250.7%358.5%117133588.7(Q9D262) 9230110F15Rik protein 
*	TK270802_E14_cyto_2D_step03.2330.2330.2	1.255	0.1072	1216.41	2	6110.0%	1	R.NYFLFSHTGK.W
UTRDN_HUMAN50.7%222.6%728814249.4(Q13061) Triadin 
*	TK270802_E14_cyto_2D_step06.3149.3149.1	1.7678	0.0689	1143.65	7	4440.0%	1	K.EVQKTPSKPK.E
*	TK270802_E14_cyto_2D_step12.2188.2188.1	0.5498	0.0016	1028.15	36	1880.0%	1	K.KEHSVPSDK.Q
URP1_HUMAN50.7%572.6%21562406595.8(P56715) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein) (Retinitis pigmentosa 1 protein) 
*	TK270802_E14_cyto_2D_step09.2693.2693.2	1.3021	0.0359	1496.91	6	3330.0%	1	K.QNSEKETNEGETK.M
*	TK270802_E14_cyto_2D_step09.2914.2914.3	1.6144	0.0249	1977.34	146	1880.0%	1	R.GDDIQKDLNILTDPEYK.N
*	TK270802_E14_cyto_2D_step05.4962.4962.2	1.2677	0.1519	1964.99	1	3060.0%	2	K.AAVANLVESTTSHFGLSEK.E
*	TK270802_E14_cyto_2D_step05.2522.2522.1	1.768	0.0045	876.02	5	7500.0%	1	K.KFQPDLK.E
UH2AG_HUMAN50.6%5731.0%1291397610.9(P20671) Histone H2A.g (H2A/g) (H2A.3) (P20671) Histone H2A.g (H2A/g) (H2A.3) 
	TK270802_E14_cyto_2D_step02.5111.5111.1	0.8587	0.0016	1330.88	28	3500.0%	1	R.IIPRHLQLAIR.N
	TK270802_E14_cyto_2D_step05.4573.4573.2	1.3264	0.044	2917.07	14	1610.0%	1	R.VGAGAPVYLAAVLEYLTAEILELAGNAAR.D
	TK270802_E14_cyto_2D_step03.1814.1814.1	0.8943	0.121	498.96	2	6670.0%	2	R.IIPR.H
	TK270802_E14_cyto_2D_step08.2790.2790.1	1.4907	0.1169	850.92	3	6670.0%	1	R.HLQLAIR.N
UP7039250.3%111.4%11891356677.9(P70392) Guanine nucleotide release/exchange factor Ras-GRF2 
	TK270802_E14_cyto_2D_step03.3322.3322.2	1.9937	0.2407	1977.36	2	3750.0%	1	R.CLHNYNGVLEITSALNR.S
UQ9D1M850.1%4435.2%193209128.5(Q9D1M8) Cysteine-rich protein 2 
*	TK270802_E14_cyto_2D_step11.3867.3867.2	1.0849	0.1455	2579.39	1	2500.0%	1	K.CSRCGDSVYAAENIIGAGKPWHK.N
	TK270802_E14_cyto_2D_step13.2138.2138.2	1.5709	0.3099	2275.72	1	3000.0%	1	R.LGIKPESAQPHRPTTNPNTSK.F
	TK270802_E14_cyto_2D_step14.2589.2589.3	1.1573	0.0252	2746.85	3	1560.0%	1	R.LGIKPESAQPHRPTTNPNTSKFAQK.Y
	TK270802_E14_cyto_2D_step03.3495.3495.2	1.0238	0.0067	1974.24	48	2370.0%	1	K.NFGPKGFGYGQGAGALVHAQ.-
UQ9DBZ850.1%112.8%462539307.9(Q9DBZ8) 1200008O12Rik protein 
*	TK270802_E14_cyto_2D_step01.3843.3843.1	1.751	0.0063	1534.66	1	5420.0%	1	K.EVEDLNQLLSSQR.K
UQ9NPE950.1%3515.6%167198116.4(Q9NPE9) Hypothetical protein FLJ11007 (HSPC055) (Hypothetical protein FLJ10027) (Similar to HSPC055 protein) 
*	TK270802_E14_cyto_2D_step06.2381.2381.1	1.7325	0.1731	1450.83	6	4580.0%	2	K.NEKSEDIASQSNK.E
*	TK270802_E14_cyto_2D_step01.3910.3910.1	1.097	0.0322	1442.06	78	2920.0%	1	K.DHLIGPNDNDFGK.Y
UQ9JLJ250.1%225.7%494535157.0(Q9JLJ2) 4-trimethylaminobutyraldehyde dehydrogenase (EC 1.2.1.47) (Aldehyde dehydrogenase 9A) 
*	TK270802_E14_cyto_2D_step11.2486.2486.3	0.985	0.0228	1839.46	30	1500.0%	1	K.SPLIIFSDCNMENAVK.G
*	TK270802_E14_cyto_2D_step05.2963.2963.1	1.7328	0.178	1213.14	6	4550.0%	1	K.GVKPITLELGGK.S
UQ9Y6L750.1%446.9%10151135575.9(Q9Y6L7) Tolloid-like 2 protein 
*	TK270802_E14_cyto_2D_step06.4591.4591.2	0.6035	0.0224	2172.39	94	1050.0%	1	R.FCGSKKPDPTVASGSSMFLR.F
*	TK270802_E14_cyto_2D_step10.2881.2881.2	1.1516	0.0308	1831.57	68	2060.0%	1	R.ATALGALVSLLLLLPLPR.G
*	TK270802_E14_cyto_2D_step02.4028.4028.1	1.7548	0.0785	1110.94	6	5620.0%	1	R.FRTDDTINK.K
*	TK270802_E14_cyto_2D_step12.3208.3208.3	1.298	0.0071	2569.01	40	1930.0%	1	R.GVFLDTILPRQDDNGVRPTIGQR.V
UQ9Z1N950.0%445.5%15911803175.9(Q9Z1N9) Renal munc13 
*	TK270802_E14_cyto_2D_step12.4360.4360.2	0.8469	0.0666	3153.79	1	1610.0%	1	R.VVMNTMERVIVLPPLTDQTGTQLILTAAK.E
*	TK270802_E14_cyto_2D_step04.3550.3550.3	0.9935	0.1335	3436.39	40	780.0%	1	R.YGSSCNVSQGSSLLSELDQYHEQDDDGRER.D
	TK270802_E14_cyto_2D_step02.4234.4234.1	1.3869	0.1986	1488.06	1	3750.0%	1	K.LITLIVSIIEEDK.N
	TK270802_E14_cyto_2D_step13.3950.3950.2	1.0546	0.033	1903.1	7	3000.0%	1	K.CQDLLNADCLQRAAEK.S
ProteinsPeptide IDsCopies
Unfiltered192754185142663
Filtered995826170603